F486370

General Info

Members Datasets Scaffolds Average Seq Length
942 398 917 337

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0045148|Ga0501032_0045148_481_1524
Length 336
Sequence MPFTTLTRRSAIVAAFGLGISGLAGHAPSAAAKDITLVNVSYDPTRELYAAYDKAFEKYWKAKTGDDVTVKQSHGGSGKQARAVIDGLQADVVTLALAADVDALHKNGDLIKADWIKKFPDNSAPYTSTIVFLVRKGNPKGIKDWPDLVKNGVDIITPNPKTSGGARWNYLAAWGYALKQPGGNEEKAKEFVSQIYKHTKVLDSGARGSTNTFVERGIGDVLLAWENEAHLALKEFGPDKFEIVTPSVSILAEPNVAVVDKVVDKRGTRKVAEAYLNYLYSPEGQKIAAENFYAGKFAQVKTFTIDDVFGGWTKAQAKHFADGGIFDQIYTPGKNG

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
3 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
4 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
11 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
12 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
13 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
14 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
15 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
16 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
17 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
18 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
19 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
20 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
21 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
22 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
23 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
222 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
272 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
273 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
279 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
280 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
382 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
383 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
384 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
386 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
397 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
398 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0.11
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.42
Rhizoplane 2.34
Rhizosphere 85.24
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002543 3300002773 Bacteria 6869
2 JGI25151J46595_10032725 3300003187 Bacteria 2011
3 JGI25153J46596_10000022 3300003215 Bacteria 251919
4 rootH1_10007030 3300003316 Bacteria 3759
5 rootH2_10004548 3300003320 Bacteria 37146
6 Ga0055524_1011997 3300003775 Bacteria 3351
7 Ga0055528_1001577 3300003790 Bacteria 13583
8 Ga0055528_1004369 3300003790 Bacteria 6817
9 Ga0055531_10000021 3300003794 Bacteria 167213
10 Ga0065707_10004891 3300005295 Bacteria 3251
11 Ga0070658_10046904 3300005327 Bacteria 3496
12 Ga0070676_10003998 3300005328 Bacteria 7736
13 Ga0070676_10097891 3300005328 Bacteria 1808
14 Ga0070690_100000065 3300005330 Bacteria 52724
15 Ga0070677_10026825 3300005333 Bacteria 2163
16 Ga0068869_100001485 3300005334 Bacteria 13881
17 Ga0068869_100009525 3300005334 Bacteria 6303
18 Ga0068869_100037247 3300005334 Bacteria 3458
19 Ga0068869_100041914 3300005334 Bacteria 3280
20 Ga0068869_100113601 3300005334 Bacteria 2063
21 Ga0070666_10006668 3300005335 Bacteria 7102
22 Ga0070666_10011356 3300005335 Bacteria 5587
23 Ga0070666_10163935 3300005335 Bacteria 1554
24 Ga0070666_10174800 3300005335 Bacteria 1505
25 Ga0070680_100029862 3300005336 Bacteria 4377
26 Ga0070680_100030265 3300005336 Bacteria 4350
27 Ga0070682_100012811 3300005337 Bacteria 4814
28 Ga0070682_100016729 3300005337 Bacteria 4268
29 Ga0070682_100056380 3300005337 Bacteria 2471
30 Ga0070660_100328272 3300005339 Bacteria 1258
31 Ga0070689_100000217 3300005340 Bacteria 34142
32 Ga0070689_100027922 3300005340 Bacteria 4260
33 Ga0070691_10028007 3300005341 Bacteria 2630
34 Ga0070691_10183984 3300005341 Bacteria 1089
35 Ga0070687_100011598 3300005343 Bacteria 3861
36 Ga0070687_100043197 3300005343 Bacteria 2289
37 Ga0070692_10021798 3300005345 Bacteria 3121
38 Ga0070668_100053228 3300005347 Bacteria 3121
39 Ga0070668_100079142 3300005347 Bacteria 2573
40 Ga0070668_100206850 3300005347 Bacteria 1613
41 Ga0070669_100017016 3300005353 Bacteria 5190
42 Ga0070669_100029603 3300005353 Bacteria 3948
43 Ga0070669_100030927 3300005353 Bacteria 3864
44 Ga0070669_100034422 3300005353 Bacteria 3667
45 Ga0070669_100126745 3300005353 Bacteria 1954
46 Ga0070675_100028893 3300005354 Bacteria 4467
47 Ga0070675_100034996 3300005354 Bacteria 4079
48 Ga0070675_100053085 3300005354 Bacteria 3333
49 Ga0070671_100162865 3300005355 Bacteria 1885
50 Ga0070671_100320146 3300005355 Bacteria 1321
51 Ga0070674_100000049 3300005356 Bacteria 51989
52 Ga0070674_100003659 3300005356 Bacteria 8663
53 Ga0070674_100004470 3300005356 Bacteria 7977
54 Ga0070674_100024852 3300005356 Bacteria 3892
55 Ga0070674_100356796 3300005356 Bacteria 1182
56 Ga0070673_100039090 3300005364 Bacteria 3628
57 Ga0070673_100039317 3300005364 Bacteria 3619
58 Ga0070673_100103051 3300005364 Bacteria 2354
59 Ga0070688_100000057 3300005365 Bacteria 54169
60 Ga0070688_100079911 3300005365 Bacteria 2114
61 Ga0070667_100001374 3300005367 Bacteria 21779
62 Ga0070667_100048507 3300005367 Bacteria 3574
63 Ga0070667_100191696 3300005367 Bacteria 1811
64 Ga0070703_10033864 3300005406 Bacteria 1557
65 Ga0070714_100015012 3300005435 Bacteria 6226
66 Ga0070713_100068985 3300005436 Bacteria 2980
67 Ga0070711_100090528 3300005439 Bacteria 2204
68 Ga0070711_100115817 3300005439 Bacteria 1974
69 Ga0070711_100210045 3300005439 Bacteria 1507
70 Ga0070705_100000065 3300005440 Bacteria 55736
71 Ga0070705_100026266 3300005440 Bacteria 3167
72 Ga0070705_100044656 3300005440 Bacteria 2546
73 Ga0070705_100107992 3300005440 Bacteria 1772
74 Ga0070700_100000578 3300005441 Bacteria 18360
75 Ga0070700_100002159 3300005441 Bacteria 9980
76 Ga0070700_100201460 3300005441 Bacteria 1398
77 Ga0070700_100270871 3300005441 Bacteria 1227
78 Ga0070694_100009816 3300005444 Bacteria 5879
79 Ga0070694_100040652 3300005444 Bacteria 3099
80 Ga0070694_100075071 3300005444 Bacteria 2338
81 Ga0070708_100008257 3300005445 Bacteria 8361
82 Ga0070708_100116599 3300005445 Bacteria 2459
83 Ga0070708_100123798 3300005445 Bacteria 2388
84 Ga0070663_100002230 3300005455 Bacteria 10844
85 Ga0070663_100044090 3300005455 Bacteria 3143
86 Ga0070678_100008603 3300005456 Bacteria 6119
87 Ga0070678_100037507 3300005456 Bacteria 3404
88 Ga0070678_100046815 3300005456 Bacteria 3104
89 Ga0070662_100004587 3300005457 Bacteria 8747
90 Ga0070662_100040713 3300005457 Bacteria 3310
91 Ga0070681_10002709 3300005458 Bacteria 16302
92 Ga0070681_10018041 3300005458 Bacteria 7051
93 Ga0070681_10027325 3300005458 Bacteria 5737
94 Ga0070681_10077946 3300005458 Bacteria 3271
95 Ga0068867_100000617 3300005459 Bacteria 23569
96 Ga0068867_100006283 3300005459 Bacteria 8401
97 Ga0068867_100100156 3300005459 Bacteria 2212
98 Ga0070685_10000052 3300005466 Bacteria 71095
99 Ga0070706_100004299 3300005467 Bacteria 13799
100 Ga0070706_100008439 3300005467 Bacteria 9595
101 Ga0070706_100166218 3300005467 Bacteria 2060
102 Ga0070707_100077664 3300005468 Bacteria 3204
103 Ga0070707_100122433 3300005468 Bacteria 2525
104 Ga0070698_100002008 3300005471 Bacteria 22594
105 Ga0070698_100029606 3300005471 Bacteria 5685
106 Ga0070699_100000803 3300005518 Bacteria 28995
107 Ga0070699_100001531 3300005518 Bacteria 21129
108 Ga0070699_100005205 3300005518 Bacteria 11431
109 Ga0070699_100094418 3300005518 Bacteria 2618
110 Ga0070679_100040973 3300005530 Bacteria 4609
111 Ga0070679_100043671 3300005530 Bacteria 4463
112 Ga0070679_100124029 3300005530 Bacteria 2566
113 Ga0070684_100290072 3300005535 Bacteria 1500
114 Ga0070684_100308367 3300005535 Bacteria 1453
115 Ga0070697_100083886 3300005536 Bacteria 2628
116 Ga0068853_100011725 3300005539 Bacteria 7122
117 Ga0068853_100198983 3300005539 Bacteria 1823
118 Ga0070672_100014218 3300005543 Bacteria 5634
119 Ga0070672_100279081 3300005543 Bacteria 1412
120 Ga0070686_100000158 3300005544 Bacteria 46470
121 Ga0070686_100006706 3300005544 Bacteria 6409
122 Ga0070695_100003473 3300005545 Bacteria 9205
123 Ga0070695_100056401 3300005545 Bacteria 2535
124 Ga0070696_100000412 3300005546 Bacteria 26669
125 Ga0070696_100000981 3300005546 Bacteria 18506
126 Ga0070696_100011533 3300005546 Bacteria 5921
127 Ga0070696_100048806 3300005546 Bacteria 2939
128 Ga0070693_100016515 3300005547 Bacteria 3823
129 Ga0070693_100022372 3300005547 Bacteria 3360
130 Ga0070693_100047938 3300005547 Bacteria 2432
131 Ga0070704_100000957 3300005549 Bacteria 14638
132 Ga0070704_100018232 3300005549 Bacteria 4482
133 Ga0070704_100181716 3300005549 Bacteria 1683
134 Ga0068855_100003783 3300005563 Bacteria 18509
135 Ga0068855_100016082 3300005563 Bacteria 8999
136 Ga0068855_100297546 3300005563 Bacteria 1788
137 Ga0068855_100579952 3300005563 Bacteria 1211
138 Ga0070664_100159454 3300005564 Bacteria 1995
139 Ga0068857_100007394 3300005577 Bacteria 9459
140 Ga0068857_100011381 3300005577 Bacteria 7741
141 Ga0068857_100019781 3300005577 Bacteria 5915
142 Ga0068854_100053051 3300005578 Bacteria 2910
143 Ga0070702_100037409 3300005615 Bacteria 2696
144 Ga0070702_100089649 3300005615 Bacteria 1862
145 Ga0070702_100285962 3300005615 Bacteria 1134
146 Ga0068859_100002270 3300005617 Bacteria 19503
147 Ga0068859_100006156 3300005617 Bacteria 12197
148 Ga0068859_100011622 3300005617 Bacteria 8853
149 Ga0068859_100024836 3300005617 Bacteria 6015
150 Ga0068859_100150486 3300005617 Bacteria 2403
151 Ga0068864_100013022 3300005618 Bacteria 6886
152 Ga0068864_100019118 3300005618 Bacteria 5726
153 Ga0068864_100025299 3300005618 Bacteria 4998
154 Ga0068864_100038556 3300005618 Bacteria 4082
155 Ga0068864_100044522 3300005618 Bacteria 3805
156 Ga0068864_100068615 3300005618 Bacteria 3080
157 Ga0068864_100142154 3300005618 Bacteria 2166
158 Ga0068866_10003908 3300005718 Bacteria 6117
159 Ga0068866_10010068 3300005718 Bacteria 4043
160 Ga0068866_10208879 3300005718 Bacteria 1171
161 Ga0068861_100017794 3300005719 Bacteria 5049
162 Ga0068861_100026742 3300005719 Bacteria 4197
163 Ga0068861_100058981 3300005719 Bacteria 2937
164 Ga0068861_100098578 3300005719 Bacteria 2320
165 Ga0068861_100137511 3300005719 Bacteria 1990
166 Ga0068861_100318383 3300005719 Bacteria 1354
167 Ga0068863_100033116 3300005841 Bacteria 4923
168 Ga0068863_100047852 3300005841 Bacteria 4056
169 Ga0068863_100053479 3300005841 Bacteria 3828
170 Ga0068863_100114747 3300005841 Bacteria 2566
171 Ga0068863_100145406 3300005841 Bacteria 2267
172 Ga0068858_100002931 3300005842 Bacteria 17169
173 Ga0068858_100024942 3300005842 Bacteria 5565
174 Ga0068858_100033644 3300005842 Bacteria 4755
175 Ga0068858_100080622 3300005842 Bacteria 3024
176 Ga0068858_100126380 3300005842 Bacteria 2395
177 Ga0068858_100289504 3300005842 Bacteria 1561
178 Ga0068860_100001588 3300005843 Bacteria 24436
179 Ga0068860_100009081 3300005843 Bacteria 9893
180 Ga0068860_100015154 3300005843 Bacteria 7531
181 Ga0068860_100031216 3300005843 Bacteria 5122
182 Ga0068860_100055383 3300005843 Bacteria 3770
183 Ga0068860_100097791 3300005843 Bacteria 2799
184 Ga0068860_100130891 3300005843 Bacteria 2407
185 Ga0068860_100395056 3300005843 Bacteria 1367
186 Ga0068862_100001016 3300005844 Bacteria 26969
187 Ga0068862_100020918 3300005844 Bacteria 5466
188 Ga0068862_100045310 3300005844 Bacteria 3753
189 Ga0068862_100059416 3300005844 Bacteria 3283
190 Ga0068862_100076430 3300005844 Bacteria 2898
191 Ga0068862_100113456 3300005844 Bacteria 2381
192 Ga0081455_10002721 3300005937 Bacteria 20866
193 Ga0081455_10002830 3300005937 Bacteria 20425
194 Ga0070717_10009163 3300006028 Bacteria 7437
195 Ga0070717_10217440 3300006028 Bacteria 1678
196 Ga0075368_10000722 3300006042 Bacteria 10117
197 Ga0075368_10025721 3300006042 Bacteria 2259
198 Ga0075363_100008114 3300006048 Bacteria 4873
199 Ga0075363_100034561 3300006048 Bacteria 2640
200 Ga0075364_10054272 3300006051 Bacteria 2620
201 Ga0075364_10092593 3300006051 Bacteria 2006
202 Ga0070716_100088649 3300006173 Bacteria 1867
203 Ga0075362_10014864 3300006177 Bacteria 3153
204 Ga0075367_10003740 3300006178 Bacteria 7322
205 Ga0075367_10042665 3300006178 Bacteria 2655
206 Ga0075369_10014629 3300006186 Bacteria 3138
207 Ga0075369_10016368 3300006186 Bacteria 2991
208 Ga0075366_10002514 3300006195 Bacteria 9415
209 Ga0075366_10002866 3300006195 Bacteria 8941
210 Ga0075366_10012577 3300006195 Bacteria 4804
211 Ga0075366_10014707 3300006195 Bacteria 4473
212 Ga0097621_100019503 3300006237 Bacteria 5205
213 Ga0097621_100064092 3300006237 Bacteria 3021
214 Ga0097621_100065912 3300006237 Bacteria 2982
215 Ga0097621_100170926 3300006237 Bacteria 1873
216 Ga0097621_100444590 3300006237 Bacteria 1167
217 Ga0075370_10001660 3300006353 Bacteria 9843
218 Ga0075370_10008951 3300006353 Bacteria 5175
219 Ga0075370_10015223 3300006353 Bacteria 4113
220 Ga0075370_10020532 3300006353 Bacteria 3612
221 Ga0075370_10030479 3300006353 Bacteria 3010
222 Ga0068871_100048995 3300006358 Bacteria 3413
223 Ga0068871_100112023 3300006358 Bacteria 2296
224 Ga0075428_100007776 3300006844 Bacteria 11878
225 Ga0075428_100094556 3300006844 Bacteria 3258
226 Ga0075428_100175145 3300006844 Bacteria 2324
227 Ga0075430_100061087 3300006846 Bacteria 3167
228 Ga0075431_100005884 3300006847 Bacteria 12137
229 Ga0075431_100275661 3300006847 Bacteria 1703
230 Ga0075433_10000078 3300006852 Bacteria 44001
231 Ga0075433_10006861 3300006852 Bacteria 9022
232 Ga0075433_10013036 3300006852 Bacteria 6742
233 Ga0075433_10157149 3300006852 Bacteria 2023
234 Ga0075434_100000130 3300006871 Bacteria 45069
235 Ga0075434_100003042 3300006871 Bacteria 14917
236 Ga0075429_100015699 3300006880 Bacteria 6562
237 Ga0068865_100073173 3300006881 Bacteria 2436
238 Ga0068865_100102141 3300006881 Bacteria 2101
239 Ga0068865_100109312 3300006881 Bacteria 2037
240 Ga0068865_100121432 3300006881 Bacteria 1943
241 Ga0068865_100168306 3300006881 Bacteria 1677
242 Ga0097620_100002270 3300006931 Bacteria 19503
243 Ga0097620_100006156 3300006931 Bacteria 12197
244 Ga0097620_100011622 3300006931 Bacteria 8853
245 Ga0097620_100024836 3300006931 Bacteria 6015
246 Ga0097620_100150477 3300006931 Bacteria 2403
247 Ga0075435_100011495 3300007076 Bacteria 6518
248 Ga0105240_10005484 3300009093 Bacteria 18912
249 Ga0105240_10398596 3300009093 Bacteria 1550
250 Ga0111539_10003393 3300009094 Bacteria 20988
251 Ga0111539_10006671 3300009094 Bacteria 14868
252 Ga0111539_10112515 3300009094 Bacteria 3193
253 Ga0111539_10350856 3300009094 Bacteria 1717
254 Ga0105245_10006355 3300009098 Bacteria 10397
255 Ga0105245_10018544 3300009098 Bacteria 6086
256 Ga0105245_10032802 3300009098 Bacteria 4599
257 Ga0105245_10188935 3300009098 Bacteria 1972
258 Ga0105245_10278068 3300009098 Bacteria 1635
259 Ga0114129_10037842 3300009147 Bacteria 6809
260 Ga0114129_10336721 3300009147 Bacteria 2002
261 Ga0105243_10321757 3300009148 Bacteria 1410
262 Ga0105241_10005410 3300009174 Bacteria 9439
263 Ga0105241_10009701 3300009174 Bacteria 7075
264 Ga0105241_10026457 3300009174 Bacteria 4317
265 Ga0105242_10075375 3300009176 Bacteria 2809
266 Ga0105248_10020136 3300009177 Bacteria 7391
267 Ga0105248_10037641 3300009177 Bacteria 5413
268 Ga0105248_10041536 3300009177 Bacteria 5156
269 Ga0105248_10128243 3300009177 Bacteria 2862
270 Ga0105248_10169907 3300009177 Bacteria 2457
271 Ga0105248_10193767 3300009177 Bacteria 2290
272 Ga0105248_10196339 3300009177 Bacteria 2274
273 Ga0105248_10210892 3300009177 Bacteria 2188
274 Ga0105248_10247795 3300009177 Bacteria 2005
275 Ga0105248_10561510 3300009177 Bacteria 1288
276 Ga0105237_10008329 3300009545 Bacteria 11250
277 Ga0105237_10011239 3300009545 Bacteria 9478
278 Ga0105237_10034822 3300009545 Bacteria 5095
279 Ga0105237_10036944 3300009545 Bacteria 4939
280 Ga0105237_10146244 3300009545 Bacteria 2358
281 Ga0105237_10366099 3300009545 Bacteria 1446
282 Ga0105238_10054021 3300009551 Bacteria 4036
283 Ga0105238_10136709 3300009551 Bacteria 2428
284 Ga0105238_10496342 3300009551 Bacteria 1221
285 Ga0105249_10014864 3300009553 Bacteria 6884
286 Ga0105249_10106640 3300009553 Bacteria 2643
287 Ga0105249_10250650 3300009553 Bacteria 1755
288 Ga0105249_10363069 3300009553 Bacteria 1470
289 Ga0105249_10412968 3300009553 Bacteria 1382
290 Ga0105030_100593 3300009987 Bacteria 3230
291 Ga0105239_10003653 3300010375 Bacteria 18807
292 Ga0105239_10027248 3300010375 Bacteria 6290
293 Ga0105239_10122351 3300010375 Bacteria 2891
294 Ga0105239_10128972 3300010375 Bacteria 2812
295 Ga0105239_10284092 3300010375 Bacteria 1863
296 Ga0105246_10239436 3300011119 Bacteria 1434
297 Ga0157373_10273232 3300013100 Bacteria 1197
298 Ga0157369_10361570 3300013105 Bacteria 1507
299 Ga0157369_10460023 3300013105 Bacteria 1317
300 Ga0157374_10193516 3300013296 Bacteria 1989
301 Ga0157374_10250864 3300013296 Bacteria 1741
302 Ga0157378_10005236 3300013297 Bacteria 11390
303 Ga0157378_10164266 3300013297 Bacteria 2079
304 Ga0163162_10029974 3300013306 Bacteria 5387
305 Ga0163162_10082677 3300013306 Bacteria 3283
306 Ga0163162_10090555 3300013306 Bacteria 3140
307 Ga0163162_10300956 3300013306 Bacteria 1736
308 Ga0163162_10315255 3300013306 Bacteria 1697
309 Ga0163162_10325480 3300013306 Bacteria 1669
310 Ga0163162_10368096 3300013306 Bacteria 1570
311 Ga0157372_10063316 3300013307 Bacteria 4147
312 Ga0157375_10010290 3300013308 Bacteria 8230
313 Ga0157375_10017502 3300013308 Bacteria 6469
314 Ga0157375_10026843 3300013308 Bacteria 5374
315 Ga0157375_10126201 3300013308 Bacteria 2674
316 Ga0157375_10163922 3300013308 Bacteria 2366
317 Ga0163163_10000581 3300014325 Bacteria 32150
318 Ga0163163_10007008 3300014325 Bacteria 9901
319 Ga0163163_10020970 3300014325 Bacteria 6161
320 Ga0163163_10056050 3300014325 Bacteria 3895
321 Ga0163163_10240598 3300014325 Bacteria 1860
322 Ga0163163_10677781 3300014325 Bacteria 1094
323 Ga0157380_10007283 3300014326 Bacteria 7851
324 Ga0157380_10008547 3300014326 Bacteria 7320
325 Ga0157380_10025490 3300014326 Bacteria 4484
326 Ga0157380_10029395 3300014326 Bacteria 4200
327 Ga0157380_10093870 3300014326 Bacteria 2482
328 Ga0157380_10097051 3300014326 Bacteria 2445
329 Ga0157377_10027772 3300014745 Bacteria 3041
330 Ga0157379_10026614 3300014968 Bacteria 5149
331 Ga0157379_10032827 3300014968 Bacteria 4629
332 Ga0157379_10049685 3300014968 Bacteria 3745
333 Ga0157379_10087963 3300014968 Bacteria 2786
334 Ga0157379_10206371 3300014968 Bacteria 1778
335 Ga0157376_10074514 3300014969 Bacteria 2894
336 Ga0157376_10082537 3300014969 Bacteria 2762
337 Ga0213872_10001049 3300021361 Bacteria 19233
338 Ga0213872_10002041 3300021361 Bacteria 12277
339 Ga0209129_1000019 3300025258 Bacteria 460802
340 Ga0209673_1000132 3300025273 Bacteria 162349
341 Ga0209025_1001953 3300025294 Bacteria 23804
342 Ga0209564_1011311 3300025295 Bacteria 4011
343 Ga0209758_1000005 3300025297 Bacteria 1368918
344 Ga0209758_1015826 3300025297 Bacteria 3876
345 Ga0209050_1003476 3300025298 Bacteria 11551
346 Ga0209256_1000458 3300025299 Bacteria 61611
347 Ga0209051_1019686 3300025303 Bacteria 2935
348 Ga0209051_1028459 3300025303 Bacteria 2206
349 Ga0209257_1000032 3300025304 Bacteria 680354
350 Ga0209257_1000560 3300025304 Bacteria 63396
351 Ga0207653_10001196 3300025885 Bacteria 8473
352 Ga0207682_10004901 3300025893 Bacteria 5516
353 Ga0207692_10021047 3300025898 Bacteria 2978
354 Ga0207642_10024347 3300025899 Bacteria 2433
355 Ga0207680_10058821 3300025903 Bacteria 2331
356 Ga0207680_10124987 3300025903 Bacteria 1687
357 Ga0207647_10011665 3300025904 Bacteria 6153
358 Ga0207647_10056658 3300025904 Bacteria 2404
359 Ga0207645_10003656 3300025907 Bacteria 11604
360 Ga0207643_10003138 3300025908 Bacteria 8893
361 Ga0207705_10092388 3300025909 Bacteria 2217
362 Ga0207684_10001346 3300025910 Bacteria 26938
363 Ga0207684_10011731 3300025910 Bacteria 7644
364 Ga0207684_10071796 3300025910 Bacteria 2941
365 Ga0207654_10002858 3300025911 Bacteria 8758
366 Ga0207654_10007746 3300025911 Bacteria 5421
367 Ga0207707_10021578 3300025912 Bacteria 5628
368 Ga0207707_10025434 3300025912 Bacteria 5179
369 Ga0207707_10026761 3300025912 Bacteria 5041
370 Ga0207707_10169231 3300025912 Bacteria 1910
371 Ga0207695_10010977 3300025913 Bacteria 11010
372 Ga0207695_10117358 3300025913 Bacteria 2634
373 Ga0207695_10271372 3300025913 Bacteria 1592
374 Ga0207671_10103513 3300025914 Bacteria 2159
375 Ga0207671_10141183 3300025914 Bacteria 1856
376 Ga0207663_10109420 3300025916 Bacteria 1873
377 Ga0207663_10241074 3300025916 Bacteria 1326
378 Ga0207660_10013268 3300025917 Bacteria 5399
379 Ga0207662_10019149 3300025918 Bacteria 3891
380 Ga0207662_10162500 3300025918 Bacteria 1427
381 Ga0207657_10001958 3300025919 Bacteria 22216
382 Ga0207657_10053172 3300025919 Bacteria 3510
383 Ga0207652_10124083 3300025921 Bacteria 2300
384 Ga0207652_10143489 3300025921 Bacteria 2136
385 Ga0207652_10173032 3300025921 Bacteria 1938
386 Ga0207652_10179960 3300025921 Bacteria 1900
387 Ga0207652_10187832 3300025921 Bacteria 1858
388 Ga0207646_10035270 3300025922 Bacteria 4518
389 Ga0207681_10038264 3300025923 Bacteria 3177
390 Ga0207681_10131952 3300025923 Bacteria 1848
391 Ga0207681_10280861 3300025923 Bacteria 1311
392 Ga0207694_10122990 3300025924 Bacteria 2073
393 Ga0207659_10048124 3300025926 Bacteria 3020
394 Ga0207659_10049300 3300025926 Bacteria 2986
395 Ga0207687_10006633 3300025927 Bacteria 7636
396 Ga0207687_10051594 3300025927 Bacteria 2868
397 Ga0207687_10165291 3300025927 Bacteria 1702
398 Ga0207700_10063551 3300025928 Bacteria 2808
399 Ga0207664_10001478 3300025929 Bacteria 15421
400 Ga0207644_10114985 3300025931 Bacteria 2040
401 Ga0207706_10000233 3300025933 Bacteria 60777
402 Ga0207706_10055217 3300025933 Bacteria 3504
403 Ga0207686_10000534 3300025934 Bacteria 24546
404 Ga0207709_10003759 3300025935 Bacteria 8925
405 Ga0207670_10000099 3300025936 Bacteria 60113
406 Ga0207670_10006499 3300025936 Bacteria 6487
407 Ga0207669_10000325 3300025937 Bacteria 21831
408 Ga0207669_10008438 3300025937 Bacteria 4838
409 Ga0207669_10040969 3300025937 Bacteria 2692
410 Ga0207669_10073883 3300025937 Bacteria 2153
411 Ga0207669_10253198 3300025937 Bacteria 1312
412 Ga0207704_10003773 3300025938 Bacteria 6898
413 Ga0207704_10031077 3300025938 Bacteria 3002
414 Ga0207665_10111673 3300025939 Bacteria 1921
415 Ga0207691_10007014 3300025940 Bacteria 10871
416 Ga0207691_10013491 3300025940 Bacteria 7817
417 Ga0207691_10074339 3300025940 Bacteria 3065
418 Ga0207691_10104363 3300025940 Bacteria 2526
419 Ga0207691_10142544 3300025940 Bacteria 2111
420 Ga0207711_10001369 3300025941 Bacteria 22958
421 Ga0207711_10006171 3300025941 Bacteria 10126
422 Ga0207711_10022130 3300025941 Bacteria 5314
423 Ga0207711_10049274 3300025941 Bacteria 3606
424 Ga0207711_10108679 3300025941 Bacteria 2464
425 Ga0207711_10308941 3300025941 Bacteria 1460
426 Ga0207711_10356329 3300025941 Bacteria 1355
427 Ga0207711_10368373 3300025941 Bacteria 1332
428 Ga0207689_10041045 3300025942 Bacteria 3829
429 Ga0207689_10060208 3300025942 Bacteria 3122
430 Ga0207689_10063711 3300025942 Bacteria 3033
431 Ga0207689_10068338 3300025942 Bacteria 2920
432 Ga0207689_10209764 3300025942 Bacteria 1609
433 Ga0207689_10247593 3300025942 Bacteria 1474
434 Ga0207661_10004129 3300025944 Bacteria 10153
435 Ga0207661_10007948 3300025944 Bacteria 7563
436 Ga0207679_10009673 3300025945 Bacteria 6180
437 Ga0207679_10170533 3300025945 Bacteria 1791
438 Ga0207667_10004770 3300025949 Bacteria 16571
439 Ga0207667_10017868 3300025949 Bacteria 7971
440 Ga0207667_10024833 3300025949 Bacteria 6571
441 Ga0207667_10240116 3300025949 Bacteria 1854
442 Ga0207667_10480544 3300025949 Bacteria 1261
443 Ga0207651_10015693 3300025960 Bacteria 4412
444 Ga0207651_10031921 3300025960 Bacteria 3374
445 Ga0207712_10008312 3300025961 Bacteria 6562
446 Ga0207712_10129398 3300025961 Bacteria 1921
447 Ga0207668_10354007 3300025972 Bacteria 1228
448 Ga0207640_10021357 3300025981 Bacteria 3858
449 Ga0207658_10001308 3300025986 Bacteria 19644
450 Ga0207658_10034217 3300025986 Bacteria 3630
451 Ga0207658_10120070 3300025986 Bacteria 2094
452 Ga0207677_10127867 3300026023 Bacteria 1923
453 Ga0207703_10011165 3300026035 Bacteria 6989
454 Ga0207703_10049780 3300026035 Bacteria 3388
455 Ga0207703_10110285 3300026035 Bacteria 2347
456 Ga0207703_10135803 3300026035 Bacteria 2129
457 Ga0207703_10151824 3300026035 Bacteria 2021
458 Ga0207703_10247097 3300026035 Bacteria 1606
459 Ga0207639_10003453 3300026041 Bacteria 10636
460 Ga0207639_10003938 3300026041 Bacteria 10023
461 Ga0207639_10028234 3300026041 Bacteria 4095
462 Ga0207639_10050987 3300026041 Bacteria 3145
463 Ga0207639_10056189 3300026041 Bacteria 3016
464 Ga0207639_10434845 3300026041 Bacteria 1189
465 Ga0207678_10000554 3300026067 Bacteria 34126
466 Ga0207678_10016427 3300026067 Bacteria 6498
467 Ga0207678_10062952 3300026067 Bacteria 3188
468 Ga0207678_10098159 3300026067 Bacteria 2503
469 Ga0207708_10000185 3300026075 Bacteria 49057
470 Ga0207708_10016719 3300026075 Bacteria 5520
471 Ga0207708_10016956 3300026075 Bacteria 5483
472 Ga0207708_10311928 3300026075 Bacteria 1282
473 Ga0207708_10329029 3300026075 Bacteria 1249
474 Ga0207641_10116855 3300026088 Bacteria 2374
475 Ga0207641_10130328 3300026088 Bacteria 2257
476 Ga0207641_10132904 3300026088 Bacteria 2236
477 Ga0207648_10000030 3300026089 Bacteria 129654
478 Ga0207648_10001855 3300026089 Bacteria 23091
479 Ga0207648_10061370 3300026089 Bacteria 3278
480 Ga0207648_10116656 3300026089 Bacteria 2346
481 Ga0207648_10162729 3300026089 Bacteria 1971
482 Ga0207648_10202952 3300026089 Bacteria 1759
483 Ga0207676_10012644 3300026095 Bacteria 6054
484 Ga0207676_10015397 3300026095 Bacteria 5515
485 Ga0207676_10019158 3300026095 Bacteria 4987
486 Ga0207676_10108431 3300026095 Bacteria 2318
487 Ga0207676_10123478 3300026095 Bacteria 2188
488 Ga0207674_10001364 3300026116 Bacteria 31620
489 Ga0207674_10013835 3300026116 Bacteria 8927
490 Ga0207674_10016409 3300026116 Bacteria 8108
491 Ga0207674_10024871 3300026116 Bacteria 6391
492 Ga0207674_10090467 3300026116 Bacteria 3052
493 Ga0207674_10174327 3300026116 Bacteria 2103
494 Ga0207674_10440253 3300026116 Bacteria 1260
495 Ga0207675_100002563 3300026118 Bacteria 18003
496 Ga0207675_100004168 3300026118 Bacteria 13995
497 Ga0207675_100014298 3300026118 Bacteria 7399
498 Ga0207675_100060311 3300026118 Bacteria 3541
499 Ga0207675_100103027 3300026118 Bacteria 2689
500 Ga0207675_100107967 3300026118 Bacteria 2624
501 Ga0207675_100112086 3300026118 Bacteria 2574
502 Ga0207675_100122486 3300026118 Bacteria 2462
503 Ga0207675_100191625 3300026118 Bacteria 1961
504 Ga0207683_10011580 3300026121 Bacteria 7530
505 Ga0207683_10036240 3300026121 Bacteria 4294
506 Ga0207698_10192223 3300026142 Bacteria 1819
507 Ga0207698_10234004 3300026142 Bacteria 1670
508 Ga0207428_10062099 3300027907 Bacteria 2955
509 Ga0207428_10083819 3300027907 Bacteria 2485
510 Ga0268266_10071019 3300028379 Bacteria 3017
511 Ga0268266_10123187 3300028379 Bacteria 2309
512 Ga0268266_10229837 3300028379 Bacteria 1708
513 Ga0268265_10003611 3300028380 Bacteria 11040
514 Ga0268265_10019222 3300028380 Bacteria 4744
515 Ga0268265_10020306 3300028380 Bacteria 4635
516 Ga0268265_10065770 3300028380 Bacteria 2800
517 Ga0268265_10447114 3300028380 Bacteria 1206
518 Ga0268265_10510304 3300028380 Bacteria 1134
519 Ga0268264_10001871 3300028381 Bacteria 19134
520 Ga0268264_10001894 3300028381 Bacteria 18988
521 Ga0268264_10014526 3300028381 Bacteria 6471
522 Ga0268264_10029882 3300028381 Bacteria 4467
523 Ga0268264_10042884 3300028381 Bacteria 3747
524 Ga0268264_10066388 3300028381 Bacteria 3042
525 Ga0268264_10139266 3300028381 Bacteria 2162
526 Ga0268264_10453998 3300028381 Bacteria 1242
527 Ga0265337_1000036 3300028556 Bacteria 58197
528 Ga0265334_10006414 3300028573 Bacteria 5071
529 Ga0265318_10000626 3300028577 Bacteria 24443
530 Ga0265336_10000372 3300028666 Bacteria 28838
531 Ga0265336_10000377 3300028666 Bacteria 28553
532 Ga0307515_10022552 3300028794 Bacteria 11086
533 Ga0307515_10043062 3300028794 Bacteria 7034
534 Ga0307515_10137256 3300028794 Bacteria 2649
535 Ga0307515_10176197 3300028794 Bacteria 2108
536 Ga0265338_10005377 3300028800 Bacteria 16734
537 Ga0265338_10006215 3300028800 Bacteria 15298
538 Ga0265338_10016978 3300028800 Bacteria 7875
539 Ga0265338_10049198 3300028800 Bacteria 3824
540 Ga0265338_10103246 3300028800 Bacteria 2316
541 Ga0265338_10115220 3300028800 Bacteria 2155
542 Ga0265338_10199449 3300028800 Bacteria 1510
543 Ga0265324_10000002 3300029957 Bacteria 382754
544 Ga0307512_10154301 3300030522 Bacteria 1364
545 Ga0265760_10034596 3300031090 Bacteria 1495
546 Ga0265330_10045981 3300031235 Bacteria 1924
547 Ga0265332_10082350 3300031238 Bacteria 1364
548 Ga0265328_10001458 3300031239 Bacteria 10911
549 Ga0265320_10001037 3300031240 Bacteria 20637
550 Ga0265320_10002179 3300031240 Bacteria 13769
551 Ga0265320_10025177 3300031240 Bacteria 3133
552 Ga0265320_10055547 3300031240 Bacteria 1905
553 Ga0265320_10098836 3300031240 Bacteria 1345
554 Ga0265320_10105439 3300031240 Bacteria 1295
555 Ga0265325_10001332 3300031241 Bacteria 17493
556 Ga0265325_10134006 3300031241 Bacteria 1183
557 Ga0265329_10019712 3300031242 Bacteria 2286
558 Ga0265340_10008366 3300031247 Bacteria 5591
559 Ga0265340_10020657 3300031247 Bacteria 3381
560 Ga0265339_10061160 3300031249 Bacteria 2028
561 Ga0265331_10005681 3300031250 Bacteria 7490
562 Ga0265331_10007063 3300031250 Bacteria 6548
563 Ga0265331_10013992 3300031250 Bacteria 4291
564 Ga0265331_10019773 3300031250 Bacteria 3470
565 Ga0265331_10077121 3300031250 Bacteria 1553
566 Ga0265327_10000213 3300031251 Bacteria 121151
567 Ga0265327_10001422 3300031251 Bacteria 30463
568 Ga0265327_10007133 3300031251 Bacteria 8718
569 Ga0265327_10065755 3300031251 Bacteria 1832
570 Ga0265316_10000545 3300031344 Bacteria 42261
571 Ga0265316_10015555 3300031344 Bacteria 6647
572 Ga0307513_10011862 3300031456 Bacteria 10795
573 Ga0307513_10018254 3300031456 Bacteria 8390
574 Ga0307513_10075689 3300031456 Bacteria 3494
575 Ga0307513_10109533 3300031456 Bacteria 2759
576 Ga0307513_10116874 3300031456 Bacteria 2645
577 Ga0307509_10003789 3300031507 Bacteria 22447
578 Ga0307509_10118278 3300031507 Bacteria 2634
579 Ga0307509_10168056 3300031507 Bacteria 2078
580 Ga0307509_10182476 3300031507 Bacteria 1961
581 Ga0307408_100023107 3300031548 Bacteria 4233
582 Ga0307408_100112327 3300031548 Bacteria 2095
583 Ga0307408_100130882 3300031548 Bacteria 1957
584 Ga0265313_10007576 3300031595 Bacteria 7379
585 Ga0265313_10015842 3300031595 Bacteria 4363
586 Ga0307508_10004086 3300031616 Bacteria 14409
587 Ga0307508_10005039 3300031616 Bacteria 12690
588 Ga0265314_10013583 3300031711 Bacteria 6570
589 Ga0265314_10066836 3300031711 Bacteria 2423
590 Ga0265342_10041127 3300031712 Bacteria 2801
591 Ga0307405_10219477 3300031731 Bacteria 1394
592 Ga0307413_10084019 3300031824 Bacteria 2050
593 Ga0307410_10019021 3300031852 Bacteria 4167
594 Ga0307410_10033519 3300031852 Bacteria 3316
595 Ga0307410_10041132 3300031852 Bacteria 3046
596 Ga0307410_10049197 3300031852 Bacteria 2829
597 Ga0307410_10069507 3300031852 Bacteria 2436
598 Ga0307410_10136222 3300031852 Bacteria 1810
599 Ga0307410_10288594 3300031852 Bacteria 1290
600 Ga0307406_10025491 3300031901 Bacteria 3541
601 Ga0307412_10057419 3300031911 Bacteria 2598
602 Ga0307412_10082539 3300031911 Bacteria 2226
603 Ga0307409_100011518 3300031995 Bacteria 5583
604 Ga0307409_100049227 3300031995 Bacteria 3212
605 Ga0307409_100075541 3300031995 Bacteria 2698
606 Ga0307409_100116957 3300031995 Bacteria 2249
607 Ga0307409_100133992 3300031995 Bacteria 2122
608 Ga0307409_100331827 3300031995 Bacteria 1427
609 Ga0307409_100419043 3300031995 Bacteria 1284
610 Ga0307416_100002489 3300032002 Bacteria 10595
611 Ga0307416_100019810 3300032002 Bacteria 4781
612 Ga0307416_100024582 3300032002 Bacteria 4401
613 Ga0307416_100039677 3300032002 Bacteria 3649
614 Ga0307416_100083965 3300032002 Bacteria 2704
615 Ga0307416_100139886 3300032002 Bacteria 2198
616 Ga0307416_100463005 3300032002 Bacteria 1323
617 Ga0307414_10281233 3300032004 Bacteria 1398
618 Ga0307414_10281464 3300032004 Bacteria 1398
619 Ga0307411_10002990 3300032005 Bacteria 7695
620 Ga0307411_10054114 3300032005 Bacteria 2633
621 Ga0307411_10088034 3300032005 Bacteria 2158
622 Ga0307415_100019386 3300032126 Bacteria 4129
623 Ga0307507_10030162 3300033179 Bacteria 5724
624 Ga0307510_10000812 3300033180 Bacteria 32513
625 Ga0307510_10127595 3300033180 Bacteria 2228
626 Ga0373952_0004765 3300035092 Bacteria 2468
627 Ga0373936_0046417 3300035113 Bacteria 1751
628 Ga0373939_0021767 3300035114 Bacteria 1760
629 Ga0373931_0100224 3300035691 Bacteria 1628
630 Ga0373927_0067900 3300035695 Bacteria 2307
631 Ga0373927_0154282 3300035695 Bacteria 1504
632 Ga0373937_0128660 3300036401 Bacteria 2364
633 Ga0373937_0331100 3300036401 Bacteria 1441
634 Ga0373925_0029000 3300037068 Bacteria 4058
635 Ga0395905_0019247 3300037471 Bacteria 6472
636 Ga0395905_0444276 3300037471 Bacteria 1194
637 Ga0436364_0618718 3300037853 Bacteria 2833
638 Ga0237816_00009 3300039145 Bacteria 12381
639 Ga0436361_0621527 3300039447 Bacteria 17412
640 Ga0436361_1088302 3300039447 Bacteria 21721
641 Ga0439461_0000411 3300041410 Bacteria 6176
642 Ga0439465_0005927 3300041413 Bacteria 3884
643 Ga0439465_0013218 3300041413 Bacteria 2578
644 Ga0451802_0170293 3300041460 Bacteria 3945
645 Ga0451807_1837847 3300041486 Bacteria 1558
646 Ga0451807_2577330 3300041486 Bacteria 1895
647 Ga0451837_1564041 3300041494 Bacteria 2895
648 Ga0439445_0006065 3300042004 Bacteria 2772
649 Ga0439449_0000114 3300042007 Bacteria 26375
650 Ga0439449_0003134 3300042007 Bacteria 6433
651 Ga0450894_002673 3300042131 Bacteria 2370
652 Ga0450896_001275 3300042133 Bacteria 3051
653 Ga0450898_000329 3300042134 Bacteria 5389
654 Ga0450910_003248 3300042147 Bacteria 2155
655 Ga0439446_0000379 3300042156 Bacteria 8582
656 Ga0450908_000588 3300042184 Bacteria 6962
657 Ga0439434_0001027 3300042435 Bacteria 8075
658 Ga0439435_0000513 3300042436 Bacteria 6185
659 Ga0439459_0025938 3300042438 Bacteria 1161
660 Ga0450918_005098 3300042531 Bacteria 2367
661 Ga0451577_0003485 3300042876 Bacteria 17504
662 Ga0451577_0011223 3300042876 Bacteria 8492
663 Ga0451577_0084624 3300042876 Bacteria 2830
664 Ga0451577_0153364 3300042876 Bacteria 2073
665 Ga0451577_0224706 3300042876 Bacteria 1697
666 Ga0466969_0031267 3300044656 Bacteria 2711
667 Ga0466969_0066095 3300044656 Bacteria 1746
668 Ga0466972_0016607 3300044658 Bacteria 3680
669 Ga0466965_0045036 3300044683 Bacteria 2181
670 Ga0466965_0072811 3300044683 Bacteria 1729
671 Ga0466961_0021251 3300044693 Bacteria 4179
672 Ga0466961_0076286 3300044693 Bacteria 2124
673 Ga0453684_0000136 3300044712 Bacteria 323402
674 Ga0453684_0000499 3300044712 Bacteria 153532
675 Ga0453684_0000682 3300044712 Bacteria 121090
676 Ga0453684_0002254 3300044712 Bacteria 47784
677 Ga0453684_0010455 3300044712 Bacteria 15862
678 Ga0453684_0017209 3300044712 Bacteria 11224
679 Ga0453684_0023051 3300044712 Bacteria 9198
680 Ga0453684_0024764 3300044712 Bacteria 8748
681 Ga0453684_0029755 3300044712 Bacteria 7740
682 Ga0453684_0031025 3300044712 Bacteria 7528
683 Ga0453684_0049121 3300044712 Bacteria 5568
684 Ga0453684_0052474 3300044712 Bacteria 5331
685 Ga0453684_0057685 3300044712 Bacteria 5022
686 Ga0453684_0062444 3300044712 Bacteria 4772
687 Ga0453684_0063014 3300044712 Bacteria 4745
688 Ga0453684_0117173 3300044712 Bacteria 3223
689 Ga0453684_0352830 3300044712 Bacteria 1658
690 Ga0453684_0358210 3300044712 Bacteria 1643
691 Ga0453684_0508543 3300044712 Bacteria 1333
692 Ga0466971_0011291 3300044719 Bacteria 3913
693 Ga0466968_0010602 3300044735 Bacteria 3577
694 Ga0466970_0040730 3300044765 Bacteria 2467
695 Ga0466959_0071909 3300045049 Bacteria 2504
696 Ga0466959_0153855 3300045049 Bacteria 1619
697 Ga0451576_0000025 3300045051 Bacteria 427980
698 Ga0451576_0001018 3300045051 Bacteria 51870
699 Ga0451576_0003603 3300045051 Bacteria 21062
700 Ga0451576_0005451 3300045051 Bacteria 15954
701 Ga0451576_0019148 3300045051 Bacteria 7477
702 Ga0451576_0065562 3300045051 Bacteria 3781
703 Ga0451576_0173258 3300045051 Bacteria 2252
704 Ga0451576_0641677 3300045051 Bacteria 1116
705 Ga0466967_0043524 3300045976 Bacteria 3888
706 Ga0495638_0023913 3300046460 Bacteria 3991
707 Ga0495651_0008790 3300046462 Bacteria 7745
708 Ga0495608_0053871 3300046511 Bacteria 2660
709 Ga0495610_0032043 3300046512 Bacteria 2736
710 Ga0495618_0038290 3300046514 Bacteria 3013
711 Ga0495628_0000851 3300046516 Bacteria 28201
712 Ga0495630_0088618 3300046517 Bacteria 2337
713 Ga0495648_0081810 3300046524 Bacteria 1836
714 Ga0495663_0000771 3300046525 Bacteria 10950
715 Ga0495642_0057302 3300046528 Bacteria 1611
716 Ga0495652_0022954 3300046529 Bacteria 5533
717 Ga0495597_0004870 3300046542 Bacteria 7230
718 Ga0495611_0154408 3300046648 Bacteria 1072
719 Ga0495625_0008867 3300046660 Bacteria 8512
720 Ga0495625_0106431 3300046660 Bacteria 1920
721 Ga0495623_0003893 3300046679 Bacteria 9846
722 Ga0495613_0017816 3300046689 Bacteria 5293
723 Ga0495671_0023334 3300046692 Bacteria 3232
724 Ga0495589_0070497 3300046794 Bacteria 1709
725 Ga0495660_0050459 3300046810 Bacteria 2267
726 Ga0495687_000128 3300047443 Bacteria 116626
727 Ga0495687_036927 3300047443 Bacteria 2181
728 Ga0495675_0118421 3300047444 Bacteria 1650
729 Ga0495686_0040286 3300047472 Bacteria 2980
730 Ga0495686_0061450 3300047472 Bacteria 2333
731 Ga0495602_0053021 3300048088 Bacteria 3595
732 Ga0496101_0121991 3300048904 Bacteria 1971
733 Ga0496101_0306692 3300048904 Bacteria 1244
734 Ga0496102_0083158 3300048905 Bacteria 2953
735 Ga0496102_0264693 3300048905 Bacteria 1621
736 Ga0496102_0316633 3300048905 Bacteria 1470
737 Ga0496102_0386208 3300048905 Bacteria 1317
738 Ga0496103_0009158 3300048906 Bacteria 5862
739 Ga0496104_0217941 3300048907 Bacteria 1821
740 Ga0496106_0030531 3300048909 Bacteria 4017
741 Ga0496106_0044803 3300048909 Bacteria 3322
742 Ga0496106_0047472 3300048909 Bacteria 3232
743 Ga0496106_0243598 3300048909 Bacteria 1437
744 Ga0496106_0316904 3300048909 Bacteria 1252
745 Ga0496107_0018174 3300048910 Bacteria 4948
746 Ga0496109_0499624 3300048912 Bacteria 1148
747 Ga0496112_0016195 3300048915 Bacteria 6975
748 Ga0496114_0012813 3300048917 Bacteria 6713
749 Ga0496114_0047371 3300048917 Bacteria 3576
750 Ga0496115_0001590 3300048918 Bacteria 16293
751 Ga0496121_0000154 3300048924 Bacteria 150013
752 Ga0496121_0074864 3300048924 Bacteria 2706
753 Ga0496122_0015448 3300048925 Bacteria 7299
754 Ga0496122_0149147 3300048925 Bacteria 1447
755 Ga0496124_0000018 3300048927 Bacteria 442940
756 Ga0496125_0116140 3300048928 Bacteria 1922
757 Ga0496126_0032642 3300048929 Bacteria 4903
758 Ga0501031_0015028 3300049568 Bacteria 5029
759 Ga0501031_0237182 3300049568 Bacteria 1186
760 Ga0501032_0000570 3300049569 Bacteria 29860
761 Ga0501032_0045148 3300049569 Bacteria 2981
762 Ga0501032_0049955 3300049569 Bacteria 2821
763 Ga0501032_0199742 3300049569 Bacteria 1305
764 Ga0501033_0001988 3300049570 Bacteria 17819
765 Ga0501034_0000624 3300049571 Bacteria 55267
766 Ga0501034_0076566 3300049571 Bacteria 3352
767 Ga0501034_0132433 3300049571 Bacteria 2476
768 Ga0501034_0180034 3300049571 Bacteria 2079
769 Ga0501036_0047782 3300049572 Bacteria 3623
770 Ga0501036_0153587 3300049572 Bacteria 1941
771 Ga0501037_0003745 3300049573 Bacteria 11033
772 Ga0501037_0024041 3300049573 Bacteria 4505
773 Ga0501037_0040775 3300049573 Bacteria 3416
774 Ga0501038_0000379 3300049574 Bacteria 38322
775 Ga0501038_0024509 3300049574 Bacteria 5382
776 Ga0501039_0004090 3300049575 Bacteria 10971
777 Ga0501039_0007955 3300049575 Bacteria 8072
778 Ga0501039_0008947 3300049575 Bacteria 7629
779 Ga0501040_0159206 3300049576 Bacteria 1596
780 Ga0501041_0016666 3300049577 Bacteria 4372
781 Ga0501041_0092447 3300049577 Bacteria 1868
782 Ga0501041_0136466 3300049577 Bacteria 1529
783 Ga0501042_0023337 3300049578 Bacteria 4328
784 Ga0501042_0034928 3300049578 Bacteria 3567
785 Ga0501043_0050616 3300049579 Bacteria 3265
786 Ga0501046_0000029 3300049580 Bacteria 194168
787 Ga0501046_0014910 3300049580 Bacteria 6539
788 Ga0501046_0025272 3300049580 Bacteria 4862
789 Ga0501046_0045598 3300049580 Bacteria 3483
790 Ga0501046_0235228 3300049580 Bacteria 1352
791 Ga0501047_0000581 3300049581 Bacteria 38872
792 Ga0501047_0022231 3300049581 Bacteria 6093
793 Ga0501047_0042815 3300049581 Bacteria 4374
794 Ga0501047_0069721 3300049581 Bacteria 3385
795 Ga0501048_0004012 3300049582 Bacteria 11186
796 Ga0501048_0036307 3300049582 Bacteria 3542
797 Ga0501048_0095559 3300049582 Bacteria 2096
798 Ga0501067_0005591 3300049583 Bacteria 6972
799 Ga0501067_0011858 3300049583 Bacteria 4831
800 Ga0501067_0033510 3300049583 Bacteria 2850
801 Ga0501068_0000124 3300049584 Bacteria 34247
802 Ga0501068_0004113 3300049584 Bacteria 7888
803 Ga0501068_0026220 3300049584 Bacteria 3433
804 Ga0501068_0042477 3300049584 Bacteria 2734
805 Ga0501068_0067320 3300049584 Bacteria 2182
806 Ga0501069_0059431 3300049585 Bacteria 2133
807 Ga0501070_0011683 3300049586 Bacteria 7415
808 Ga0501071_0004121 3300049587 Bacteria 9188
809 Ga0501071_0042782 3300049587 Bacteria 3246
810 Ga0501071_0126805 3300049587 Bacteria 1895
811 Ga0501071_0264268 3300049587 Bacteria 1300
812 Ga0501072_0049582 3300049588 Bacteria 3306
813 Ga0501072_0074917 3300049588 Bacteria 2676
814 Ga0501072_0076600 3300049588 Bacteria 2646
815 Ga0501072_0104811 3300049588 Bacteria 2248
816 Ga0501072_0279960 3300049588 Bacteria 1327
817 Ga0501073_0000399 3300049589 Bacteria 29561
818 Ga0501073_0002048 3300049589 Bacteria 15053
819 Ga0501073_0002144 3300049589 Bacteria 14758
820 Ga0501073_0048235 3300049589 Bacteria 2990
821 Ga0501073_0054959 3300049589 Bacteria 2787
822 Ga0501074_0007859 3300049590 Bacteria 7725
823 Ga0501074_0078476 3300049590 Bacteria 2370
824 Ga0501075_0008262 3300049591 Bacteria 7253
825 Ga0501075_0017516 3300049591 Bacteria 5176
826 Ga0501076_0007140 3300049592 Bacteria 8119
827 Ga0501076_0097775 3300049592 Bacteria 2364
828 Ga0501076_0247520 3300049592 Bacteria 1458
829 Ga0501077_0001020 3300049593 Bacteria 16910
830 Ga0501077_0009846 3300049593 Bacteria 5945
831 Ga0501077_0032948 3300049593 Bacteria 3299
832 Ga0501225_0024599 3300049705 Bacteria 1658
833 Ga0501079_0005396 3300049741 Bacteria 9523
834 Ga0501079_0027691 3300049741 Bacteria 4347
835 Ga0501079_0122552 3300049741 Bacteria 2022
836 Ga0501080_0000192 3300049742 Bacteria 44688
837 Ga0501080_0013052 3300049742 Bacteria 7628
838 Ga0501080_0038417 3300049742 Bacteria 4469
839 Ga0501080_0093236 3300049742 Bacteria 2796
840 Ga0501080_0276807 3300049742 Bacteria 1526
841 Ga0501081_0043527 3300049743 Bacteria 3080
842 Ga0501083_0069618 3300049744 Bacteria 2341
843 Ga0501083_0207454 3300049744 Bacteria 1278
844 Ga0501280_002270 3300049776 Bacteria 3257
845 Ga0501035_0005219 3300049822 Bacteria 12295
846 Ga0501035_0006345 3300049822 Bacteria 11117
847 Ga0501035_0006565 3300049822 Bacteria 10906
848 Ga0501035_0017905 3300049822 Bacteria 6534
849 Ga0501044_0000006 3300049823 Bacteria 291413
850 Ga0501044_0001209 3300049823 Bacteria 30642
851 Ga0501044_0002324 3300049823 Bacteria 21666
852 Ga0501044_0024583 3300049823 Bacteria 6392
853 Ga0501044_0033679 3300049823 Bacteria 5381
854 Ga0501045_0006548 3300049824 Bacteria 8075
855 Ga0501045_0084137 3300049824 Bacteria 2347
856 nmdc:mga03683_41656_c1 3300050489 Bacteria 1887
857 nmdc:mga03683_8519_c1 3300050489 Bacteria 3609
858 nmdc:mga03n38_39630_c1 3300050490 Bacteria 2044
859 nmdc:mga00v17_92398_c1 3300050491 Bacteria 1902
860 nmdc:mga0k408_167724_c1 3300050493 Bacteria 1309
861 nmdc:mga0k408_4311_c1 3300050493 Bacteria 7557
862 nmdc:mga0k408_5851_c1 3300050493 Bacteria 6552
863 nmdc:mga06z11_1038_c1 3300050494 Bacteria 10109
864 nmdc:mga06z11_23634_c1 3300050494 Bacteria 2891
865 nmdc:mga06z11_31712_c1 3300050494 Bacteria 2570
866 nmdc:mga07m45_1267_c1 3300050496 Bacteria 11495
867 nmdc:mga07m45_139536_c1 3300050496 Bacteria 1404
868 nmdc:mga07m45_18414_c1 3300050496 Bacteria 3770
869 nmdc:mga07m45_4022_c1 3300050496 Bacteria 7160
870 nmdc:mga07m45_42962_c1 3300050496 Bacteria 2534
871 nmdc:mga05p37_109305_c1 3300050507 Bacteria 3401
872 nmdc:mga05p37_30717_c1 3300050507 Bacteria 6555
873 nmdc:mga0qj67_39250_c1 3300050509 Bacteria 3717
874 nmdc:mga06r32_514283_c1 3300050510 Bacteria 1173
875 nmdc:mga08y16_16754_c1 3300050511 Bacteria 7712
876 nmdc:mga08y16_41573_c1 3300050511 Bacteria 4815
877 nmdc:mga08y16_424503_c1 3300050511 Bacteria 1358
878 nmdc:mga08y16_532432_c1 3300050511 Bacteria 1190
879 nmdc:mga08y16_7173_c1 3300050511 Bacteria 11695
880 nmdc:mga0n895_7001_c1 3300050512 Bacteria 9633
881 nmdc:mga0rr50_49618_c1 3300050513 Bacteria 3107
882 nmdc:mga0a205_17283_c1 3300050515 Bacteria 6758
883 nmdc:mga0a205_31976_c1 3300050515 Bacteria 5044
884 nmdc:mga0a205_3811_c1 3300050515 Bacteria 13515
885 nmdc:mga0a205_39580_c1 3300050515 Bacteria 4537
886 nmdc:mga0sz30_24059_c1 3300050516 Bacteria 2484
887 Ga0500643_000017 3300053087 Bacteria 305781
888 Ga0500643_031703 3300053087 Bacteria 1609
889 Ga0500646_0040156 3300053090 Bacteria 1315
890 Ga0500641_0002110 3300053096 Bacteria 7046
891 Ga0500641_0009333 3300053096 Bacteria 3528
892 Ga0500555_001712 3300053103 Bacteria 6594
893 Ga0500592_007244 3300053116 Bacteria 1764
894 Ga0500642_0071074 3300053130 Bacteria 1584
895 Ga0500652_057116 3300053131 Bacteria 1601
896 Ga0500658_0017516 3300053134 Bacteria 2677
897 Ga0500568_0015780 3300053139 Bacteria 3373
898 Ga0500568_0022043 3300053139 Bacteria 2732
899 Ga0500616_0014220 3300053153 Bacteria 4580
900 Ga0500622_0048058 3300053156 Bacteria 2202
901 Ga0500622_0056261 3300053156 Bacteria 2014
902 Ga0500609_000624 3300053731 Bacteria 5396
903 Ga0501084_0002257 3300054114 Bacteria 15480
904 Ga0501084_0019391 3300054114 Bacteria 5666
905 Ga0501084_0046081 3300054114 Bacteria 3651
906 Ga0501084_0080230 3300054114 Bacteria 2736
907 Ga0501084_0152476 3300054114 Bacteria 1948
908 Ga0590071_003216 3300059421 Bacteria 4035
909 Ga0590074_002183 3300059423 Bacteria 3211
910 Ga0501082_0002041 3300060353 Bacteria 17752
911 Ga0501082_0021283 3300060353 Bacteria 5595
912 Ga0501082_0022288 3300060353 Bacteria 5457
913 Ga0501082_0055186 3300060353 Bacteria 3423
914 Ga0501082_0058495 3300060353 Bacteria 3321
915 Ga0501082_0080700 3300060353 Bacteria 2807
916 Ga0530510_0014407 3300061734 Bacteria 5575
917 Ga0530510_0076303 3300061734 Bacteria 2435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10219477 Ga0307405_102194772 310
2 3300005563 Ga0068855_100003783 Ga0068855_10000378316 311
3 3300025949 Ga0207667_10240116 Ga0207667_102401162 311
4 3300025898 Ga0207692_10021047 Ga0207692_100210472 312
5 3300044712 Ga0453684_0023051 Ga0453684_0023051_6853_7893 314
6 3300042131 Ga0450894_002673 Ga0450894_002673_536_1549 315
7 3300042133 Ga0450896_001275 Ga0450896_001275_1432_2445 315
8 3300042147 Ga0450910_003248 Ga0450910_003248_615_1628 315
9 3300042184 Ga0450908_000588 Ga0450908_000588_2399_3412 315
10 3300042531 Ga0450918_005098 Ga0450918_005098_742_1755 315
11 3300028381 Ga0268264_10139266 Ga0268264_101392664 316
12 3300028800 Ga0265338_10115220 Ga0265338_101152202 316
13 3300031240 Ga0265320_10055547 Ga0265320_100555472 316
14 3300031240 Ga0265320_10098836 Ga0265320_100988361 316
15 3300048909 Ga0496106_0047472 Ga0496106_0047472_2182_3207 316
16 3300005355 Ga0070671_100162865 Ga0070671_1001628653 317
17 3300005563 Ga0068855_100579952 Ga0068855_1005799522 317
18 3300005617 Ga0068859_100024836 Ga0068859_1000248362 317
19 3300005618 Ga0068864_100038556 Ga0068864_1000385562 317
20 3300005841 Ga0068863_100053479 Ga0068863_1000534795 317
21 3300006931 Ga0097620_100024836 Ga0097620_1000248362 317
22 3300009098 Ga0105245_10032802 Ga0105245_100328023 317
23 3300009987 Ga0105030_100593 Ga0105030_1005932 317
24 3300013306 Ga0163162_10315255 Ga0163162_103152551 317
25 3300014325 Ga0163163_10056050 Ga0163163_100560504 317
26 3300025927 Ga0207687_10165291 Ga0207687_101652911 317
27 3300026035 Ga0207703_10151824 Ga0207703_101518243 317
28 3300026095 Ga0207676_10019158 Ga0207676_100191582 317
29 3300028379 Ga0268266_10123187 Ga0268266_101231872 317
30 3300031507 Ga0307509_10168056 Ga0307509_101680561 317
31 3300031548 Ga0307408_100023107 Ga0307408_1000231074 317
32 3300031852 Ga0307410_10041132 Ga0307410_100411323 317
33 3300031901 Ga0307406_10025491 Ga0307406_100254914 317
34 3300031911 Ga0307412_10082539 Ga0307412_100825392 317
35 3300031995 Ga0307409_100075541 Ga0307409_1000755412 317
36 3300032002 Ga0307416_100002489 Ga0307416_1000024898 317
37 3300032002 Ga0307416_100024582 Ga0307416_1000245822 317
38 3300032005 Ga0307411_10002990 Ga0307411_100029904 317
39 3300046460 Ga0495638_0023913 Ga0495638_0023913_2427_3446 317
40 3300048909 Ga0496106_0243598 Ga0496106_0243598_75_1094 317
41 3300049583 Ga0501067_0033510 Ga0501067_0033510_1157_2167 317
42 3300049589 Ga0501073_0002048 Ga0501073_0002048_9582_10592 317
43 3300049593 Ga0501077_0032948 Ga0501077_0032948_56_1066 317
44 3300049742 Ga0501080_0093236 Ga0501080_0093236_485_1495 317
45 3300049744 Ga0501083_0207454 Ga0501083_0207454_228_1238 317
46 3300054114 Ga0501084_0080230 Ga0501084_0080230_47_1057 317
47 3300059421 Ga0590071_003216 Ga0590071_003216_801_1820 317
48 3300060353 Ga0501082_0002041 Ga0501082_0002041_16450_17460 317
49 3300005337 Ga0070682_100056380 Ga0070682_1000563801 318
50 3300005467 Ga0070706_100004299 Ga0070706_10000429912 318
51 3300005468 Ga0070707_100077664 Ga0070707_1000776643 318
52 3300006195 Ga0075366_10002514 Ga0075366_100025144 318
53 3300006353 Ga0075370_10030479 Ga0075370_100304792 318
54 3300009553 Ga0105249_10363069 Ga0105249_103630692 318
55 3300025910 Ga0207684_10011731 Ga0207684_100117312 318
56 3300025922 Ga0207646_10035270 Ga0207646_100352702 318
57 3300031251 Ga0265327_10065755 Ga0265327_100657552 318
58 3300031911 Ga0307412_10057419 Ga0307412_100574193 318
59 3300032005 Ga0307411_10088034 Ga0307411_100880342 318
60 3300032126 Ga0307415_100019386 Ga0307415_1000193862 318
61 3300042436 Ga0439435_0000513 Ga0439435_0000513_3820_4833 318
62 3300050496 nmdc:mga07m45_139536_c1 nmdc:mga07m45_139536_c1_240_1271 318
63 3300005618 Ga0068864_100019118 Ga0068864_1000191185 319
64 3300009098 Ga0105245_10006355 Ga0105245_100063555 319
65 3300009174 Ga0105241_10005410 Ga0105241_100054106 319
66 3300014326 Ga0157380_10008547 Ga0157380_100085472 319
67 3300025908 Ga0207643_10003138 Ga0207643_100031382 319
68 3300025911 Ga0207654_10002858 Ga0207654_100028584 319
69 3300025927 Ga0207687_10006633 Ga0207687_100066335 319
70 3300026116 Ga0207674_10013835 Ga0207674_100138358 319
71 3300031824 Ga0307413_10084019 Ga0307413_100840192 319
72 3300031852 Ga0307410_10019021 Ga0307410_100190214 319
73 3300032002 Ga0307416_100039677 Ga0307416_1000396773 319
74 3300032005 Ga0307411_10054114 Ga0307411_100541143 319
75 3300005543 Ga0070672_100279081 Ga0070672_1002790812 320
76 3300005841 Ga0068863_100047852 Ga0068863_1000478524 320
77 3300006042 Ga0075368_10000722 Ga0075368_100007224 320
78 3300006048 Ga0075363_100008114 Ga0075363_1000081143 320
79 3300006177 Ga0075362_10014864 Ga0075362_100148642 320
80 3300006186 Ga0075369_10014629 Ga0075369_100146293 320
81 3300025940 Ga0207691_10013491 Ga0207691_1001349110 320
82 3300032004 Ga0307414_10281233 Ga0307414_102812332 320
83 3300037068 Ga0373925_0029000 Ga0373925_0029000_1448_2467 320
84 3300050489 nmdc:mga03683_8519_c1 nmdc:mga03683_8519_c1_1192_2214 320
85 3300050494 nmdc:mga06z11_23634_c1 nmdc:mga06z11_23634_c1_1392_2414 320
86 3300050507 nmdc:mga05p37_30717_c1 nmdc:mga05p37_30717_c1_915_1934 320
87 3300005341 Ga0070691_10183984 Ga0070691_101839841 321
88 3300005353 Ga0070669_100030927 Ga0070669_1000309273 321
89 3300005844 Ga0068862_100045310 Ga0068862_1000453103 321
90 3300006358 Ga0068871_100112023 Ga0068871_1001120232 321
91 3300014326 Ga0157380_10093870 Ga0157380_100938702 321
92 3300026118 Ga0207675_100107967 Ga0207675_1001079672 321
93 3300049584 Ga0501068_0004113 Ga0501068_0004113_5841_6860 321
94 3300049587 Ga0501071_0042782 Ga0501071_0042782_1610_2629 321
95 3300049588 Ga0501072_0076600 Ga0501072_0076600_1586_2605 321
96 3300049589 Ga0501073_0002144 Ga0501073_0002144_555_1574 321
97 3300049590 Ga0501074_0007859 Ga0501074_0007859_956_1975 321
98 3300049592 Ga0501076_0247520 Ga0501076_0247520_121_1140 321
99 3300049593 Ga0501077_0001020 Ga0501077_0001020_10140_11159 321
100 3300049741 Ga0501079_0005396 Ga0501079_0005396_1029_2048 321
101 3300049742 Ga0501080_0013052 Ga0501080_0013052_5454_6473 321
102 3300049744 Ga0501083_0069618 Ga0501083_0069618_1023_2042 321
103 3300053134 Ga0500658_0017516 Ga0500658_0017516_946_1968 321
104 3300054114 Ga0501084_0002257 Ga0501084_0002257_40_1059 321
105 3300060353 Ga0501082_0022288 Ga0501082_0022288_1620_2639 321
106 3300009545 Ga0105237_10366099 Ga0105237_103660991 322
107 3300031616 Ga0307508_10004086 Ga0307508_100040863 322
108 3300046794 Ga0495589_0070497 Ga0495589_0070497_284_1351 322
109 3300048928 Ga0496125_0116140 Ga0496125_0116140_63_1115 322
110 3300049589 Ga0501073_0048235 Ga0501073_0048235_1849_2823 322
111 3300003794 Ga0055531_10000021 Ga0055531_1000002162 323
112 3300005353 Ga0070669_100029603 Ga0070669_1000296033 323
113 3300005356 Ga0070674_100024852 Ga0070674_1000248523 323
114 3300005719 Ga0068861_100058981 Ga0068861_1000589812 323
115 3300005844 Ga0068862_100020918 Ga0068862_1000209184 323
116 3300009553 Ga0105249_10106640 Ga0105249_101066402 323
117 3300014326 Ga0157380_10029395 Ga0157380_100293952 323
118 3300025298 Ga0209050_1003476 Ga0209050_10034769 323
119 3300025303 Ga0209051_1019686 Ga0209051_10196861 323
120 3300025304 Ga0209257_1000032 Ga0209257_1000032458 323
121 3300025923 Ga0207681_10038264 Ga0207681_100382642 323
122 3300026118 Ga0207675_100191625 Ga0207675_1001916252 323
123 3300028380 Ga0268265_10019222 Ga0268265_100192224 323
124 3300031995 Ga0307409_100116957 Ga0307409_1001169572 323
125 3300042438 Ga0439459_0025938 Ga0439459_0025938_44_1063 323
126 3300044712 Ga0453684_0508543 Ga0453684_0508543_34_1032 323
127 3300049569 Ga0501032_0045148 Ga0501032_0045148_481_1524 323
128 3300049571 Ga0501034_0000624 Ga0501034_0000624_6825_7868 323
129 3300049573 Ga0501037_0024041 Ga0501037_0024041_321_1364 323
130 3300049575 Ga0501039_0004090 Ga0501039_0004090_9008_10051 323
131 3300049580 Ga0501046_0045598 Ga0501046_0045598_1284_2327 323
132 3300049581 Ga0501047_0022231 Ga0501047_0022231_3053_4096 323
133 3300049583 Ga0501067_0011858 Ga0501067_0011858_1151_2194 323
134 3300049586 Ga0501070_0011683 Ga0501070_0011683_2462_3505 323
135 3300049742 Ga0501080_0038417 Ga0501080_0038417_573_1616 323
136 3300049822 Ga0501035_0005219 Ga0501035_0005219_10162_11205 323
137 3300049823 Ga0501044_0000006 Ga0501044_0000006_242683_243726 323
138 3300005295 Ga0065707_10004891 Ga0065707_100048912 324
139 3300005546 Ga0070696_100048806 Ga0070696_1000488062 324
140 3300014325 Ga0163163_10020970 Ga0163163_100209705 324
141 3300028556 Ga0265337_1000036 Ga0265337_100003656 324
142 3300028800 Ga0265338_10005377 Ga0265338_100053779 324
143 3300031240 Ga0265320_10001037 Ga0265320_100010373 324
144 3300031507 Ga0307509_10182476 Ga0307509_101824762 324
145 3300031712 Ga0265342_10041127 Ga0265342_100411272 324
146 3300033179 Ga0307507_10030162 Ga0307507_100301622 324
147 3300042876 Ga0451577_0153364 Ga0451577_0153364_1037_2041 324
148 3300044693 Ga0466961_0021251 Ga0466961_0021251_2963_3955 324
149 3300046517 Ga0495630_0088618 Ga0495630_0088618_71_1069 324
150 3300046528 Ga0495642_0057302 Ga0495642_0057302_150_1175 324
151 3300047444 Ga0495675_0118421 Ga0495675_0118421_249_1247 324
152 3300060353 Ga0501082_0080700 Ga0501082_0080700_1807_2787 324
153 iso_pu_bacteria 2643221579 2643906261 324
154 iso_pu_bacteria 2643221581 2643915281 324
155 iso_pu_bacteria 2923516293 2923519169 324
156 3300005445 Ga0070708_100116599 Ga0070708_1001165993 325
157 3300005549 Ga0070704_100181716 Ga0070704_1001817161 325
158 3300006844 Ga0075428_100094556 Ga0075428_1000945561 325
159 3300006844 Ga0075428_100175145 Ga0075428_1001751452 325
160 3300009094 Ga0111539_10350856 Ga0111539_103508562 325
161 3300009177 Ga0105248_10561510 Ga0105248_105615102 325
162 3300025921 Ga0207652_10173032 Ga0207652_101730322 325
163 3300031995 Ga0307409_100419043 Ga0307409_1004190432 325
164 3300032002 Ga0307416_100019810 Ga0307416_1000198102 325
165 3300032004 Ga0307414_10281464 Ga0307414_102814641 325
166 3300035114 Ga0373939_0021767 Ga0373939_0021767_138_1148 325
167 3300044712 Ga0453684_0000136 Ga0453684_0000136_258370_259416 325
168 3300044712 Ga0453684_0000682 Ga0453684_0000682_14742_15740 325
169 3300044712 Ga0453684_0024764 Ga0453684_0024764_2122_3120 325
170 3300044712 Ga0453684_0063014 Ga0453684_0063014_1252_2247 325
171 3300045051 Ga0451576_0000025 Ga0451576_0000025_168475_169521 325
172 3300045051 Ga0451576_0001018 Ga0451576_0001018_38744_39742 325
173 3300045051 Ga0451576_0019148 Ga0451576_0019148_4859_5854 325
174 3300048905 Ga0496102_0316633 Ga0496102_0316633_221_1231 325
175 3300048909 Ga0496106_0044803 Ga0496106_0044803_686_1696 325
176 3300049705 Ga0501225_0024599 Ga0501225_0024599_517_1527 325
177 3300050509 nmdc:mga0qj67_39250_c1 nmdc:mga0qj67_39250_c1_1423_2439 325
178 iso_pu_bacteria 8002869464 8002869549 325
179 3300005367 Ga0070667_100001374 Ga0070667_10000137415 326
180 3300005535 Ga0070684_100308367 Ga0070684_1003083671 326
181 3300005841 Ga0068863_100145406 Ga0068863_1001454062 326
182 3300005842 Ga0068858_100033644 Ga0068858_1000336444 326
183 3300009177 Ga0105248_10128243 Ga0105248_101282431 326
184 3300009545 Ga0105237_10034822 Ga0105237_100348223 326
185 3300010375 Ga0105239_10027248 Ga0105239_100272483 326
186 3300013105 Ga0157369_10361570 Ga0157369_103615702 326
187 3300013306 Ga0163162_10090555 Ga0163162_100905552 326
188 3300013308 Ga0157375_10163922 Ga0157375_101639222 326
189 3300021361 Ga0213872_10001049 Ga0213872_100010493 326
190 3300021361 Ga0213872_10002041 Ga0213872_1000204112 326
191 3300025944 Ga0207661_10007948 Ga0207661_100079486 326
192 3300025986 Ga0207658_10001308 Ga0207658_100013085 326
193 3300026035 Ga0207703_10049780 Ga0207703_100497802 326
194 3300026088 Ga0207641_10132904 Ga0207641_101329043 326
195 3300028794 Ga0307515_10176197 Ga0307515_101761973 326
196 3300031240 Ga0265320_10002179 Ga0265320_1000217913 326
197 3300031242 Ga0265329_10019712 Ga0265329_100197122 326
198 3300031247 Ga0265340_10020657 Ga0265340_100206574 326
199 3300031250 Ga0265331_10007063 Ga0265331_100070632 326
200 3300031344 Ga0265316_10000545 Ga0265316_1000054527 326
201 3300031344 Ga0265316_10015555 Ga0265316_100155556 326
202 3300031456 Ga0307513_10011862 Ga0307513_100118626 326
203 3300039447 Ga0436361_0621527 Ga0436361_0621527_5099_6094 326
204 3300042876 Ga0451577_0224706 Ga0451577_0224706_81_1082 326
205 3300044712 Ga0453684_0017209 Ga0453684_0017209_8277_9275 326
206 3300044712 Ga0453684_0358210 Ga0453684_0358210_161_1162 326
207 3300044735 Ga0466968_0010602 Ga0466968_0010602_2516_3529 326
208 3300045051 Ga0451576_0065562 Ga0451576_0065562_1713_2711 326
209 3300045051 Ga0451576_0173258 Ga0451576_0173258_1213_2211 326
210 3300045976 Ga0466967_0043524 Ga0466967_0043524_334_1395 326
211 3300048915 Ga0496112_0016195 Ga0496112_0016195_480_1469 326
212 3300048924 Ga0496121_0000154 Ga0496121_0000154_126056_127051 326
213 3300048927 Ga0496124_0000018 Ga0496124_0000018_402480_403484 326
214 3300050511 nmdc:mga08y16_41573_c1 nmdc:mga08y16_41573_c1_1263_2261 326
215 iso_pu_bacteria 2998344455 2998345603 326
216 3300005435 Ga0070714_100015012 Ga0070714_1000150123 327
217 3300005467 Ga0070706_100008439 Ga0070706_1000084396 327
218 3300005518 Ga0070699_100094418 Ga0070699_1000944181 327
219 3300014325 Ga0163163_10240598 Ga0163163_102405982 327
220 3300025910 Ga0207684_10001346 Ga0207684_100013463 327
221 3300025929 Ga0207664_10001478 Ga0207664_100014787 327
222 3300026041 Ga0207639_10050987 Ga0207639_100509872 327
223 3300031548 Ga0307408_100112327 Ga0307408_1001123272 327
224 3300031852 Ga0307410_10033519 Ga0307410_100335191 327
225 3300031852 Ga0307410_10069507 Ga0307410_100695073 327
226 3300031995 Ga0307409_100133992 Ga0307409_1001339923 327
227 3300032002 Ga0307416_100139886 Ga0307416_1001398863 327
228 3300037471 Ga0395905_0444276 Ga0395905_0444276_66_1076 327
229 3300037853 Ga0436364_0618718 Ga0436364_0618718_261_1268 327
230 3300044656 Ga0466969_0066095 Ga0466969_0066095_276_1274 327
231 3300044683 Ga0466965_0072811 Ga0466965_0072811_395_1393 327
232 3300044693 Ga0466961_0076286 Ga0466961_0076286_989_1987 327
233 3300044719 Ga0466971_0011291 Ga0466971_0011291_2202_3200 327
234 3300044765 Ga0466970_0040730 Ga0466970_0040730_1200_2198 327
235 3300045049 Ga0466959_0153855 Ga0466959_0153855_346_1344 327
236 3300048917 Ga0496114_0012813 Ga0496114_0012813_1448_2464 327
237 3300048929 Ga0496126_0032642 Ga0496126_0032642_2108_3124 327
238 3300053153 Ga0500616_0014220 Ga0500616_0014220_716_1750 327
239 iso_pu_bacteria 2643221654 2644304584 327
240 3300005327 Ga0070658_10046904 Ga0070658_100469041 328
241 3300005335 Ga0070666_10011356 Ga0070666_100113564 328
242 3300005336 Ga0070680_100030265 Ga0070680_1000302653 328
243 3300005340 Ga0070689_100027922 Ga0070689_1000279224 328
244 3300005365 Ga0070688_100079911 Ga0070688_1000799112 328
245 3300005367 Ga0070667_100191696 Ga0070667_1001916962 328
246 3300005440 Ga0070705_100107992 Ga0070705_1001079921 328
247 3300005441 Ga0070700_100270871 Ga0070700_1002708712 328
248 3300005458 Ga0070681_10018041 Ga0070681_100180415 328
249 3300005471 Ga0070698_100029606 Ga0070698_1000296064 328
250 3300005530 Ga0070679_100043671 Ga0070679_1000436712 328
251 3300005544 Ga0070686_100006706 Ga0070686_1000067063 328
252 3300005577 Ga0068857_100019781 Ga0068857_1000197813 328
253 3300005618 Ga0068864_100013022 Ga0068864_1000130223 328
254 3300005618 Ga0068864_100044522 Ga0068864_1000445222 328
255 3300005719 Ga0068861_100017794 Ga0068861_1000177944 328
256 3300005841 Ga0068863_100114747 Ga0068863_1001147473 328
257 3300005842 Ga0068858_100080622 Ga0068858_1000806222 328
258 3300005842 Ga0068858_100126380 Ga0068858_1001263803 328
259 3300005843 Ga0068860_100015154 Ga0068860_1000151544 328
260 3300005843 Ga0068860_100395056 Ga0068860_1003950562 328
261 3300005937 Ga0081455_10002830 Ga0081455_1000283016 328
262 3300006237 Ga0097621_100064092 Ga0097621_1000640923 328
263 3300006846 Ga0075430_100061087 Ga0075430_1000610872 328
264 3300009093 Ga0105240_10398596 Ga0105240_103985962 328
265 3300009098 Ga0105245_10018544 Ga0105245_100185445 328
266 3300009177 Ga0105248_10169907 Ga0105248_101699072 328
267 3300009177 Ga0105248_10196339 Ga0105248_101963392 328
268 3300009177 Ga0105248_10210892 Ga0105248_102108922 328
269 3300009545 Ga0105237_10146244 Ga0105237_101462442 328
270 3300009551 Ga0105238_10136709 Ga0105238_101367092 328
271 3300009551 Ga0105238_10496342 Ga0105238_104963422 328
272 3300010375 Ga0105239_10122351 Ga0105239_101223512 328
273 3300013306 Ga0163162_10029974 Ga0163162_100299745 328
274 3300013306 Ga0163162_10300956 Ga0163162_103009562 328
275 3300013307 Ga0157372_10063316 Ga0157372_100633163 328
276 3300013308 Ga0157375_10010290 Ga0157375_100102903 328
277 3300014325 Ga0163163_10000581 Ga0163163_1000058110 328
278 3300014325 Ga0163163_10007008 Ga0163163_100070087 328
279 3300014968 Ga0157379_10032827 Ga0157379_100328272 328
280 3300014969 Ga0157376_10082537 Ga0157376_100825372 328
281 3300025903 Ga0207680_10058821 Ga0207680_100588212 328
282 3300025909 Ga0207705_10092388 Ga0207705_100923882 328
283 3300025912 Ga0207707_10026761 Ga0207707_100267614 328
284 3300025913 Ga0207695_10271372 Ga0207695_102713722 328
285 3300025919 Ga0207657_10001958 Ga0207657_1000195819 328
286 3300025921 Ga0207652_10124083 Ga0207652_101240832 328
287 3300025921 Ga0207652_10179960 Ga0207652_101799602 328
288 3300025924 Ga0207694_10122990 Ga0207694_101229902 328
289 3300025927 Ga0207687_10051594 Ga0207687_100515942 328
290 3300025936 Ga0207670_10006499 Ga0207670_100064993 328
291 3300025941 Ga0207711_10108679 Ga0207711_101086792 328
292 3300025941 Ga0207711_10368373 Ga0207711_103683732 328
293 3300025942 Ga0207689_10247593 Ga0207689_102475931 328
294 3300025949 Ga0207667_10017868 Ga0207667_100178686 328
295 3300025986 Ga0207658_10120070 Ga0207658_101200702 328
296 3300026035 Ga0207703_10110285 Ga0207703_101102852 328
297 3300026035 Ga0207703_10247097 Ga0207703_102470972 328
298 3300026041 Ga0207639_10434845 Ga0207639_104348451 328
299 3300026075 Ga0207708_10311928 Ga0207708_103119281 328
300 3300026088 Ga0207641_10116855 Ga0207641_101168552 328
301 3300026095 Ga0207676_10012644 Ga0207676_100126441 328
302 3300026095 Ga0207676_10015397 Ga0207676_100153972 328
303 3300026116 Ga0207674_10024871 Ga0207674_100248713 328
304 3300026118 Ga0207675_100004168 Ga0207675_1000041689 328
305 3300026142 Ga0207698_10192223 Ga0207698_101922232 328
306 3300028381 Ga0268264_10066388 Ga0268264_100663882 328
307 3300028381 Ga0268264_10453998 Ga0268264_104539981 328
308 3300028666 Ga0265336_10000372 Ga0265336_1000037220 328
309 3300028794 Ga0307515_10043062 Ga0307515_100430627 328
310 3300028800 Ga0265338_10006215 Ga0265338_100062156 328
311 3300028800 Ga0265338_10103246 Ga0265338_101032461 328
312 3300028800 Ga0265338_10199449 Ga0265338_101994492 328
313 3300029957 Ga0265324_10000002 Ga0265324_10000002224 328
314 3300031238 Ga0265332_10082350 Ga0265332_100823502 328
315 3300031241 Ga0265325_10001332 Ga0265325_1000133211 328
316 3300031241 Ga0265325_10134006 Ga0265325_101340061 328
317 3300031250 Ga0265331_10013992 Ga0265331_100139926 328
318 3300031250 Ga0265331_10019773 Ga0265331_100197732 328
319 3300031251 Ga0265327_10001422 Ga0265327_1000142235 328
320 3300036401 Ga0373937_0331100 Ga0373937_0331100_321_1325 328
321 3300039145 Ga0237816_00009 Ga0237816_00009_11212_12234 328
322 3300039447 Ga0436361_1088302 Ga0436361_1088302_10309_11310 328
323 3300044656 Ga0466969_0031267 Ga0466969_0031267_1105_2112 328
324 3300044712 Ga0453684_0031025 Ga0453684_0031025_1975_2994 328
325 3300044712 Ga0453684_0062444 Ga0453684_0062444_1507_2523 328
326 3300044712 Ga0453684_0117173 Ga0453684_0117173_334_1338 328
327 3300045049 Ga0466959_0071909 Ga0466959_0071909_1337_2344 328
328 3300049571 Ga0501034_0132433 Ga0501034_0132433_588_1589 328
329 3300049576 Ga0501040_0159206 Ga0501040_0159206_470_1477 328
330 3300049577 Ga0501041_0092447 Ga0501041_0092447_17_1018 328
331 3300049587 Ga0501071_0126805 Ga0501071_0126805_26_1033 328
332 3300049588 Ga0501072_0049582 Ga0501072_0049582_1422_2429 328
333 3300049588 Ga0501072_0279960 Ga0501072_0279960_54_1061 328
334 3300049592 Ga0501076_0097775 Ga0501076_0097775_961_1962 328
335 3300053087 Ga0500643_000017 Ga0500643_000017_282312_283313 328
336 3300053090 Ga0500646_0040156 Ga0500646_0040156_157_1158 328
337 3300053116 Ga0500592_007244 Ga0500592_007244_355_1356 328
338 3300053139 Ga0500568_0015780 Ga0500568_0015780_1376_2377 328
339 3300054114 Ga0501084_0152476 Ga0501084_0152476_402_1415 328
340 3300060353 Ga0501082_0021283 Ga0501082_0021283_3786_4799 328
341 iso_pu_bacteria 2788500588 2791215019 328
342 iso_pu_bacteria 2818991451 2819629403 328
343 iso_pu_bacteria 2891633521 2891633832 328
344 iso_pu_bacteria 2904606771 2904610201 328
345 iso_pu_bacteria 2928510474 2928511194 328
346 3300003316 rootH1_10007030 rootH1_100070303 329
347 3300003320 rootH2_10004548 rootH2_1000454824 329
348 3300005334 Ga0068869_100037247 Ga0068869_1000372472 329
349 3300005336 Ga0070680_100029862 Ga0070680_1000298623 329
350 3300005345 Ga0070692_10021798 Ga0070692_100217981 329
351 3300005439 Ga0070711_100210045 Ga0070711_1002100452 329
352 3300005440 Ga0070705_100000065 Ga0070705_10000006525 329
353 3300005441 Ga0070700_100002159 Ga0070700_1000021592 329
354 3300005444 Ga0070694_100040652 Ga0070694_1000406523 329
355 3300005445 Ga0070708_100008257 Ga0070708_1000082576 329
356 3300005455 Ga0070663_100044090 Ga0070663_1000440903 329
357 3300005457 Ga0070662_100040713 Ga0070662_1000407133 329
358 3300005458 Ga0070681_10027325 Ga0070681_100273254 329
359 3300005467 Ga0070706_100166218 Ga0070706_1001662181 329
360 3300005471 Ga0070698_100002008 Ga0070698_1000020082 329
361 3300005518 Ga0070699_100000803 Ga0070699_10000080326 329
362 3300005518 Ga0070699_100001531 Ga0070699_1000015313 329
363 3300005530 Ga0070679_100124029 Ga0070679_1001240292 329
364 3300005536 Ga0070697_100083886 Ga0070697_1000838862 329
365 3300005545 Ga0070695_100003473 Ga0070695_1000034735 329
366 3300005546 Ga0070696_100000981 Ga0070696_10000098110 329
367 3300005547 Ga0070693_100047938 Ga0070693_1000479382 329
368 3300005549 Ga0070704_100000957 Ga0070704_10000095710 329
369 3300005577 Ga0068857_100011381 Ga0068857_1000113814 329
370 3300005615 Ga0070702_100089649 Ga0070702_1000896491 329
371 3300005617 Ga0068859_100006156 Ga0068859_1000061569 329
372 3300005618 Ga0068864_100142154 Ga0068864_1001421542 329
373 3300005842 Ga0068858_100289504 Ga0068858_1002895042 329
374 3300005843 Ga0068860_100001588 Ga0068860_1000015884 329
375 3300005843 Ga0068860_100031216 Ga0068860_1000312164 329
376 3300005844 Ga0068862_100001016 Ga0068862_10000101624 329
377 3300006051 Ga0075364_10092593 Ga0075364_100925932 329
378 3300006195 Ga0075366_10002866 Ga0075366_100028664 329
379 3300006353 Ga0075370_10015223 Ga0075370_100152232 329
380 3300006847 Ga0075431_100005884 Ga0075431_1000058843 329
381 3300006852 Ga0075433_10000078 Ga0075433_100000787 329
382 3300006871 Ga0075434_100000130 Ga0075434_10000013024 329
383 3300006880 Ga0075429_100015699 Ga0075429_1000156995 329
384 3300006931 Ga0097620_100006156 Ga0097620_1000061569 329
385 3300007076 Ga0075435_100011495 Ga0075435_1000114952 329
386 3300009094 Ga0111539_10112515 Ga0111539_101125152 329
387 3300025304 Ga0209257_1000560 Ga0209257_100056030 329
388 3300025885 Ga0207653_10001196 Ga0207653_100011965 329
389 3300025910 Ga0207684_10071796 Ga0207684_100717963 329
390 3300025912 Ga0207707_10021578 Ga0207707_100215783 329
391 3300025917 Ga0207660_10013268 Ga0207660_100132682 329
392 3300025921 Ga0207652_10187832 Ga0207652_101878322 329
393 3300025933 Ga0207706_10055217 Ga0207706_100552173 329
394 3300025942 Ga0207689_10063711 Ga0207689_100637113 329
395 3300025945 Ga0207679_10009673 Ga0207679_100096736 329
396 3300025961 Ga0207712_10008312 Ga0207712_100083123 329
397 3300026067 Ga0207678_10016427 Ga0207678_100164275 329
398 3300026075 Ga0207708_10016719 Ga0207708_100167192 329
399 3300026095 Ga0207676_10108431 Ga0207676_101084312 329
400 3300026116 Ga0207674_10001364 Ga0207674_1000136420 329
401 3300027907 Ga0207428_10083819 Ga0207428_100838192 329
402 3300028380 Ga0268265_10003611 Ga0268265_100036113 329
403 3300028381 Ga0268264_10001894 Ga0268264_1000189410 329
404 3300028381 Ga0268264_10014526 Ga0268264_100145264 329
405 3300031239 Ga0265328_10001458 Ga0265328_1000145812 329
406 3300031250 Ga0265331_10005681 Ga0265331_100056816 329
407 3300031250 Ga0265331_10077121 Ga0265331_100771212 329
408 3300031251 Ga0265327_10000213 Ga0265327_1000021362 329
409 3300031251 Ga0265327_10007133 Ga0265327_100071336 329
410 3300031456 Ga0307513_10018254 Ga0307513_100182544 329
411 3300031852 Ga0307410_10288594 Ga0307410_102885942 329
412 3300033180 Ga0307510_10000812 Ga0307510_1000081226 329
413 3300035691 Ga0373931_0100224 Ga0373931_0100224_313_1320 329
414 3300035695 Ga0373927_0154282 Ga0373927_0154282_469_1476 329
415 3300041413 Ga0439465_0005927 Ga0439465_0005927_1762_2784 329
416 3300041413 Ga0439465_0013218 Ga0439465_0013218_728_1762 329
417 3300041460 Ga0451802_0170293 Ga0451802_0170293_1785_2807 329
418 3300041486 Ga0451807_1837847 Ga0451807_1837847_132_1154 329
419 3300041486 Ga0451807_2577330 Ga0451807_2577330_416_1438 329
420 3300041494 Ga0451837_1564041 Ga0451837_1564041_430_1452 329
421 3300042004 Ga0439445_0006065 Ga0439445_0006065_682_1704 329
422 3300042007 Ga0439449_0000114 Ga0439449_0000114_22304_23338 329
423 3300042007 Ga0439449_0003134 Ga0439449_0003134_585_1607 329
424 3300044683 Ga0466965_0045036 Ga0466965_0045036_764_1768 329
425 3300046462 Ga0495651_0008790 Ga0495651_0008790_6369_7385 329
426 3300046511 Ga0495608_0053871 Ga0495608_0053871_1275_2291 329
427 3300046514 Ga0495618_0038290 Ga0495618_0038290_219_1226 329
428 3300046516 Ga0495628_0000851 Ga0495628_0000851_3023_4039 329
429 3300046525 Ga0495663_0000771 Ga0495663_0000771_4190_5212 329
430 3300046529 Ga0495652_0022954 Ga0495652_0022954_116_1132 329
431 3300046679 Ga0495623_0003893 Ga0495623_0003893_1307_2323 329
432 3300046692 Ga0495671_0023334 Ga0495671_0023334_835_1857 329
433 3300048088 Ga0495602_0053021 Ga0495602_0053021_926_1942 329
434 3300048925 Ga0496122_0015448 Ga0496122_0015448_3067_4089 329
435 3300049568 Ga0501031_0015028 Ga0501031_0015028_2654_3655 329
436 3300049568 Ga0501031_0237182 Ga0501031_0237182_121_1158 329
437 3300049569 Ga0501032_0000570 Ga0501032_0000570_22435_23436 329
438 3300049569 Ga0501032_0199742 Ga0501032_0199742_109_1116 329
439 3300049570 Ga0501033_0001988 Ga0501033_0001988_3927_4928 329
440 3300049572 Ga0501036_0153587 Ga0501036_0153587_494_1495 329
441 3300049573 Ga0501037_0003745 Ga0501037_0003745_9118_10119 329
442 3300049574 Ga0501038_0000379 Ga0501038_0000379_30111_31112 329
443 3300049575 Ga0501039_0008947 Ga0501039_0008947_3404_4405 329
444 3300049577 Ga0501041_0016666 Ga0501041_0016666_2253_3290 329
445 3300049578 Ga0501042_0023337 Ga0501042_0023337_1433_2434 329
446 3300049578 Ga0501042_0034928 Ga0501042_0034928_1658_2695 329
447 3300049580 Ga0501046_0025272 Ga0501046_0025272_2001_3008 329
448 3300049580 Ga0501046_0235228 Ga0501046_0235228_205_1206 329
449 3300049582 Ga0501048_0095559 Ga0501048_0095559_800_1837 329
450 3300049584 Ga0501068_0000124 Ga0501068_0000124_21255_22262 329
451 3300049584 Ga0501068_0067320 Ga0501068_0067320_844_1845 329
452 3300049588 Ga0501072_0104811 Ga0501072_0104811_1144_2181 329
453 3300049589 Ga0501073_0000399 Ga0501073_0000399_14639_15646 329
454 3300049590 Ga0501074_0078476 Ga0501074_0078476_69_1112 329
455 3300049591 Ga0501075_0017516 Ga0501075_0017516_3303_4340 329
456 3300049593 Ga0501077_0009846 Ga0501077_0009846_2357_3394 329
457 3300049741 Ga0501079_0027691 Ga0501079_0027691_1391_2428 329
458 3300049741 Ga0501079_0122552 Ga0501079_0122552_292_1299 329
459 3300049742 Ga0501080_0000192 Ga0501080_0000192_21687_22694 329
460 3300049743 Ga0501081_0043527 Ga0501081_0043527_1329_2366 329
461 3300049822 Ga0501035_0006345 Ga0501035_0006345_5015_6016 329
462 3300049823 Ga0501044_0033679 Ga0501044_0033679_3927_4928 329
463 3300049824 Ga0501045_0084137 Ga0501045_0084137_752_1789 329
464 3300050493 nmdc:mga0k408_5851_c1 nmdc:mga0k408_5851_c1_3700_4722 329
465 3300050507 nmdc:mga05p37_109305_c1 nmdc:mga05p37_109305_c1_1577_2599 329
466 3300050510 nmdc:mga06r32_514283_c1 nmdc:mga06r32_514283_c1_26_1048 329
467 3300050512 nmdc:mga0n895_7001_c1 nmdc:mga0n895_7001_c1_1387_2397 329
468 3300050513 nmdc:mga0rr50_49618_c1 nmdc:mga0rr50_49618_c1_1280_2290 329
469 3300050515 nmdc:mga0a205_3811_c1 nmdc:mga0a205_3811_c1_8865_9875 329
470 3300053096 Ga0500641_0009333 Ga0500641_0009333_2052_3053 329
471 3300053131 Ga0500652_057116 Ga0500652_057116_249_1274 329
472 3300054114 Ga0501084_0046081 Ga0501084_0046081_2386_3423 329
473 3300059423 Ga0590074_002183 Ga0590074_002183_737_1774 329
474 3300060353 Ga0501082_0055186 Ga0501082_0055186_878_1879 329
475 3300060353 Ga0501082_0058495 Ga0501082_0058495_1972_2979 329
476 3300061734 Ga0530510_0076303 Ga0530510_0076303_496_1533 329
477 iso_pu_bacteria 2842780639 2842781603 329
478 iso_pu_bacteria 2956897341 2956899594 329
479 3300005328 Ga0070676_10097891 Ga0070676_100978912 330
480 3300005334 Ga0068869_100041914 Ga0068869_1000419143 330
481 3300005334 Ga0068869_100113601 Ga0068869_1001136012 330
482 3300005347 Ga0070668_100053228 Ga0070668_1000532282 330
483 3300005354 Ga0070675_100028893 Ga0070675_1000288934 330
484 3300005367 Ga0070667_100048507 Ga0070667_1000485072 330
485 3300005436 Ga0070713_100068985 Ga0070713_1000689852 330
486 3300005439 Ga0070711_100115817 Ga0070711_1001158171 330
487 3300005468 Ga0070707_100122433 Ga0070707_1001224332 330
488 3300005535 Ga0070684_100290072 Ga0070684_1002900722 330
489 3300005549 Ga0070704_100018232 Ga0070704_1000182323 330
490 3300005577 Ga0068857_100007394 Ga0068857_1000073942 330
491 3300005617 Ga0068859_100150486 Ga0068859_1001504863 330
492 3300005618 Ga0068864_100068615 Ga0068864_1000686152 330
493 3300005719 Ga0068861_100098578 Ga0068861_1000985783 330
494 3300006042 Ga0075368_10025721 Ga0075368_100257212 330
495 3300006048 Ga0075363_100034561 Ga0075363_1000345613 330
496 3300006051 Ga0075364_10054272 Ga0075364_100542722 330
497 3300006178 Ga0075367_10003740 Ga0075367_100037407 330
498 3300006178 Ga0075367_10042665 Ga0075367_100426652 330
499 3300006186 Ga0075369_10016368 Ga0075369_100163682 330
500 3300006195 Ga0075366_10014707 Ga0075366_100147073 330
501 3300006353 Ga0075370_10001660 Ga0075370_100016603 330
502 3300006353 Ga0075370_10008951 Ga0075370_100089512 330
503 3300006353 Ga0075370_10020532 Ga0075370_100205324 330
504 3300006881 Ga0068865_100102141 Ga0068865_1001021412 330
505 3300006931 Ga0097620_100150477 Ga0097620_1001504773 330
506 3300009094 Ga0111539_10003393 Ga0111539_1000339315 330
507 3300009177 Ga0105248_10041536 Ga0105248_100415364 330
508 3300009177 Ga0105248_10247795 Ga0105248_102477952 330
509 3300009545 Ga0105237_10011239 Ga0105237_100112393 330
510 3300009545 Ga0105237_10036944 Ga0105237_100369443 330
511 3300010375 Ga0105239_10284092 Ga0105239_102840922 330
512 3300013308 Ga0157375_10026843 Ga0157375_100268432 330
513 3300014326 Ga0157380_10007283 Ga0157380_100072834 330
514 3300014745 Ga0157377_10027772 Ga0157377_100277722 330
515 3300025914 Ga0207671_10103513 Ga0207671_101035132 330
516 3300025916 Ga0207663_10241074 Ga0207663_102410742 330
517 3300025926 Ga0207659_10048124 Ga0207659_100481243 330
518 3300025928 Ga0207700_10063551 Ga0207700_100635512 330
519 3300025937 Ga0207669_10040969 Ga0207669_100409693 330
520 3300025941 Ga0207711_10022130 Ga0207711_100221304 330
521 3300025941 Ga0207711_10308941 Ga0207711_103089411 330
522 3300025942 Ga0207689_10041045 Ga0207689_100410452 330
523 3300025942 Ga0207689_10068338 Ga0207689_100683382 330
524 3300025944 Ga0207661_10004129 Ga0207661_1000412912 330
525 3300026041 Ga0207639_10056189 Ga0207639_100561892 330
526 3300026067 Ga0207678_10062952 Ga0207678_100629521 330
527 3300026089 Ga0207648_10116656 Ga0207648_101166562 330
528 3300026089 Ga0207648_10162729 Ga0207648_101627291 330
529 3300026095 Ga0207676_10123478 Ga0207676_101234782 330
530 3300026116 Ga0207674_10016409 Ga0207674_100164095 330
531 3300026116 Ga0207674_10174327 Ga0207674_101743272 330
532 3300026118 Ga0207675_100122486 Ga0207675_1001224862 330
533 3300028380 Ga0268265_10065770 Ga0268265_100657702 330
534 3300028794 Ga0307515_10022552 Ga0307515_100225523 330
535 3300028794 Ga0307515_10137256 Ga0307515_101372561 330
536 3300028800 Ga0265338_10049198 Ga0265338_100491983 330
537 3300031507 Ga0307509_10003789 Ga0307509_100037892 330
538 3300031548 Ga0307408_100130882 Ga0307408_1001308822 330
539 3300031595 Ga0265313_10007576 Ga0265313_100075765 330
540 3300031616 Ga0307508_10005039 Ga0307508_100050397 330
541 3300031852 Ga0307410_10136222 Ga0307410_101362222 330
542 3300031995 Ga0307409_100049227 Ga0307409_1000492272 330
543 3300032002 Ga0307416_100463005 Ga0307416_1004630051 330
544 3300036401 Ga0373937_0128660 Ga0373937_0128660_1324_2337 330
545 3300037471 Ga0395905_0019247 Ga0395905_0019247_997_2007 330
546 3300041410 Ga0439461_0000411 Ga0439461_0000411_5119_6132 330
547 3300042134 Ga0450898_000329 Ga0450898_000329_3404_4417 330
548 3300042156 Ga0439446_0000379 Ga0439446_0000379_5040_6053 330
549 3300042435 Ga0439434_0001027 Ga0439434_0001027_4306_5319 330
550 3300042876 Ga0451577_0011223 Ga0451577_0011223_4407_5417 330
551 3300044658 Ga0466972_0016607 Ga0466972_0016607_329_1381 330
552 3300044712 Ga0453684_0002254 Ga0453684_0002254_8606_9622 330
553 3300046512 Ga0495610_0032043 Ga0495610_0032043_1161_2198 330
554 3300046524 Ga0495648_0081810 Ga0495648_0081810_19_1047 330
555 3300046542 Ga0495597_0004870 Ga0495597_0004870_1554_2582 330
556 3300046660 Ga0495625_0008867 Ga0495625_0008867_1111_2139 330
557 3300046810 Ga0495660_0050459 Ga0495660_0050459_478_1506 330
558 3300047443 Ga0495687_000128 Ga0495687_000128_34344_35372 330
559 3300047443 Ga0495687_036927 Ga0495687_036927_437_1465 330
560 3300048905 Ga0496102_0264693 Ga0496102_0264693_539_1546 330
561 3300048905 Ga0496102_0386208 Ga0496102_0386208_228_1235 330
562 3300048909 Ga0496106_0316904 Ga0496106_0316904_161_1168 330
563 3300048912 Ga0496109_0499624 Ga0496109_0499624_75_1082 330
564 3300049571 Ga0501034_0180034 Ga0501034_0180034_343_1356 330
565 3300049572 Ga0501036_0047782 Ga0501036_0047782_1902_2915 330
566 3300049573 Ga0501037_0040775 Ga0501037_0040775_68_1081 330
567 3300049574 Ga0501038_0024509 Ga0501038_0024509_3629_4651 330
568 3300049575 Ga0501039_0007955 Ga0501039_0007955_3060_4073 330
569 3300049577 Ga0501041_0136466 Ga0501041_0136466_380_1393 330
570 3300049582 Ga0501048_0036307 Ga0501048_0036307_1037_2050 330
571 3300049584 Ga0501068_0042477 Ga0501068_0042477_1399_2409 330
572 3300049585 Ga0501069_0059431 Ga0501069_0059431_432_1454 330
573 3300049587 Ga0501071_0004121 Ga0501071_0004121_4328_5350 330
574 3300049587 Ga0501071_0264268 Ga0501071_0264268_17_1030 330
575 3300049591 Ga0501075_0008262 Ga0501075_0008262_5589_6602 330
576 3300049592 Ga0501076_0007140 Ga0501076_0007140_3755_4768 330
577 3300049822 Ga0501035_0017905 Ga0501035_0017905_4507_5520 330
578 3300049824 Ga0501045_0006548 Ga0501045_0006548_454_1467 330
579 3300050489 nmdc:mga03683_41656_c1 nmdc:mga03683_41656_c1_31_1059 330
580 3300050490 nmdc:mga03n38_39630_c1 nmdc:mga03n38_39630_c1_163_1191 330
581 3300050491 nmdc:mga00v17_92398_c1 nmdc:mga00v17_92398_c1_746_1774 330
582 3300050493 nmdc:mga0k408_167724_c1 nmdc:mga0k408_167724_c1_169_1197 330
583 3300050493 nmdc:mga0k408_4311_c1 nmdc:mga0k408_4311_c1_5655_6683 330
584 3300050494 nmdc:mga06z11_1038_c1 nmdc:mga06z11_1038_c1_4135_5163 330
585 3300050496 nmdc:mga07m45_1267_c1 nmdc:mga07m45_1267_c1_2949_3977 330
586 3300050496 nmdc:mga07m45_4022_c1 nmdc:mga07m45_4022_c1_5891_6919 330
587 3300050496 nmdc:mga07m45_42962_c1 nmdc:mga07m45_42962_c1_654_1664 330
588 3300050516 nmdc:mga0sz30_24059_c1 nmdc:mga0sz30_24059_c1_842_1870 330
589 3300061734 Ga0530510_0014407 Ga0530510_0014407_738_1751 330
590 iso_pu_bacteria 2643221598 2644000900 330
591 3300005328 Ga0070676_10003998 Ga0070676_100039981 331
592 3300005334 Ga0068869_100001485 Ga0068869_1000014852 331
593 3300005334 Ga0068869_100009525 Ga0068869_1000095258 331
594 3300005335 Ga0070666_10006668 Ga0070666_100066687 331
595 3300005335 Ga0070666_10163935 Ga0070666_101639351 331
596 3300005341 Ga0070691_10028007 Ga0070691_100280072 331
597 3300005343 Ga0070687_100043197 Ga0070687_1000431972 331
598 3300005347 Ga0070668_100206850 Ga0070668_1002068502 331
599 3300005353 Ga0070669_100126745 Ga0070669_1001267452 331
600 3300005356 Ga0070674_100000049 Ga0070674_10000004939 331
601 3300005364 Ga0070673_100039090 Ga0070673_1000390901 331
602 3300005406 Ga0070703_10033864 Ga0070703_100338642 331
603 3300005439 Ga0070711_100090528 Ga0070711_1000905282 331
604 3300005440 Ga0070705_100044656 Ga0070705_1000446562 331
605 3300005441 Ga0070700_100201460 Ga0070700_1002014602 331
606 3300005444 Ga0070694_100009816 Ga0070694_1000098162 331
607 3300005445 Ga0070708_100123798 Ga0070708_1001237982 331
608 3300005456 Ga0070678_100008603 Ga0070678_1000086036 331
609 3300005457 Ga0070662_100004587 Ga0070662_1000045876 331
610 3300005458 Ga0070681_10002709 Ga0070681_1000270913 331
611 3300005459 Ga0068867_100006283 Ga0068867_1000062835 331
612 3300005518 Ga0070699_100005205 Ga0070699_1000052059 331
613 3300005539 Ga0068853_100011725 Ga0068853_1000117254 331
614 3300005539 Ga0068853_100198983 Ga0068853_1001989832 331
615 3300005545 Ga0070695_100056401 Ga0070695_1000564012 331
616 3300005546 Ga0070696_100000412 Ga0070696_10000041211 331
617 3300005547 Ga0070693_100016515 Ga0070693_1000165152 331
618 3300005578 Ga0068854_100053051 Ga0068854_1000530512 331
619 3300005615 Ga0070702_100037409 Ga0070702_1000374092 331
620 3300005615 Ga0070702_100285962 Ga0070702_1002859621 331
621 3300005617 Ga0068859_100011622 Ga0068859_1000116226 331
622 3300005618 Ga0068864_100025299 Ga0068864_1000252996 331
623 3300005718 Ga0068866_10003908 Ga0068866_100039082 331
624 3300005718 Ga0068866_10208879 Ga0068866_102088791 331
625 3300005719 Ga0068861_100026742 Ga0068861_1000267423 331
626 3300005841 Ga0068863_100033116 Ga0068863_1000331166 331
627 3300005842 Ga0068858_100002931 Ga0068858_1000029313 331
628 3300005842 Ga0068858_100024942 Ga0068858_1000249423 331
629 3300005843 Ga0068860_100009081 Ga0068860_1000090818 331
630 3300005843 Ga0068860_100097791 Ga0068860_1000977914 331
631 3300005843 Ga0068860_100130891 Ga0068860_1001308913 331
632 3300005844 Ga0068862_100076430 Ga0068862_1000764301 331
633 3300005844 Ga0068862_100113456 Ga0068862_1001134562 331
634 3300006028 Ga0070717_10009163 Ga0070717_100091637 331
635 3300006028 Ga0070717_10217440 Ga0070717_102174402 331
636 3300006173 Ga0070716_100088649 Ga0070716_1000886492 331
637 3300006195 Ga0075366_10012577 Ga0075366_100125771 331
638 3300006237 Ga0097621_100019503 Ga0097621_1000195036 331
639 3300006358 Ga0068871_100048995 Ga0068871_1000489954 331
640 3300006844 Ga0075428_100007776 Ga0075428_1000077762 331
641 3300006852 Ga0075433_10006861 Ga0075433_100068612 331
642 3300006881 Ga0068865_100073173 Ga0068865_1000731733 331
643 3300006931 Ga0097620_100011622 Ga0097620_1000116226 331
644 3300009094 Ga0111539_10006671 Ga0111539_1000667110 331
645 3300009098 Ga0105245_10278068 Ga0105245_102780682 331
646 3300009147 Ga0114129_10336721 Ga0114129_103367212 331
647 3300009148 Ga0105243_10321757 Ga0105243_103217572 331
648 3300009174 Ga0105241_10026457 Ga0105241_100264573 331
649 3300009176 Ga0105242_10075375 Ga0105242_100753753 331
650 3300009177 Ga0105248_10020136 Ga0105248_100201366 331
651 3300009177 Ga0105248_10037641 Ga0105248_100376414 331
652 3300009545 Ga0105237_10008329 Ga0105237_1000832911 331
653 3300009553 Ga0105249_10412968 Ga0105249_104129682 331
654 3300010375 Ga0105239_10128972 Ga0105239_101289723 331
655 3300013100 Ga0157373_10273232 Ga0157373_102732322 331
656 3300013296 Ga0157374_10193516 Ga0157374_101935162 331
657 3300013296 Ga0157374_10250864 Ga0157374_102508642 331
658 3300013297 Ga0157378_10005236 Ga0157378_100052367 331
659 3300013306 Ga0163162_10325480 Ga0163162_103254801 331
660 3300013306 Ga0163162_10368096 Ga0163162_103680962 331
661 3300013308 Ga0157375_10017502 Ga0157375_100175025 331
662 3300013308 Ga0157375_10126201 Ga0157375_101262012 331
663 3300014325 Ga0163163_10677781 Ga0163163_106777811 331
664 3300014968 Ga0157379_10026614 Ga0157379_100266145 331
665 3300014968 Ga0157379_10087963 Ga0157379_100879632 331
666 3300025903 Ga0207680_10124987 Ga0207680_101249872 331
667 3300025904 Ga0207647_10011665 Ga0207647_100116653 331
668 3300025907 Ga0207645_10003656 Ga0207645_100036567 331
669 3300025911 Ga0207654_10007746 Ga0207654_100077462 331
670 3300025912 Ga0207707_10025434 Ga0207707_100254343 331
671 3300025913 Ga0207695_10010977 Ga0207695_1001097710 331
672 3300025916 Ga0207663_10109420 Ga0207663_101094202 331
673 3300025918 Ga0207662_10162500 Ga0207662_101625002 331
674 3300025923 Ga0207681_10131952 Ga0207681_101319522 331
675 3300025933 Ga0207706_10000233 Ga0207706_100002334 331
676 3300025934 Ga0207686_10000534 Ga0207686_1000053414 331
677 3300025935 Ga0207709_10003759 Ga0207709_100037591 331
678 3300025937 Ga0207669_10000325 Ga0207669_100003255 331
679 3300025937 Ga0207669_10253198 Ga0207669_102531981 331
680 3300025938 Ga0207704_10003773 Ga0207704_100037733 331
681 3300025939 Ga0207665_10111673 Ga0207665_101116732 331
682 3300025940 Ga0207691_10074339 Ga0207691_100743391 331
683 3300025940 Ga0207691_10142544 Ga0207691_101425443 331
684 3300025941 Ga0207711_10006171 Ga0207711_100061715 331
685 3300025941 Ga0207711_10049274 Ga0207711_100492743 331
686 3300025941 Ga0207711_10356329 Ga0207711_103563291 331
687 3300025942 Ga0207689_10060208 Ga0207689_100602082 331
688 3300025960 Ga0207651_10015693 Ga0207651_100156934 331
689 3300025972 Ga0207668_10354007 Ga0207668_103540071 331
690 3300025981 Ga0207640_10021357 Ga0207640_100213573 331
691 3300025986 Ga0207658_10034217 Ga0207658_100342173 331
692 3300026023 Ga0207677_10127867 Ga0207677_101278672 331
693 3300026035 Ga0207703_10011165 Ga0207703_100111653 331
694 3300026035 Ga0207703_10135803 Ga0207703_101358032 331
695 3300026041 Ga0207639_10003938 Ga0207639_100039385 331
696 3300026041 Ga0207639_10028234 Ga0207639_100282344 331
697 3300026067 Ga0207678_10098159 Ga0207678_100981592 331
698 3300026075 Ga0207708_10016956 Ga0207708_100169562 331
699 3300026088 Ga0207641_10130328 Ga0207641_101303283 331
700 3300026089 Ga0207648_10000030 Ga0207648_1000003055 331
701 3300026089 Ga0207648_10061370 Ga0207648_100613703 331
702 3300026089 Ga0207648_10202952 Ga0207648_102029522 331
703 3300026116 Ga0207674_10440253 Ga0207674_104402531 331
704 3300026118 Ga0207675_100014298 Ga0207675_1000142987 331
705 3300026118 Ga0207675_100103027 Ga0207675_1001030273 331
706 3300027907 Ga0207428_10062099 Ga0207428_100620993 331
707 3300028379 Ga0268266_10229837 Ga0268266_102298372 331
708 3300028380 Ga0268265_10510304 Ga0268265_105103041 331
709 3300028381 Ga0268264_10001871 Ga0268264_100018716 331
710 3300028381 Ga0268264_10042884 Ga0268264_100428843 331
711 3300028666 Ga0265336_10000377 Ga0265336_1000037711 331
712 3300031247 Ga0265340_10008366 Ga0265340_100083663 331
713 3300031456 Ga0307513_10109533 Ga0307513_101095332 331
714 3300031852 Ga0307410_10049197 Ga0307410_100491972 331
715 3300031995 Ga0307409_100331827 Ga0307409_1003318272 331
716 3300032002 Ga0307416_100083965 Ga0307416_1000839652 331
717 3300035113 Ga0373936_0046417 Ga0373936_0046417_401_1408 331
718 3300035695 Ga0373927_0067900 Ga0373927_0067900_999_2006 331
719 3300042876 Ga0451577_0003485 Ga0451577_0003485_264_1277 331
720 3300042876 Ga0451577_0084624 Ga0451577_0084624_581_1585 331
721 3300044712 Ga0453684_0052474 Ga0453684_0052474_4000_5013 331
722 3300044712 Ga0453684_0352830 Ga0453684_0352830_28_1044 331
723 3300045051 Ga0451576_0003603 Ga0451576_0003603_18159_19172 331
724 3300045051 Ga0451576_0005451 Ga0451576_0005451_2909_3913 331
725 3300045051 Ga0451576_0641677 Ga0451576_0641677_17_1027 331
726 3300046648 Ga0495611_0154408 Ga0495611_0154408_37_1047 331
727 3300048904 Ga0496101_0121991 Ga0496101_0121991_564_1574 331
728 3300048917 Ga0496114_0047371 Ga0496114_0047371_112_1122 331
729 3300049742 Ga0501080_0276807 Ga0501080_0276807_11_1015 331
730 3300049776 Ga0501280_002270 Ga0501280_002270_783_1790 331
731 3300050494 nmdc:mga06z11_31712_c1 nmdc:mga06z11_31712_c1_815_1846 331
732 3300050496 nmdc:mga07m45_18414_c1 nmdc:mga07m45_18414_c1_2484_3515 331
733 3300050511 nmdc:mga08y16_16754_c1 nmdc:mga08y16_16754_c1_604_1629 331
734 3300050515 nmdc:mga0a205_31976_c1 nmdc:mga0a205_31976_c1_2669_3703 331
735 iso_pu_bacteria 2643221614 2644088622 331
736 iso_pu_bacteria 2643221661 2644343857 331
737 iso_pu_bacteria 2643221666 2644368664 331
738 3300005330 Ga0070690_100000065 Ga0070690_10000006556 332
739 3300005333 Ga0070677_10026825 Ga0070677_100268252 332
740 3300005335 Ga0070666_10174800 Ga0070666_101748001 332
741 3300005337 Ga0070682_100016729 Ga0070682_1000167293 332
742 3300005340 Ga0070689_100000217 Ga0070689_10000021718 332
743 3300005343 Ga0070687_100011598 Ga0070687_1000115983 332
744 3300005353 Ga0070669_100034422 Ga0070669_1000344222 332
745 3300005354 Ga0070675_100034996 Ga0070675_1000349963 332
746 3300005354 Ga0070675_100053085 Ga0070675_1000530853 332
747 3300005356 Ga0070674_100356796 Ga0070674_1003567961 332
748 3300005364 Ga0070673_100039317 Ga0070673_1000393172 332
749 3300005364 Ga0070673_100103051 Ga0070673_1001030512 332
750 3300005365 Ga0070688_100000057 Ga0070688_1000000575 332
751 3300005441 Ga0070700_100000578 Ga0070700_1000005789 332
752 3300005456 Ga0070678_100037507 Ga0070678_1000375073 332
753 3300005456 Ga0070678_100046815 Ga0070678_1000468153 332
754 3300005459 Ga0068867_100000617 Ga0068867_10000061711 332
755 3300005466 Ga0070685_10000052 Ga0070685_1000005242 332
756 3300005543 Ga0070672_100014218 Ga0070672_1000142186 332
757 3300005544 Ga0070686_100000158 Ga0070686_10000015828 332
758 3300005617 Ga0068859_100002270 Ga0068859_1000022702 332
759 3300005719 Ga0068861_100137511 Ga0068861_1001375112 332
760 3300005719 Ga0068861_100318383 Ga0068861_1003183832 332
761 3300005937 Ga0081455_10002721 Ga0081455_1000272112 332
762 3300006237 Ga0097621_100170926 Ga0097621_1001709262 332
763 3300006852 Ga0075433_10157149 Ga0075433_101571492 332
764 3300006881 Ga0068865_100109312 Ga0068865_1001093122 332
765 3300006881 Ga0068865_100121432 Ga0068865_1001214322 332
766 3300006881 Ga0068865_100168306 Ga0068865_1001683061 332
767 3300006931 Ga0097620_100002270 Ga0097620_1000022702 332
768 3300009093 Ga0105240_10005484 Ga0105240_1000548419 332
769 3300009177 Ga0105248_10193767 Ga0105248_101937672 332
770 3300009553 Ga0105249_10250650 Ga0105249_102506502 332
771 3300011119 Ga0105246_10239436 Ga0105246_102394361 332
772 3300013306 Ga0163162_10082677 Ga0163162_100826773 332
773 3300014326 Ga0157380_10097051 Ga0157380_100970511 332
774 3300014968 Ga0157379_10206371 Ga0157379_102063711 332
775 3300025893 Ga0207682_10004901 Ga0207682_100049012 332
776 3300025918 Ga0207662_10019149 Ga0207662_100191493 332
777 3300025923 Ga0207681_10280861 Ga0207681_102808611 332
778 3300025926 Ga0207659_10049300 Ga0207659_100493002 332
779 3300025936 Ga0207670_10000099 Ga0207670_1000009944 332
780 3300025938 Ga0207704_10031077 Ga0207704_100310772 332
781 3300025940 Ga0207691_10007014 Ga0207691_100070149 332
782 3300025940 Ga0207691_10104363 Ga0207691_101043632 332
783 3300025941 Ga0207711_10001369 Ga0207711_100013696 332
784 3300025960 Ga0207651_10031921 Ga0207651_100319212 332
785 3300026075 Ga0207708_10000185 Ga0207708_1000018533 332
786 3300026075 Ga0207708_10329029 Ga0207708_103290292 332
787 3300026089 Ga0207648_10001855 Ga0207648_1000185525 332
788 3300026118 Ga0207675_100060311 Ga0207675_1000603114 332
789 3300026118 Ga0207675_100112086 Ga0207675_1001120862 332
790 3300026121 Ga0207683_10011580 Ga0207683_100115805 332
791 3300026121 Ga0207683_10036240 Ga0207683_100362403 332
792 3300028380 Ga0268265_10447114 Ga0268265_104471141 332
793 3300031090 Ga0265760_10034596 Ga0265760_100345962 332
794 3300031456 Ga0307513_10075689 Ga0307513_100756893 332
795 3300031456 Ga0307513_10116874 Ga0307513_101168742 332
796 3300031507 Ga0307509_10118278 Ga0307509_101182781 332
797 3300031995 Ga0307409_100011518 Ga0307409_1000115183 332
798 3300033180 Ga0307510_10127595 Ga0307510_101275952 332
799 3300035092 Ga0373952_0004765 Ga0373952_0004765_171_1193 332
800 3300046660 Ga0495625_0106431 Ga0495625_0106431_849_1868 332
801 3300046689 Ga0495613_0017816 Ga0495613_0017816_2825_3847 332
802 3300050511 nmdc:mga08y16_424503_c1 nmdc:mga08y16_424503_c1_130_1155 332
803 3300050511 nmdc:mga08y16_7173_c1 nmdc:mga08y16_7173_c1_7210_8238 332
804 3300050515 nmdc:mga0a205_39580_c1 nmdc:mga0a205_39580_c1_2350_3372 332
805 3300053139 Ga0500568_0022043 Ga0500568_0022043_1178_2200 332
806 3300053156 Ga0500622_0048058 Ga0500622_0048058_54_1076 332
807 iso_pu_bacteria 2883291878 2883294100 332
808 3300005347 Ga0070668_100079142 Ga0070668_1000791422 333
809 3300005355 Ga0070671_100320146 Ga0070671_1003201461 333
810 3300005356 Ga0070674_100004470 Ga0070674_1000044704 333
811 3300006237 Ga0097621_100065912 Ga0097621_1000659123 333
812 3300014969 Ga0157376_10074514 Ga0157376_100745142 333
813 3300025931 Ga0207644_10114985 Ga0207644_101149852 333
814 3300025937 Ga0207669_10073883 Ga0207669_100738832 333
815 3300031240 Ga0265320_10025177 Ga0265320_100251773 333
816 3300031711 Ga0265314_10013583 Ga0265314_100135836 333
817 3300044712 Ga0453684_0000499 Ga0453684_0000499_126602_127621 333
818 3300044712 Ga0453684_0010455 Ga0453684_0010455_3493_4590 333
819 3300044712 Ga0453684_0029755 Ga0453684_0029755_1942_2952 333
820 3300044712 Ga0453684_0049121 Ga0453684_0049121_4037_5137 333
821 3300044712 Ga0453684_0057685 Ga0453684_0057685_3629_4726 333
822 3300048904 Ga0496101_0306692 Ga0496101_0306692_41_1054 333
823 3300048907 Ga0496104_0217941 Ga0496104_0217941_112_1125 333
824 3300005337 Ga0070682_100012811 Ga0070682_1000128113 334
825 3300005339 Ga0070660_100328272 Ga0070660_1003282721 334
826 3300005440 Ga0070705_100026266 Ga0070705_1000262662 334
827 3300005444 Ga0070694_100075071 Ga0070694_1000750711 334
828 3300005455 Ga0070663_100002230 Ga0070663_10000223010 334
829 3300005458 Ga0070681_10077946 Ga0070681_100779463 334
830 3300005530 Ga0070679_100040973 Ga0070679_1000409733 334
831 3300005547 Ga0070693_100022372 Ga0070693_1000223721 334
832 3300005563 Ga0068855_100016082 Ga0068855_1000160822 334
833 3300005563 Ga0068855_100297546 Ga0068855_1002975462 334
834 3300005564 Ga0070664_100159454 Ga0070664_1001594541 334
835 3300005843 Ga0068860_100055383 Ga0068860_1000553832 334
836 3300006237 Ga0097621_100444590 Ga0097621_1004445901 334
837 3300006852 Ga0075433_10013036 Ga0075433_100130363 334
838 3300006871 Ga0075434_100003042 Ga0075434_10000304211 334
839 3300009098 Ga0105245_10188935 Ga0105245_101889352 334
840 3300009174 Ga0105241_10009701 Ga0105241_100097016 334
841 3300009551 Ga0105238_10054021 Ga0105238_100540211 334
842 3300009553 Ga0105249_10014864 Ga0105249_100148642 334
843 3300010375 Ga0105239_10003653 Ga0105239_100036532 334
844 3300013105 Ga0157369_10460023 Ga0157369_104600232 334
845 3300013297 Ga0157378_10164266 Ga0157378_101642661 334
846 3300014968 Ga0157379_10049685 Ga0157379_100496852 334
847 3300025904 Ga0207647_10056658 Ga0207647_100566583 334
848 3300025912 Ga0207707_10169231 Ga0207707_101692311 334
849 3300025913 Ga0207695_10117358 Ga0207695_101173582 334
850 3300025914 Ga0207671_10141183 Ga0207671_101411832 334
851 3300025919 Ga0207657_10053172 Ga0207657_100531723 334
852 3300025921 Ga0207652_10143489 Ga0207652_101434891 334
853 3300025942 Ga0207689_10209764 Ga0207689_102097641 334
854 3300025945 Ga0207679_10170533 Ga0207679_101705331 334
855 3300025949 Ga0207667_10004770 Ga0207667_1000477010 334
856 3300025949 Ga0207667_10024833 Ga0207667_100248333 334
857 3300025949 Ga0207667_10480544 Ga0207667_104805441 334
858 3300026041 Ga0207639_10003453 Ga0207639_100034532 334
859 3300026067 Ga0207678_10000554 Ga0207678_1000055429 334
860 3300026116 Ga0207674_10090467 Ga0207674_100904673 334
861 3300026142 Ga0207698_10234004 Ga0207698_102340041 334
862 3300028379 Ga0268266_10071019 Ga0268266_100710192 334
863 3300028381 Ga0268264_10029882 Ga0268264_100298823 334
864 3300031249 Ga0265339_10061160 Ga0265339_100611601 334
865 3300048905 Ga0496102_0083158 Ga0496102_0083158_981_2186 334
866 3300048906 Ga0496103_0009158 Ga0496103_0009158_2522_3727 334
867 3300048909 Ga0496106_0030531 Ga0496106_0030531_339_1544 334
868 3300048910 Ga0496107_0018174 Ga0496107_0018174_2922_4127 334
869 3300048918 Ga0496115_0001590 Ga0496115_0001590_822_2027 334
870 3300048925 Ga0496122_0149147 Ga0496122_0149147_142_1176 334
871 3300049571 Ga0501034_0076566 Ga0501034_0076566_988_2031 334
872 3300049580 Ga0501046_0000029 Ga0501046_0000029_112367_113398 334
873 3300049580 Ga0501046_0014910 Ga0501046_0014910_1101_2144 334
874 3300049581 Ga0501047_0000581 Ga0501047_0000581_8011_9081 334
875 3300049581 Ga0501047_0042815 Ga0501047_0042815_1091_2134 334
876 3300049582 Ga0501048_0004012 Ga0501048_0004012_8881_9915 334
877 3300049583 Ga0501067_0005591 Ga0501067_0005591_5700_6743 334
878 3300049822 Ga0501035_0006565 Ga0501035_0006565_6475_7545 334
879 3300049823 Ga0501044_0002324 Ga0501044_0002324_17346_18416 334
880 3300049823 Ga0501044_0024583 Ga0501044_0024583_4130_5146 334
881 3300050515 nmdc:mga0a205_17283_c1 nmdc:mga0a205_17283_c1_1070_2167 334
882 3300003215 JGI25153J46596_10000022 JGI25153J46596_10000022165 335
883 3300005353 Ga0070669_100017016 Ga0070669_1000170164 335
884 3300005356 Ga0070674_100003659 Ga0070674_1000036596 335
885 3300005459 Ga0068867_100100156 Ga0068867_1001001562 335
886 3300005546 Ga0070696_100011533 Ga0070696_1000115335 335
887 3300005718 Ga0068866_10010068 Ga0068866_100100684 335
888 3300005844 Ga0068862_100059416 Ga0068862_1000594164 335
889 3300006847 Ga0075431_100275661 Ga0075431_1002756612 335
890 3300009147 Ga0114129_10037842 Ga0114129_100378422 335
891 3300014326 Ga0157380_10025490 Ga0157380_100254903 335
892 3300025297 Ga0209758_1000005 Ga0209758_1000005397 335
893 3300025899 Ga0207642_10024347 Ga0207642_100243472 335
894 3300025937 Ga0207669_10008438 Ga0207669_100084386 335
895 3300026118 Ga0207675_100002563 Ga0207675_10000256311 335
896 3300028380 Ga0268265_10020306 Ga0268265_100203062 335
897 3300030522 Ga0307512_10154301 Ga0307512_101543012 335
898 3300047472 Ga0495686_0040286 Ga0495686_0040286_47_1066 335
899 3300047472 Ga0495686_0061450 Ga0495686_0061450_844_1878 335
900 3300049569 Ga0501032_0049955 Ga0501032_0049955_850_1872 335
901 3300049579 Ga0501043_0050616 Ga0501043_0050616_1360_2382 335
902 3300049581 Ga0501047_0069721 Ga0501047_0069721_798_1820 335
903 3300049584 Ga0501068_0026220 Ga0501068_0026220_1567_2589 335
904 3300049588 Ga0501072_0074917 Ga0501072_0074917_1128_2150 335
905 3300049589 Ga0501073_0054959 Ga0501073_0054959_959_1981 335
906 3300049823 Ga0501044_0001209 Ga0501044_0001209_1226_2248 335
907 3300053087 Ga0500643_031703 Ga0500643_031703_48_1067 335
908 3300053096 Ga0500641_0002110 Ga0500641_0002110_31_1050 335
909 3300053103 Ga0500555_001712 Ga0500555_001712_4778_5797 335
910 3300053130 Ga0500642_0071074 Ga0500642_0071074_400_1419 335
911 3300053156 Ga0500622_0056261 Ga0500622_0056261_632_1654 335
912 3300053731 Ga0500609_000624 Ga0500609_000624_4306_5325 335
913 3300054114 Ga0501084_0019391 Ga0501084_0019391_3484_4506 335
914 iso_pu_bacteria 2989771324 2989775432 335
915 3300028573 Ga0265334_10006414 Ga0265334_100064144 336
916 3300028577 Ga0265318_10000626 Ga0265318_100006264 336
917 3300028800 Ga0265338_10016978 Ga0265338_100169782 336
918 3300031235 Ga0265330_10045981 Ga0265330_100459812 336
919 3300031240 Ga0265320_10105439 Ga0265320_101054391 336
920 3300031595 Ga0265313_10015842 Ga0265313_100158421 336
921 3300031711 Ga0265314_10066836 Ga0265314_100668362 336
922 3300050511 nmdc:mga08y16_532432_c1 nmdc:mga08y16_532432_c1_64_1119 336
923 3300025961 Ga0207712_10129398 Ga0207712_101293982 337
924 iso_pu_bacteria 2513237146 2513929066 337
925 iso_pu_bacteria 2582581306 2585267580 337
926 iso_pu_bacteria 2582581865 2585386640 337
927 iso_pu_bacteria 2599185170 2599414721 337
928 iso_pu_bacteria 2838035591 2838039560 337
929 iso_pu_bacteria 643692032 643823030 337
930 3300002773 JGI25152J39213_1002543 JGI25152J39213_10025433 341
931 3300003187 JGI25151J46595_10032725 JGI25151J46595_100327252 341
932 3300003775 Ga0055524_1011997 Ga0055524_10119972 341
933 3300003790 Ga0055528_1001577 Ga0055528_10015774 341
934 3300003790 Ga0055528_1004369 Ga0055528_10043695 341
935 3300025258 Ga0209129_1000019 Ga0209129_100001999 341
936 3300025273 Ga0209673_1000132 Ga0209673_100013297 341
937 3300025294 Ga0209025_1001953 Ga0209025_100195320 341
938 3300025295 Ga0209564_1011311 Ga0209564_10113114 341
939 3300025297 Ga0209758_1015826 Ga0209758_10158262 341
940 3300025299 Ga0209256_1000458 Ga0209256_100045833 341
941 3300025303 Ga0209051_1028459 Ga0209051_10284592 341
942 3300048924 Ga0496121_0074864 Ga0496121_0074864_1371_2396 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

45

294

0.89

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

42

286

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9925 30 336
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9853 30 338
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.979 30 338
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9614 30 336
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9279 31 327
ID Description Score Start End Superfamily
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9793 124 335 3.40.190.10
af_P16700_16_293_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9761 25 295 3.40.50.1100
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9752 33 100 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9702 124 335 3.40.190.10
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9673 30 306 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y2MFH1-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.999 124 341 GO:0042597
GO:1901681
GO:1902358
AF-A0A3S4BHY4-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9963 137 242 GO:0042597
GO:1901681
GO:1902358
AF-A0A3B9PPJ2-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9956 119 337 GO:0042597
GO:1901681
GO:1902358
AF-A0A257JCF6-F1-model_v4 Sulfate transporter subunit 0.9951 86 291 GO:0042597
GO:1901681
GO:1902358
AF-A0A553KUG5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.995 129 291 GO:0042597
GO:1901681
GO:1902358

Feature Viewer

pLDDT pTM Quality
91.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map