F486370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 942 | 398 | 917 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0045148|Ga0501032_0045148_481_1524 |
| Length | 336 |
| Sequence | MPFTTLTRRSAIVAAFGLGISGLAGHAPSAAAKDITLVNVSYDPTRELYAAYDKAFEKYWKAKTGDDVTVKQSHGGSGKQARAVIDGLQADVVTLALAADVDALHKNGDLIKADWIKKFPDNSAPYTSTIVFLVRKGNPKGIKDWPDLVKNGVDIITPNPKTSGGARWNYLAAWGYALKQPGGNEEKAKEFVSQIYKHTKVLDSGARGSTNTFVERGIGDVLLAWENEAHLALKEFGPDKFEIVTPSVSILAEPNVAVVDKVVDKRGTRKVAEAYLNYLYSPEGQKIAAENFYAGKFAQVKTFTIDDVFGGWTKAQAKHFADGGIFDQIYTPGKNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 2 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 3 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 4 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 5 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 6 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 7 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 8 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 11 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 12 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 13 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 14 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 15 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 16 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 17 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 18 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 19 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 20 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 21 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 22 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 23 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 24 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 222 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 265 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 266 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 269 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 270 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 271 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 272 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 273 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 274 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 275 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 276 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 279 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 280 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 286 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 382 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 385 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 386 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 394 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 397 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 398 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.24 |
| Metatranscriptomes | 0.11 |
| Isolates | 2.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 0.42 |
| Rhizoplane | 2.34 |
| Rhizosphere | 85.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1002543 | 3300002773 | Bacteria | 6869 |
| 2 | JGI25151J46595_10032725 | 3300003187 | Bacteria | 2011 |
| 3 | JGI25153J46596_10000022 | 3300003215 | Bacteria | 251919 |
| 4 | rootH1_10007030 | 3300003316 | Bacteria | 3759 |
| 5 | rootH2_10004548 | 3300003320 | Bacteria | 37146 |
| 6 | Ga0055524_1011997 | 3300003775 | Bacteria | 3351 |
| 7 | Ga0055528_1001577 | 3300003790 | Bacteria | 13583 |
| 8 | Ga0055528_1004369 | 3300003790 | Bacteria | 6817 |
| 9 | Ga0055531_10000021 | 3300003794 | Bacteria | 167213 |
| 10 | Ga0065707_10004891 | 3300005295 | Bacteria | 3251 |
| 11 | Ga0070658_10046904 | 3300005327 | Bacteria | 3496 |
| 12 | Ga0070676_10003998 | 3300005328 | Bacteria | 7736 |
| 13 | Ga0070676_10097891 | 3300005328 | Bacteria | 1808 |
| 14 | Ga0070690_100000065 | 3300005330 | Bacteria | 52724 |
| 15 | Ga0070677_10026825 | 3300005333 | Bacteria | 2163 |
| 16 | Ga0068869_100001485 | 3300005334 | Bacteria | 13881 |
| 17 | Ga0068869_100009525 | 3300005334 | Bacteria | 6303 |
| 18 | Ga0068869_100037247 | 3300005334 | Bacteria | 3458 |
| 19 | Ga0068869_100041914 | 3300005334 | Bacteria | 3280 |
| 20 | Ga0068869_100113601 | 3300005334 | Bacteria | 2063 |
| 21 | Ga0070666_10006668 | 3300005335 | Bacteria | 7102 |
| 22 | Ga0070666_10011356 | 3300005335 | Bacteria | 5587 |
| 23 | Ga0070666_10163935 | 3300005335 | Bacteria | 1554 |
| 24 | Ga0070666_10174800 | 3300005335 | Bacteria | 1505 |
| 25 | Ga0070680_100029862 | 3300005336 | Bacteria | 4377 |
| 26 | Ga0070680_100030265 | 3300005336 | Bacteria | 4350 |
| 27 | Ga0070682_100012811 | 3300005337 | Bacteria | 4814 |
| 28 | Ga0070682_100016729 | 3300005337 | Bacteria | 4268 |
| 29 | Ga0070682_100056380 | 3300005337 | Bacteria | 2471 |
| 30 | Ga0070660_100328272 | 3300005339 | Bacteria | 1258 |
| 31 | Ga0070689_100000217 | 3300005340 | Bacteria | 34142 |
| 32 | Ga0070689_100027922 | 3300005340 | Bacteria | 4260 |
| 33 | Ga0070691_10028007 | 3300005341 | Bacteria | 2630 |
| 34 | Ga0070691_10183984 | 3300005341 | Bacteria | 1089 |
| 35 | Ga0070687_100011598 | 3300005343 | Bacteria | 3861 |
| 36 | Ga0070687_100043197 | 3300005343 | Bacteria | 2289 |
| 37 | Ga0070692_10021798 | 3300005345 | Bacteria | 3121 |
| 38 | Ga0070668_100053228 | 3300005347 | Bacteria | 3121 |
| 39 | Ga0070668_100079142 | 3300005347 | Bacteria | 2573 |
| 40 | Ga0070668_100206850 | 3300005347 | Bacteria | 1613 |
| 41 | Ga0070669_100017016 | 3300005353 | Bacteria | 5190 |
| 42 | Ga0070669_100029603 | 3300005353 | Bacteria | 3948 |
| 43 | Ga0070669_100030927 | 3300005353 | Bacteria | 3864 |
| 44 | Ga0070669_100034422 | 3300005353 | Bacteria | 3667 |
| 45 | Ga0070669_100126745 | 3300005353 | Bacteria | 1954 |
| 46 | Ga0070675_100028893 | 3300005354 | Bacteria | 4467 |
| 47 | Ga0070675_100034996 | 3300005354 | Bacteria | 4079 |
| 48 | Ga0070675_100053085 | 3300005354 | Bacteria | 3333 |
| 49 | Ga0070671_100162865 | 3300005355 | Bacteria | 1885 |
| 50 | Ga0070671_100320146 | 3300005355 | Bacteria | 1321 |
| 51 | Ga0070674_100000049 | 3300005356 | Bacteria | 51989 |
| 52 | Ga0070674_100003659 | 3300005356 | Bacteria | 8663 |
| 53 | Ga0070674_100004470 | 3300005356 | Bacteria | 7977 |
| 54 | Ga0070674_100024852 | 3300005356 | Bacteria | 3892 |
| 55 | Ga0070674_100356796 | 3300005356 | Bacteria | 1182 |
| 56 | Ga0070673_100039090 | 3300005364 | Bacteria | 3628 |
| 57 | Ga0070673_100039317 | 3300005364 | Bacteria | 3619 |
| 58 | Ga0070673_100103051 | 3300005364 | Bacteria | 2354 |
| 59 | Ga0070688_100000057 | 3300005365 | Bacteria | 54169 |
| 60 | Ga0070688_100079911 | 3300005365 | Bacteria | 2114 |
| 61 | Ga0070667_100001374 | 3300005367 | Bacteria | 21779 |
| 62 | Ga0070667_100048507 | 3300005367 | Bacteria | 3574 |
| 63 | Ga0070667_100191696 | 3300005367 | Bacteria | 1811 |
| 64 | Ga0070703_10033864 | 3300005406 | Bacteria | 1557 |
| 65 | Ga0070714_100015012 | 3300005435 | Bacteria | 6226 |
| 66 | Ga0070713_100068985 | 3300005436 | Bacteria | 2980 |
| 67 | Ga0070711_100090528 | 3300005439 | Bacteria | 2204 |
| 68 | Ga0070711_100115817 | 3300005439 | Bacteria | 1974 |
| 69 | Ga0070711_100210045 | 3300005439 | Bacteria | 1507 |
| 70 | Ga0070705_100000065 | 3300005440 | Bacteria | 55736 |
| 71 | Ga0070705_100026266 | 3300005440 | Bacteria | 3167 |
| 72 | Ga0070705_100044656 | 3300005440 | Bacteria | 2546 |
| 73 | Ga0070705_100107992 | 3300005440 | Bacteria | 1772 |
| 74 | Ga0070700_100000578 | 3300005441 | Bacteria | 18360 |
| 75 | Ga0070700_100002159 | 3300005441 | Bacteria | 9980 |
| 76 | Ga0070700_100201460 | 3300005441 | Bacteria | 1398 |
| 77 | Ga0070700_100270871 | 3300005441 | Bacteria | 1227 |
| 78 | Ga0070694_100009816 | 3300005444 | Bacteria | 5879 |
| 79 | Ga0070694_100040652 | 3300005444 | Bacteria | 3099 |
| 80 | Ga0070694_100075071 | 3300005444 | Bacteria | 2338 |
| 81 | Ga0070708_100008257 | 3300005445 | Bacteria | 8361 |
| 82 | Ga0070708_100116599 | 3300005445 | Bacteria | 2459 |
| 83 | Ga0070708_100123798 | 3300005445 | Bacteria | 2388 |
| 84 | Ga0070663_100002230 | 3300005455 | Bacteria | 10844 |
| 85 | Ga0070663_100044090 | 3300005455 | Bacteria | 3143 |
| 86 | Ga0070678_100008603 | 3300005456 | Bacteria | 6119 |
| 87 | Ga0070678_100037507 | 3300005456 | Bacteria | 3404 |
| 88 | Ga0070678_100046815 | 3300005456 | Bacteria | 3104 |
| 89 | Ga0070662_100004587 | 3300005457 | Bacteria | 8747 |
| 90 | Ga0070662_100040713 | 3300005457 | Bacteria | 3310 |
| 91 | Ga0070681_10002709 | 3300005458 | Bacteria | 16302 |
| 92 | Ga0070681_10018041 | 3300005458 | Bacteria | 7051 |
| 93 | Ga0070681_10027325 | 3300005458 | Bacteria | 5737 |
| 94 | Ga0070681_10077946 | 3300005458 | Bacteria | 3271 |
| 95 | Ga0068867_100000617 | 3300005459 | Bacteria | 23569 |
| 96 | Ga0068867_100006283 | 3300005459 | Bacteria | 8401 |
| 97 | Ga0068867_100100156 | 3300005459 | Bacteria | 2212 |
| 98 | Ga0070685_10000052 | 3300005466 | Bacteria | 71095 |
| 99 | Ga0070706_100004299 | 3300005467 | Bacteria | 13799 |
| 100 | Ga0070706_100008439 | 3300005467 | Bacteria | 9595 |
| 101 | Ga0070706_100166218 | 3300005467 | Bacteria | 2060 |
| 102 | Ga0070707_100077664 | 3300005468 | Bacteria | 3204 |
| 103 | Ga0070707_100122433 | 3300005468 | Bacteria | 2525 |
| 104 | Ga0070698_100002008 | 3300005471 | Bacteria | 22594 |
| 105 | Ga0070698_100029606 | 3300005471 | Bacteria | 5685 |
| 106 | Ga0070699_100000803 | 3300005518 | Bacteria | 28995 |
| 107 | Ga0070699_100001531 | 3300005518 | Bacteria | 21129 |
| 108 | Ga0070699_100005205 | 3300005518 | Bacteria | 11431 |
| 109 | Ga0070699_100094418 | 3300005518 | Bacteria | 2618 |
| 110 | Ga0070679_100040973 | 3300005530 | Bacteria | 4609 |
| 111 | Ga0070679_100043671 | 3300005530 | Bacteria | 4463 |
| 112 | Ga0070679_100124029 | 3300005530 | Bacteria | 2566 |
| 113 | Ga0070684_100290072 | 3300005535 | Bacteria | 1500 |
| 114 | Ga0070684_100308367 | 3300005535 | Bacteria | 1453 |
| 115 | Ga0070697_100083886 | 3300005536 | Bacteria | 2628 |
| 116 | Ga0068853_100011725 | 3300005539 | Bacteria | 7122 |
| 117 | Ga0068853_100198983 | 3300005539 | Bacteria | 1823 |
| 118 | Ga0070672_100014218 | 3300005543 | Bacteria | 5634 |
| 119 | Ga0070672_100279081 | 3300005543 | Bacteria | 1412 |
| 120 | Ga0070686_100000158 | 3300005544 | Bacteria | 46470 |
| 121 | Ga0070686_100006706 | 3300005544 | Bacteria | 6409 |
| 122 | Ga0070695_100003473 | 3300005545 | Bacteria | 9205 |
| 123 | Ga0070695_100056401 | 3300005545 | Bacteria | 2535 |
| 124 | Ga0070696_100000412 | 3300005546 | Bacteria | 26669 |
| 125 | Ga0070696_100000981 | 3300005546 | Bacteria | 18506 |
| 126 | Ga0070696_100011533 | 3300005546 | Bacteria | 5921 |
| 127 | Ga0070696_100048806 | 3300005546 | Bacteria | 2939 |
| 128 | Ga0070693_100016515 | 3300005547 | Bacteria | 3823 |
| 129 | Ga0070693_100022372 | 3300005547 | Bacteria | 3360 |
| 130 | Ga0070693_100047938 | 3300005547 | Bacteria | 2432 |
| 131 | Ga0070704_100000957 | 3300005549 | Bacteria | 14638 |
| 132 | Ga0070704_100018232 | 3300005549 | Bacteria | 4482 |
| 133 | Ga0070704_100181716 | 3300005549 | Bacteria | 1683 |
| 134 | Ga0068855_100003783 | 3300005563 | Bacteria | 18509 |
| 135 | Ga0068855_100016082 | 3300005563 | Bacteria | 8999 |
| 136 | Ga0068855_100297546 | 3300005563 | Bacteria | 1788 |
| 137 | Ga0068855_100579952 | 3300005563 | Bacteria | 1211 |
| 138 | Ga0070664_100159454 | 3300005564 | Bacteria | 1995 |
| 139 | Ga0068857_100007394 | 3300005577 | Bacteria | 9459 |
| 140 | Ga0068857_100011381 | 3300005577 | Bacteria | 7741 |
| 141 | Ga0068857_100019781 | 3300005577 | Bacteria | 5915 |
| 142 | Ga0068854_100053051 | 3300005578 | Bacteria | 2910 |
| 143 | Ga0070702_100037409 | 3300005615 | Bacteria | 2696 |
| 144 | Ga0070702_100089649 | 3300005615 | Bacteria | 1862 |
| 145 | Ga0070702_100285962 | 3300005615 | Bacteria | 1134 |
| 146 | Ga0068859_100002270 | 3300005617 | Bacteria | 19503 |
| 147 | Ga0068859_100006156 | 3300005617 | Bacteria | 12197 |
| 148 | Ga0068859_100011622 | 3300005617 | Bacteria | 8853 |
| 149 | Ga0068859_100024836 | 3300005617 | Bacteria | 6015 |
| 150 | Ga0068859_100150486 | 3300005617 | Bacteria | 2403 |
| 151 | Ga0068864_100013022 | 3300005618 | Bacteria | 6886 |
| 152 | Ga0068864_100019118 | 3300005618 | Bacteria | 5726 |
| 153 | Ga0068864_100025299 | 3300005618 | Bacteria | 4998 |
| 154 | Ga0068864_100038556 | 3300005618 | Bacteria | 4082 |
| 155 | Ga0068864_100044522 | 3300005618 | Bacteria | 3805 |
| 156 | Ga0068864_100068615 | 3300005618 | Bacteria | 3080 |
| 157 | Ga0068864_100142154 | 3300005618 | Bacteria | 2166 |
| 158 | Ga0068866_10003908 | 3300005718 | Bacteria | 6117 |
| 159 | Ga0068866_10010068 | 3300005718 | Bacteria | 4043 |
| 160 | Ga0068866_10208879 | 3300005718 | Bacteria | 1171 |
| 161 | Ga0068861_100017794 | 3300005719 | Bacteria | 5049 |
| 162 | Ga0068861_100026742 | 3300005719 | Bacteria | 4197 |
| 163 | Ga0068861_100058981 | 3300005719 | Bacteria | 2937 |
| 164 | Ga0068861_100098578 | 3300005719 | Bacteria | 2320 |
| 165 | Ga0068861_100137511 | 3300005719 | Bacteria | 1990 |
| 166 | Ga0068861_100318383 | 3300005719 | Bacteria | 1354 |
| 167 | Ga0068863_100033116 | 3300005841 | Bacteria | 4923 |
| 168 | Ga0068863_100047852 | 3300005841 | Bacteria | 4056 |
| 169 | Ga0068863_100053479 | 3300005841 | Bacteria | 3828 |
| 170 | Ga0068863_100114747 | 3300005841 | Bacteria | 2566 |
| 171 | Ga0068863_100145406 | 3300005841 | Bacteria | 2267 |
| 172 | Ga0068858_100002931 | 3300005842 | Bacteria | 17169 |
| 173 | Ga0068858_100024942 | 3300005842 | Bacteria | 5565 |
| 174 | Ga0068858_100033644 | 3300005842 | Bacteria | 4755 |
| 175 | Ga0068858_100080622 | 3300005842 | Bacteria | 3024 |
| 176 | Ga0068858_100126380 | 3300005842 | Bacteria | 2395 |
| 177 | Ga0068858_100289504 | 3300005842 | Bacteria | 1561 |
| 178 | Ga0068860_100001588 | 3300005843 | Bacteria | 24436 |
| 179 | Ga0068860_100009081 | 3300005843 | Bacteria | 9893 |
| 180 | Ga0068860_100015154 | 3300005843 | Bacteria | 7531 |
| 181 | Ga0068860_100031216 | 3300005843 | Bacteria | 5122 |
| 182 | Ga0068860_100055383 | 3300005843 | Bacteria | 3770 |
| 183 | Ga0068860_100097791 | 3300005843 | Bacteria | 2799 |
| 184 | Ga0068860_100130891 | 3300005843 | Bacteria | 2407 |
| 185 | Ga0068860_100395056 | 3300005843 | Bacteria | 1367 |
| 186 | Ga0068862_100001016 | 3300005844 | Bacteria | 26969 |
| 187 | Ga0068862_100020918 | 3300005844 | Bacteria | 5466 |
| 188 | Ga0068862_100045310 | 3300005844 | Bacteria | 3753 |
| 189 | Ga0068862_100059416 | 3300005844 | Bacteria | 3283 |
| 190 | Ga0068862_100076430 | 3300005844 | Bacteria | 2898 |
| 191 | Ga0068862_100113456 | 3300005844 | Bacteria | 2381 |
| 192 | Ga0081455_10002721 | 3300005937 | Bacteria | 20866 |
| 193 | Ga0081455_10002830 | 3300005937 | Bacteria | 20425 |
| 194 | Ga0070717_10009163 | 3300006028 | Bacteria | 7437 |
| 195 | Ga0070717_10217440 | 3300006028 | Bacteria | 1678 |
| 196 | Ga0075368_10000722 | 3300006042 | Bacteria | 10117 |
| 197 | Ga0075368_10025721 | 3300006042 | Bacteria | 2259 |
| 198 | Ga0075363_100008114 | 3300006048 | Bacteria | 4873 |
| 199 | Ga0075363_100034561 | 3300006048 | Bacteria | 2640 |
| 200 | Ga0075364_10054272 | 3300006051 | Bacteria | 2620 |
| 201 | Ga0075364_10092593 | 3300006051 | Bacteria | 2006 |
| 202 | Ga0070716_100088649 | 3300006173 | Bacteria | 1867 |
| 203 | Ga0075362_10014864 | 3300006177 | Bacteria | 3153 |
| 204 | Ga0075367_10003740 | 3300006178 | Bacteria | 7322 |
| 205 | Ga0075367_10042665 | 3300006178 | Bacteria | 2655 |
| 206 | Ga0075369_10014629 | 3300006186 | Bacteria | 3138 |
| 207 | Ga0075369_10016368 | 3300006186 | Bacteria | 2991 |
| 208 | Ga0075366_10002514 | 3300006195 | Bacteria | 9415 |
| 209 | Ga0075366_10002866 | 3300006195 | Bacteria | 8941 |
| 210 | Ga0075366_10012577 | 3300006195 | Bacteria | 4804 |
| 211 | Ga0075366_10014707 | 3300006195 | Bacteria | 4473 |
| 212 | Ga0097621_100019503 | 3300006237 | Bacteria | 5205 |
| 213 | Ga0097621_100064092 | 3300006237 | Bacteria | 3021 |
| 214 | Ga0097621_100065912 | 3300006237 | Bacteria | 2982 |
| 215 | Ga0097621_100170926 | 3300006237 | Bacteria | 1873 |
| 216 | Ga0097621_100444590 | 3300006237 | Bacteria | 1167 |
| 217 | Ga0075370_10001660 | 3300006353 | Bacteria | 9843 |
| 218 | Ga0075370_10008951 | 3300006353 | Bacteria | 5175 |
| 219 | Ga0075370_10015223 | 3300006353 | Bacteria | 4113 |
| 220 | Ga0075370_10020532 | 3300006353 | Bacteria | 3612 |
| 221 | Ga0075370_10030479 | 3300006353 | Bacteria | 3010 |
| 222 | Ga0068871_100048995 | 3300006358 | Bacteria | 3413 |
| 223 | Ga0068871_100112023 | 3300006358 | Bacteria | 2296 |
| 224 | Ga0075428_100007776 | 3300006844 | Bacteria | 11878 |
| 225 | Ga0075428_100094556 | 3300006844 | Bacteria | 3258 |
| 226 | Ga0075428_100175145 | 3300006844 | Bacteria | 2324 |
| 227 | Ga0075430_100061087 | 3300006846 | Bacteria | 3167 |
| 228 | Ga0075431_100005884 | 3300006847 | Bacteria | 12137 |
| 229 | Ga0075431_100275661 | 3300006847 | Bacteria | 1703 |
| 230 | Ga0075433_10000078 | 3300006852 | Bacteria | 44001 |
| 231 | Ga0075433_10006861 | 3300006852 | Bacteria | 9022 |
| 232 | Ga0075433_10013036 | 3300006852 | Bacteria | 6742 |
| 233 | Ga0075433_10157149 | 3300006852 | Bacteria | 2023 |
| 234 | Ga0075434_100000130 | 3300006871 | Bacteria | 45069 |
| 235 | Ga0075434_100003042 | 3300006871 | Bacteria | 14917 |
| 236 | Ga0075429_100015699 | 3300006880 | Bacteria | 6562 |
| 237 | Ga0068865_100073173 | 3300006881 | Bacteria | 2436 |
| 238 | Ga0068865_100102141 | 3300006881 | Bacteria | 2101 |
| 239 | Ga0068865_100109312 | 3300006881 | Bacteria | 2037 |
| 240 | Ga0068865_100121432 | 3300006881 | Bacteria | 1943 |
| 241 | Ga0068865_100168306 | 3300006881 | Bacteria | 1677 |
| 242 | Ga0097620_100002270 | 3300006931 | Bacteria | 19503 |
| 243 | Ga0097620_100006156 | 3300006931 | Bacteria | 12197 |
| 244 | Ga0097620_100011622 | 3300006931 | Bacteria | 8853 |
| 245 | Ga0097620_100024836 | 3300006931 | Bacteria | 6015 |
| 246 | Ga0097620_100150477 | 3300006931 | Bacteria | 2403 |
| 247 | Ga0075435_100011495 | 3300007076 | Bacteria | 6518 |
| 248 | Ga0105240_10005484 | 3300009093 | Bacteria | 18912 |
| 249 | Ga0105240_10398596 | 3300009093 | Bacteria | 1550 |
| 250 | Ga0111539_10003393 | 3300009094 | Bacteria | 20988 |
| 251 | Ga0111539_10006671 | 3300009094 | Bacteria | 14868 |
| 252 | Ga0111539_10112515 | 3300009094 | Bacteria | 3193 |
| 253 | Ga0111539_10350856 | 3300009094 | Bacteria | 1717 |
| 254 | Ga0105245_10006355 | 3300009098 | Bacteria | 10397 |
| 255 | Ga0105245_10018544 | 3300009098 | Bacteria | 6086 |
| 256 | Ga0105245_10032802 | 3300009098 | Bacteria | 4599 |
| 257 | Ga0105245_10188935 | 3300009098 | Bacteria | 1972 |
| 258 | Ga0105245_10278068 | 3300009098 | Bacteria | 1635 |
| 259 | Ga0114129_10037842 | 3300009147 | Bacteria | 6809 |
| 260 | Ga0114129_10336721 | 3300009147 | Bacteria | 2002 |
| 261 | Ga0105243_10321757 | 3300009148 | Bacteria | 1410 |
| 262 | Ga0105241_10005410 | 3300009174 | Bacteria | 9439 |
| 263 | Ga0105241_10009701 | 3300009174 | Bacteria | 7075 |
| 264 | Ga0105241_10026457 | 3300009174 | Bacteria | 4317 |
| 265 | Ga0105242_10075375 | 3300009176 | Bacteria | 2809 |
| 266 | Ga0105248_10020136 | 3300009177 | Bacteria | 7391 |
| 267 | Ga0105248_10037641 | 3300009177 | Bacteria | 5413 |
| 268 | Ga0105248_10041536 | 3300009177 | Bacteria | 5156 |
| 269 | Ga0105248_10128243 | 3300009177 | Bacteria | 2862 |
| 270 | Ga0105248_10169907 | 3300009177 | Bacteria | 2457 |
| 271 | Ga0105248_10193767 | 3300009177 | Bacteria | 2290 |
| 272 | Ga0105248_10196339 | 3300009177 | Bacteria | 2274 |
| 273 | Ga0105248_10210892 | 3300009177 | Bacteria | 2188 |
| 274 | Ga0105248_10247795 | 3300009177 | Bacteria | 2005 |
| 275 | Ga0105248_10561510 | 3300009177 | Bacteria | 1288 |
| 276 | Ga0105237_10008329 | 3300009545 | Bacteria | 11250 |
| 277 | Ga0105237_10011239 | 3300009545 | Bacteria | 9478 |
| 278 | Ga0105237_10034822 | 3300009545 | Bacteria | 5095 |
| 279 | Ga0105237_10036944 | 3300009545 | Bacteria | 4939 |
| 280 | Ga0105237_10146244 | 3300009545 | Bacteria | 2358 |
| 281 | Ga0105237_10366099 | 3300009545 | Bacteria | 1446 |
| 282 | Ga0105238_10054021 | 3300009551 | Bacteria | 4036 |
| 283 | Ga0105238_10136709 | 3300009551 | Bacteria | 2428 |
| 284 | Ga0105238_10496342 | 3300009551 | Bacteria | 1221 |
| 285 | Ga0105249_10014864 | 3300009553 | Bacteria | 6884 |
| 286 | Ga0105249_10106640 | 3300009553 | Bacteria | 2643 |
| 287 | Ga0105249_10250650 | 3300009553 | Bacteria | 1755 |
| 288 | Ga0105249_10363069 | 3300009553 | Bacteria | 1470 |
| 289 | Ga0105249_10412968 | 3300009553 | Bacteria | 1382 |
| 290 | Ga0105030_100593 | 3300009987 | Bacteria | 3230 |
| 291 | Ga0105239_10003653 | 3300010375 | Bacteria | 18807 |
| 292 | Ga0105239_10027248 | 3300010375 | Bacteria | 6290 |
| 293 | Ga0105239_10122351 | 3300010375 | Bacteria | 2891 |
| 294 | Ga0105239_10128972 | 3300010375 | Bacteria | 2812 |
| 295 | Ga0105239_10284092 | 3300010375 | Bacteria | 1863 |
| 296 | Ga0105246_10239436 | 3300011119 | Bacteria | 1434 |
| 297 | Ga0157373_10273232 | 3300013100 | Bacteria | 1197 |
| 298 | Ga0157369_10361570 | 3300013105 | Bacteria | 1507 |
| 299 | Ga0157369_10460023 | 3300013105 | Bacteria | 1317 |
| 300 | Ga0157374_10193516 | 3300013296 | Bacteria | 1989 |
| 301 | Ga0157374_10250864 | 3300013296 | Bacteria | 1741 |
| 302 | Ga0157378_10005236 | 3300013297 | Bacteria | 11390 |
| 303 | Ga0157378_10164266 | 3300013297 | Bacteria | 2079 |
| 304 | Ga0163162_10029974 | 3300013306 | Bacteria | 5387 |
| 305 | Ga0163162_10082677 | 3300013306 | Bacteria | 3283 |
| 306 | Ga0163162_10090555 | 3300013306 | Bacteria | 3140 |
| 307 | Ga0163162_10300956 | 3300013306 | Bacteria | 1736 |
| 308 | Ga0163162_10315255 | 3300013306 | Bacteria | 1697 |
| 309 | Ga0163162_10325480 | 3300013306 | Bacteria | 1669 |
| 310 | Ga0163162_10368096 | 3300013306 | Bacteria | 1570 |
| 311 | Ga0157372_10063316 | 3300013307 | Bacteria | 4147 |
| 312 | Ga0157375_10010290 | 3300013308 | Bacteria | 8230 |
| 313 | Ga0157375_10017502 | 3300013308 | Bacteria | 6469 |
| 314 | Ga0157375_10026843 | 3300013308 | Bacteria | 5374 |
| 315 | Ga0157375_10126201 | 3300013308 | Bacteria | 2674 |
| 316 | Ga0157375_10163922 | 3300013308 | Bacteria | 2366 |
| 317 | Ga0163163_10000581 | 3300014325 | Bacteria | 32150 |
| 318 | Ga0163163_10007008 | 3300014325 | Bacteria | 9901 |
| 319 | Ga0163163_10020970 | 3300014325 | Bacteria | 6161 |
| 320 | Ga0163163_10056050 | 3300014325 | Bacteria | 3895 |
| 321 | Ga0163163_10240598 | 3300014325 | Bacteria | 1860 |
| 322 | Ga0163163_10677781 | 3300014325 | Bacteria | 1094 |
| 323 | Ga0157380_10007283 | 3300014326 | Bacteria | 7851 |
| 324 | Ga0157380_10008547 | 3300014326 | Bacteria | 7320 |
| 325 | Ga0157380_10025490 | 3300014326 | Bacteria | 4484 |
| 326 | Ga0157380_10029395 | 3300014326 | Bacteria | 4200 |
| 327 | Ga0157380_10093870 | 3300014326 | Bacteria | 2482 |
| 328 | Ga0157380_10097051 | 3300014326 | Bacteria | 2445 |
| 329 | Ga0157377_10027772 | 3300014745 | Bacteria | 3041 |
| 330 | Ga0157379_10026614 | 3300014968 | Bacteria | 5149 |
| 331 | Ga0157379_10032827 | 3300014968 | Bacteria | 4629 |
| 332 | Ga0157379_10049685 | 3300014968 | Bacteria | 3745 |
| 333 | Ga0157379_10087963 | 3300014968 | Bacteria | 2786 |
| 334 | Ga0157379_10206371 | 3300014968 | Bacteria | 1778 |
| 335 | Ga0157376_10074514 | 3300014969 | Bacteria | 2894 |
| 336 | Ga0157376_10082537 | 3300014969 | Bacteria | 2762 |
| 337 | Ga0213872_10001049 | 3300021361 | Bacteria | 19233 |
| 338 | Ga0213872_10002041 | 3300021361 | Bacteria | 12277 |
| 339 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 340 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 341 | Ga0209025_1001953 | 3300025294 | Bacteria | 23804 |
| 342 | Ga0209564_1011311 | 3300025295 | Bacteria | 4011 |
| 343 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 344 | Ga0209758_1015826 | 3300025297 | Bacteria | 3876 |
| 345 | Ga0209050_1003476 | 3300025298 | Bacteria | 11551 |
| 346 | Ga0209256_1000458 | 3300025299 | Bacteria | 61611 |
| 347 | Ga0209051_1019686 | 3300025303 | Bacteria | 2935 |
| 348 | Ga0209051_1028459 | 3300025303 | Bacteria | 2206 |
| 349 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 350 | Ga0209257_1000560 | 3300025304 | Bacteria | 63396 |
| 351 | Ga0207653_10001196 | 3300025885 | Bacteria | 8473 |
| 352 | Ga0207682_10004901 | 3300025893 | Bacteria | 5516 |
| 353 | Ga0207692_10021047 | 3300025898 | Bacteria | 2978 |
| 354 | Ga0207642_10024347 | 3300025899 | Bacteria | 2433 |
| 355 | Ga0207680_10058821 | 3300025903 | Bacteria | 2331 |
| 356 | Ga0207680_10124987 | 3300025903 | Bacteria | 1687 |
| 357 | Ga0207647_10011665 | 3300025904 | Bacteria | 6153 |
| 358 | Ga0207647_10056658 | 3300025904 | Bacteria | 2404 |
| 359 | Ga0207645_10003656 | 3300025907 | Bacteria | 11604 |
| 360 | Ga0207643_10003138 | 3300025908 | Bacteria | 8893 |
| 361 | Ga0207705_10092388 | 3300025909 | Bacteria | 2217 |
| 362 | Ga0207684_10001346 | 3300025910 | Bacteria | 26938 |
| 363 | Ga0207684_10011731 | 3300025910 | Bacteria | 7644 |
| 364 | Ga0207684_10071796 | 3300025910 | Bacteria | 2941 |
| 365 | Ga0207654_10002858 | 3300025911 | Bacteria | 8758 |
| 366 | Ga0207654_10007746 | 3300025911 | Bacteria | 5421 |
| 367 | Ga0207707_10021578 | 3300025912 | Bacteria | 5628 |
| 368 | Ga0207707_10025434 | 3300025912 | Bacteria | 5179 |
| 369 | Ga0207707_10026761 | 3300025912 | Bacteria | 5041 |
| 370 | Ga0207707_10169231 | 3300025912 | Bacteria | 1910 |
| 371 | Ga0207695_10010977 | 3300025913 | Bacteria | 11010 |
| 372 | Ga0207695_10117358 | 3300025913 | Bacteria | 2634 |
| 373 | Ga0207695_10271372 | 3300025913 | Bacteria | 1592 |
| 374 | Ga0207671_10103513 | 3300025914 | Bacteria | 2159 |
| 375 | Ga0207671_10141183 | 3300025914 | Bacteria | 1856 |
| 376 | Ga0207663_10109420 | 3300025916 | Bacteria | 1873 |
| 377 | Ga0207663_10241074 | 3300025916 | Bacteria | 1326 |
| 378 | Ga0207660_10013268 | 3300025917 | Bacteria | 5399 |
| 379 | Ga0207662_10019149 | 3300025918 | Bacteria | 3891 |
| 380 | Ga0207662_10162500 | 3300025918 | Bacteria | 1427 |
| 381 | Ga0207657_10001958 | 3300025919 | Bacteria | 22216 |
| 382 | Ga0207657_10053172 | 3300025919 | Bacteria | 3510 |
| 383 | Ga0207652_10124083 | 3300025921 | Bacteria | 2300 |
| 384 | Ga0207652_10143489 | 3300025921 | Bacteria | 2136 |
| 385 | Ga0207652_10173032 | 3300025921 | Bacteria | 1938 |
| 386 | Ga0207652_10179960 | 3300025921 | Bacteria | 1900 |
| 387 | Ga0207652_10187832 | 3300025921 | Bacteria | 1858 |
| 388 | Ga0207646_10035270 | 3300025922 | Bacteria | 4518 |
| 389 | Ga0207681_10038264 | 3300025923 | Bacteria | 3177 |
| 390 | Ga0207681_10131952 | 3300025923 | Bacteria | 1848 |
| 391 | Ga0207681_10280861 | 3300025923 | Bacteria | 1311 |
| 392 | Ga0207694_10122990 | 3300025924 | Bacteria | 2073 |
| 393 | Ga0207659_10048124 | 3300025926 | Bacteria | 3020 |
| 394 | Ga0207659_10049300 | 3300025926 | Bacteria | 2986 |
| 395 | Ga0207687_10006633 | 3300025927 | Bacteria | 7636 |
| 396 | Ga0207687_10051594 | 3300025927 | Bacteria | 2868 |
| 397 | Ga0207687_10165291 | 3300025927 | Bacteria | 1702 |
| 398 | Ga0207700_10063551 | 3300025928 | Bacteria | 2808 |
| 399 | Ga0207664_10001478 | 3300025929 | Bacteria | 15421 |
| 400 | Ga0207644_10114985 | 3300025931 | Bacteria | 2040 |
| 401 | Ga0207706_10000233 | 3300025933 | Bacteria | 60777 |
| 402 | Ga0207706_10055217 | 3300025933 | Bacteria | 3504 |
| 403 | Ga0207686_10000534 | 3300025934 | Bacteria | 24546 |
| 404 | Ga0207709_10003759 | 3300025935 | Bacteria | 8925 |
| 405 | Ga0207670_10000099 | 3300025936 | Bacteria | 60113 |
| 406 | Ga0207670_10006499 | 3300025936 | Bacteria | 6487 |
| 407 | Ga0207669_10000325 | 3300025937 | Bacteria | 21831 |
| 408 | Ga0207669_10008438 | 3300025937 | Bacteria | 4838 |
| 409 | Ga0207669_10040969 | 3300025937 | Bacteria | 2692 |
| 410 | Ga0207669_10073883 | 3300025937 | Bacteria | 2153 |
| 411 | Ga0207669_10253198 | 3300025937 | Bacteria | 1312 |
| 412 | Ga0207704_10003773 | 3300025938 | Bacteria | 6898 |
| 413 | Ga0207704_10031077 | 3300025938 | Bacteria | 3002 |
| 414 | Ga0207665_10111673 | 3300025939 | Bacteria | 1921 |
| 415 | Ga0207691_10007014 | 3300025940 | Bacteria | 10871 |
| 416 | Ga0207691_10013491 | 3300025940 | Bacteria | 7817 |
| 417 | Ga0207691_10074339 | 3300025940 | Bacteria | 3065 |
| 418 | Ga0207691_10104363 | 3300025940 | Bacteria | 2526 |
| 419 | Ga0207691_10142544 | 3300025940 | Bacteria | 2111 |
| 420 | Ga0207711_10001369 | 3300025941 | Bacteria | 22958 |
| 421 | Ga0207711_10006171 | 3300025941 | Bacteria | 10126 |
| 422 | Ga0207711_10022130 | 3300025941 | Bacteria | 5314 |
| 423 | Ga0207711_10049274 | 3300025941 | Bacteria | 3606 |
| 424 | Ga0207711_10108679 | 3300025941 | Bacteria | 2464 |
| 425 | Ga0207711_10308941 | 3300025941 | Bacteria | 1460 |
| 426 | Ga0207711_10356329 | 3300025941 | Bacteria | 1355 |
| 427 | Ga0207711_10368373 | 3300025941 | Bacteria | 1332 |
| 428 | Ga0207689_10041045 | 3300025942 | Bacteria | 3829 |
| 429 | Ga0207689_10060208 | 3300025942 | Bacteria | 3122 |
| 430 | Ga0207689_10063711 | 3300025942 | Bacteria | 3033 |
| 431 | Ga0207689_10068338 | 3300025942 | Bacteria | 2920 |
| 432 | Ga0207689_10209764 | 3300025942 | Bacteria | 1609 |
| 433 | Ga0207689_10247593 | 3300025942 | Bacteria | 1474 |
| 434 | Ga0207661_10004129 | 3300025944 | Bacteria | 10153 |
| 435 | Ga0207661_10007948 | 3300025944 | Bacteria | 7563 |
| 436 | Ga0207679_10009673 | 3300025945 | Bacteria | 6180 |
| 437 | Ga0207679_10170533 | 3300025945 | Bacteria | 1791 |
| 438 | Ga0207667_10004770 | 3300025949 | Bacteria | 16571 |
| 439 | Ga0207667_10017868 | 3300025949 | Bacteria | 7971 |
| 440 | Ga0207667_10024833 | 3300025949 | Bacteria | 6571 |
| 441 | Ga0207667_10240116 | 3300025949 | Bacteria | 1854 |
| 442 | Ga0207667_10480544 | 3300025949 | Bacteria | 1261 |
| 443 | Ga0207651_10015693 | 3300025960 | Bacteria | 4412 |
| 444 | Ga0207651_10031921 | 3300025960 | Bacteria | 3374 |
| 445 | Ga0207712_10008312 | 3300025961 | Bacteria | 6562 |
| 446 | Ga0207712_10129398 | 3300025961 | Bacteria | 1921 |
| 447 | Ga0207668_10354007 | 3300025972 | Bacteria | 1228 |
| 448 | Ga0207640_10021357 | 3300025981 | Bacteria | 3858 |
| 449 | Ga0207658_10001308 | 3300025986 | Bacteria | 19644 |
| 450 | Ga0207658_10034217 | 3300025986 | Bacteria | 3630 |
| 451 | Ga0207658_10120070 | 3300025986 | Bacteria | 2094 |
| 452 | Ga0207677_10127867 | 3300026023 | Bacteria | 1923 |
| 453 | Ga0207703_10011165 | 3300026035 | Bacteria | 6989 |
| 454 | Ga0207703_10049780 | 3300026035 | Bacteria | 3388 |
| 455 | Ga0207703_10110285 | 3300026035 | Bacteria | 2347 |
| 456 | Ga0207703_10135803 | 3300026035 | Bacteria | 2129 |
| 457 | Ga0207703_10151824 | 3300026035 | Bacteria | 2021 |
| 458 | Ga0207703_10247097 | 3300026035 | Bacteria | 1606 |
| 459 | Ga0207639_10003453 | 3300026041 | Bacteria | 10636 |
| 460 | Ga0207639_10003938 | 3300026041 | Bacteria | 10023 |
| 461 | Ga0207639_10028234 | 3300026041 | Bacteria | 4095 |
| 462 | Ga0207639_10050987 | 3300026041 | Bacteria | 3145 |
| 463 | Ga0207639_10056189 | 3300026041 | Bacteria | 3016 |
| 464 | Ga0207639_10434845 | 3300026041 | Bacteria | 1189 |
| 465 | Ga0207678_10000554 | 3300026067 | Bacteria | 34126 |
| 466 | Ga0207678_10016427 | 3300026067 | Bacteria | 6498 |
| 467 | Ga0207678_10062952 | 3300026067 | Bacteria | 3188 |
| 468 | Ga0207678_10098159 | 3300026067 | Bacteria | 2503 |
| 469 | Ga0207708_10000185 | 3300026075 | Bacteria | 49057 |
| 470 | Ga0207708_10016719 | 3300026075 | Bacteria | 5520 |
| 471 | Ga0207708_10016956 | 3300026075 | Bacteria | 5483 |
| 472 | Ga0207708_10311928 | 3300026075 | Bacteria | 1282 |
| 473 | Ga0207708_10329029 | 3300026075 | Bacteria | 1249 |
| 474 | Ga0207641_10116855 | 3300026088 | Bacteria | 2374 |
| 475 | Ga0207641_10130328 | 3300026088 | Bacteria | 2257 |
| 476 | Ga0207641_10132904 | 3300026088 | Bacteria | 2236 |
| 477 | Ga0207648_10000030 | 3300026089 | Bacteria | 129654 |
| 478 | Ga0207648_10001855 | 3300026089 | Bacteria | 23091 |
| 479 | Ga0207648_10061370 | 3300026089 | Bacteria | 3278 |
| 480 | Ga0207648_10116656 | 3300026089 | Bacteria | 2346 |
| 481 | Ga0207648_10162729 | 3300026089 | Bacteria | 1971 |
| 482 | Ga0207648_10202952 | 3300026089 | Bacteria | 1759 |
| 483 | Ga0207676_10012644 | 3300026095 | Bacteria | 6054 |
| 484 | Ga0207676_10015397 | 3300026095 | Bacteria | 5515 |
| 485 | Ga0207676_10019158 | 3300026095 | Bacteria | 4987 |
| 486 | Ga0207676_10108431 | 3300026095 | Bacteria | 2318 |
| 487 | Ga0207676_10123478 | 3300026095 | Bacteria | 2188 |
| 488 | Ga0207674_10001364 | 3300026116 | Bacteria | 31620 |
| 489 | Ga0207674_10013835 | 3300026116 | Bacteria | 8927 |
| 490 | Ga0207674_10016409 | 3300026116 | Bacteria | 8108 |
| 491 | Ga0207674_10024871 | 3300026116 | Bacteria | 6391 |
| 492 | Ga0207674_10090467 | 3300026116 | Bacteria | 3052 |
| 493 | Ga0207674_10174327 | 3300026116 | Bacteria | 2103 |
| 494 | Ga0207674_10440253 | 3300026116 | Bacteria | 1260 |
| 495 | Ga0207675_100002563 | 3300026118 | Bacteria | 18003 |
| 496 | Ga0207675_100004168 | 3300026118 | Bacteria | 13995 |
| 497 | Ga0207675_100014298 | 3300026118 | Bacteria | 7399 |
| 498 | Ga0207675_100060311 | 3300026118 | Bacteria | 3541 |
| 499 | Ga0207675_100103027 | 3300026118 | Bacteria | 2689 |
| 500 | Ga0207675_100107967 | 3300026118 | Bacteria | 2624 |
| 501 | Ga0207675_100112086 | 3300026118 | Bacteria | 2574 |
| 502 | Ga0207675_100122486 | 3300026118 | Bacteria | 2462 |
| 503 | Ga0207675_100191625 | 3300026118 | Bacteria | 1961 |
| 504 | Ga0207683_10011580 | 3300026121 | Bacteria | 7530 |
| 505 | Ga0207683_10036240 | 3300026121 | Bacteria | 4294 |
| 506 | Ga0207698_10192223 | 3300026142 | Bacteria | 1819 |
| 507 | Ga0207698_10234004 | 3300026142 | Bacteria | 1670 |
| 508 | Ga0207428_10062099 | 3300027907 | Bacteria | 2955 |
| 509 | Ga0207428_10083819 | 3300027907 | Bacteria | 2485 |
| 510 | Ga0268266_10071019 | 3300028379 | Bacteria | 3017 |
| 511 | Ga0268266_10123187 | 3300028379 | Bacteria | 2309 |
| 512 | Ga0268266_10229837 | 3300028379 | Bacteria | 1708 |
| 513 | Ga0268265_10003611 | 3300028380 | Bacteria | 11040 |
| 514 | Ga0268265_10019222 | 3300028380 | Bacteria | 4744 |
| 515 | Ga0268265_10020306 | 3300028380 | Bacteria | 4635 |
| 516 | Ga0268265_10065770 | 3300028380 | Bacteria | 2800 |
| 517 | Ga0268265_10447114 | 3300028380 | Bacteria | 1206 |
| 518 | Ga0268265_10510304 | 3300028380 | Bacteria | 1134 |
| 519 | Ga0268264_10001871 | 3300028381 | Bacteria | 19134 |
| 520 | Ga0268264_10001894 | 3300028381 | Bacteria | 18988 |
| 521 | Ga0268264_10014526 | 3300028381 | Bacteria | 6471 |
| 522 | Ga0268264_10029882 | 3300028381 | Bacteria | 4467 |
| 523 | Ga0268264_10042884 | 3300028381 | Bacteria | 3747 |
| 524 | Ga0268264_10066388 | 3300028381 | Bacteria | 3042 |
| 525 | Ga0268264_10139266 | 3300028381 | Bacteria | 2162 |
| 526 | Ga0268264_10453998 | 3300028381 | Bacteria | 1242 |
| 527 | Ga0265337_1000036 | 3300028556 | Bacteria | 58197 |
| 528 | Ga0265334_10006414 | 3300028573 | Bacteria | 5071 |
| 529 | Ga0265318_10000626 | 3300028577 | Bacteria | 24443 |
| 530 | Ga0265336_10000372 | 3300028666 | Bacteria | 28838 |
| 531 | Ga0265336_10000377 | 3300028666 | Bacteria | 28553 |
| 532 | Ga0307515_10022552 | 3300028794 | Bacteria | 11086 |
| 533 | Ga0307515_10043062 | 3300028794 | Bacteria | 7034 |
| 534 | Ga0307515_10137256 | 3300028794 | Bacteria | 2649 |
| 535 | Ga0307515_10176197 | 3300028794 | Bacteria | 2108 |
| 536 | Ga0265338_10005377 | 3300028800 | Bacteria | 16734 |
| 537 | Ga0265338_10006215 | 3300028800 | Bacteria | 15298 |
| 538 | Ga0265338_10016978 | 3300028800 | Bacteria | 7875 |
| 539 | Ga0265338_10049198 | 3300028800 | Bacteria | 3824 |
| 540 | Ga0265338_10103246 | 3300028800 | Bacteria | 2316 |
| 541 | Ga0265338_10115220 | 3300028800 | Bacteria | 2155 |
| 542 | Ga0265338_10199449 | 3300028800 | Bacteria | 1510 |
| 543 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 544 | Ga0307512_10154301 | 3300030522 | Bacteria | 1364 |
| 545 | Ga0265760_10034596 | 3300031090 | Bacteria | 1495 |
| 546 | Ga0265330_10045981 | 3300031235 | Bacteria | 1924 |
| 547 | Ga0265332_10082350 | 3300031238 | Bacteria | 1364 |
| 548 | Ga0265328_10001458 | 3300031239 | Bacteria | 10911 |
| 549 | Ga0265320_10001037 | 3300031240 | Bacteria | 20637 |
| 550 | Ga0265320_10002179 | 3300031240 | Bacteria | 13769 |
| 551 | Ga0265320_10025177 | 3300031240 | Bacteria | 3133 |
| 552 | Ga0265320_10055547 | 3300031240 | Bacteria | 1905 |
| 553 | Ga0265320_10098836 | 3300031240 | Bacteria | 1345 |
| 554 | Ga0265320_10105439 | 3300031240 | Bacteria | 1295 |
| 555 | Ga0265325_10001332 | 3300031241 | Bacteria | 17493 |
| 556 | Ga0265325_10134006 | 3300031241 | Bacteria | 1183 |
| 557 | Ga0265329_10019712 | 3300031242 | Bacteria | 2286 |
| 558 | Ga0265340_10008366 | 3300031247 | Bacteria | 5591 |
| 559 | Ga0265340_10020657 | 3300031247 | Bacteria | 3381 |
| 560 | Ga0265339_10061160 | 3300031249 | Bacteria | 2028 |
| 561 | Ga0265331_10005681 | 3300031250 | Bacteria | 7490 |
| 562 | Ga0265331_10007063 | 3300031250 | Bacteria | 6548 |
| 563 | Ga0265331_10013992 | 3300031250 | Bacteria | 4291 |
| 564 | Ga0265331_10019773 | 3300031250 | Bacteria | 3470 |
| 565 | Ga0265331_10077121 | 3300031250 | Bacteria | 1553 |
| 566 | Ga0265327_10000213 | 3300031251 | Bacteria | 121151 |
| 567 | Ga0265327_10001422 | 3300031251 | Bacteria | 30463 |
| 568 | Ga0265327_10007133 | 3300031251 | Bacteria | 8718 |
| 569 | Ga0265327_10065755 | 3300031251 | Bacteria | 1832 |
| 570 | Ga0265316_10000545 | 3300031344 | Bacteria | 42261 |
| 571 | Ga0265316_10015555 | 3300031344 | Bacteria | 6647 |
| 572 | Ga0307513_10011862 | 3300031456 | Bacteria | 10795 |
| 573 | Ga0307513_10018254 | 3300031456 | Bacteria | 8390 |
| 574 | Ga0307513_10075689 | 3300031456 | Bacteria | 3494 |
| 575 | Ga0307513_10109533 | 3300031456 | Bacteria | 2759 |
| 576 | Ga0307513_10116874 | 3300031456 | Bacteria | 2645 |
| 577 | Ga0307509_10003789 | 3300031507 | Bacteria | 22447 |
| 578 | Ga0307509_10118278 | 3300031507 | Bacteria | 2634 |
| 579 | Ga0307509_10168056 | 3300031507 | Bacteria | 2078 |
| 580 | Ga0307509_10182476 | 3300031507 | Bacteria | 1961 |
| 581 | Ga0307408_100023107 | 3300031548 | Bacteria | 4233 |
| 582 | Ga0307408_100112327 | 3300031548 | Bacteria | 2095 |
| 583 | Ga0307408_100130882 | 3300031548 | Bacteria | 1957 |
| 584 | Ga0265313_10007576 | 3300031595 | Bacteria | 7379 |
| 585 | Ga0265313_10015842 | 3300031595 | Bacteria | 4363 |
| 586 | Ga0307508_10004086 | 3300031616 | Bacteria | 14409 |
| 587 | Ga0307508_10005039 | 3300031616 | Bacteria | 12690 |
| 588 | Ga0265314_10013583 | 3300031711 | Bacteria | 6570 |
| 589 | Ga0265314_10066836 | 3300031711 | Bacteria | 2423 |
| 590 | Ga0265342_10041127 | 3300031712 | Bacteria | 2801 |
| 591 | Ga0307405_10219477 | 3300031731 | Bacteria | 1394 |
| 592 | Ga0307413_10084019 | 3300031824 | Bacteria | 2050 |
| 593 | Ga0307410_10019021 | 3300031852 | Bacteria | 4167 |
| 594 | Ga0307410_10033519 | 3300031852 | Bacteria | 3316 |
| 595 | Ga0307410_10041132 | 3300031852 | Bacteria | 3046 |
| 596 | Ga0307410_10049197 | 3300031852 | Bacteria | 2829 |
| 597 | Ga0307410_10069507 | 3300031852 | Bacteria | 2436 |
| 598 | Ga0307410_10136222 | 3300031852 | Bacteria | 1810 |
| 599 | Ga0307410_10288594 | 3300031852 | Bacteria | 1290 |
| 600 | Ga0307406_10025491 | 3300031901 | Bacteria | 3541 |
| 601 | Ga0307412_10057419 | 3300031911 | Bacteria | 2598 |
| 602 | Ga0307412_10082539 | 3300031911 | Bacteria | 2226 |
| 603 | Ga0307409_100011518 | 3300031995 | Bacteria | 5583 |
| 604 | Ga0307409_100049227 | 3300031995 | Bacteria | 3212 |
| 605 | Ga0307409_100075541 | 3300031995 | Bacteria | 2698 |
| 606 | Ga0307409_100116957 | 3300031995 | Bacteria | 2249 |
| 607 | Ga0307409_100133992 | 3300031995 | Bacteria | 2122 |
| 608 | Ga0307409_100331827 | 3300031995 | Bacteria | 1427 |
| 609 | Ga0307409_100419043 | 3300031995 | Bacteria | 1284 |
| 610 | Ga0307416_100002489 | 3300032002 | Bacteria | 10595 |
| 611 | Ga0307416_100019810 | 3300032002 | Bacteria | 4781 |
| 612 | Ga0307416_100024582 | 3300032002 | Bacteria | 4401 |
| 613 | Ga0307416_100039677 | 3300032002 | Bacteria | 3649 |
| 614 | Ga0307416_100083965 | 3300032002 | Bacteria | 2704 |
| 615 | Ga0307416_100139886 | 3300032002 | Bacteria | 2198 |
| 616 | Ga0307416_100463005 | 3300032002 | Bacteria | 1323 |
| 617 | Ga0307414_10281233 | 3300032004 | Bacteria | 1398 |
| 618 | Ga0307414_10281464 | 3300032004 | Bacteria | 1398 |
| 619 | Ga0307411_10002990 | 3300032005 | Bacteria | 7695 |
| 620 | Ga0307411_10054114 | 3300032005 | Bacteria | 2633 |
| 621 | Ga0307411_10088034 | 3300032005 | Bacteria | 2158 |
| 622 | Ga0307415_100019386 | 3300032126 | Bacteria | 4129 |
| 623 | Ga0307507_10030162 | 3300033179 | Bacteria | 5724 |
| 624 | Ga0307510_10000812 | 3300033180 | Bacteria | 32513 |
| 625 | Ga0307510_10127595 | 3300033180 | Bacteria | 2228 |
| 626 | Ga0373952_0004765 | 3300035092 | Bacteria | 2468 |
| 627 | Ga0373936_0046417 | 3300035113 | Bacteria | 1751 |
| 628 | Ga0373939_0021767 | 3300035114 | Bacteria | 1760 |
| 629 | Ga0373931_0100224 | 3300035691 | Bacteria | 1628 |
| 630 | Ga0373927_0067900 | 3300035695 | Bacteria | 2307 |
| 631 | Ga0373927_0154282 | 3300035695 | Bacteria | 1504 |
| 632 | Ga0373937_0128660 | 3300036401 | Bacteria | 2364 |
| 633 | Ga0373937_0331100 | 3300036401 | Bacteria | 1441 |
| 634 | Ga0373925_0029000 | 3300037068 | Bacteria | 4058 |
| 635 | Ga0395905_0019247 | 3300037471 | Bacteria | 6472 |
| 636 | Ga0395905_0444276 | 3300037471 | Bacteria | 1194 |
| 637 | Ga0436364_0618718 | 3300037853 | Bacteria | 2833 |
| 638 | Ga0237816_00009 | 3300039145 | Bacteria | 12381 |
| 639 | Ga0436361_0621527 | 3300039447 | Bacteria | 17412 |
| 640 | Ga0436361_1088302 | 3300039447 | Bacteria | 21721 |
| 641 | Ga0439461_0000411 | 3300041410 | Bacteria | 6176 |
| 642 | Ga0439465_0005927 | 3300041413 | Bacteria | 3884 |
| 643 | Ga0439465_0013218 | 3300041413 | Bacteria | 2578 |
| 644 | Ga0451802_0170293 | 3300041460 | Bacteria | 3945 |
| 645 | Ga0451807_1837847 | 3300041486 | Bacteria | 1558 |
| 646 | Ga0451807_2577330 | 3300041486 | Bacteria | 1895 |
| 647 | Ga0451837_1564041 | 3300041494 | Bacteria | 2895 |
| 648 | Ga0439445_0006065 | 3300042004 | Bacteria | 2772 |
| 649 | Ga0439449_0000114 | 3300042007 | Bacteria | 26375 |
| 650 | Ga0439449_0003134 | 3300042007 | Bacteria | 6433 |
| 651 | Ga0450894_002673 | 3300042131 | Bacteria | 2370 |
| 652 | Ga0450896_001275 | 3300042133 | Bacteria | 3051 |
| 653 | Ga0450898_000329 | 3300042134 | Bacteria | 5389 |
| 654 | Ga0450910_003248 | 3300042147 | Bacteria | 2155 |
| 655 | Ga0439446_0000379 | 3300042156 | Bacteria | 8582 |
| 656 | Ga0450908_000588 | 3300042184 | Bacteria | 6962 |
| 657 | Ga0439434_0001027 | 3300042435 | Bacteria | 8075 |
| 658 | Ga0439435_0000513 | 3300042436 | Bacteria | 6185 |
| 659 | Ga0439459_0025938 | 3300042438 | Bacteria | 1161 |
| 660 | Ga0450918_005098 | 3300042531 | Bacteria | 2367 |
| 661 | Ga0451577_0003485 | 3300042876 | Bacteria | 17504 |
| 662 | Ga0451577_0011223 | 3300042876 | Bacteria | 8492 |
| 663 | Ga0451577_0084624 | 3300042876 | Bacteria | 2830 |
| 664 | Ga0451577_0153364 | 3300042876 | Bacteria | 2073 |
| 665 | Ga0451577_0224706 | 3300042876 | Bacteria | 1697 |
| 666 | Ga0466969_0031267 | 3300044656 | Bacteria | 2711 |
| 667 | Ga0466969_0066095 | 3300044656 | Bacteria | 1746 |
| 668 | Ga0466972_0016607 | 3300044658 | Bacteria | 3680 |
| 669 | Ga0466965_0045036 | 3300044683 | Bacteria | 2181 |
| 670 | Ga0466965_0072811 | 3300044683 | Bacteria | 1729 |
| 671 | Ga0466961_0021251 | 3300044693 | Bacteria | 4179 |
| 672 | Ga0466961_0076286 | 3300044693 | Bacteria | 2124 |
| 673 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 674 | Ga0453684_0000499 | 3300044712 | Bacteria | 153532 |
| 675 | Ga0453684_0000682 | 3300044712 | Bacteria | 121090 |
| 676 | Ga0453684_0002254 | 3300044712 | Bacteria | 47784 |
| 677 | Ga0453684_0010455 | 3300044712 | Bacteria | 15862 |
| 678 | Ga0453684_0017209 | 3300044712 | Bacteria | 11224 |
| 679 | Ga0453684_0023051 | 3300044712 | Bacteria | 9198 |
| 680 | Ga0453684_0024764 | 3300044712 | Bacteria | 8748 |
| 681 | Ga0453684_0029755 | 3300044712 | Bacteria | 7740 |
| 682 | Ga0453684_0031025 | 3300044712 | Bacteria | 7528 |
| 683 | Ga0453684_0049121 | 3300044712 | Bacteria | 5568 |
| 684 | Ga0453684_0052474 | 3300044712 | Bacteria | 5331 |
| 685 | Ga0453684_0057685 | 3300044712 | Bacteria | 5022 |
| 686 | Ga0453684_0062444 | 3300044712 | Bacteria | 4772 |
| 687 | Ga0453684_0063014 | 3300044712 | Bacteria | 4745 |
| 688 | Ga0453684_0117173 | 3300044712 | Bacteria | 3223 |
| 689 | Ga0453684_0352830 | 3300044712 | Bacteria | 1658 |
| 690 | Ga0453684_0358210 | 3300044712 | Bacteria | 1643 |
| 691 | Ga0453684_0508543 | 3300044712 | Bacteria | 1333 |
| 692 | Ga0466971_0011291 | 3300044719 | Bacteria | 3913 |
| 693 | Ga0466968_0010602 | 3300044735 | Bacteria | 3577 |
| 694 | Ga0466970_0040730 | 3300044765 | Bacteria | 2467 |
| 695 | Ga0466959_0071909 | 3300045049 | Bacteria | 2504 |
| 696 | Ga0466959_0153855 | 3300045049 | Bacteria | 1619 |
| 697 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 698 | Ga0451576_0001018 | 3300045051 | Bacteria | 51870 |
| 699 | Ga0451576_0003603 | 3300045051 | Bacteria | 21062 |
| 700 | Ga0451576_0005451 | 3300045051 | Bacteria | 15954 |
| 701 | Ga0451576_0019148 | 3300045051 | Bacteria | 7477 |
| 702 | Ga0451576_0065562 | 3300045051 | Bacteria | 3781 |
| 703 | Ga0451576_0173258 | 3300045051 | Bacteria | 2252 |
| 704 | Ga0451576_0641677 | 3300045051 | Bacteria | 1116 |
| 705 | Ga0466967_0043524 | 3300045976 | Bacteria | 3888 |
| 706 | Ga0495638_0023913 | 3300046460 | Bacteria | 3991 |
| 707 | Ga0495651_0008790 | 3300046462 | Bacteria | 7745 |
| 708 | Ga0495608_0053871 | 3300046511 | Bacteria | 2660 |
| 709 | Ga0495610_0032043 | 3300046512 | Bacteria | 2736 |
| 710 | Ga0495618_0038290 | 3300046514 | Bacteria | 3013 |
| 711 | Ga0495628_0000851 | 3300046516 | Bacteria | 28201 |
| 712 | Ga0495630_0088618 | 3300046517 | Bacteria | 2337 |
| 713 | Ga0495648_0081810 | 3300046524 | Bacteria | 1836 |
| 714 | Ga0495663_0000771 | 3300046525 | Bacteria | 10950 |
| 715 | Ga0495642_0057302 | 3300046528 | Bacteria | 1611 |
| 716 | Ga0495652_0022954 | 3300046529 | Bacteria | 5533 |
| 717 | Ga0495597_0004870 | 3300046542 | Bacteria | 7230 |
| 718 | Ga0495611_0154408 | 3300046648 | Bacteria | 1072 |
| 719 | Ga0495625_0008867 | 3300046660 | Bacteria | 8512 |
| 720 | Ga0495625_0106431 | 3300046660 | Bacteria | 1920 |
| 721 | Ga0495623_0003893 | 3300046679 | Bacteria | 9846 |
| 722 | Ga0495613_0017816 | 3300046689 | Bacteria | 5293 |
| 723 | Ga0495671_0023334 | 3300046692 | Bacteria | 3232 |
| 724 | Ga0495589_0070497 | 3300046794 | Bacteria | 1709 |
| 725 | Ga0495660_0050459 | 3300046810 | Bacteria | 2267 |
| 726 | Ga0495687_000128 | 3300047443 | Bacteria | 116626 |
| 727 | Ga0495687_036927 | 3300047443 | Bacteria | 2181 |
| 728 | Ga0495675_0118421 | 3300047444 | Bacteria | 1650 |
| 729 | Ga0495686_0040286 | 3300047472 | Bacteria | 2980 |
| 730 | Ga0495686_0061450 | 3300047472 | Bacteria | 2333 |
| 731 | Ga0495602_0053021 | 3300048088 | Bacteria | 3595 |
| 732 | Ga0496101_0121991 | 3300048904 | Bacteria | 1971 |
| 733 | Ga0496101_0306692 | 3300048904 | Bacteria | 1244 |
| 734 | Ga0496102_0083158 | 3300048905 | Bacteria | 2953 |
| 735 | Ga0496102_0264693 | 3300048905 | Bacteria | 1621 |
| 736 | Ga0496102_0316633 | 3300048905 | Bacteria | 1470 |
| 737 | Ga0496102_0386208 | 3300048905 | Bacteria | 1317 |
| 738 | Ga0496103_0009158 | 3300048906 | Bacteria | 5862 |
| 739 | Ga0496104_0217941 | 3300048907 | Bacteria | 1821 |
| 740 | Ga0496106_0030531 | 3300048909 | Bacteria | 4017 |
| 741 | Ga0496106_0044803 | 3300048909 | Bacteria | 3322 |
| 742 | Ga0496106_0047472 | 3300048909 | Bacteria | 3232 |
| 743 | Ga0496106_0243598 | 3300048909 | Bacteria | 1437 |
| 744 | Ga0496106_0316904 | 3300048909 | Bacteria | 1252 |
| 745 | Ga0496107_0018174 | 3300048910 | Bacteria | 4948 |
| 746 | Ga0496109_0499624 | 3300048912 | Bacteria | 1148 |
| 747 | Ga0496112_0016195 | 3300048915 | Bacteria | 6975 |
| 748 | Ga0496114_0012813 | 3300048917 | Bacteria | 6713 |
| 749 | Ga0496114_0047371 | 3300048917 | Bacteria | 3576 |
| 750 | Ga0496115_0001590 | 3300048918 | Bacteria | 16293 |
| 751 | Ga0496121_0000154 | 3300048924 | Bacteria | 150013 |
| 752 | Ga0496121_0074864 | 3300048924 | Bacteria | 2706 |
| 753 | Ga0496122_0015448 | 3300048925 | Bacteria | 7299 |
| 754 | Ga0496122_0149147 | 3300048925 | Bacteria | 1447 |
| 755 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 756 | Ga0496125_0116140 | 3300048928 | Bacteria | 1922 |
| 757 | Ga0496126_0032642 | 3300048929 | Bacteria | 4903 |
| 758 | Ga0501031_0015028 | 3300049568 | Bacteria | 5029 |
| 759 | Ga0501031_0237182 | 3300049568 | Bacteria | 1186 |
| 760 | Ga0501032_0000570 | 3300049569 | Bacteria | 29860 |
| 761 | Ga0501032_0045148 | 3300049569 | Bacteria | 2981 |
| 762 | Ga0501032_0049955 | 3300049569 | Bacteria | 2821 |
| 763 | Ga0501032_0199742 | 3300049569 | Bacteria | 1305 |
| 764 | Ga0501033_0001988 | 3300049570 | Bacteria | 17819 |
| 765 | Ga0501034_0000624 | 3300049571 | Bacteria | 55267 |
| 766 | Ga0501034_0076566 | 3300049571 | Bacteria | 3352 |
| 767 | Ga0501034_0132433 | 3300049571 | Bacteria | 2476 |
| 768 | Ga0501034_0180034 | 3300049571 | Bacteria | 2079 |
| 769 | Ga0501036_0047782 | 3300049572 | Bacteria | 3623 |
| 770 | Ga0501036_0153587 | 3300049572 | Bacteria | 1941 |
| 771 | Ga0501037_0003745 | 3300049573 | Bacteria | 11033 |
| 772 | Ga0501037_0024041 | 3300049573 | Bacteria | 4505 |
| 773 | Ga0501037_0040775 | 3300049573 | Bacteria | 3416 |
| 774 | Ga0501038_0000379 | 3300049574 | Bacteria | 38322 |
| 775 | Ga0501038_0024509 | 3300049574 | Bacteria | 5382 |
| 776 | Ga0501039_0004090 | 3300049575 | Bacteria | 10971 |
| 777 | Ga0501039_0007955 | 3300049575 | Bacteria | 8072 |
| 778 | Ga0501039_0008947 | 3300049575 | Bacteria | 7629 |
| 779 | Ga0501040_0159206 | 3300049576 | Bacteria | 1596 |
| 780 | Ga0501041_0016666 | 3300049577 | Bacteria | 4372 |
| 781 | Ga0501041_0092447 | 3300049577 | Bacteria | 1868 |
| 782 | Ga0501041_0136466 | 3300049577 | Bacteria | 1529 |
| 783 | Ga0501042_0023337 | 3300049578 | Bacteria | 4328 |
| 784 | Ga0501042_0034928 | 3300049578 | Bacteria | 3567 |
| 785 | Ga0501043_0050616 | 3300049579 | Bacteria | 3265 |
| 786 | Ga0501046_0000029 | 3300049580 | Bacteria | 194168 |
| 787 | Ga0501046_0014910 | 3300049580 | Bacteria | 6539 |
| 788 | Ga0501046_0025272 | 3300049580 | Bacteria | 4862 |
| 789 | Ga0501046_0045598 | 3300049580 | Bacteria | 3483 |
| 790 | Ga0501046_0235228 | 3300049580 | Bacteria | 1352 |
| 791 | Ga0501047_0000581 | 3300049581 | Bacteria | 38872 |
| 792 | Ga0501047_0022231 | 3300049581 | Bacteria | 6093 |
| 793 | Ga0501047_0042815 | 3300049581 | Bacteria | 4374 |
| 794 | Ga0501047_0069721 | 3300049581 | Bacteria | 3385 |
| 795 | Ga0501048_0004012 | 3300049582 | Bacteria | 11186 |
| 796 | Ga0501048_0036307 | 3300049582 | Bacteria | 3542 |
| 797 | Ga0501048_0095559 | 3300049582 | Bacteria | 2096 |
| 798 | Ga0501067_0005591 | 3300049583 | Bacteria | 6972 |
| 799 | Ga0501067_0011858 | 3300049583 | Bacteria | 4831 |
| 800 | Ga0501067_0033510 | 3300049583 | Bacteria | 2850 |
| 801 | Ga0501068_0000124 | 3300049584 | Bacteria | 34247 |
| 802 | Ga0501068_0004113 | 3300049584 | Bacteria | 7888 |
| 803 | Ga0501068_0026220 | 3300049584 | Bacteria | 3433 |
| 804 | Ga0501068_0042477 | 3300049584 | Bacteria | 2734 |
| 805 | Ga0501068_0067320 | 3300049584 | Bacteria | 2182 |
| 806 | Ga0501069_0059431 | 3300049585 | Bacteria | 2133 |
| 807 | Ga0501070_0011683 | 3300049586 | Bacteria | 7415 |
| 808 | Ga0501071_0004121 | 3300049587 | Bacteria | 9188 |
| 809 | Ga0501071_0042782 | 3300049587 | Bacteria | 3246 |
| 810 | Ga0501071_0126805 | 3300049587 | Bacteria | 1895 |
| 811 | Ga0501071_0264268 | 3300049587 | Bacteria | 1300 |
| 812 | Ga0501072_0049582 | 3300049588 | Bacteria | 3306 |
| 813 | Ga0501072_0074917 | 3300049588 | Bacteria | 2676 |
| 814 | Ga0501072_0076600 | 3300049588 | Bacteria | 2646 |
| 815 | Ga0501072_0104811 | 3300049588 | Bacteria | 2248 |
| 816 | Ga0501072_0279960 | 3300049588 | Bacteria | 1327 |
| 817 | Ga0501073_0000399 | 3300049589 | Bacteria | 29561 |
| 818 | Ga0501073_0002048 | 3300049589 | Bacteria | 15053 |
| 819 | Ga0501073_0002144 | 3300049589 | Bacteria | 14758 |
| 820 | Ga0501073_0048235 | 3300049589 | Bacteria | 2990 |
| 821 | Ga0501073_0054959 | 3300049589 | Bacteria | 2787 |
| 822 | Ga0501074_0007859 | 3300049590 | Bacteria | 7725 |
| 823 | Ga0501074_0078476 | 3300049590 | Bacteria | 2370 |
| 824 | Ga0501075_0008262 | 3300049591 | Bacteria | 7253 |
| 825 | Ga0501075_0017516 | 3300049591 | Bacteria | 5176 |
| 826 | Ga0501076_0007140 | 3300049592 | Bacteria | 8119 |
| 827 | Ga0501076_0097775 | 3300049592 | Bacteria | 2364 |
| 828 | Ga0501076_0247520 | 3300049592 | Bacteria | 1458 |
| 829 | Ga0501077_0001020 | 3300049593 | Bacteria | 16910 |
| 830 | Ga0501077_0009846 | 3300049593 | Bacteria | 5945 |
| 831 | Ga0501077_0032948 | 3300049593 | Bacteria | 3299 |
| 832 | Ga0501225_0024599 | 3300049705 | Bacteria | 1658 |
| 833 | Ga0501079_0005396 | 3300049741 | Bacteria | 9523 |
| 834 | Ga0501079_0027691 | 3300049741 | Bacteria | 4347 |
| 835 | Ga0501079_0122552 | 3300049741 | Bacteria | 2022 |
| 836 | Ga0501080_0000192 | 3300049742 | Bacteria | 44688 |
| 837 | Ga0501080_0013052 | 3300049742 | Bacteria | 7628 |
| 838 | Ga0501080_0038417 | 3300049742 | Bacteria | 4469 |
| 839 | Ga0501080_0093236 | 3300049742 | Bacteria | 2796 |
| 840 | Ga0501080_0276807 | 3300049742 | Bacteria | 1526 |
| 841 | Ga0501081_0043527 | 3300049743 | Bacteria | 3080 |
| 842 | Ga0501083_0069618 | 3300049744 | Bacteria | 2341 |
| 843 | Ga0501083_0207454 | 3300049744 | Bacteria | 1278 |
| 844 | Ga0501280_002270 | 3300049776 | Bacteria | 3257 |
| 845 | Ga0501035_0005219 | 3300049822 | Bacteria | 12295 |
| 846 | Ga0501035_0006345 | 3300049822 | Bacteria | 11117 |
| 847 | Ga0501035_0006565 | 3300049822 | Bacteria | 10906 |
| 848 | Ga0501035_0017905 | 3300049822 | Bacteria | 6534 |
| 849 | Ga0501044_0000006 | 3300049823 | Bacteria | 291413 |
| 850 | Ga0501044_0001209 | 3300049823 | Bacteria | 30642 |
| 851 | Ga0501044_0002324 | 3300049823 | Bacteria | 21666 |
| 852 | Ga0501044_0024583 | 3300049823 | Bacteria | 6392 |
| 853 | Ga0501044_0033679 | 3300049823 | Bacteria | 5381 |
| 854 | Ga0501045_0006548 | 3300049824 | Bacteria | 8075 |
| 855 | Ga0501045_0084137 | 3300049824 | Bacteria | 2347 |
| 856 | nmdc:mga03683_41656_c1 | 3300050489 | Bacteria | 1887 |
| 857 | nmdc:mga03683_8519_c1 | 3300050489 | Bacteria | 3609 |
| 858 | nmdc:mga03n38_39630_c1 | 3300050490 | Bacteria | 2044 |
| 859 | nmdc:mga00v17_92398_c1 | 3300050491 | Bacteria | 1902 |
| 860 | nmdc:mga0k408_167724_c1 | 3300050493 | Bacteria | 1309 |
| 861 | nmdc:mga0k408_4311_c1 | 3300050493 | Bacteria | 7557 |
| 862 | nmdc:mga0k408_5851_c1 | 3300050493 | Bacteria | 6552 |
| 863 | nmdc:mga06z11_1038_c1 | 3300050494 | Bacteria | 10109 |
| 864 | nmdc:mga06z11_23634_c1 | 3300050494 | Bacteria | 2891 |
| 865 | nmdc:mga06z11_31712_c1 | 3300050494 | Bacteria | 2570 |
| 866 | nmdc:mga07m45_1267_c1 | 3300050496 | Bacteria | 11495 |
| 867 | nmdc:mga07m45_139536_c1 | 3300050496 | Bacteria | 1404 |
| 868 | nmdc:mga07m45_18414_c1 | 3300050496 | Bacteria | 3770 |
| 869 | nmdc:mga07m45_4022_c1 | 3300050496 | Bacteria | 7160 |
| 870 | nmdc:mga07m45_42962_c1 | 3300050496 | Bacteria | 2534 |
| 871 | nmdc:mga05p37_109305_c1 | 3300050507 | Bacteria | 3401 |
| 872 | nmdc:mga05p37_30717_c1 | 3300050507 | Bacteria | 6555 |
| 873 | nmdc:mga0qj67_39250_c1 | 3300050509 | Bacteria | 3717 |
| 874 | nmdc:mga06r32_514283_c1 | 3300050510 | Bacteria | 1173 |
| 875 | nmdc:mga08y16_16754_c1 | 3300050511 | Bacteria | 7712 |
| 876 | nmdc:mga08y16_41573_c1 | 3300050511 | Bacteria | 4815 |
| 877 | nmdc:mga08y16_424503_c1 | 3300050511 | Bacteria | 1358 |
| 878 | nmdc:mga08y16_532432_c1 | 3300050511 | Bacteria | 1190 |
| 879 | nmdc:mga08y16_7173_c1 | 3300050511 | Bacteria | 11695 |
| 880 | nmdc:mga0n895_7001_c1 | 3300050512 | Bacteria | 9633 |
| 881 | nmdc:mga0rr50_49618_c1 | 3300050513 | Bacteria | 3107 |
| 882 | nmdc:mga0a205_17283_c1 | 3300050515 | Bacteria | 6758 |
| 883 | nmdc:mga0a205_31976_c1 | 3300050515 | Bacteria | 5044 |
| 884 | nmdc:mga0a205_3811_c1 | 3300050515 | Bacteria | 13515 |
| 885 | nmdc:mga0a205_39580_c1 | 3300050515 | Bacteria | 4537 |
| 886 | nmdc:mga0sz30_24059_c1 | 3300050516 | Bacteria | 2484 |
| 887 | Ga0500643_000017 | 3300053087 | Bacteria | 305781 |
| 888 | Ga0500643_031703 | 3300053087 | Bacteria | 1609 |
| 889 | Ga0500646_0040156 | 3300053090 | Bacteria | 1315 |
| 890 | Ga0500641_0002110 | 3300053096 | Bacteria | 7046 |
| 891 | Ga0500641_0009333 | 3300053096 | Bacteria | 3528 |
| 892 | Ga0500555_001712 | 3300053103 | Bacteria | 6594 |
| 893 | Ga0500592_007244 | 3300053116 | Bacteria | 1764 |
| 894 | Ga0500642_0071074 | 3300053130 | Bacteria | 1584 |
| 895 | Ga0500652_057116 | 3300053131 | Bacteria | 1601 |
| 896 | Ga0500658_0017516 | 3300053134 | Bacteria | 2677 |
| 897 | Ga0500568_0015780 | 3300053139 | Bacteria | 3373 |
| 898 | Ga0500568_0022043 | 3300053139 | Bacteria | 2732 |
| 899 | Ga0500616_0014220 | 3300053153 | Bacteria | 4580 |
| 900 | Ga0500622_0048058 | 3300053156 | Bacteria | 2202 |
| 901 | Ga0500622_0056261 | 3300053156 | Bacteria | 2014 |
| 902 | Ga0500609_000624 | 3300053731 | Bacteria | 5396 |
| 903 | Ga0501084_0002257 | 3300054114 | Bacteria | 15480 |
| 904 | Ga0501084_0019391 | 3300054114 | Bacteria | 5666 |
| 905 | Ga0501084_0046081 | 3300054114 | Bacteria | 3651 |
| 906 | Ga0501084_0080230 | 3300054114 | Bacteria | 2736 |
| 907 | Ga0501084_0152476 | 3300054114 | Bacteria | 1948 |
| 908 | Ga0590071_003216 | 3300059421 | Bacteria | 4035 |
| 909 | Ga0590074_002183 | 3300059423 | Bacteria | 3211 |
| 910 | Ga0501082_0002041 | 3300060353 | Bacteria | 17752 |
| 911 | Ga0501082_0021283 | 3300060353 | Bacteria | 5595 |
| 912 | Ga0501082_0022288 | 3300060353 | Bacteria | 5457 |
| 913 | Ga0501082_0055186 | 3300060353 | Bacteria | 3423 |
| 914 | Ga0501082_0058495 | 3300060353 | Bacteria | 3321 |
| 915 | Ga0501082_0080700 | 3300060353 | Bacteria | 2807 |
| 916 | Ga0530510_0014407 | 3300061734 | Bacteria | 5575 |
| 917 | Ga0530510_0076303 | 3300061734 | Bacteria | 2435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10219477 | Ga0307405_102194772 | 310 |
| 2 | 3300005563 | Ga0068855_100003783 | Ga0068855_10000378316 | 311 |
| 3 | 3300025949 | Ga0207667_10240116 | Ga0207667_102401162 | 311 |
| 4 | 3300025898 | Ga0207692_10021047 | Ga0207692_100210472 | 312 |
| 5 | 3300044712 | Ga0453684_0023051 | Ga0453684_0023051_6853_7893 | 314 |
| 6 | 3300042131 | Ga0450894_002673 | Ga0450894_002673_536_1549 | 315 |
| 7 | 3300042133 | Ga0450896_001275 | Ga0450896_001275_1432_2445 | 315 |
| 8 | 3300042147 | Ga0450910_003248 | Ga0450910_003248_615_1628 | 315 |
| 9 | 3300042184 | Ga0450908_000588 | Ga0450908_000588_2399_3412 | 315 |
| 10 | 3300042531 | Ga0450918_005098 | Ga0450918_005098_742_1755 | 315 |
| 11 | 3300028381 | Ga0268264_10139266 | Ga0268264_101392664 | 316 |
| 12 | 3300028800 | Ga0265338_10115220 | Ga0265338_101152202 | 316 |
| 13 | 3300031240 | Ga0265320_10055547 | Ga0265320_100555472 | 316 |
| 14 | 3300031240 | Ga0265320_10098836 | Ga0265320_100988361 | 316 |
| 15 | 3300048909 | Ga0496106_0047472 | Ga0496106_0047472_2182_3207 | 316 |
| 16 | 3300005355 | Ga0070671_100162865 | Ga0070671_1001628653 | 317 |
| 17 | 3300005563 | Ga0068855_100579952 | Ga0068855_1005799522 | 317 |
| 18 | 3300005617 | Ga0068859_100024836 | Ga0068859_1000248362 | 317 |
| 19 | 3300005618 | Ga0068864_100038556 | Ga0068864_1000385562 | 317 |
| 20 | 3300005841 | Ga0068863_100053479 | Ga0068863_1000534795 | 317 |
| 21 | 3300006931 | Ga0097620_100024836 | Ga0097620_1000248362 | 317 |
| 22 | 3300009098 | Ga0105245_10032802 | Ga0105245_100328023 | 317 |
| 23 | 3300009987 | Ga0105030_100593 | Ga0105030_1005932 | 317 |
| 24 | 3300013306 | Ga0163162_10315255 | Ga0163162_103152551 | 317 |
| 25 | 3300014325 | Ga0163163_10056050 | Ga0163163_100560504 | 317 |
| 26 | 3300025927 | Ga0207687_10165291 | Ga0207687_101652911 | 317 |
| 27 | 3300026035 | Ga0207703_10151824 | Ga0207703_101518243 | 317 |
| 28 | 3300026095 | Ga0207676_10019158 | Ga0207676_100191582 | 317 |
| 29 | 3300028379 | Ga0268266_10123187 | Ga0268266_101231872 | 317 |
| 30 | 3300031507 | Ga0307509_10168056 | Ga0307509_101680561 | 317 |
| 31 | 3300031548 | Ga0307408_100023107 | Ga0307408_1000231074 | 317 |
| 32 | 3300031852 | Ga0307410_10041132 | Ga0307410_100411323 | 317 |
| 33 | 3300031901 | Ga0307406_10025491 | Ga0307406_100254914 | 317 |
| 34 | 3300031911 | Ga0307412_10082539 | Ga0307412_100825392 | 317 |
| 35 | 3300031995 | Ga0307409_100075541 | Ga0307409_1000755412 | 317 |
| 36 | 3300032002 | Ga0307416_100002489 | Ga0307416_1000024898 | 317 |
| 37 | 3300032002 | Ga0307416_100024582 | Ga0307416_1000245822 | 317 |
| 38 | 3300032005 | Ga0307411_10002990 | Ga0307411_100029904 | 317 |
| 39 | 3300046460 | Ga0495638_0023913 | Ga0495638_0023913_2427_3446 | 317 |
| 40 | 3300048909 | Ga0496106_0243598 | Ga0496106_0243598_75_1094 | 317 |
| 41 | 3300049583 | Ga0501067_0033510 | Ga0501067_0033510_1157_2167 | 317 |
| 42 | 3300049589 | Ga0501073_0002048 | Ga0501073_0002048_9582_10592 | 317 |
| 43 | 3300049593 | Ga0501077_0032948 | Ga0501077_0032948_56_1066 | 317 |
| 44 | 3300049742 | Ga0501080_0093236 | Ga0501080_0093236_485_1495 | 317 |
| 45 | 3300049744 | Ga0501083_0207454 | Ga0501083_0207454_228_1238 | 317 |
| 46 | 3300054114 | Ga0501084_0080230 | Ga0501084_0080230_47_1057 | 317 |
| 47 | 3300059421 | Ga0590071_003216 | Ga0590071_003216_801_1820 | 317 |
| 48 | 3300060353 | Ga0501082_0002041 | Ga0501082_0002041_16450_17460 | 317 |
| 49 | 3300005337 | Ga0070682_100056380 | Ga0070682_1000563801 | 318 |
| 50 | 3300005467 | Ga0070706_100004299 | Ga0070706_10000429912 | 318 |
| 51 | 3300005468 | Ga0070707_100077664 | Ga0070707_1000776643 | 318 |
| 52 | 3300006195 | Ga0075366_10002514 | Ga0075366_100025144 | 318 |
| 53 | 3300006353 | Ga0075370_10030479 | Ga0075370_100304792 | 318 |
| 54 | 3300009553 | Ga0105249_10363069 | Ga0105249_103630692 | 318 |
| 55 | 3300025910 | Ga0207684_10011731 | Ga0207684_100117312 | 318 |
| 56 | 3300025922 | Ga0207646_10035270 | Ga0207646_100352702 | 318 |
| 57 | 3300031251 | Ga0265327_10065755 | Ga0265327_100657552 | 318 |
| 58 | 3300031911 | Ga0307412_10057419 | Ga0307412_100574193 | 318 |
| 59 | 3300032005 | Ga0307411_10088034 | Ga0307411_100880342 | 318 |
| 60 | 3300032126 | Ga0307415_100019386 | Ga0307415_1000193862 | 318 |
| 61 | 3300042436 | Ga0439435_0000513 | Ga0439435_0000513_3820_4833 | 318 |
| 62 | 3300050496 | nmdc:mga07m45_139536_c1 | nmdc:mga07m45_139536_c1_240_1271 | 318 |
| 63 | 3300005618 | Ga0068864_100019118 | Ga0068864_1000191185 | 319 |
| 64 | 3300009098 | Ga0105245_10006355 | Ga0105245_100063555 | 319 |
| 65 | 3300009174 | Ga0105241_10005410 | Ga0105241_100054106 | 319 |
| 66 | 3300014326 | Ga0157380_10008547 | Ga0157380_100085472 | 319 |
| 67 | 3300025908 | Ga0207643_10003138 | Ga0207643_100031382 | 319 |
| 68 | 3300025911 | Ga0207654_10002858 | Ga0207654_100028584 | 319 |
| 69 | 3300025927 | Ga0207687_10006633 | Ga0207687_100066335 | 319 |
| 70 | 3300026116 | Ga0207674_10013835 | Ga0207674_100138358 | 319 |
| 71 | 3300031824 | Ga0307413_10084019 | Ga0307413_100840192 | 319 |
| 72 | 3300031852 | Ga0307410_10019021 | Ga0307410_100190214 | 319 |
| 73 | 3300032002 | Ga0307416_100039677 | Ga0307416_1000396773 | 319 |
| 74 | 3300032005 | Ga0307411_10054114 | Ga0307411_100541143 | 319 |
| 75 | 3300005543 | Ga0070672_100279081 | Ga0070672_1002790812 | 320 |
| 76 | 3300005841 | Ga0068863_100047852 | Ga0068863_1000478524 | 320 |
| 77 | 3300006042 | Ga0075368_10000722 | Ga0075368_100007224 | 320 |
| 78 | 3300006048 | Ga0075363_100008114 | Ga0075363_1000081143 | 320 |
| 79 | 3300006177 | Ga0075362_10014864 | Ga0075362_100148642 | 320 |
| 80 | 3300006186 | Ga0075369_10014629 | Ga0075369_100146293 | 320 |
| 81 | 3300025940 | Ga0207691_10013491 | Ga0207691_1001349110 | 320 |
| 82 | 3300032004 | Ga0307414_10281233 | Ga0307414_102812332 | 320 |
| 83 | 3300037068 | Ga0373925_0029000 | Ga0373925_0029000_1448_2467 | 320 |
| 84 | 3300050489 | nmdc:mga03683_8519_c1 | nmdc:mga03683_8519_c1_1192_2214 | 320 |
| 85 | 3300050494 | nmdc:mga06z11_23634_c1 | nmdc:mga06z11_23634_c1_1392_2414 | 320 |
| 86 | 3300050507 | nmdc:mga05p37_30717_c1 | nmdc:mga05p37_30717_c1_915_1934 | 320 |
| 87 | 3300005341 | Ga0070691_10183984 | Ga0070691_101839841 | 321 |
| 88 | 3300005353 | Ga0070669_100030927 | Ga0070669_1000309273 | 321 |
| 89 | 3300005844 | Ga0068862_100045310 | Ga0068862_1000453103 | 321 |
| 90 | 3300006358 | Ga0068871_100112023 | Ga0068871_1001120232 | 321 |
| 91 | 3300014326 | Ga0157380_10093870 | Ga0157380_100938702 | 321 |
| 92 | 3300026118 | Ga0207675_100107967 | Ga0207675_1001079672 | 321 |
| 93 | 3300049584 | Ga0501068_0004113 | Ga0501068_0004113_5841_6860 | 321 |
| 94 | 3300049587 | Ga0501071_0042782 | Ga0501071_0042782_1610_2629 | 321 |
| 95 | 3300049588 | Ga0501072_0076600 | Ga0501072_0076600_1586_2605 | 321 |
| 96 | 3300049589 | Ga0501073_0002144 | Ga0501073_0002144_555_1574 | 321 |
| 97 | 3300049590 | Ga0501074_0007859 | Ga0501074_0007859_956_1975 | 321 |
| 98 | 3300049592 | Ga0501076_0247520 | Ga0501076_0247520_121_1140 | 321 |
| 99 | 3300049593 | Ga0501077_0001020 | Ga0501077_0001020_10140_11159 | 321 |
| 100 | 3300049741 | Ga0501079_0005396 | Ga0501079_0005396_1029_2048 | 321 |
| 101 | 3300049742 | Ga0501080_0013052 | Ga0501080_0013052_5454_6473 | 321 |
| 102 | 3300049744 | Ga0501083_0069618 | Ga0501083_0069618_1023_2042 | 321 |
| 103 | 3300053134 | Ga0500658_0017516 | Ga0500658_0017516_946_1968 | 321 |
| 104 | 3300054114 | Ga0501084_0002257 | Ga0501084_0002257_40_1059 | 321 |
| 105 | 3300060353 | Ga0501082_0022288 | Ga0501082_0022288_1620_2639 | 321 |
| 106 | 3300009545 | Ga0105237_10366099 | Ga0105237_103660991 | 322 |
| 107 | 3300031616 | Ga0307508_10004086 | Ga0307508_100040863 | 322 |
| 108 | 3300046794 | Ga0495589_0070497 | Ga0495589_0070497_284_1351 | 322 |
| 109 | 3300048928 | Ga0496125_0116140 | Ga0496125_0116140_63_1115 | 322 |
| 110 | 3300049589 | Ga0501073_0048235 | Ga0501073_0048235_1849_2823 | 322 |
| 111 | 3300003794 | Ga0055531_10000021 | Ga0055531_1000002162 | 323 |
| 112 | 3300005353 | Ga0070669_100029603 | Ga0070669_1000296033 | 323 |
| 113 | 3300005356 | Ga0070674_100024852 | Ga0070674_1000248523 | 323 |
| 114 | 3300005719 | Ga0068861_100058981 | Ga0068861_1000589812 | 323 |
| 115 | 3300005844 | Ga0068862_100020918 | Ga0068862_1000209184 | 323 |
| 116 | 3300009553 | Ga0105249_10106640 | Ga0105249_101066402 | 323 |
| 117 | 3300014326 | Ga0157380_10029395 | Ga0157380_100293952 | 323 |
| 118 | 3300025298 | Ga0209050_1003476 | Ga0209050_10034769 | 323 |
| 119 | 3300025303 | Ga0209051_1019686 | Ga0209051_10196861 | 323 |
| 120 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032458 | 323 |
| 121 | 3300025923 | Ga0207681_10038264 | Ga0207681_100382642 | 323 |
| 122 | 3300026118 | Ga0207675_100191625 | Ga0207675_1001916252 | 323 |
| 123 | 3300028380 | Ga0268265_10019222 | Ga0268265_100192224 | 323 |
| 124 | 3300031995 | Ga0307409_100116957 | Ga0307409_1001169572 | 323 |
| 125 | 3300042438 | Ga0439459_0025938 | Ga0439459_0025938_44_1063 | 323 |
| 126 | 3300044712 | Ga0453684_0508543 | Ga0453684_0508543_34_1032 | 323 |
| 127 | 3300049569 | Ga0501032_0045148 | Ga0501032_0045148_481_1524 | 323 |
| 128 | 3300049571 | Ga0501034_0000624 | Ga0501034_0000624_6825_7868 | 323 |
| 129 | 3300049573 | Ga0501037_0024041 | Ga0501037_0024041_321_1364 | 323 |
| 130 | 3300049575 | Ga0501039_0004090 | Ga0501039_0004090_9008_10051 | 323 |
| 131 | 3300049580 | Ga0501046_0045598 | Ga0501046_0045598_1284_2327 | 323 |
| 132 | 3300049581 | Ga0501047_0022231 | Ga0501047_0022231_3053_4096 | 323 |
| 133 | 3300049583 | Ga0501067_0011858 | Ga0501067_0011858_1151_2194 | 323 |
| 134 | 3300049586 | Ga0501070_0011683 | Ga0501070_0011683_2462_3505 | 323 |
| 135 | 3300049742 | Ga0501080_0038417 | Ga0501080_0038417_573_1616 | 323 |
| 136 | 3300049822 | Ga0501035_0005219 | Ga0501035_0005219_10162_11205 | 323 |
| 137 | 3300049823 | Ga0501044_0000006 | Ga0501044_0000006_242683_243726 | 323 |
| 138 | 3300005295 | Ga0065707_10004891 | Ga0065707_100048912 | 324 |
| 139 | 3300005546 | Ga0070696_100048806 | Ga0070696_1000488062 | 324 |
| 140 | 3300014325 | Ga0163163_10020970 | Ga0163163_100209705 | 324 |
| 141 | 3300028556 | Ga0265337_1000036 | Ga0265337_100003656 | 324 |
| 142 | 3300028800 | Ga0265338_10005377 | Ga0265338_100053779 | 324 |
| 143 | 3300031240 | Ga0265320_10001037 | Ga0265320_100010373 | 324 |
| 144 | 3300031507 | Ga0307509_10182476 | Ga0307509_101824762 | 324 |
| 145 | 3300031712 | Ga0265342_10041127 | Ga0265342_100411272 | 324 |
| 146 | 3300033179 | Ga0307507_10030162 | Ga0307507_100301622 | 324 |
| 147 | 3300042876 | Ga0451577_0153364 | Ga0451577_0153364_1037_2041 | 324 |
| 148 | 3300044693 | Ga0466961_0021251 | Ga0466961_0021251_2963_3955 | 324 |
| 149 | 3300046517 | Ga0495630_0088618 | Ga0495630_0088618_71_1069 | 324 |
| 150 | 3300046528 | Ga0495642_0057302 | Ga0495642_0057302_150_1175 | 324 |
| 151 | 3300047444 | Ga0495675_0118421 | Ga0495675_0118421_249_1247 | 324 |
| 152 | 3300060353 | Ga0501082_0080700 | Ga0501082_0080700_1807_2787 | 324 |
| 153 | iso_pu_bacteria | 2643221579 | 2643906261 | 324 |
| 154 | iso_pu_bacteria | 2643221581 | 2643915281 | 324 |
| 155 | iso_pu_bacteria | 2923516293 | 2923519169 | 324 |
| 156 | 3300005445 | Ga0070708_100116599 | Ga0070708_1001165993 | 325 |
| 157 | 3300005549 | Ga0070704_100181716 | Ga0070704_1001817161 | 325 |
| 158 | 3300006844 | Ga0075428_100094556 | Ga0075428_1000945561 | 325 |
| 159 | 3300006844 | Ga0075428_100175145 | Ga0075428_1001751452 | 325 |
| 160 | 3300009094 | Ga0111539_10350856 | Ga0111539_103508562 | 325 |
| 161 | 3300009177 | Ga0105248_10561510 | Ga0105248_105615102 | 325 |
| 162 | 3300025921 | Ga0207652_10173032 | Ga0207652_101730322 | 325 |
| 163 | 3300031995 | Ga0307409_100419043 | Ga0307409_1004190432 | 325 |
| 164 | 3300032002 | Ga0307416_100019810 | Ga0307416_1000198102 | 325 |
| 165 | 3300032004 | Ga0307414_10281464 | Ga0307414_102814641 | 325 |
| 166 | 3300035114 | Ga0373939_0021767 | Ga0373939_0021767_138_1148 | 325 |
| 167 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_258370_259416 | 325 |
| 168 | 3300044712 | Ga0453684_0000682 | Ga0453684_0000682_14742_15740 | 325 |
| 169 | 3300044712 | Ga0453684_0024764 | Ga0453684_0024764_2122_3120 | 325 |
| 170 | 3300044712 | Ga0453684_0063014 | Ga0453684_0063014_1252_2247 | 325 |
| 171 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_168475_169521 | 325 |
| 172 | 3300045051 | Ga0451576_0001018 | Ga0451576_0001018_38744_39742 | 325 |
| 173 | 3300045051 | Ga0451576_0019148 | Ga0451576_0019148_4859_5854 | 325 |
| 174 | 3300048905 | Ga0496102_0316633 | Ga0496102_0316633_221_1231 | 325 |
| 175 | 3300048909 | Ga0496106_0044803 | Ga0496106_0044803_686_1696 | 325 |
| 176 | 3300049705 | Ga0501225_0024599 | Ga0501225_0024599_517_1527 | 325 |
| 177 | 3300050509 | nmdc:mga0qj67_39250_c1 | nmdc:mga0qj67_39250_c1_1423_2439 | 325 |
| 178 | iso_pu_bacteria | 8002869464 | 8002869549 | 325 |
| 179 | 3300005367 | Ga0070667_100001374 | Ga0070667_10000137415 | 326 |
| 180 | 3300005535 | Ga0070684_100308367 | Ga0070684_1003083671 | 326 |
| 181 | 3300005841 | Ga0068863_100145406 | Ga0068863_1001454062 | 326 |
| 182 | 3300005842 | Ga0068858_100033644 | Ga0068858_1000336444 | 326 |
| 183 | 3300009177 | Ga0105248_10128243 | Ga0105248_101282431 | 326 |
| 184 | 3300009545 | Ga0105237_10034822 | Ga0105237_100348223 | 326 |
| 185 | 3300010375 | Ga0105239_10027248 | Ga0105239_100272483 | 326 |
| 186 | 3300013105 | Ga0157369_10361570 | Ga0157369_103615702 | 326 |
| 187 | 3300013306 | Ga0163162_10090555 | Ga0163162_100905552 | 326 |
| 188 | 3300013308 | Ga0157375_10163922 | Ga0157375_101639222 | 326 |
| 189 | 3300021361 | Ga0213872_10001049 | Ga0213872_100010493 | 326 |
| 190 | 3300021361 | Ga0213872_10002041 | Ga0213872_1000204112 | 326 |
| 191 | 3300025944 | Ga0207661_10007948 | Ga0207661_100079486 | 326 |
| 192 | 3300025986 | Ga0207658_10001308 | Ga0207658_100013085 | 326 |
| 193 | 3300026035 | Ga0207703_10049780 | Ga0207703_100497802 | 326 |
| 194 | 3300026088 | Ga0207641_10132904 | Ga0207641_101329043 | 326 |
| 195 | 3300028794 | Ga0307515_10176197 | Ga0307515_101761973 | 326 |
| 196 | 3300031240 | Ga0265320_10002179 | Ga0265320_1000217913 | 326 |
| 197 | 3300031242 | Ga0265329_10019712 | Ga0265329_100197122 | 326 |
| 198 | 3300031247 | Ga0265340_10020657 | Ga0265340_100206574 | 326 |
| 199 | 3300031250 | Ga0265331_10007063 | Ga0265331_100070632 | 326 |
| 200 | 3300031344 | Ga0265316_10000545 | Ga0265316_1000054527 | 326 |
| 201 | 3300031344 | Ga0265316_10015555 | Ga0265316_100155556 | 326 |
| 202 | 3300031456 | Ga0307513_10011862 | Ga0307513_100118626 | 326 |
| 203 | 3300039447 | Ga0436361_0621527 | Ga0436361_0621527_5099_6094 | 326 |
| 204 | 3300042876 | Ga0451577_0224706 | Ga0451577_0224706_81_1082 | 326 |
| 205 | 3300044712 | Ga0453684_0017209 | Ga0453684_0017209_8277_9275 | 326 |
| 206 | 3300044712 | Ga0453684_0358210 | Ga0453684_0358210_161_1162 | 326 |
| 207 | 3300044735 | Ga0466968_0010602 | Ga0466968_0010602_2516_3529 | 326 |
| 208 | 3300045051 | Ga0451576_0065562 | Ga0451576_0065562_1713_2711 | 326 |
| 209 | 3300045051 | Ga0451576_0173258 | Ga0451576_0173258_1213_2211 | 326 |
| 210 | 3300045976 | Ga0466967_0043524 | Ga0466967_0043524_334_1395 | 326 |
| 211 | 3300048915 | Ga0496112_0016195 | Ga0496112_0016195_480_1469 | 326 |
| 212 | 3300048924 | Ga0496121_0000154 | Ga0496121_0000154_126056_127051 | 326 |
| 213 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_402480_403484 | 326 |
| 214 | 3300050511 | nmdc:mga08y16_41573_c1 | nmdc:mga08y16_41573_c1_1263_2261 | 326 |
| 215 | iso_pu_bacteria | 2998344455 | 2998345603 | 326 |
| 216 | 3300005435 | Ga0070714_100015012 | Ga0070714_1000150123 | 327 |
| 217 | 3300005467 | Ga0070706_100008439 | Ga0070706_1000084396 | 327 |
| 218 | 3300005518 | Ga0070699_100094418 | Ga0070699_1000944181 | 327 |
| 219 | 3300014325 | Ga0163163_10240598 | Ga0163163_102405982 | 327 |
| 220 | 3300025910 | Ga0207684_10001346 | Ga0207684_100013463 | 327 |
| 221 | 3300025929 | Ga0207664_10001478 | Ga0207664_100014787 | 327 |
| 222 | 3300026041 | Ga0207639_10050987 | Ga0207639_100509872 | 327 |
| 223 | 3300031548 | Ga0307408_100112327 | Ga0307408_1001123272 | 327 |
| 224 | 3300031852 | Ga0307410_10033519 | Ga0307410_100335191 | 327 |
| 225 | 3300031852 | Ga0307410_10069507 | Ga0307410_100695073 | 327 |
| 226 | 3300031995 | Ga0307409_100133992 | Ga0307409_1001339923 | 327 |
| 227 | 3300032002 | Ga0307416_100139886 | Ga0307416_1001398863 | 327 |
| 228 | 3300037471 | Ga0395905_0444276 | Ga0395905_0444276_66_1076 | 327 |
| 229 | 3300037853 | Ga0436364_0618718 | Ga0436364_0618718_261_1268 | 327 |
| 230 | 3300044656 | Ga0466969_0066095 | Ga0466969_0066095_276_1274 | 327 |
| 231 | 3300044683 | Ga0466965_0072811 | Ga0466965_0072811_395_1393 | 327 |
| 232 | 3300044693 | Ga0466961_0076286 | Ga0466961_0076286_989_1987 | 327 |
| 233 | 3300044719 | Ga0466971_0011291 | Ga0466971_0011291_2202_3200 | 327 |
| 234 | 3300044765 | Ga0466970_0040730 | Ga0466970_0040730_1200_2198 | 327 |
| 235 | 3300045049 | Ga0466959_0153855 | Ga0466959_0153855_346_1344 | 327 |
| 236 | 3300048917 | Ga0496114_0012813 | Ga0496114_0012813_1448_2464 | 327 |
| 237 | 3300048929 | Ga0496126_0032642 | Ga0496126_0032642_2108_3124 | 327 |
| 238 | 3300053153 | Ga0500616_0014220 | Ga0500616_0014220_716_1750 | 327 |
| 239 | iso_pu_bacteria | 2643221654 | 2644304584 | 327 |
| 240 | 3300005327 | Ga0070658_10046904 | Ga0070658_100469041 | 328 |
| 241 | 3300005335 | Ga0070666_10011356 | Ga0070666_100113564 | 328 |
| 242 | 3300005336 | Ga0070680_100030265 | Ga0070680_1000302653 | 328 |
| 243 | 3300005340 | Ga0070689_100027922 | Ga0070689_1000279224 | 328 |
| 244 | 3300005365 | Ga0070688_100079911 | Ga0070688_1000799112 | 328 |
| 245 | 3300005367 | Ga0070667_100191696 | Ga0070667_1001916962 | 328 |
| 246 | 3300005440 | Ga0070705_100107992 | Ga0070705_1001079921 | 328 |
| 247 | 3300005441 | Ga0070700_100270871 | Ga0070700_1002708712 | 328 |
| 248 | 3300005458 | Ga0070681_10018041 | Ga0070681_100180415 | 328 |
| 249 | 3300005471 | Ga0070698_100029606 | Ga0070698_1000296064 | 328 |
| 250 | 3300005530 | Ga0070679_100043671 | Ga0070679_1000436712 | 328 |
| 251 | 3300005544 | Ga0070686_100006706 | Ga0070686_1000067063 | 328 |
| 252 | 3300005577 | Ga0068857_100019781 | Ga0068857_1000197813 | 328 |
| 253 | 3300005618 | Ga0068864_100013022 | Ga0068864_1000130223 | 328 |
| 254 | 3300005618 | Ga0068864_100044522 | Ga0068864_1000445222 | 328 |
| 255 | 3300005719 | Ga0068861_100017794 | Ga0068861_1000177944 | 328 |
| 256 | 3300005841 | Ga0068863_100114747 | Ga0068863_1001147473 | 328 |
| 257 | 3300005842 | Ga0068858_100080622 | Ga0068858_1000806222 | 328 |
| 258 | 3300005842 | Ga0068858_100126380 | Ga0068858_1001263803 | 328 |
| 259 | 3300005843 | Ga0068860_100015154 | Ga0068860_1000151544 | 328 |
| 260 | 3300005843 | Ga0068860_100395056 | Ga0068860_1003950562 | 328 |
| 261 | 3300005937 | Ga0081455_10002830 | Ga0081455_1000283016 | 328 |
| 262 | 3300006237 | Ga0097621_100064092 | Ga0097621_1000640923 | 328 |
| 263 | 3300006846 | Ga0075430_100061087 | Ga0075430_1000610872 | 328 |
| 264 | 3300009093 | Ga0105240_10398596 | Ga0105240_103985962 | 328 |
| 265 | 3300009098 | Ga0105245_10018544 | Ga0105245_100185445 | 328 |
| 266 | 3300009177 | Ga0105248_10169907 | Ga0105248_101699072 | 328 |
| 267 | 3300009177 | Ga0105248_10196339 | Ga0105248_101963392 | 328 |
| 268 | 3300009177 | Ga0105248_10210892 | Ga0105248_102108922 | 328 |
| 269 | 3300009545 | Ga0105237_10146244 | Ga0105237_101462442 | 328 |
| 270 | 3300009551 | Ga0105238_10136709 | Ga0105238_101367092 | 328 |
| 271 | 3300009551 | Ga0105238_10496342 | Ga0105238_104963422 | 328 |
| 272 | 3300010375 | Ga0105239_10122351 | Ga0105239_101223512 | 328 |
| 273 | 3300013306 | Ga0163162_10029974 | Ga0163162_100299745 | 328 |
| 274 | 3300013306 | Ga0163162_10300956 | Ga0163162_103009562 | 328 |
| 275 | 3300013307 | Ga0157372_10063316 | Ga0157372_100633163 | 328 |
| 276 | 3300013308 | Ga0157375_10010290 | Ga0157375_100102903 | 328 |
| 277 | 3300014325 | Ga0163163_10000581 | Ga0163163_1000058110 | 328 |
| 278 | 3300014325 | Ga0163163_10007008 | Ga0163163_100070087 | 328 |
| 279 | 3300014968 | Ga0157379_10032827 | Ga0157379_100328272 | 328 |
| 280 | 3300014969 | Ga0157376_10082537 | Ga0157376_100825372 | 328 |
| 281 | 3300025903 | Ga0207680_10058821 | Ga0207680_100588212 | 328 |
| 282 | 3300025909 | Ga0207705_10092388 | Ga0207705_100923882 | 328 |
| 283 | 3300025912 | Ga0207707_10026761 | Ga0207707_100267614 | 328 |
| 284 | 3300025913 | Ga0207695_10271372 | Ga0207695_102713722 | 328 |
| 285 | 3300025919 | Ga0207657_10001958 | Ga0207657_1000195819 | 328 |
| 286 | 3300025921 | Ga0207652_10124083 | Ga0207652_101240832 | 328 |
| 287 | 3300025921 | Ga0207652_10179960 | Ga0207652_101799602 | 328 |
| 288 | 3300025924 | Ga0207694_10122990 | Ga0207694_101229902 | 328 |
| 289 | 3300025927 | Ga0207687_10051594 | Ga0207687_100515942 | 328 |
| 290 | 3300025936 | Ga0207670_10006499 | Ga0207670_100064993 | 328 |
| 291 | 3300025941 | Ga0207711_10108679 | Ga0207711_101086792 | 328 |
| 292 | 3300025941 | Ga0207711_10368373 | Ga0207711_103683732 | 328 |
| 293 | 3300025942 | Ga0207689_10247593 | Ga0207689_102475931 | 328 |
| 294 | 3300025949 | Ga0207667_10017868 | Ga0207667_100178686 | 328 |
| 295 | 3300025986 | Ga0207658_10120070 | Ga0207658_101200702 | 328 |
| 296 | 3300026035 | Ga0207703_10110285 | Ga0207703_101102852 | 328 |
| 297 | 3300026035 | Ga0207703_10247097 | Ga0207703_102470972 | 328 |
| 298 | 3300026041 | Ga0207639_10434845 | Ga0207639_104348451 | 328 |
| 299 | 3300026075 | Ga0207708_10311928 | Ga0207708_103119281 | 328 |
| 300 | 3300026088 | Ga0207641_10116855 | Ga0207641_101168552 | 328 |
| 301 | 3300026095 | Ga0207676_10012644 | Ga0207676_100126441 | 328 |
| 302 | 3300026095 | Ga0207676_10015397 | Ga0207676_100153972 | 328 |
| 303 | 3300026116 | Ga0207674_10024871 | Ga0207674_100248713 | 328 |
| 304 | 3300026118 | Ga0207675_100004168 | Ga0207675_1000041689 | 328 |
| 305 | 3300026142 | Ga0207698_10192223 | Ga0207698_101922232 | 328 |
| 306 | 3300028381 | Ga0268264_10066388 | Ga0268264_100663882 | 328 |
| 307 | 3300028381 | Ga0268264_10453998 | Ga0268264_104539981 | 328 |
| 308 | 3300028666 | Ga0265336_10000372 | Ga0265336_1000037220 | 328 |
| 309 | 3300028794 | Ga0307515_10043062 | Ga0307515_100430627 | 328 |
| 310 | 3300028800 | Ga0265338_10006215 | Ga0265338_100062156 | 328 |
| 311 | 3300028800 | Ga0265338_10103246 | Ga0265338_101032461 | 328 |
| 312 | 3300028800 | Ga0265338_10199449 | Ga0265338_101994492 | 328 |
| 313 | 3300029957 | Ga0265324_10000002 | Ga0265324_10000002224 | 328 |
| 314 | 3300031238 | Ga0265332_10082350 | Ga0265332_100823502 | 328 |
| 315 | 3300031241 | Ga0265325_10001332 | Ga0265325_1000133211 | 328 |
| 316 | 3300031241 | Ga0265325_10134006 | Ga0265325_101340061 | 328 |
| 317 | 3300031250 | Ga0265331_10013992 | Ga0265331_100139926 | 328 |
| 318 | 3300031250 | Ga0265331_10019773 | Ga0265331_100197732 | 328 |
| 319 | 3300031251 | Ga0265327_10001422 | Ga0265327_1000142235 | 328 |
| 320 | 3300036401 | Ga0373937_0331100 | Ga0373937_0331100_321_1325 | 328 |
| 321 | 3300039145 | Ga0237816_00009 | Ga0237816_00009_11212_12234 | 328 |
| 322 | 3300039447 | Ga0436361_1088302 | Ga0436361_1088302_10309_11310 | 328 |
| 323 | 3300044656 | Ga0466969_0031267 | Ga0466969_0031267_1105_2112 | 328 |
| 324 | 3300044712 | Ga0453684_0031025 | Ga0453684_0031025_1975_2994 | 328 |
| 325 | 3300044712 | Ga0453684_0062444 | Ga0453684_0062444_1507_2523 | 328 |
| 326 | 3300044712 | Ga0453684_0117173 | Ga0453684_0117173_334_1338 | 328 |
| 327 | 3300045049 | Ga0466959_0071909 | Ga0466959_0071909_1337_2344 | 328 |
| 328 | 3300049571 | Ga0501034_0132433 | Ga0501034_0132433_588_1589 | 328 |
| 329 | 3300049576 | Ga0501040_0159206 | Ga0501040_0159206_470_1477 | 328 |
| 330 | 3300049577 | Ga0501041_0092447 | Ga0501041_0092447_17_1018 | 328 |
| 331 | 3300049587 | Ga0501071_0126805 | Ga0501071_0126805_26_1033 | 328 |
| 332 | 3300049588 | Ga0501072_0049582 | Ga0501072_0049582_1422_2429 | 328 |
| 333 | 3300049588 | Ga0501072_0279960 | Ga0501072_0279960_54_1061 | 328 |
| 334 | 3300049592 | Ga0501076_0097775 | Ga0501076_0097775_961_1962 | 328 |
| 335 | 3300053087 | Ga0500643_000017 | Ga0500643_000017_282312_283313 | 328 |
| 336 | 3300053090 | Ga0500646_0040156 | Ga0500646_0040156_157_1158 | 328 |
| 337 | 3300053116 | Ga0500592_007244 | Ga0500592_007244_355_1356 | 328 |
| 338 | 3300053139 | Ga0500568_0015780 | Ga0500568_0015780_1376_2377 | 328 |
| 339 | 3300054114 | Ga0501084_0152476 | Ga0501084_0152476_402_1415 | 328 |
| 340 | 3300060353 | Ga0501082_0021283 | Ga0501082_0021283_3786_4799 | 328 |
| 341 | iso_pu_bacteria | 2788500588 | 2791215019 | 328 |
| 342 | iso_pu_bacteria | 2818991451 | 2819629403 | 328 |
| 343 | iso_pu_bacteria | 2891633521 | 2891633832 | 328 |
| 344 | iso_pu_bacteria | 2904606771 | 2904610201 | 328 |
| 345 | iso_pu_bacteria | 2928510474 | 2928511194 | 328 |
| 346 | 3300003316 | rootH1_10007030 | rootH1_100070303 | 329 |
| 347 | 3300003320 | rootH2_10004548 | rootH2_1000454824 | 329 |
| 348 | 3300005334 | Ga0068869_100037247 | Ga0068869_1000372472 | 329 |
| 349 | 3300005336 | Ga0070680_100029862 | Ga0070680_1000298623 | 329 |
| 350 | 3300005345 | Ga0070692_10021798 | Ga0070692_100217981 | 329 |
| 351 | 3300005439 | Ga0070711_100210045 | Ga0070711_1002100452 | 329 |
| 352 | 3300005440 | Ga0070705_100000065 | Ga0070705_10000006525 | 329 |
| 353 | 3300005441 | Ga0070700_100002159 | Ga0070700_1000021592 | 329 |
| 354 | 3300005444 | Ga0070694_100040652 | Ga0070694_1000406523 | 329 |
| 355 | 3300005445 | Ga0070708_100008257 | Ga0070708_1000082576 | 329 |
| 356 | 3300005455 | Ga0070663_100044090 | Ga0070663_1000440903 | 329 |
| 357 | 3300005457 | Ga0070662_100040713 | Ga0070662_1000407133 | 329 |
| 358 | 3300005458 | Ga0070681_10027325 | Ga0070681_100273254 | 329 |
| 359 | 3300005467 | Ga0070706_100166218 | Ga0070706_1001662181 | 329 |
| 360 | 3300005471 | Ga0070698_100002008 | Ga0070698_1000020082 | 329 |
| 361 | 3300005518 | Ga0070699_100000803 | Ga0070699_10000080326 | 329 |
| 362 | 3300005518 | Ga0070699_100001531 | Ga0070699_1000015313 | 329 |
| 363 | 3300005530 | Ga0070679_100124029 | Ga0070679_1001240292 | 329 |
| 364 | 3300005536 | Ga0070697_100083886 | Ga0070697_1000838862 | 329 |
| 365 | 3300005545 | Ga0070695_100003473 | Ga0070695_1000034735 | 329 |
| 366 | 3300005546 | Ga0070696_100000981 | Ga0070696_10000098110 | 329 |
| 367 | 3300005547 | Ga0070693_100047938 | Ga0070693_1000479382 | 329 |
| 368 | 3300005549 | Ga0070704_100000957 | Ga0070704_10000095710 | 329 |
| 369 | 3300005577 | Ga0068857_100011381 | Ga0068857_1000113814 | 329 |
| 370 | 3300005615 | Ga0070702_100089649 | Ga0070702_1000896491 | 329 |
| 371 | 3300005617 | Ga0068859_100006156 | Ga0068859_1000061569 | 329 |
| 372 | 3300005618 | Ga0068864_100142154 | Ga0068864_1001421542 | 329 |
| 373 | 3300005842 | Ga0068858_100289504 | Ga0068858_1002895042 | 329 |
| 374 | 3300005843 | Ga0068860_100001588 | Ga0068860_1000015884 | 329 |
| 375 | 3300005843 | Ga0068860_100031216 | Ga0068860_1000312164 | 329 |
| 376 | 3300005844 | Ga0068862_100001016 | Ga0068862_10000101624 | 329 |
| 377 | 3300006051 | Ga0075364_10092593 | Ga0075364_100925932 | 329 |
| 378 | 3300006195 | Ga0075366_10002866 | Ga0075366_100028664 | 329 |
| 379 | 3300006353 | Ga0075370_10015223 | Ga0075370_100152232 | 329 |
| 380 | 3300006847 | Ga0075431_100005884 | Ga0075431_1000058843 | 329 |
| 381 | 3300006852 | Ga0075433_10000078 | Ga0075433_100000787 | 329 |
| 382 | 3300006871 | Ga0075434_100000130 | Ga0075434_10000013024 | 329 |
| 383 | 3300006880 | Ga0075429_100015699 | Ga0075429_1000156995 | 329 |
| 384 | 3300006931 | Ga0097620_100006156 | Ga0097620_1000061569 | 329 |
| 385 | 3300007076 | Ga0075435_100011495 | Ga0075435_1000114952 | 329 |
| 386 | 3300009094 | Ga0111539_10112515 | Ga0111539_101125152 | 329 |
| 387 | 3300025304 | Ga0209257_1000560 | Ga0209257_100056030 | 329 |
| 388 | 3300025885 | Ga0207653_10001196 | Ga0207653_100011965 | 329 |
| 389 | 3300025910 | Ga0207684_10071796 | Ga0207684_100717963 | 329 |
| 390 | 3300025912 | Ga0207707_10021578 | Ga0207707_100215783 | 329 |
| 391 | 3300025917 | Ga0207660_10013268 | Ga0207660_100132682 | 329 |
| 392 | 3300025921 | Ga0207652_10187832 | Ga0207652_101878322 | 329 |
| 393 | 3300025933 | Ga0207706_10055217 | Ga0207706_100552173 | 329 |
| 394 | 3300025942 | Ga0207689_10063711 | Ga0207689_100637113 | 329 |
| 395 | 3300025945 | Ga0207679_10009673 | Ga0207679_100096736 | 329 |
| 396 | 3300025961 | Ga0207712_10008312 | Ga0207712_100083123 | 329 |
| 397 | 3300026067 | Ga0207678_10016427 | Ga0207678_100164275 | 329 |
| 398 | 3300026075 | Ga0207708_10016719 | Ga0207708_100167192 | 329 |
| 399 | 3300026095 | Ga0207676_10108431 | Ga0207676_101084312 | 329 |
| 400 | 3300026116 | Ga0207674_10001364 | Ga0207674_1000136420 | 329 |
| 401 | 3300027907 | Ga0207428_10083819 | Ga0207428_100838192 | 329 |
| 402 | 3300028380 | Ga0268265_10003611 | Ga0268265_100036113 | 329 |
| 403 | 3300028381 | Ga0268264_10001894 | Ga0268264_1000189410 | 329 |
| 404 | 3300028381 | Ga0268264_10014526 | Ga0268264_100145264 | 329 |
| 405 | 3300031239 | Ga0265328_10001458 | Ga0265328_1000145812 | 329 |
| 406 | 3300031250 | Ga0265331_10005681 | Ga0265331_100056816 | 329 |
| 407 | 3300031250 | Ga0265331_10077121 | Ga0265331_100771212 | 329 |
| 408 | 3300031251 | Ga0265327_10000213 | Ga0265327_1000021362 | 329 |
| 409 | 3300031251 | Ga0265327_10007133 | Ga0265327_100071336 | 329 |
| 410 | 3300031456 | Ga0307513_10018254 | Ga0307513_100182544 | 329 |
| 411 | 3300031852 | Ga0307410_10288594 | Ga0307410_102885942 | 329 |
| 412 | 3300033180 | Ga0307510_10000812 | Ga0307510_1000081226 | 329 |
| 413 | 3300035691 | Ga0373931_0100224 | Ga0373931_0100224_313_1320 | 329 |
| 414 | 3300035695 | Ga0373927_0154282 | Ga0373927_0154282_469_1476 | 329 |
| 415 | 3300041413 | Ga0439465_0005927 | Ga0439465_0005927_1762_2784 | 329 |
| 416 | 3300041413 | Ga0439465_0013218 | Ga0439465_0013218_728_1762 | 329 |
| 417 | 3300041460 | Ga0451802_0170293 | Ga0451802_0170293_1785_2807 | 329 |
| 418 | 3300041486 | Ga0451807_1837847 | Ga0451807_1837847_132_1154 | 329 |
| 419 | 3300041486 | Ga0451807_2577330 | Ga0451807_2577330_416_1438 | 329 |
| 420 | 3300041494 | Ga0451837_1564041 | Ga0451837_1564041_430_1452 | 329 |
| 421 | 3300042004 | Ga0439445_0006065 | Ga0439445_0006065_682_1704 | 329 |
| 422 | 3300042007 | Ga0439449_0000114 | Ga0439449_0000114_22304_23338 | 329 |
| 423 | 3300042007 | Ga0439449_0003134 | Ga0439449_0003134_585_1607 | 329 |
| 424 | 3300044683 | Ga0466965_0045036 | Ga0466965_0045036_764_1768 | 329 |
| 425 | 3300046462 | Ga0495651_0008790 | Ga0495651_0008790_6369_7385 | 329 |
| 426 | 3300046511 | Ga0495608_0053871 | Ga0495608_0053871_1275_2291 | 329 |
| 427 | 3300046514 | Ga0495618_0038290 | Ga0495618_0038290_219_1226 | 329 |
| 428 | 3300046516 | Ga0495628_0000851 | Ga0495628_0000851_3023_4039 | 329 |
| 429 | 3300046525 | Ga0495663_0000771 | Ga0495663_0000771_4190_5212 | 329 |
| 430 | 3300046529 | Ga0495652_0022954 | Ga0495652_0022954_116_1132 | 329 |
| 431 | 3300046679 | Ga0495623_0003893 | Ga0495623_0003893_1307_2323 | 329 |
| 432 | 3300046692 | Ga0495671_0023334 | Ga0495671_0023334_835_1857 | 329 |
| 433 | 3300048088 | Ga0495602_0053021 | Ga0495602_0053021_926_1942 | 329 |
| 434 | 3300048925 | Ga0496122_0015448 | Ga0496122_0015448_3067_4089 | 329 |
| 435 | 3300049568 | Ga0501031_0015028 | Ga0501031_0015028_2654_3655 | 329 |
| 436 | 3300049568 | Ga0501031_0237182 | Ga0501031_0237182_121_1158 | 329 |
| 437 | 3300049569 | Ga0501032_0000570 | Ga0501032_0000570_22435_23436 | 329 |
| 438 | 3300049569 | Ga0501032_0199742 | Ga0501032_0199742_109_1116 | 329 |
| 439 | 3300049570 | Ga0501033_0001988 | Ga0501033_0001988_3927_4928 | 329 |
| 440 | 3300049572 | Ga0501036_0153587 | Ga0501036_0153587_494_1495 | 329 |
| 441 | 3300049573 | Ga0501037_0003745 | Ga0501037_0003745_9118_10119 | 329 |
| 442 | 3300049574 | Ga0501038_0000379 | Ga0501038_0000379_30111_31112 | 329 |
| 443 | 3300049575 | Ga0501039_0008947 | Ga0501039_0008947_3404_4405 | 329 |
| 444 | 3300049577 | Ga0501041_0016666 | Ga0501041_0016666_2253_3290 | 329 |
| 445 | 3300049578 | Ga0501042_0023337 | Ga0501042_0023337_1433_2434 | 329 |
| 446 | 3300049578 | Ga0501042_0034928 | Ga0501042_0034928_1658_2695 | 329 |
| 447 | 3300049580 | Ga0501046_0025272 | Ga0501046_0025272_2001_3008 | 329 |
| 448 | 3300049580 | Ga0501046_0235228 | Ga0501046_0235228_205_1206 | 329 |
| 449 | 3300049582 | Ga0501048_0095559 | Ga0501048_0095559_800_1837 | 329 |
| 450 | 3300049584 | Ga0501068_0000124 | Ga0501068_0000124_21255_22262 | 329 |
| 451 | 3300049584 | Ga0501068_0067320 | Ga0501068_0067320_844_1845 | 329 |
| 452 | 3300049588 | Ga0501072_0104811 | Ga0501072_0104811_1144_2181 | 329 |
| 453 | 3300049589 | Ga0501073_0000399 | Ga0501073_0000399_14639_15646 | 329 |
| 454 | 3300049590 | Ga0501074_0078476 | Ga0501074_0078476_69_1112 | 329 |
| 455 | 3300049591 | Ga0501075_0017516 | Ga0501075_0017516_3303_4340 | 329 |
| 456 | 3300049593 | Ga0501077_0009846 | Ga0501077_0009846_2357_3394 | 329 |
| 457 | 3300049741 | Ga0501079_0027691 | Ga0501079_0027691_1391_2428 | 329 |
| 458 | 3300049741 | Ga0501079_0122552 | Ga0501079_0122552_292_1299 | 329 |
| 459 | 3300049742 | Ga0501080_0000192 | Ga0501080_0000192_21687_22694 | 329 |
| 460 | 3300049743 | Ga0501081_0043527 | Ga0501081_0043527_1329_2366 | 329 |
| 461 | 3300049822 | Ga0501035_0006345 | Ga0501035_0006345_5015_6016 | 329 |
| 462 | 3300049823 | Ga0501044_0033679 | Ga0501044_0033679_3927_4928 | 329 |
| 463 | 3300049824 | Ga0501045_0084137 | Ga0501045_0084137_752_1789 | 329 |
| 464 | 3300050493 | nmdc:mga0k408_5851_c1 | nmdc:mga0k408_5851_c1_3700_4722 | 329 |
| 465 | 3300050507 | nmdc:mga05p37_109305_c1 | nmdc:mga05p37_109305_c1_1577_2599 | 329 |
| 466 | 3300050510 | nmdc:mga06r32_514283_c1 | nmdc:mga06r32_514283_c1_26_1048 | 329 |
| 467 | 3300050512 | nmdc:mga0n895_7001_c1 | nmdc:mga0n895_7001_c1_1387_2397 | 329 |
| 468 | 3300050513 | nmdc:mga0rr50_49618_c1 | nmdc:mga0rr50_49618_c1_1280_2290 | 329 |
| 469 | 3300050515 | nmdc:mga0a205_3811_c1 | nmdc:mga0a205_3811_c1_8865_9875 | 329 |
| 470 | 3300053096 | Ga0500641_0009333 | Ga0500641_0009333_2052_3053 | 329 |
| 471 | 3300053131 | Ga0500652_057116 | Ga0500652_057116_249_1274 | 329 |
| 472 | 3300054114 | Ga0501084_0046081 | Ga0501084_0046081_2386_3423 | 329 |
| 473 | 3300059423 | Ga0590074_002183 | Ga0590074_002183_737_1774 | 329 |
| 474 | 3300060353 | Ga0501082_0055186 | Ga0501082_0055186_878_1879 | 329 |
| 475 | 3300060353 | Ga0501082_0058495 | Ga0501082_0058495_1972_2979 | 329 |
| 476 | 3300061734 | Ga0530510_0076303 | Ga0530510_0076303_496_1533 | 329 |
| 477 | iso_pu_bacteria | 2842780639 | 2842781603 | 329 |
| 478 | iso_pu_bacteria | 2956897341 | 2956899594 | 329 |
| 479 | 3300005328 | Ga0070676_10097891 | Ga0070676_100978912 | 330 |
| 480 | 3300005334 | Ga0068869_100041914 | Ga0068869_1000419143 | 330 |
| 481 | 3300005334 | Ga0068869_100113601 | Ga0068869_1001136012 | 330 |
| 482 | 3300005347 | Ga0070668_100053228 | Ga0070668_1000532282 | 330 |
| 483 | 3300005354 | Ga0070675_100028893 | Ga0070675_1000288934 | 330 |
| 484 | 3300005367 | Ga0070667_100048507 | Ga0070667_1000485072 | 330 |
| 485 | 3300005436 | Ga0070713_100068985 | Ga0070713_1000689852 | 330 |
| 486 | 3300005439 | Ga0070711_100115817 | Ga0070711_1001158171 | 330 |
| 487 | 3300005468 | Ga0070707_100122433 | Ga0070707_1001224332 | 330 |
| 488 | 3300005535 | Ga0070684_100290072 | Ga0070684_1002900722 | 330 |
| 489 | 3300005549 | Ga0070704_100018232 | Ga0070704_1000182323 | 330 |
| 490 | 3300005577 | Ga0068857_100007394 | Ga0068857_1000073942 | 330 |
| 491 | 3300005617 | Ga0068859_100150486 | Ga0068859_1001504863 | 330 |
| 492 | 3300005618 | Ga0068864_100068615 | Ga0068864_1000686152 | 330 |
| 493 | 3300005719 | Ga0068861_100098578 | Ga0068861_1000985783 | 330 |
| 494 | 3300006042 | Ga0075368_10025721 | Ga0075368_100257212 | 330 |
| 495 | 3300006048 | Ga0075363_100034561 | Ga0075363_1000345613 | 330 |
| 496 | 3300006051 | Ga0075364_10054272 | Ga0075364_100542722 | 330 |
| 497 | 3300006178 | Ga0075367_10003740 | Ga0075367_100037407 | 330 |
| 498 | 3300006178 | Ga0075367_10042665 | Ga0075367_100426652 | 330 |
| 499 | 3300006186 | Ga0075369_10016368 | Ga0075369_100163682 | 330 |
| 500 | 3300006195 | Ga0075366_10014707 | Ga0075366_100147073 | 330 |
| 501 | 3300006353 | Ga0075370_10001660 | Ga0075370_100016603 | 330 |
| 502 | 3300006353 | Ga0075370_10008951 | Ga0075370_100089512 | 330 |
| 503 | 3300006353 | Ga0075370_10020532 | Ga0075370_100205324 | 330 |
| 504 | 3300006881 | Ga0068865_100102141 | Ga0068865_1001021412 | 330 |
| 505 | 3300006931 | Ga0097620_100150477 | Ga0097620_1001504773 | 330 |
| 506 | 3300009094 | Ga0111539_10003393 | Ga0111539_1000339315 | 330 |
| 507 | 3300009177 | Ga0105248_10041536 | Ga0105248_100415364 | 330 |
| 508 | 3300009177 | Ga0105248_10247795 | Ga0105248_102477952 | 330 |
| 509 | 3300009545 | Ga0105237_10011239 | Ga0105237_100112393 | 330 |
| 510 | 3300009545 | Ga0105237_10036944 | Ga0105237_100369443 | 330 |
| 511 | 3300010375 | Ga0105239_10284092 | Ga0105239_102840922 | 330 |
| 512 | 3300013308 | Ga0157375_10026843 | Ga0157375_100268432 | 330 |
| 513 | 3300014326 | Ga0157380_10007283 | Ga0157380_100072834 | 330 |
| 514 | 3300014745 | Ga0157377_10027772 | Ga0157377_100277722 | 330 |
| 515 | 3300025914 | Ga0207671_10103513 | Ga0207671_101035132 | 330 |
| 516 | 3300025916 | Ga0207663_10241074 | Ga0207663_102410742 | 330 |
| 517 | 3300025926 | Ga0207659_10048124 | Ga0207659_100481243 | 330 |
| 518 | 3300025928 | Ga0207700_10063551 | Ga0207700_100635512 | 330 |
| 519 | 3300025937 | Ga0207669_10040969 | Ga0207669_100409693 | 330 |
| 520 | 3300025941 | Ga0207711_10022130 | Ga0207711_100221304 | 330 |
| 521 | 3300025941 | Ga0207711_10308941 | Ga0207711_103089411 | 330 |
| 522 | 3300025942 | Ga0207689_10041045 | Ga0207689_100410452 | 330 |
| 523 | 3300025942 | Ga0207689_10068338 | Ga0207689_100683382 | 330 |
| 524 | 3300025944 | Ga0207661_10004129 | Ga0207661_1000412912 | 330 |
| 525 | 3300026041 | Ga0207639_10056189 | Ga0207639_100561892 | 330 |
| 526 | 3300026067 | Ga0207678_10062952 | Ga0207678_100629521 | 330 |
| 527 | 3300026089 | Ga0207648_10116656 | Ga0207648_101166562 | 330 |
| 528 | 3300026089 | Ga0207648_10162729 | Ga0207648_101627291 | 330 |
| 529 | 3300026095 | Ga0207676_10123478 | Ga0207676_101234782 | 330 |
| 530 | 3300026116 | Ga0207674_10016409 | Ga0207674_100164095 | 330 |
| 531 | 3300026116 | Ga0207674_10174327 | Ga0207674_101743272 | 330 |
| 532 | 3300026118 | Ga0207675_100122486 | Ga0207675_1001224862 | 330 |
| 533 | 3300028380 | Ga0268265_10065770 | Ga0268265_100657702 | 330 |
| 534 | 3300028794 | Ga0307515_10022552 | Ga0307515_100225523 | 330 |
| 535 | 3300028794 | Ga0307515_10137256 | Ga0307515_101372561 | 330 |
| 536 | 3300028800 | Ga0265338_10049198 | Ga0265338_100491983 | 330 |
| 537 | 3300031507 | Ga0307509_10003789 | Ga0307509_100037892 | 330 |
| 538 | 3300031548 | Ga0307408_100130882 | Ga0307408_1001308822 | 330 |
| 539 | 3300031595 | Ga0265313_10007576 | Ga0265313_100075765 | 330 |
| 540 | 3300031616 | Ga0307508_10005039 | Ga0307508_100050397 | 330 |
| 541 | 3300031852 | Ga0307410_10136222 | Ga0307410_101362222 | 330 |
| 542 | 3300031995 | Ga0307409_100049227 | Ga0307409_1000492272 | 330 |
| 543 | 3300032002 | Ga0307416_100463005 | Ga0307416_1004630051 | 330 |
| 544 | 3300036401 | Ga0373937_0128660 | Ga0373937_0128660_1324_2337 | 330 |
| 545 | 3300037471 | Ga0395905_0019247 | Ga0395905_0019247_997_2007 | 330 |
| 546 | 3300041410 | Ga0439461_0000411 | Ga0439461_0000411_5119_6132 | 330 |
| 547 | 3300042134 | Ga0450898_000329 | Ga0450898_000329_3404_4417 | 330 |
| 548 | 3300042156 | Ga0439446_0000379 | Ga0439446_0000379_5040_6053 | 330 |
| 549 | 3300042435 | Ga0439434_0001027 | Ga0439434_0001027_4306_5319 | 330 |
| 550 | 3300042876 | Ga0451577_0011223 | Ga0451577_0011223_4407_5417 | 330 |
| 551 | 3300044658 | Ga0466972_0016607 | Ga0466972_0016607_329_1381 | 330 |
| 552 | 3300044712 | Ga0453684_0002254 | Ga0453684_0002254_8606_9622 | 330 |
| 553 | 3300046512 | Ga0495610_0032043 | Ga0495610_0032043_1161_2198 | 330 |
| 554 | 3300046524 | Ga0495648_0081810 | Ga0495648_0081810_19_1047 | 330 |
| 555 | 3300046542 | Ga0495597_0004870 | Ga0495597_0004870_1554_2582 | 330 |
| 556 | 3300046660 | Ga0495625_0008867 | Ga0495625_0008867_1111_2139 | 330 |
| 557 | 3300046810 | Ga0495660_0050459 | Ga0495660_0050459_478_1506 | 330 |
| 558 | 3300047443 | Ga0495687_000128 | Ga0495687_000128_34344_35372 | 330 |
| 559 | 3300047443 | Ga0495687_036927 | Ga0495687_036927_437_1465 | 330 |
| 560 | 3300048905 | Ga0496102_0264693 | Ga0496102_0264693_539_1546 | 330 |
| 561 | 3300048905 | Ga0496102_0386208 | Ga0496102_0386208_228_1235 | 330 |
| 562 | 3300048909 | Ga0496106_0316904 | Ga0496106_0316904_161_1168 | 330 |
| 563 | 3300048912 | Ga0496109_0499624 | Ga0496109_0499624_75_1082 | 330 |
| 564 | 3300049571 | Ga0501034_0180034 | Ga0501034_0180034_343_1356 | 330 |
| 565 | 3300049572 | Ga0501036_0047782 | Ga0501036_0047782_1902_2915 | 330 |
| 566 | 3300049573 | Ga0501037_0040775 | Ga0501037_0040775_68_1081 | 330 |
| 567 | 3300049574 | Ga0501038_0024509 | Ga0501038_0024509_3629_4651 | 330 |
| 568 | 3300049575 | Ga0501039_0007955 | Ga0501039_0007955_3060_4073 | 330 |
| 569 | 3300049577 | Ga0501041_0136466 | Ga0501041_0136466_380_1393 | 330 |
| 570 | 3300049582 | Ga0501048_0036307 | Ga0501048_0036307_1037_2050 | 330 |
| 571 | 3300049584 | Ga0501068_0042477 | Ga0501068_0042477_1399_2409 | 330 |
| 572 | 3300049585 | Ga0501069_0059431 | Ga0501069_0059431_432_1454 | 330 |
| 573 | 3300049587 | Ga0501071_0004121 | Ga0501071_0004121_4328_5350 | 330 |
| 574 | 3300049587 | Ga0501071_0264268 | Ga0501071_0264268_17_1030 | 330 |
| 575 | 3300049591 | Ga0501075_0008262 | Ga0501075_0008262_5589_6602 | 330 |
| 576 | 3300049592 | Ga0501076_0007140 | Ga0501076_0007140_3755_4768 | 330 |
| 577 | 3300049822 | Ga0501035_0017905 | Ga0501035_0017905_4507_5520 | 330 |
| 578 | 3300049824 | Ga0501045_0006548 | Ga0501045_0006548_454_1467 | 330 |
| 579 | 3300050489 | nmdc:mga03683_41656_c1 | nmdc:mga03683_41656_c1_31_1059 | 330 |
| 580 | 3300050490 | nmdc:mga03n38_39630_c1 | nmdc:mga03n38_39630_c1_163_1191 | 330 |
| 581 | 3300050491 | nmdc:mga00v17_92398_c1 | nmdc:mga00v17_92398_c1_746_1774 | 330 |
| 582 | 3300050493 | nmdc:mga0k408_167724_c1 | nmdc:mga0k408_167724_c1_169_1197 | 330 |
| 583 | 3300050493 | nmdc:mga0k408_4311_c1 | nmdc:mga0k408_4311_c1_5655_6683 | 330 |
| 584 | 3300050494 | nmdc:mga06z11_1038_c1 | nmdc:mga06z11_1038_c1_4135_5163 | 330 |
| 585 | 3300050496 | nmdc:mga07m45_1267_c1 | nmdc:mga07m45_1267_c1_2949_3977 | 330 |
| 586 | 3300050496 | nmdc:mga07m45_4022_c1 | nmdc:mga07m45_4022_c1_5891_6919 | 330 |
| 587 | 3300050496 | nmdc:mga07m45_42962_c1 | nmdc:mga07m45_42962_c1_654_1664 | 330 |
| 588 | 3300050516 | nmdc:mga0sz30_24059_c1 | nmdc:mga0sz30_24059_c1_842_1870 | 330 |
| 589 | 3300061734 | Ga0530510_0014407 | Ga0530510_0014407_738_1751 | 330 |
| 590 | iso_pu_bacteria | 2643221598 | 2644000900 | 330 |
| 591 | 3300005328 | Ga0070676_10003998 | Ga0070676_100039981 | 331 |
| 592 | 3300005334 | Ga0068869_100001485 | Ga0068869_1000014852 | 331 |
| 593 | 3300005334 | Ga0068869_100009525 | Ga0068869_1000095258 | 331 |
| 594 | 3300005335 | Ga0070666_10006668 | Ga0070666_100066687 | 331 |
| 595 | 3300005335 | Ga0070666_10163935 | Ga0070666_101639351 | 331 |
| 596 | 3300005341 | Ga0070691_10028007 | Ga0070691_100280072 | 331 |
| 597 | 3300005343 | Ga0070687_100043197 | Ga0070687_1000431972 | 331 |
| 598 | 3300005347 | Ga0070668_100206850 | Ga0070668_1002068502 | 331 |
| 599 | 3300005353 | Ga0070669_100126745 | Ga0070669_1001267452 | 331 |
| 600 | 3300005356 | Ga0070674_100000049 | Ga0070674_10000004939 | 331 |
| 601 | 3300005364 | Ga0070673_100039090 | Ga0070673_1000390901 | 331 |
| 602 | 3300005406 | Ga0070703_10033864 | Ga0070703_100338642 | 331 |
| 603 | 3300005439 | Ga0070711_100090528 | Ga0070711_1000905282 | 331 |
| 604 | 3300005440 | Ga0070705_100044656 | Ga0070705_1000446562 | 331 |
| 605 | 3300005441 | Ga0070700_100201460 | Ga0070700_1002014602 | 331 |
| 606 | 3300005444 | Ga0070694_100009816 | Ga0070694_1000098162 | 331 |
| 607 | 3300005445 | Ga0070708_100123798 | Ga0070708_1001237982 | 331 |
| 608 | 3300005456 | Ga0070678_100008603 | Ga0070678_1000086036 | 331 |
| 609 | 3300005457 | Ga0070662_100004587 | Ga0070662_1000045876 | 331 |
| 610 | 3300005458 | Ga0070681_10002709 | Ga0070681_1000270913 | 331 |
| 611 | 3300005459 | Ga0068867_100006283 | Ga0068867_1000062835 | 331 |
| 612 | 3300005518 | Ga0070699_100005205 | Ga0070699_1000052059 | 331 |
| 613 | 3300005539 | Ga0068853_100011725 | Ga0068853_1000117254 | 331 |
| 614 | 3300005539 | Ga0068853_100198983 | Ga0068853_1001989832 | 331 |
| 615 | 3300005545 | Ga0070695_100056401 | Ga0070695_1000564012 | 331 |
| 616 | 3300005546 | Ga0070696_100000412 | Ga0070696_10000041211 | 331 |
| 617 | 3300005547 | Ga0070693_100016515 | Ga0070693_1000165152 | 331 |
| 618 | 3300005578 | Ga0068854_100053051 | Ga0068854_1000530512 | 331 |
| 619 | 3300005615 | Ga0070702_100037409 | Ga0070702_1000374092 | 331 |
| 620 | 3300005615 | Ga0070702_100285962 | Ga0070702_1002859621 | 331 |
| 621 | 3300005617 | Ga0068859_100011622 | Ga0068859_1000116226 | 331 |
| 622 | 3300005618 | Ga0068864_100025299 | Ga0068864_1000252996 | 331 |
| 623 | 3300005718 | Ga0068866_10003908 | Ga0068866_100039082 | 331 |
| 624 | 3300005718 | Ga0068866_10208879 | Ga0068866_102088791 | 331 |
| 625 | 3300005719 | Ga0068861_100026742 | Ga0068861_1000267423 | 331 |
| 626 | 3300005841 | Ga0068863_100033116 | Ga0068863_1000331166 | 331 |
| 627 | 3300005842 | Ga0068858_100002931 | Ga0068858_1000029313 | 331 |
| 628 | 3300005842 | Ga0068858_100024942 | Ga0068858_1000249423 | 331 |
| 629 | 3300005843 | Ga0068860_100009081 | Ga0068860_1000090818 | 331 |
| 630 | 3300005843 | Ga0068860_100097791 | Ga0068860_1000977914 | 331 |
| 631 | 3300005843 | Ga0068860_100130891 | Ga0068860_1001308913 | 331 |
| 632 | 3300005844 | Ga0068862_100076430 | Ga0068862_1000764301 | 331 |
| 633 | 3300005844 | Ga0068862_100113456 | Ga0068862_1001134562 | 331 |
| 634 | 3300006028 | Ga0070717_10009163 | Ga0070717_100091637 | 331 |
| 635 | 3300006028 | Ga0070717_10217440 | Ga0070717_102174402 | 331 |
| 636 | 3300006173 | Ga0070716_100088649 | Ga0070716_1000886492 | 331 |
| 637 | 3300006195 | Ga0075366_10012577 | Ga0075366_100125771 | 331 |
| 638 | 3300006237 | Ga0097621_100019503 | Ga0097621_1000195036 | 331 |
| 639 | 3300006358 | Ga0068871_100048995 | Ga0068871_1000489954 | 331 |
| 640 | 3300006844 | Ga0075428_100007776 | Ga0075428_1000077762 | 331 |
| 641 | 3300006852 | Ga0075433_10006861 | Ga0075433_100068612 | 331 |
| 642 | 3300006881 | Ga0068865_100073173 | Ga0068865_1000731733 | 331 |
| 643 | 3300006931 | Ga0097620_100011622 | Ga0097620_1000116226 | 331 |
| 644 | 3300009094 | Ga0111539_10006671 | Ga0111539_1000667110 | 331 |
| 645 | 3300009098 | Ga0105245_10278068 | Ga0105245_102780682 | 331 |
| 646 | 3300009147 | Ga0114129_10336721 | Ga0114129_103367212 | 331 |
| 647 | 3300009148 | Ga0105243_10321757 | Ga0105243_103217572 | 331 |
| 648 | 3300009174 | Ga0105241_10026457 | Ga0105241_100264573 | 331 |
| 649 | 3300009176 | Ga0105242_10075375 | Ga0105242_100753753 | 331 |
| 650 | 3300009177 | Ga0105248_10020136 | Ga0105248_100201366 | 331 |
| 651 | 3300009177 | Ga0105248_10037641 | Ga0105248_100376414 | 331 |
| 652 | 3300009545 | Ga0105237_10008329 | Ga0105237_1000832911 | 331 |
| 653 | 3300009553 | Ga0105249_10412968 | Ga0105249_104129682 | 331 |
| 654 | 3300010375 | Ga0105239_10128972 | Ga0105239_101289723 | 331 |
| 655 | 3300013100 | Ga0157373_10273232 | Ga0157373_102732322 | 331 |
| 656 | 3300013296 | Ga0157374_10193516 | Ga0157374_101935162 | 331 |
| 657 | 3300013296 | Ga0157374_10250864 | Ga0157374_102508642 | 331 |
| 658 | 3300013297 | Ga0157378_10005236 | Ga0157378_100052367 | 331 |
| 659 | 3300013306 | Ga0163162_10325480 | Ga0163162_103254801 | 331 |
| 660 | 3300013306 | Ga0163162_10368096 | Ga0163162_103680962 | 331 |
| 661 | 3300013308 | Ga0157375_10017502 | Ga0157375_100175025 | 331 |
| 662 | 3300013308 | Ga0157375_10126201 | Ga0157375_101262012 | 331 |
| 663 | 3300014325 | Ga0163163_10677781 | Ga0163163_106777811 | 331 |
| 664 | 3300014968 | Ga0157379_10026614 | Ga0157379_100266145 | 331 |
| 665 | 3300014968 | Ga0157379_10087963 | Ga0157379_100879632 | 331 |
| 666 | 3300025903 | Ga0207680_10124987 | Ga0207680_101249872 | 331 |
| 667 | 3300025904 | Ga0207647_10011665 | Ga0207647_100116653 | 331 |
| 668 | 3300025907 | Ga0207645_10003656 | Ga0207645_100036567 | 331 |
| 669 | 3300025911 | Ga0207654_10007746 | Ga0207654_100077462 | 331 |
| 670 | 3300025912 | Ga0207707_10025434 | Ga0207707_100254343 | 331 |
| 671 | 3300025913 | Ga0207695_10010977 | Ga0207695_1001097710 | 331 |
| 672 | 3300025916 | Ga0207663_10109420 | Ga0207663_101094202 | 331 |
| 673 | 3300025918 | Ga0207662_10162500 | Ga0207662_101625002 | 331 |
| 674 | 3300025923 | Ga0207681_10131952 | Ga0207681_101319522 | 331 |
| 675 | 3300025933 | Ga0207706_10000233 | Ga0207706_100002334 | 331 |
| 676 | 3300025934 | Ga0207686_10000534 | Ga0207686_1000053414 | 331 |
| 677 | 3300025935 | Ga0207709_10003759 | Ga0207709_100037591 | 331 |
| 678 | 3300025937 | Ga0207669_10000325 | Ga0207669_100003255 | 331 |
| 679 | 3300025937 | Ga0207669_10253198 | Ga0207669_102531981 | 331 |
| 680 | 3300025938 | Ga0207704_10003773 | Ga0207704_100037733 | 331 |
| 681 | 3300025939 | Ga0207665_10111673 | Ga0207665_101116732 | 331 |
| 682 | 3300025940 | Ga0207691_10074339 | Ga0207691_100743391 | 331 |
| 683 | 3300025940 | Ga0207691_10142544 | Ga0207691_101425443 | 331 |
| 684 | 3300025941 | Ga0207711_10006171 | Ga0207711_100061715 | 331 |
| 685 | 3300025941 | Ga0207711_10049274 | Ga0207711_100492743 | 331 |
| 686 | 3300025941 | Ga0207711_10356329 | Ga0207711_103563291 | 331 |
| 687 | 3300025942 | Ga0207689_10060208 | Ga0207689_100602082 | 331 |
| 688 | 3300025960 | Ga0207651_10015693 | Ga0207651_100156934 | 331 |
| 689 | 3300025972 | Ga0207668_10354007 | Ga0207668_103540071 | 331 |
| 690 | 3300025981 | Ga0207640_10021357 | Ga0207640_100213573 | 331 |
| 691 | 3300025986 | Ga0207658_10034217 | Ga0207658_100342173 | 331 |
| 692 | 3300026023 | Ga0207677_10127867 | Ga0207677_101278672 | 331 |
| 693 | 3300026035 | Ga0207703_10011165 | Ga0207703_100111653 | 331 |
| 694 | 3300026035 | Ga0207703_10135803 | Ga0207703_101358032 | 331 |
| 695 | 3300026041 | Ga0207639_10003938 | Ga0207639_100039385 | 331 |
| 696 | 3300026041 | Ga0207639_10028234 | Ga0207639_100282344 | 331 |
| 697 | 3300026067 | Ga0207678_10098159 | Ga0207678_100981592 | 331 |
| 698 | 3300026075 | Ga0207708_10016956 | Ga0207708_100169562 | 331 |
| 699 | 3300026088 | Ga0207641_10130328 | Ga0207641_101303283 | 331 |
| 700 | 3300026089 | Ga0207648_10000030 | Ga0207648_1000003055 | 331 |
| 701 | 3300026089 | Ga0207648_10061370 | Ga0207648_100613703 | 331 |
| 702 | 3300026089 | Ga0207648_10202952 | Ga0207648_102029522 | 331 |
| 703 | 3300026116 | Ga0207674_10440253 | Ga0207674_104402531 | 331 |
| 704 | 3300026118 | Ga0207675_100014298 | Ga0207675_1000142987 | 331 |
| 705 | 3300026118 | Ga0207675_100103027 | Ga0207675_1001030273 | 331 |
| 706 | 3300027907 | Ga0207428_10062099 | Ga0207428_100620993 | 331 |
| 707 | 3300028379 | Ga0268266_10229837 | Ga0268266_102298372 | 331 |
| 708 | 3300028380 | Ga0268265_10510304 | Ga0268265_105103041 | 331 |
| 709 | 3300028381 | Ga0268264_10001871 | Ga0268264_100018716 | 331 |
| 710 | 3300028381 | Ga0268264_10042884 | Ga0268264_100428843 | 331 |
| 711 | 3300028666 | Ga0265336_10000377 | Ga0265336_1000037711 | 331 |
| 712 | 3300031247 | Ga0265340_10008366 | Ga0265340_100083663 | 331 |
| 713 | 3300031456 | Ga0307513_10109533 | Ga0307513_101095332 | 331 |
| 714 | 3300031852 | Ga0307410_10049197 | Ga0307410_100491972 | 331 |
| 715 | 3300031995 | Ga0307409_100331827 | Ga0307409_1003318272 | 331 |
| 716 | 3300032002 | Ga0307416_100083965 | Ga0307416_1000839652 | 331 |
| 717 | 3300035113 | Ga0373936_0046417 | Ga0373936_0046417_401_1408 | 331 |
| 718 | 3300035695 | Ga0373927_0067900 | Ga0373927_0067900_999_2006 | 331 |
| 719 | 3300042876 | Ga0451577_0003485 | Ga0451577_0003485_264_1277 | 331 |
| 720 | 3300042876 | Ga0451577_0084624 | Ga0451577_0084624_581_1585 | 331 |
| 721 | 3300044712 | Ga0453684_0052474 | Ga0453684_0052474_4000_5013 | 331 |
| 722 | 3300044712 | Ga0453684_0352830 | Ga0453684_0352830_28_1044 | 331 |
| 723 | 3300045051 | Ga0451576_0003603 | Ga0451576_0003603_18159_19172 | 331 |
| 724 | 3300045051 | Ga0451576_0005451 | Ga0451576_0005451_2909_3913 | 331 |
| 725 | 3300045051 | Ga0451576_0641677 | Ga0451576_0641677_17_1027 | 331 |
| 726 | 3300046648 | Ga0495611_0154408 | Ga0495611_0154408_37_1047 | 331 |
| 727 | 3300048904 | Ga0496101_0121991 | Ga0496101_0121991_564_1574 | 331 |
| 728 | 3300048917 | Ga0496114_0047371 | Ga0496114_0047371_112_1122 | 331 |
| 729 | 3300049742 | Ga0501080_0276807 | Ga0501080_0276807_11_1015 | 331 |
| 730 | 3300049776 | Ga0501280_002270 | Ga0501280_002270_783_1790 | 331 |
| 731 | 3300050494 | nmdc:mga06z11_31712_c1 | nmdc:mga06z11_31712_c1_815_1846 | 331 |
| 732 | 3300050496 | nmdc:mga07m45_18414_c1 | nmdc:mga07m45_18414_c1_2484_3515 | 331 |
| 733 | 3300050511 | nmdc:mga08y16_16754_c1 | nmdc:mga08y16_16754_c1_604_1629 | 331 |
| 734 | 3300050515 | nmdc:mga0a205_31976_c1 | nmdc:mga0a205_31976_c1_2669_3703 | 331 |
| 735 | iso_pu_bacteria | 2643221614 | 2644088622 | 331 |
| 736 | iso_pu_bacteria | 2643221661 | 2644343857 | 331 |
| 737 | iso_pu_bacteria | 2643221666 | 2644368664 | 331 |
| 738 | 3300005330 | Ga0070690_100000065 | Ga0070690_10000006556 | 332 |
| 739 | 3300005333 | Ga0070677_10026825 | Ga0070677_100268252 | 332 |
| 740 | 3300005335 | Ga0070666_10174800 | Ga0070666_101748001 | 332 |
| 741 | 3300005337 | Ga0070682_100016729 | Ga0070682_1000167293 | 332 |
| 742 | 3300005340 | Ga0070689_100000217 | Ga0070689_10000021718 | 332 |
| 743 | 3300005343 | Ga0070687_100011598 | Ga0070687_1000115983 | 332 |
| 744 | 3300005353 | Ga0070669_100034422 | Ga0070669_1000344222 | 332 |
| 745 | 3300005354 | Ga0070675_100034996 | Ga0070675_1000349963 | 332 |
| 746 | 3300005354 | Ga0070675_100053085 | Ga0070675_1000530853 | 332 |
| 747 | 3300005356 | Ga0070674_100356796 | Ga0070674_1003567961 | 332 |
| 748 | 3300005364 | Ga0070673_100039317 | Ga0070673_1000393172 | 332 |
| 749 | 3300005364 | Ga0070673_100103051 | Ga0070673_1001030512 | 332 |
| 750 | 3300005365 | Ga0070688_100000057 | Ga0070688_1000000575 | 332 |
| 751 | 3300005441 | Ga0070700_100000578 | Ga0070700_1000005789 | 332 |
| 752 | 3300005456 | Ga0070678_100037507 | Ga0070678_1000375073 | 332 |
| 753 | 3300005456 | Ga0070678_100046815 | Ga0070678_1000468153 | 332 |
| 754 | 3300005459 | Ga0068867_100000617 | Ga0068867_10000061711 | 332 |
| 755 | 3300005466 | Ga0070685_10000052 | Ga0070685_1000005242 | 332 |
| 756 | 3300005543 | Ga0070672_100014218 | Ga0070672_1000142186 | 332 |
| 757 | 3300005544 | Ga0070686_100000158 | Ga0070686_10000015828 | 332 |
| 758 | 3300005617 | Ga0068859_100002270 | Ga0068859_1000022702 | 332 |
| 759 | 3300005719 | Ga0068861_100137511 | Ga0068861_1001375112 | 332 |
| 760 | 3300005719 | Ga0068861_100318383 | Ga0068861_1003183832 | 332 |
| 761 | 3300005937 | Ga0081455_10002721 | Ga0081455_1000272112 | 332 |
| 762 | 3300006237 | Ga0097621_100170926 | Ga0097621_1001709262 | 332 |
| 763 | 3300006852 | Ga0075433_10157149 | Ga0075433_101571492 | 332 |
| 764 | 3300006881 | Ga0068865_100109312 | Ga0068865_1001093122 | 332 |
| 765 | 3300006881 | Ga0068865_100121432 | Ga0068865_1001214322 | 332 |
| 766 | 3300006881 | Ga0068865_100168306 | Ga0068865_1001683061 | 332 |
| 767 | 3300006931 | Ga0097620_100002270 | Ga0097620_1000022702 | 332 |
| 768 | 3300009093 | Ga0105240_10005484 | Ga0105240_1000548419 | 332 |
| 769 | 3300009177 | Ga0105248_10193767 | Ga0105248_101937672 | 332 |
| 770 | 3300009553 | Ga0105249_10250650 | Ga0105249_102506502 | 332 |
| 771 | 3300011119 | Ga0105246_10239436 | Ga0105246_102394361 | 332 |
| 772 | 3300013306 | Ga0163162_10082677 | Ga0163162_100826773 | 332 |
| 773 | 3300014326 | Ga0157380_10097051 | Ga0157380_100970511 | 332 |
| 774 | 3300014968 | Ga0157379_10206371 | Ga0157379_102063711 | 332 |
| 775 | 3300025893 | Ga0207682_10004901 | Ga0207682_100049012 | 332 |
| 776 | 3300025918 | Ga0207662_10019149 | Ga0207662_100191493 | 332 |
| 777 | 3300025923 | Ga0207681_10280861 | Ga0207681_102808611 | 332 |
| 778 | 3300025926 | Ga0207659_10049300 | Ga0207659_100493002 | 332 |
| 779 | 3300025936 | Ga0207670_10000099 | Ga0207670_1000009944 | 332 |
| 780 | 3300025938 | Ga0207704_10031077 | Ga0207704_100310772 | 332 |
| 781 | 3300025940 | Ga0207691_10007014 | Ga0207691_100070149 | 332 |
| 782 | 3300025940 | Ga0207691_10104363 | Ga0207691_101043632 | 332 |
| 783 | 3300025941 | Ga0207711_10001369 | Ga0207711_100013696 | 332 |
| 784 | 3300025960 | Ga0207651_10031921 | Ga0207651_100319212 | 332 |
| 785 | 3300026075 | Ga0207708_10000185 | Ga0207708_1000018533 | 332 |
| 786 | 3300026075 | Ga0207708_10329029 | Ga0207708_103290292 | 332 |
| 787 | 3300026089 | Ga0207648_10001855 | Ga0207648_1000185525 | 332 |
| 788 | 3300026118 | Ga0207675_100060311 | Ga0207675_1000603114 | 332 |
| 789 | 3300026118 | Ga0207675_100112086 | Ga0207675_1001120862 | 332 |
| 790 | 3300026121 | Ga0207683_10011580 | Ga0207683_100115805 | 332 |
| 791 | 3300026121 | Ga0207683_10036240 | Ga0207683_100362403 | 332 |
| 792 | 3300028380 | Ga0268265_10447114 | Ga0268265_104471141 | 332 |
| 793 | 3300031090 | Ga0265760_10034596 | Ga0265760_100345962 | 332 |
| 794 | 3300031456 | Ga0307513_10075689 | Ga0307513_100756893 | 332 |
| 795 | 3300031456 | Ga0307513_10116874 | Ga0307513_101168742 | 332 |
| 796 | 3300031507 | Ga0307509_10118278 | Ga0307509_101182781 | 332 |
| 797 | 3300031995 | Ga0307409_100011518 | Ga0307409_1000115183 | 332 |
| 798 | 3300033180 | Ga0307510_10127595 | Ga0307510_101275952 | 332 |
| 799 | 3300035092 | Ga0373952_0004765 | Ga0373952_0004765_171_1193 | 332 |
| 800 | 3300046660 | Ga0495625_0106431 | Ga0495625_0106431_849_1868 | 332 |
| 801 | 3300046689 | Ga0495613_0017816 | Ga0495613_0017816_2825_3847 | 332 |
| 802 | 3300050511 | nmdc:mga08y16_424503_c1 | nmdc:mga08y16_424503_c1_130_1155 | 332 |
| 803 | 3300050511 | nmdc:mga08y16_7173_c1 | nmdc:mga08y16_7173_c1_7210_8238 | 332 |
| 804 | 3300050515 | nmdc:mga0a205_39580_c1 | nmdc:mga0a205_39580_c1_2350_3372 | 332 |
| 805 | 3300053139 | Ga0500568_0022043 | Ga0500568_0022043_1178_2200 | 332 |
| 806 | 3300053156 | Ga0500622_0048058 | Ga0500622_0048058_54_1076 | 332 |
| 807 | iso_pu_bacteria | 2883291878 | 2883294100 | 332 |
| 808 | 3300005347 | Ga0070668_100079142 | Ga0070668_1000791422 | 333 |
| 809 | 3300005355 | Ga0070671_100320146 | Ga0070671_1003201461 | 333 |
| 810 | 3300005356 | Ga0070674_100004470 | Ga0070674_1000044704 | 333 |
| 811 | 3300006237 | Ga0097621_100065912 | Ga0097621_1000659123 | 333 |
| 812 | 3300014969 | Ga0157376_10074514 | Ga0157376_100745142 | 333 |
| 813 | 3300025931 | Ga0207644_10114985 | Ga0207644_101149852 | 333 |
| 814 | 3300025937 | Ga0207669_10073883 | Ga0207669_100738832 | 333 |
| 815 | 3300031240 | Ga0265320_10025177 | Ga0265320_100251773 | 333 |
| 816 | 3300031711 | Ga0265314_10013583 | Ga0265314_100135836 | 333 |
| 817 | 3300044712 | Ga0453684_0000499 | Ga0453684_0000499_126602_127621 | 333 |
| 818 | 3300044712 | Ga0453684_0010455 | Ga0453684_0010455_3493_4590 | 333 |
| 819 | 3300044712 | Ga0453684_0029755 | Ga0453684_0029755_1942_2952 | 333 |
| 820 | 3300044712 | Ga0453684_0049121 | Ga0453684_0049121_4037_5137 | 333 |
| 821 | 3300044712 | Ga0453684_0057685 | Ga0453684_0057685_3629_4726 | 333 |
| 822 | 3300048904 | Ga0496101_0306692 | Ga0496101_0306692_41_1054 | 333 |
| 823 | 3300048907 | Ga0496104_0217941 | Ga0496104_0217941_112_1125 | 333 |
| 824 | 3300005337 | Ga0070682_100012811 | Ga0070682_1000128113 | 334 |
| 825 | 3300005339 | Ga0070660_100328272 | Ga0070660_1003282721 | 334 |
| 826 | 3300005440 | Ga0070705_100026266 | Ga0070705_1000262662 | 334 |
| 827 | 3300005444 | Ga0070694_100075071 | Ga0070694_1000750711 | 334 |
| 828 | 3300005455 | Ga0070663_100002230 | Ga0070663_10000223010 | 334 |
| 829 | 3300005458 | Ga0070681_10077946 | Ga0070681_100779463 | 334 |
| 830 | 3300005530 | Ga0070679_100040973 | Ga0070679_1000409733 | 334 |
| 831 | 3300005547 | Ga0070693_100022372 | Ga0070693_1000223721 | 334 |
| 832 | 3300005563 | Ga0068855_100016082 | Ga0068855_1000160822 | 334 |
| 833 | 3300005563 | Ga0068855_100297546 | Ga0068855_1002975462 | 334 |
| 834 | 3300005564 | Ga0070664_100159454 | Ga0070664_1001594541 | 334 |
| 835 | 3300005843 | Ga0068860_100055383 | Ga0068860_1000553832 | 334 |
| 836 | 3300006237 | Ga0097621_100444590 | Ga0097621_1004445901 | 334 |
| 837 | 3300006852 | Ga0075433_10013036 | Ga0075433_100130363 | 334 |
| 838 | 3300006871 | Ga0075434_100003042 | Ga0075434_10000304211 | 334 |
| 839 | 3300009098 | Ga0105245_10188935 | Ga0105245_101889352 | 334 |
| 840 | 3300009174 | Ga0105241_10009701 | Ga0105241_100097016 | 334 |
| 841 | 3300009551 | Ga0105238_10054021 | Ga0105238_100540211 | 334 |
| 842 | 3300009553 | Ga0105249_10014864 | Ga0105249_100148642 | 334 |
| 843 | 3300010375 | Ga0105239_10003653 | Ga0105239_100036532 | 334 |
| 844 | 3300013105 | Ga0157369_10460023 | Ga0157369_104600232 | 334 |
| 845 | 3300013297 | Ga0157378_10164266 | Ga0157378_101642661 | 334 |
| 846 | 3300014968 | Ga0157379_10049685 | Ga0157379_100496852 | 334 |
| 847 | 3300025904 | Ga0207647_10056658 | Ga0207647_100566583 | 334 |
| 848 | 3300025912 | Ga0207707_10169231 | Ga0207707_101692311 | 334 |
| 849 | 3300025913 | Ga0207695_10117358 | Ga0207695_101173582 | 334 |
| 850 | 3300025914 | Ga0207671_10141183 | Ga0207671_101411832 | 334 |
| 851 | 3300025919 | Ga0207657_10053172 | Ga0207657_100531723 | 334 |
| 852 | 3300025921 | Ga0207652_10143489 | Ga0207652_101434891 | 334 |
| 853 | 3300025942 | Ga0207689_10209764 | Ga0207689_102097641 | 334 |
| 854 | 3300025945 | Ga0207679_10170533 | Ga0207679_101705331 | 334 |
| 855 | 3300025949 | Ga0207667_10004770 | Ga0207667_1000477010 | 334 |
| 856 | 3300025949 | Ga0207667_10024833 | Ga0207667_100248333 | 334 |
| 857 | 3300025949 | Ga0207667_10480544 | Ga0207667_104805441 | 334 |
| 858 | 3300026041 | Ga0207639_10003453 | Ga0207639_100034532 | 334 |
| 859 | 3300026067 | Ga0207678_10000554 | Ga0207678_1000055429 | 334 |
| 860 | 3300026116 | Ga0207674_10090467 | Ga0207674_100904673 | 334 |
| 861 | 3300026142 | Ga0207698_10234004 | Ga0207698_102340041 | 334 |
| 862 | 3300028379 | Ga0268266_10071019 | Ga0268266_100710192 | 334 |
| 863 | 3300028381 | Ga0268264_10029882 | Ga0268264_100298823 | 334 |
| 864 | 3300031249 | Ga0265339_10061160 | Ga0265339_100611601 | 334 |
| 865 | 3300048905 | Ga0496102_0083158 | Ga0496102_0083158_981_2186 | 334 |
| 866 | 3300048906 | Ga0496103_0009158 | Ga0496103_0009158_2522_3727 | 334 |
| 867 | 3300048909 | Ga0496106_0030531 | Ga0496106_0030531_339_1544 | 334 |
| 868 | 3300048910 | Ga0496107_0018174 | Ga0496107_0018174_2922_4127 | 334 |
| 869 | 3300048918 | Ga0496115_0001590 | Ga0496115_0001590_822_2027 | 334 |
| 870 | 3300048925 | Ga0496122_0149147 | Ga0496122_0149147_142_1176 | 334 |
| 871 | 3300049571 | Ga0501034_0076566 | Ga0501034_0076566_988_2031 | 334 |
| 872 | 3300049580 | Ga0501046_0000029 | Ga0501046_0000029_112367_113398 | 334 |
| 873 | 3300049580 | Ga0501046_0014910 | Ga0501046_0014910_1101_2144 | 334 |
| 874 | 3300049581 | Ga0501047_0000581 | Ga0501047_0000581_8011_9081 | 334 |
| 875 | 3300049581 | Ga0501047_0042815 | Ga0501047_0042815_1091_2134 | 334 |
| 876 | 3300049582 | Ga0501048_0004012 | Ga0501048_0004012_8881_9915 | 334 |
| 877 | 3300049583 | Ga0501067_0005591 | Ga0501067_0005591_5700_6743 | 334 |
| 878 | 3300049822 | Ga0501035_0006565 | Ga0501035_0006565_6475_7545 | 334 |
| 879 | 3300049823 | Ga0501044_0002324 | Ga0501044_0002324_17346_18416 | 334 |
| 880 | 3300049823 | Ga0501044_0024583 | Ga0501044_0024583_4130_5146 | 334 |
| 881 | 3300050515 | nmdc:mga0a205_17283_c1 | nmdc:mga0a205_17283_c1_1070_2167 | 334 |
| 882 | 3300003215 | JGI25153J46596_10000022 | JGI25153J46596_10000022165 | 335 |
| 883 | 3300005353 | Ga0070669_100017016 | Ga0070669_1000170164 | 335 |
| 884 | 3300005356 | Ga0070674_100003659 | Ga0070674_1000036596 | 335 |
| 885 | 3300005459 | Ga0068867_100100156 | Ga0068867_1001001562 | 335 |
| 886 | 3300005546 | Ga0070696_100011533 | Ga0070696_1000115335 | 335 |
| 887 | 3300005718 | Ga0068866_10010068 | Ga0068866_100100684 | 335 |
| 888 | 3300005844 | Ga0068862_100059416 | Ga0068862_1000594164 | 335 |
| 889 | 3300006847 | Ga0075431_100275661 | Ga0075431_1002756612 | 335 |
| 890 | 3300009147 | Ga0114129_10037842 | Ga0114129_100378422 | 335 |
| 891 | 3300014326 | Ga0157380_10025490 | Ga0157380_100254903 | 335 |
| 892 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005397 | 335 |
| 893 | 3300025899 | Ga0207642_10024347 | Ga0207642_100243472 | 335 |
| 894 | 3300025937 | Ga0207669_10008438 | Ga0207669_100084386 | 335 |
| 895 | 3300026118 | Ga0207675_100002563 | Ga0207675_10000256311 | 335 |
| 896 | 3300028380 | Ga0268265_10020306 | Ga0268265_100203062 | 335 |
| 897 | 3300030522 | Ga0307512_10154301 | Ga0307512_101543012 | 335 |
| 898 | 3300047472 | Ga0495686_0040286 | Ga0495686_0040286_47_1066 | 335 |
| 899 | 3300047472 | Ga0495686_0061450 | Ga0495686_0061450_844_1878 | 335 |
| 900 | 3300049569 | Ga0501032_0049955 | Ga0501032_0049955_850_1872 | 335 |
| 901 | 3300049579 | Ga0501043_0050616 | Ga0501043_0050616_1360_2382 | 335 |
| 902 | 3300049581 | Ga0501047_0069721 | Ga0501047_0069721_798_1820 | 335 |
| 903 | 3300049584 | Ga0501068_0026220 | Ga0501068_0026220_1567_2589 | 335 |
| 904 | 3300049588 | Ga0501072_0074917 | Ga0501072_0074917_1128_2150 | 335 |
| 905 | 3300049589 | Ga0501073_0054959 | Ga0501073_0054959_959_1981 | 335 |
| 906 | 3300049823 | Ga0501044_0001209 | Ga0501044_0001209_1226_2248 | 335 |
| 907 | 3300053087 | Ga0500643_031703 | Ga0500643_031703_48_1067 | 335 |
| 908 | 3300053096 | Ga0500641_0002110 | Ga0500641_0002110_31_1050 | 335 |
| 909 | 3300053103 | Ga0500555_001712 | Ga0500555_001712_4778_5797 | 335 |
| 910 | 3300053130 | Ga0500642_0071074 | Ga0500642_0071074_400_1419 | 335 |
| 911 | 3300053156 | Ga0500622_0056261 | Ga0500622_0056261_632_1654 | 335 |
| 912 | 3300053731 | Ga0500609_000624 | Ga0500609_000624_4306_5325 | 335 |
| 913 | 3300054114 | Ga0501084_0019391 | Ga0501084_0019391_3484_4506 | 335 |
| 914 | iso_pu_bacteria | 2989771324 | 2989775432 | 335 |
| 915 | 3300028573 | Ga0265334_10006414 | Ga0265334_100064144 | 336 |
| 916 | 3300028577 | Ga0265318_10000626 | Ga0265318_100006264 | 336 |
| 917 | 3300028800 | Ga0265338_10016978 | Ga0265338_100169782 | 336 |
| 918 | 3300031235 | Ga0265330_10045981 | Ga0265330_100459812 | 336 |
| 919 | 3300031240 | Ga0265320_10105439 | Ga0265320_101054391 | 336 |
| 920 | 3300031595 | Ga0265313_10015842 | Ga0265313_100158421 | 336 |
| 921 | 3300031711 | Ga0265314_10066836 | Ga0265314_100668362 | 336 |
| 922 | 3300050511 | nmdc:mga08y16_532432_c1 | nmdc:mga08y16_532432_c1_64_1119 | 336 |
| 923 | 3300025961 | Ga0207712_10129398 | Ga0207712_101293982 | 337 |
| 924 | iso_pu_bacteria | 2513237146 | 2513929066 | 337 |
| 925 | iso_pu_bacteria | 2582581306 | 2585267580 | 337 |
| 926 | iso_pu_bacteria | 2582581865 | 2585386640 | 337 |
| 927 | iso_pu_bacteria | 2599185170 | 2599414721 | 337 |
| 928 | iso_pu_bacteria | 2838035591 | 2838039560 | 337 |
| 929 | iso_pu_bacteria | 643692032 | 643823030 | 337 |
| 930 | 3300002773 | JGI25152J39213_1002543 | JGI25152J39213_10025433 | 341 |
| 931 | 3300003187 | JGI25151J46595_10032725 | JGI25151J46595_100327252 | 341 |
| 932 | 3300003775 | Ga0055524_1011997 | Ga0055524_10119972 | 341 |
| 933 | 3300003790 | Ga0055528_1001577 | Ga0055528_10015774 | 341 |
| 934 | 3300003790 | Ga0055528_1004369 | Ga0055528_10043695 | 341 |
| 935 | 3300025258 | Ga0209129_1000019 | Ga0209129_100001999 | 341 |
| 936 | 3300025273 | Ga0209673_1000132 | Ga0209673_100013297 | 341 |
| 937 | 3300025294 | Ga0209025_1001953 | Ga0209025_100195320 | 341 |
| 938 | 3300025295 | Ga0209564_1011311 | Ga0209564_10113114 | 341 |
| 939 | 3300025297 | Ga0209758_1015826 | Ga0209758_10158262 | 341 |
| 940 | 3300025299 | Ga0209256_1000458 | Ga0209256_100045833 | 341 |
| 941 | 3300025303 | Ga0209051_1028459 | Ga0209051_10284592 | 341 |
| 942 | 3300048924 | Ga0496121_0074864 | Ga0496121_0074864_1371_2396 | 341 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.9925 | 30 | 336 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.9853 | 30 | 338 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.979 | 30 | 338 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.9614 | 30 | 336 |
| 6ddn-assembly2.cif.gz_B | the sulfate-binding protein subi from mycobacterium tuberculosis h37rv | 0.9279 | 31 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG78_114_326_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9793 | 124 | 335 | 3.40.190.10 |
| af_P16700_16_293_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9761 | 25 | 295 | 3.40.50.1100 |
| af_P16700_28_100_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9752 | 33 | 100 | 3.40.190.10 |
| af_P0AG78_114_326_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9702 | 124 | 335 | 3.40.190.10 |
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9673 | 30 | 306 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2MFH1-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.999 | 124 | 341 |
GO:0042597
GO:1901681 GO:1902358 |
| AF-A0A3S4BHY4-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9963 | 137 | 242 |
GO:0042597
GO:1901681 GO:1902358 |
| AF-A0A3B9PPJ2-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9956 | 119 | 337 |
GO:0042597
GO:1901681 GO:1902358 |
| AF-A0A257JCF6-F1-model_v4 | Sulfate transporter subunit | 0.9951 | 86 | 291 |
GO:0042597
GO:1901681 GO:1902358 |
| AF-A0A553KUG5-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.995 | 129 | 291 |
GO:0042597
GO:1901681 GO:1902358 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar