F486378

General Info

Members Datasets Scaffolds Average Seq Length
943 251 1886 110

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100468315|Ga0070659_1004683152
Length 114
Sequence MYTFLLIVQTIVATSLVLGVGGSSSGFMTARGAADLLTRSTSVLAAIFIVLAILLAAIAGVSRKPTTIDTSLVNQMAPTVPASGSAVPGQQPAQQQPQNGAPANQTAPAVPLQQ

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
156 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
239 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
242 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
243 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
244 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
251 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.74
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.55
Stem 0
Stem Tuber 0.11
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100468315 3300005366 Bacteria 1071
2 JGI24741J21665_1006508 3300001915 Bacteria 2341
3 JGI24747J21853_1004086 3300001978 Bacteria 1291
4 JGI24740J21852_10005667 3300001979 Bacteria 5257
5 JGI24739J22299_10005106 3300001989 Bacteria 4998
6 JGI24739J22299_10005954 3300001989 Bacteria 4615
7 JGI24739J22299_10011414 3300001989 Bacteria 3280
8 JGI24737J22298_10000422 3300001990 Bacteria 14521
9 JGI24743J22301_10006458 3300001991 Bacteria 2000
10 JGI24735J21928_10002159 3300002067 Bacteria 6907
11 JGI24735J21928_10007891 3300002067 Bacteria 3458
12 JGI24735J21928_10055911 3300002067 Bacteria 1136
13 JGI24738J21930_10001939 3300002075 Bacteria 5575
14 JGI24738J21930_10004649 3300002075 Bacteria 3347
15 Ga0070658_10012936 3300005327 Bacteria 6699
16 Ga0070658_10015921 3300005327 Bacteria 6014
17 Ga0070658_10023474 3300005327 Bacteria 4949
18 Ga0070658_10048731 3300005327 Bacteria 3430
19 Ga0070658_10106727 3300005327 Bacteria 2317
20 Ga0070658_10107796 3300005327 Bacteria 2305
21 Ga0070658_10130728 3300005327 Bacteria 2092
22 Ga0070658_10194692 3300005327 Bacteria 1709
23 Ga0070658_10218497 3300005327 Bacteria 1611
24 Ga0070658_10493840 3300005327 Bacteria 1057
25 Ga0070658_11081880 3300005327 Bacteria 697
26 Ga0070658_11132446 3300005327 Bacteria 680
27 Ga0070658_11177128 3300005327 Bacteria 666
28 Ga0070658_11251927 3300005327 Bacteria 645
29 Ga0070658_11878739 3300005327 Unclassified 517
30 Ga0070676_10070423 3300005328 Bacteria 2098
31 Ga0070676_10101812 3300005328 Bacteria 1775
32 Ga0070676_10167729 3300005328 Bacteria 1418
33 Ga0070676_10295220 3300005328 Bacteria 1097
34 Ga0070676_11151739 3300005328 Bacteria 588
35 Ga0070683_100000644 3300005329 Bacteria 25133
36 Ga0070683_100012323 3300005329 Bacteria 7427
37 Ga0070683_100040893 3300005329 Bacteria 4263
38 Ga0070683_100083467 3300005329 Bacteria 2992
39 Ga0070683_100432648 3300005329 Bacteria 1255
40 Ga0070683_101531359 3300005329 Bacteria 641
41 Ga0070690_100012038 3300005330 Bacteria 5079
42 Ga0070690_100137374 3300005330 Bacteria 1656
43 Ga0070690_100168729 3300005330 Bacteria 1505
44 Ga0070670_100011264 3300005331 Bacteria 7646
45 Ga0070670_100027542 3300005331 Bacteria 4888
46 Ga0070670_100044913 3300005331 Bacteria 3798
47 Ga0070670_100829920 3300005331 Bacteria 836
48 Ga0070677_10348195 3300005333 Bacteria 767
49 Ga0070666_10000346 3300005335 Bacteria 29073
50 Ga0070666_10016985 3300005335 Bacteria 4661
51 Ga0070666_10018053 3300005335 Bacteria 4530
52 Ga0070666_10022405 3300005335 Bacteria 4101
53 Ga0070666_10185932 3300005335 Bacteria 1459
54 Ga0070680_100004746 3300005336 Bacteria 10232
55 Ga0070680_100195661 3300005336 Bacteria 1704
56 Ga0070680_100288469 3300005336 Bacteria 1391
57 Ga0070682_100017248 3300005337 Bacteria 4207
58 Ga0070682_100095445 3300005337 Bacteria 1953
59 Ga0070682_100107007 3300005337 Bacteria 1857
60 Ga0068868_100033307 3300005338 Bacteria 3971
61 Ga0070660_100000350 3300005339 Bacteria 30817
62 Ga0070660_100007777 3300005339 Bacteria 7475
63 Ga0070660_100008243 3300005339 Bacteria 7283
64 Ga0070660_100020719 3300005339 Bacteria 4838
65 Ga0070660_100027712 3300005339 Bacteria 4230
66 Ga0070660_100050213 3300005339 Bacteria 3209
67 Ga0070660_100062648 3300005339 Bacteria 2890
68 Ga0070660_100120369 3300005339 Bacteria 2095
69 Ga0070687_100370419 3300005343 Bacteria 930
70 Ga0070661_100000536 3300005344 Bacteria 29149
71 Ga0070661_100003274 3300005344 Bacteria 11184
72 Ga0070661_100004872 3300005344 Bacteria 9242
73 Ga0070661_100006434 3300005344 Bacteria 8098
74 Ga0070661_100007774 3300005344 Bacteria 7398
75 Ga0070661_100020420 3300005344 Bacteria 4723
76 Ga0070661_100043316 3300005344 Bacteria 3288
77 Ga0070661_100048009 3300005344 Bacteria 3125
78 Ga0070661_100089346 3300005344 Bacteria 2281
79 Ga0070661_100296981 3300005344 Bacteria 1256
80 Ga0070661_100405509 3300005344 Bacteria 1078
81 Ga0070661_100534838 3300005344 Bacteria 941
82 Ga0070692_10076721 3300005345 Bacteria 1792
83 Ga0070692_10274597 3300005345 Bacteria 1019
84 Ga0070692_10545273 3300005345 Bacteria 759
85 Ga0070692_10787483 3300005345 Bacteria 648
86 Ga0070668_100364073 3300005347 Bacteria 1227
87 Ga0070668_100429802 3300005347 Bacteria 1132
88 Ga0070668_100520799 3300005347 Bacteria 1032
89 Ga0070669_100155690 3300005353 Bacteria 1772
90 Ga0070675_100116649 3300005354 Bacteria 2265
91 Ga0070675_100219839 3300005354 Bacteria 1654
92 Ga0070671_100004623 3300005355 Bacteria 10913
93 Ga0070671_100012009 3300005355 Bacteria 6967
94 Ga0070671_100020835 3300005355 Bacteria 5348
95 Ga0070671_100026271 3300005355 Bacteria 4784
96 Ga0070671_100062212 3300005355 Bacteria 3109
97 Ga0070671_100070915 3300005355 Bacteria 2907
98 Ga0070671_100071087 3300005355 Bacteria 2904
99 Ga0070671_100072787 3300005355 Bacteria 2870
100 Ga0070674_100014903 3300005356 Bacteria 4841
101 Ga0070674_100036773 3300005356 Bacteria 3289
102 Ga0070674_100059398 3300005356 Bacteria 2662
103 Ga0070673_100017318 3300005364 Bacteria 5119
104 Ga0070673_100058691 3300005364 Bacteria 3043
105 Ga0070673_100081879 3300005364 Bacteria 2618
106 Ga0070673_100285111 3300005364 Bacteria 1450
107 Ga0070673_100600052 3300005364 Unclassified 1004
108 Ga0070673_100685767 3300005364 Bacteria 940
109 Ga0070659_100000139 3300005366 Bacteria 55743
110 Ga0070659_100002650 3300005366 Bacteria 12741
111 Ga0070659_100017396 3300005366 Bacteria 5409
112 Ga0070659_100035232 3300005366 Bacteria 3897
113 Ga0070659_100061107 3300005366 Bacteria 2977
114 Ga0070659_100072894 3300005366 Bacteria 2733
115 Ga0070659_100086055 3300005366 Bacteria 2515
116 Ga0070659_100274356 3300005366 Bacteria 1402
117 Ga0070659_100580947 3300005366 Bacteria 961
118 Ga0070659_100617677 3300005366 Bacteria 933
119 Ga0070659_101149083 3300005366 Unclassified 685
120 Ga0070659_101495815 3300005366 Bacteria 601
121 Ga0070667_100009737 3300005367 Bacteria 7967
122 Ga0070667_100011453 3300005367 Bacteria 7333
123 Ga0070667_100011779 3300005367 Bacteria 7226
124 Ga0070667_100024847 3300005367 Bacteria 4978
125 Ga0070667_100029058 3300005367 Bacteria 4605
126 Ga0070667_101157351 3300005367 Bacteria 724
127 Ga0070667_101247933 3300005367 Bacteria 696
128 Ga0070714_100035769 3300005435 Bacteria 4163
129 Ga0070714_100128294 3300005435 Bacteria 2264
130 Ga0070714_100186984 3300005435 Bacteria 1888
131 Ga0070713_100091068 3300005436 Bacteria 2623
132 Ga0070713_100186690 3300005436 Bacteria 1866
133 Ga0070711_100705544 3300005439 Bacteria 850
134 Ga0070663_100004900 3300005455 Bacteria 7902
135 Ga0070663_100016745 3300005455 Bacteria 4770
136 Ga0070663_100039757 3300005455 Bacteria 3289
137 Ga0070663_100045477 3300005455 Bacteria 3102
138 Ga0070663_100061660 3300005455 Bacteria 2701
139 Ga0070663_100096737 3300005455 Bacteria 2196
140 Ga0070663_100244932 3300005455 Bacteria 1416
141 Ga0070663_100635171 3300005455 Bacteria 901
142 Ga0070678_100128031 3300005456 Bacteria 2013
143 Ga0070678_100387912 3300005456 Bacteria 1210
144 Ga0070662_100000024 3300005457 Bacteria 91042
145 Ga0070662_100001022 3300005457 Bacteria 17123
146 Ga0070662_100008953 3300005457 Bacteria 6525
147 Ga0070662_100016566 3300005457 Bacteria 4950
148 Ga0070662_100031305 3300005457 Bacteria 3733
149 Ga0070662_100085640 3300005457 Bacteria 2355
150 Ga0070662_100189414 3300005457 Bacteria 1626
151 Ga0070662_100227490 3300005457 Bacteria 1491
152 Ga0070662_100486441 3300005457 Bacteria 1028
153 Ga0070662_100910392 3300005457 Bacteria 751
154 Ga0070662_100929896 3300005457 Bacteria 743
155 Ga0070662_101603118 3300005457 Bacteria 562
156 Ga0070681_10007319 3300005458 Bacteria 10778
157 Ga0070681_10039471 3300005458 Bacteria 4732
158 Ga0070681_10181234 3300005458 Bacteria 2028
159 Ga0070681_11076860 3300005458 Bacteria 724
160 Ga0068867_100028916 3300005459 Bacteria 3991
161 Ga0070679_100016119 3300005530 Bacteria 7200
162 Ga0070679_100171166 3300005530 Bacteria 2144
163 Ga0070679_100234572 3300005530 Bacteria 1794
164 Ga0070679_100276772 3300005530 Bacteria 1631
165 Ga0070679_100570217 3300005530 Bacteria 1075
166 Ga0070679_100917471 3300005530 Bacteria 819
167 Ga0070684_100033437 3300005535 Bacteria 4390
168 Ga0070684_100043691 3300005535 Bacteria 3871
169 Ga0070684_100132721 3300005535 Bacteria 2247
170 Ga0070684_100474304 3300005535 Bacteria 1158
171 Ga0070684_101507210 3300005535 Bacteria 634
172 Ga0070684_101529843 3300005535 Bacteria 629
173 Ga0068853_100000342 3300005539 Bacteria 32471
174 Ga0068853_100009064 3300005539 Bacteria 8011
175 Ga0068853_100087423 3300005539 Bacteria 2735
176 Ga0068853_100102888 3300005539 Bacteria 2528
177 Ga0068853_100158027 3300005539 Bacteria 2044
178 Ga0068853_100209354 3300005539 Bacteria 1777
179 Ga0068853_100947246 3300005539 Bacteria 828
180 Ga0068853_101286542 3300005539 Bacteria 707
181 Ga0070672_100006707 3300005543 Bacteria 7760
182 Ga0070672_100021543 3300005543 Bacteria 4719
183 Ga0070672_100042656 3300005543 Bacteria 3493
184 Ga0070672_100974369 3300005543 Bacteria 751
185 Ga0070672_101554667 3300005543 Bacteria 593
186 Ga0070686_100066840 3300005544 Bacteria 2340
187 Ga0070686_100870845 3300005544 Bacteria 731
188 Ga0070686_101499532 3300005544 Bacteria 568
189 Ga0070696_100250881 3300005546 Bacteria 1338
190 Ga0070693_100000870 3300005547 Bacteria 13452
191 Ga0070693_100339225 3300005547 Unclassified 1025
192 Ga0070665_100014111 3300005548 Bacteria 8029
193 Ga0070665_100023145 3300005548 Bacteria 6257
194 Ga0070665_100863825 3300005548 Bacteria 918
195 Ga0070665_102363366 3300005548 Bacteria 534
196 Ga0068855_100015488 3300005563 Bacteria 9181
197 Ga0068855_100017881 3300005563 Bacteria 8519
198 Ga0068855_100021596 3300005563 Bacteria 7721
199 Ga0068855_100027432 3300005563 Bacteria 6812
200 Ga0068855_100042302 3300005563 Bacteria 5398
201 Ga0068855_100092966 3300005563 Bacteria 3478
202 Ga0068855_100257759 3300005563 Bacteria 1944
203 Ga0068855_101853963 3300005563 Bacteria 612
204 Ga0070664_100000082 3300005564 Bacteria 60083
205 Ga0070664_100000446 3300005564 Bacteria 31189
206 Ga0070664_100001856 3300005564 Bacteria 16919
207 Ga0070664_100002946 3300005564 Bacteria 13768
208 Ga0070664_100029443 3300005564 Bacteria 4578
209 Ga0070664_100031851 3300005564 Bacteria 4408
210 Ga0070664_100072114 3300005564 Bacteria 2961
211 Ga0070664_100086865 3300005564 Bacteria 2702
212 Ga0070664_100122336 3300005564 Bacteria 2279
213 Ga0070664_101233790 3300005564 Bacteria 706
214 Ga0068857_100004407 3300005577 Bacteria 11899
215 Ga0068857_100004836 3300005577 Bacteria 11412
216 Ga0068857_100005624 3300005577 Bacteria 10716
217 Ga0068857_100097208 3300005577 Bacteria 2639
218 Ga0068857_100239752 3300005577 Bacteria 1660
219 Ga0068857_100640955 3300005577 Bacteria 1006
220 Ga0068857_101215477 3300005577 Bacteria 730
221 Ga0068857_101579937 3300005577 Bacteria 640
222 Ga0068854_100017161 3300005578 Bacteria 4840
223 Ga0068854_100021380 3300005578 Bacteria 4390
224 Ga0068854_100039529 3300005578 Bacteria 3324
225 Ga0068854_100165928 3300005578 Bacteria 1714
226 Ga0068854_100272826 3300005578 Bacteria 1359
227 Ga0068854_100279902 3300005578 Bacteria 1343
228 Ga0068854_100374544 3300005578 Bacteria 1172
229 Ga0068854_100421151 3300005578 Bacteria 1109
230 Ga0068854_100454289 3300005578 Bacteria 1071
231 Ga0068854_100880824 3300005578 Bacteria 786
232 Ga0068856_100002271 3300005614 Bacteria 19834
233 Ga0068856_100033360 3300005614 Bacteria 5040
234 Ga0068856_100041454 3300005614 Bacteria 4524
235 Ga0068856_100048587 3300005614 Bacteria 4182
236 Ga0068856_100176690 3300005614 Bacteria 2148
237 Ga0068856_100426828 3300005614 Bacteria 1346
238 Ga0068856_100536307 3300005614 Bacteria 1191
239 Ga0068856_100569955 3300005614 Bacteria 1153
240 Ga0068856_101842204 3300005614 Bacteria 616
241 Ga0068852_100000442 3300005616 Bacteria 27467
242 Ga0068852_100004452 3300005616 Bacteria 9902
243 Ga0068852_100011074 3300005616 Bacteria 6770
244 Ga0068852_100013406 3300005616 Bacteria 6274
245 Ga0068852_100025443 3300005616 Bacteria 4796
246 Ga0068852_100054137 3300005616 Bacteria 3458
247 Ga0068852_100158396 3300005616 Bacteria 2111
248 Ga0068852_100406327 3300005616 Bacteria 1340
249 Ga0068852_100443746 3300005616 Bacteria 1283
250 Ga0068852_100680628 3300005616 Bacteria 1038
251 Ga0068852_100790748 3300005616 Bacteria 962
252 Ga0068852_101903420 3300005616 Bacteria 617
253 Ga0068859_100032384 3300005617 Bacteria 5252
254 Ga0068859_100628853 3300005617 Bacteria 1166
255 Ga0068864_100023721 3300005618 Bacteria 5154
256 Ga0068864_100328318 3300005618 Bacteria 1438
257 Ga0068866_11323862 3300005718 Bacteria 524
258 Ga0068861_100078926 3300005719 Bacteria 2572
259 Ga0068861_101723312 3300005719 Bacteria 620
260 Ga0068851_10002364 3300005834 Bacteria 8299
261 Ga0068851_10024058 3300005834 Bacteria 2981
262 Ga0068851_10030480 3300005834 Bacteria 2675
263 Ga0068851_10037997 3300005834 Bacteria 2414
264 Ga0068851_10038992 3300005834 Bacteria 2386
265 Ga0068851_10054222 3300005834 Bacteria 2042
266 Ga0068863_100010487 3300005841 Bacteria 9007
267 Ga0068863_100020844 3300005841 Bacteria 6259
268 Ga0068863_100275138 3300005841 Bacteria 1630
269 Ga0068858_100001843 3300005842 Bacteria 21605
270 Ga0068858_100011050 3300005842 Bacteria 8534
271 Ga0068858_100218889 3300005842 Bacteria 1803
272 Ga0068858_100439125 3300005842 Bacteria 1257
273 Ga0068860_100014099 3300005843 Bacteria 7841
274 Ga0068860_100039315 3300005843 Bacteria 4524
275 Ga0068860_100667711 3300005843 Bacteria 1048
276 Ga0068862_100073889 3300005844 Bacteria 2946
277 Ga0068862_100505483 3300005844 Bacteria 1148
278 Ga0068862_100587191 3300005844 Bacteria 1068
279 Ga0081539_10052112 3300005985 Bacteria 2301
280 Ga0070716_100044871 3300006173 Bacteria 2478
281 Ga0070716_100252767 3300006173 Bacteria 1202
282 Ga0075366_10709121 3300006195 Bacteria 625
283 Ga0097621_100009747 3300006237 Bacteria 6991
284 Ga0097621_100011685 3300006237 Bacteria 6479
285 Ga0097621_100074060 3300006237 Bacteria 2820
286 Ga0097621_100230514 3300006237 Bacteria 1617
287 Ga0068871_100011780 3300006358 Bacteria 6426
288 Ga0068871_100013252 3300006358 Bacteria 6113
289 Ga0068871_100036381 3300006358 Bacteria 3920
290 Ga0097620_100032383 3300006931 Bacteria 5252
291 Ga0097620_100330704 3300006931 Bacteria 1618
292 Ga0097620_100628902 3300006931 Bacteria 1166
293 Ga0075435_101756348 3300007076 Bacteria 544
294 Ga0105240_10031411 3300009093 Bacteria 6888
295 Ga0105240_10062809 3300009093 Bacteria 4623
296 Ga0105240_10455216 3300009093 Bacteria 1431
297 Ga0105240_10529078 3300009093 Bacteria 1307
298 Ga0111539_11105191 3300009094 Bacteria 921
299 Ga0105245_10021400 3300009098 Bacteria 5672
300 Ga0105245_10093834 3300009098 Bacteria 2766
301 Ga0105247_11029079 3300009101 Bacteria 645
302 Ga0105243_10029641 3300009148 Bacteria 4209
303 Ga0105243_10104737 3300009148 Bacteria 2355
304 Ga0105241_10014435 3300009174 Bacteria 5784
305 Ga0105241_10271244 3300009174 Bacteria 1446
306 Ga0105241_10925430 3300009174 Bacteria 811
307 Ga0105241_11532887 3300009174 Bacteria 642
308 Ga0105241_11970045 3300009174 Bacteria 574
309 Ga0105241_12324651 3300009174 Unclassified 534
310 Ga0105248_10000059 3300009177 Bacteria 137176
311 Ga0105248_10004017 3300009177 Bacteria 16262
312 Ga0105248_10010113 3300009177 Bacteria 10392
313 Ga0105248_10029474 3300009177 Bacteria 6122
314 Ga0105248_10071025 3300009177 Bacteria 3910
315 Ga0105248_10178351 3300009177 Bacteria 2394
316 Ga0105248_10559644 3300009177 Bacteria 1290
317 Ga0105248_10925557 3300009177 Bacteria 984
318 Ga0105248_10928840 3300009177 Bacteria 983
319 Ga0105248_13214743 3300009177 Bacteria 520
320 Ga0105237_10025986 3300009545 Bacteria 5986
321 Ga0105237_10158420 3300009545 Bacteria 2261
322 Ga0105238_10009851 3300009551 Bacteria 9574
323 Ga0105238_10009986 3300009551 Bacteria 9518
324 Ga0105249_12427064 3300009553 Bacteria 597
325 Ga0105032_114107 3300009979 Bacteria 637
326 Ga0105239_10267295 3300010375 Bacteria 1923
327 Ga0105239_10354061 3300010375 Bacteria 1658
328 Ga0105239_10539368 3300010375 Bacteria 1328
329 Ga0105246_11262195 3300011119 Bacteria 683
330 Ga0157373_10021409 3300013100 Bacteria 4697
331 Ga0157373_10027757 3300013100 Bacteria 4084
332 Ga0157373_10028490 3300013100 Bacteria 4029
333 Ga0157373_10031145 3300013100 Bacteria 3839
334 Ga0157373_10031266 3300013100 Bacteria 3832
335 Ga0157373_10031869 3300013100 Bacteria 3796
336 Ga0157373_10061564 3300013100 Unclassified 2658
337 Ga0157373_10131278 3300013100 Bacteria 1762
338 Ga0157373_10152744 3300013100 Bacteria 1624
339 Ga0157373_10570416 3300013100 Bacteria 822
340 Ga0157373_10718841 3300013100 Bacteria 733
341 Ga0157373_10721087 3300013100 Bacteria 732
342 Ga0157373_10997743 3300013100 Bacteria 625
343 Ga0157373_11176616 3300013100 Bacteria 577
344 Ga0157373_11572309 3300013100 Unclassified 503
345 Ga0157371_10001377 3300013102 Bacteria 25491
346 Ga0157371_10025702 3300013102 Bacteria 4288
347 Ga0157371_10031308 3300013102 Bacteria 3832
348 Ga0157371_10041133 3300013102 Bacteria 3300
349 Ga0157371_10076620 3300013102 Bacteria 2368
350 Ga0157371_10106222 3300013102 Bacteria 1992
351 Ga0157371_10108056 3300013102 Bacteria 1974
352 Ga0157371_10179820 3300013102 Bacteria 1513
353 Ga0157371_10265627 3300013102 Bacteria 1238
354 Ga0157371_10499551 3300013102 Bacteria 898
355 Ga0157371_10541687 3300013102 Bacteria 862
356 Ga0157371_10550291 3300013102 Bacteria 855
357 Ga0157371_10782361 3300013102 Bacteria 718
358 Ga0157370_10004183 3300013104 Bacteria 16700
359 Ga0157370_10015902 3300013104 Bacteria 7635
360 Ga0157370_10018260 3300013104 Bacteria 7054
361 Ga0157370_10042309 3300013104 Bacteria 4391
362 Ga0157370_11230264 3300013104 Bacteria 675
363 Ga0157369_10000457 3300013105 Bacteria 54100
364 Ga0157369_10041372 3300013105 Bacteria 5030
365 Ga0157369_10228825 3300013105 Bacteria 1944
366 Ga0157369_10378868 3300013105 Bacteria 1468
367 Ga0157369_10552822 3300013105 Bacteria 1190
368 Ga0157369_11147941 3300013105 Bacteria 794
369 Ga0157369_11384412 3300013105 Bacteria 716
370 Ga0157369_11467256 3300013105 Bacteria 694
371 Ga0157369_12594729 3300013105 Bacteria 512
372 Ga0157374_10009657 3300013296 Bacteria 8284
373 Ga0157374_10181851 3300013296 Bacteria 2054
374 Ga0157374_10490086 3300013296 Bacteria 1233
375 Ga0157374_10600473 3300013296 Bacteria 1111
376 Ga0157378_10430906 3300013297 Bacteria 1305
377 Ga0163162_10007460 3300013306 Bacteria 10637
378 Ga0163162_10148629 3300013306 Bacteria 2460
379 Ga0157372_10023084 3300013307 Bacteria 6741
380 Ga0157372_10053618 3300013307 Bacteria 4495
381 Ga0157372_10093824 3300013307 Bacteria 3416
382 Ga0157372_10173303 3300013307 Bacteria 2496
383 Ga0157372_10604915 3300013307 Bacteria 1278
384 Ga0157372_10907361 3300013307 Bacteria 1022
385 Ga0157372_12361487 3300013307 Bacteria 611
386 Ga0157372_12637339 3300013307 Bacteria 577
387 Ga0157372_12896285 3300013307 Bacteria 549
388 Ga0157375_10004536 3300013308 Bacteria 12064
389 Ga0157375_10234026 3300013308 Bacteria 1996
390 Ga0157375_10479198 3300013308 Bacteria 1409
391 Ga0163163_10001588 3300014325 Bacteria 19116
392 Ga0163163_10011294 3300014325 Bacteria 8094
393 Ga0163163_10046192 3300014325 Bacteria 4277
394 Ga0163163_11625893 3300014325 Bacteria 707
395 Ga0157380_10001828 3300014326 Bacteria 14057
396 Ga0157380_10972460 3300014326 Bacteria 880
397 Ga0157380_11724043 3300014326 Bacteria 684
398 Ga0182008_10195689 3300014497 Bacteria 1027
399 Ga0182008_10252637 3300014497 Bacteria 910
400 Ga0157379_10045768 3300014968 Bacteria 3906
401 Ga0157379_10053629 3300014968 Bacteria 3602
402 Ga0157379_10500506 3300014968 Bacteria 1126
403 Ga0157376_10159828 3300014969 Bacteria 2041
404 Ga0197907_10114585 3300020069 Bacteria 993
405 Ga0197907_10985389 3300020069 Bacteria 1332
406 Ga0206356_11773638 3300020070 Bacteria 1731
407 Ga0206354_11653543 3300020081 Bacteria 1313
408 Ga0206353_10677093 3300020082 Bacteria 2628
409 Ga0213876_10058141 3300021384 Bacteria 2041
410 Ga0224712_10237661 3300022467 Bacteria 838
411 Ga0224712_10345548 3300022467 Bacteria 702
412 Ga0207656_10089896 3300025321 Bacteria 1392
413 Ga0207656_10372467 3300025321 Bacteria 715
414 Ga0207642_10821860 3300025899 Bacteria 592
415 Ga0207680_10000874 3300025903 Bacteria 14229
416 Ga0207680_10055789 3300025903 Bacteria 2383
417 Ga0207680_10059338 3300025903 Bacteria 2323
418 Ga0207647_10019612 3300025904 Bacteria 4545
419 Ga0207647_10032503 3300025904 Bacteria 3350
420 Ga0207645_10005127 3300025907 Bacteria 9585
421 Ga0207645_10094922 3300025907 Bacteria 1920
422 Ga0207645_10390059 3300025907 Bacteria 936
423 Ga0207705_10000062 3300025909 Bacteria 149432
424 Ga0207705_10000192 3300025909 Bacteria 62246
425 Ga0207705_10001710 3300025909 Bacteria 17412
426 Ga0207705_10022394 3300025909 Bacteria 4505
427 Ga0207705_10036827 3300025909 Bacteria 3501
428 Ga0207705_10113817 3300025909 Unclassified 2001
429 Ga0207705_10309627 3300025909 Bacteria 1212
430 Ga0207705_10328303 3300025909 Bacteria 1176
431 Ga0207705_10372648 3300025909 Bacteria 1102
432 Ga0207707_10404128 3300025912 Bacteria 1172
433 Ga0207707_11107345 3300025912 Bacteria 645
434 Ga0207707_11372860 3300025912 Bacteria 565
435 Ga0207707_11663277 3300025912 Bacteria 501
436 Ga0207695_10018769 3300025913 Bacteria 7982
437 Ga0207671_10041187 3300025914 Bacteria 3418
438 Ga0207671_10457803 3300025914 Bacteria 1016
439 Ga0207693_10008153 3300025915 Bacteria 8586
440 Ga0207660_10003522 3300025917 Bacteria 10202
441 Ga0207660_10030369 3300025917 Bacteria 3714
442 Ga0207660_10119029 3300025917 Bacteria 1998
443 Ga0207660_10607254 3300025917 Bacteria 891
444 Ga0207657_10000015 3300025919 Bacteria 175776
445 Ga0207657_10000924 3300025919 Bacteria 31097
446 Ga0207657_10001620 3300025919 Bacteria 24220
447 Ga0207657_10011425 3300025919 Bacteria 8815
448 Ga0207657_10014904 3300025919 Bacteria 7559
449 Ga0207657_10044733 3300025919 Bacteria 3891
450 Ga0207657_10049034 3300025919 Bacteria 3683
451 Ga0207657_10092466 3300025919 Bacteria 2521
452 Ga0207657_10150698 3300025919 Bacteria 1895
453 Ga0207657_10157627 3300025919 Bacteria 1845
454 Ga0207649_10000264 3300025920 Bacteria 41423
455 Ga0207649_10002895 3300025920 Bacteria 9443
456 Ga0207649_10032781 3300025920 Bacteria 3099
457 Ga0207649_10053105 3300025920 Bacteria 2517
458 Ga0207649_10070690 3300025920 Bacteria 2227
459 Ga0207649_10207302 3300025920 Bacteria 1389
460 Ga0207649_10213874 3300025920 Bacteria 1369
461 Ga0207649_10233182 3300025920 Bacteria 1317
462 Ga0207649_10261086 3300025920 Bacteria 1251
463 Ga0207649_10281478 3300025920 Bacteria 1209
464 Ga0207649_10315132 3300025920 Bacteria 1147
465 Ga0207649_10768683 3300025920 Bacteria 750
466 Ga0207652_10028353 3300025921 Bacteria 4671
467 Ga0207652_10275023 3300025921 Bacteria 1519
468 Ga0207652_10315937 3300025921 Bacteria 1410
469 Ga0207652_10621600 3300025921 Bacteria 968
470 Ga0207652_10759782 3300025921 Bacteria 862
471 Ga0207652_10856952 3300025921 Bacteria 804
472 Ga0207652_11807014 3300025921 Bacteria 516
473 Ga0207681_10060355 3300025923 Bacteria 2603
474 Ga0207681_10087119 3300025923 Bacteria 2221
475 Ga0207650_10006533 3300025925 Bacteria 7952
476 Ga0207650_10027132 3300025925 Bacteria 4096
477 Ga0207650_10047240 3300025925 Bacteria 3172
478 Ga0207650_10222605 3300025925 Bacteria 1519
479 Ga0207650_10768661 3300025925 Bacteria 816
480 Ga0207659_10211331 3300025926 Bacteria 1555
481 Ga0207687_10054425 3300025927 Bacteria 2799
482 Ga0207700_10323958 3300025928 Bacteria 1336
483 Ga0207700_10808072 3300025928 Bacteria 839
484 Ga0207664_10022983 3300025929 Bacteria 4666
485 Ga0207664_10270472 3300025929 Bacteria 1488
486 Ga0207664_10324223 3300025929 Bacteria 1359
487 Ga0207644_10003121 3300025931 Bacteria 10665
488 Ga0207644_10005596 3300025931 Bacteria 8180
489 Ga0207644_10036823 3300025931 Bacteria 3437
490 Ga0207644_10058621 3300025931 Bacteria 2783
491 Ga0207644_10118549 3300025931 Bacteria 2011
492 Ga0207690_10000032 3300025932 Bacteria 152479
493 Ga0207690_10011885 3300025932 Bacteria 5205
494 Ga0207690_10031694 3300025932 Bacteria 3385
495 Ga0207690_10061657 3300025932 Bacteria 2550
496 Ga0207690_10257671 3300025932 Bacteria 1350
497 Ga0207690_10259046 3300025932 Bacteria 1347
498 Ga0207690_10262082 3300025932 Bacteria 1340
499 Ga0207690_10304873 3300025932 Bacteria 1247
500 Ga0207690_10646763 3300025932 Bacteria 866
501 Ga0207690_11001532 3300025932 Bacteria 695
502 Ga0207690_11312423 3300025932 Bacteria 605
503 Ga0207690_11671078 3300025932 Bacteria 532
504 Ga0207706_10000032 3300025933 Bacteria 142723
505 Ga0207706_10036477 3300025933 Bacteria 4367
506 Ga0207706_10061386 3300025933 Bacteria 3310
507 Ga0207706_10147339 3300025933 Bacteria 2071
508 Ga0207706_10307425 3300025933 Bacteria 1381
509 Ga0207706_10625759 3300025933 Bacteria 923
510 Ga0207669_10659457 3300025937 Bacteria 856
511 Ga0207669_10862618 3300025937 Bacteria 754
512 Ga0207665_10032193 3300025939 Bacteria 3472
513 Ga0207665_10041392 3300025939 Bacteria 3076
514 Ga0207691_10037688 3300025940 Bacteria 4476
515 Ga0207691_10362750 3300025940 Bacteria 1238
516 Ga0207691_10415376 3300025940 Bacteria 1147
517 Ga0207711_10000476 3300025941 Bacteria 41373
518 Ga0207711_10003388 3300025941 Bacteria 13815
519 Ga0207711_10003405 3300025941 Bacteria 13768
520 Ga0207711_10331279 3300025941 Bacteria 1408
521 Ga0207711_10726092 3300025941 Unclassified 926
522 Ga0207711_11481784 3300025941 Bacteria 622
523 Ga0207711_11664807 3300025941 Bacteria 581
524 Ga0207661_10007272 3300025944 Bacteria 7877
525 Ga0207661_10074005 3300025944 Bacteria 2792
526 Ga0207661_10384409 3300025944 Bacteria 1271
527 Ga0207679_10002831 3300025945 Bacteria 10761
528 Ga0207679_10008801 3300025945 Bacteria 6436
529 Ga0207679_10019442 3300025945 Bacteria 4562
530 Ga0207679_10029126 3300025945 Bacteria 3841
531 Ga0207679_10031196 3300025945 Bacteria 3729
532 Ga0207679_10060099 3300025945 Bacteria 2822
533 Ga0207679_11002128 3300025945 Bacteria 766
534 Ga0207667_10006833 3300025949 Bacteria 13786
535 Ga0207667_10012957 3300025949 Bacteria 9575
536 Ga0207667_10086411 3300025949 Bacteria 3245
537 Ga0207667_10086548 3300025949 Bacteria 3243
538 Ga0207667_10101868 3300025949 Bacteria 2962
539 Ga0207667_10112445 3300025949 Bacteria 2808
540 Ga0207667_10117262 3300025949 Bacteria 2744
541 Ga0207667_10230328 3300025949 Bacteria 1897
542 Ga0207667_10389942 3300025949 Bacteria 1418
543 Ga0207667_10769372 3300025949 Bacteria 961
544 Ga0207651_10001385 3300025960 Bacteria 10984
545 Ga0207651_10006626 3300025960 Bacteria 6086
546 Ga0207651_10371764 3300025960 Bacteria 1209
547 Ga0207651_10407530 3300025960 Bacteria 1158
548 Ga0207651_11852377 3300025960 Bacteria 543
549 Ga0207668_10062639 3300025972 Bacteria 2620
550 Ga0207668_10116082 3300025972 Bacteria 2018
551 Ga0207668_10222351 3300025972 Bacteria 1517
552 Ga0207668_10312846 3300025972 Bacteria 1300
553 Ga0207640_10005181 3300025981 Bacteria 7091
554 Ga0207640_10025454 3300025981 Bacteria 3583
555 Ga0207640_10036832 3300025981 Bacteria 3074
556 Ga0207640_10188022 3300025981 Bacteria 1554
557 Ga0207640_10597914 3300025981 Bacteria 933
558 Ga0207640_11674363 3300025981 Bacteria 574
559 Ga0207658_10012412 3300025986 Bacteria 5820
560 Ga0207658_10012532 3300025986 Bacteria 5792
561 Ga0207658_10028041 3300025986 Bacteria 3962
562 Ga0207658_10039859 3300025986 Bacteria 3391
563 Ga0207658_11080238 3300025986 Bacteria 733
564 Ga0207658_11827643 3300025986 Bacteria 554
565 Ga0207677_10027828 3300026023 Bacteria 3567
566 Ga0207677_10180400 3300026023 Bacteria 1660
567 Ga0207703_10061367 3300026035 Bacteria 3077
568 Ga0207703_10087145 3300026035 Bacteria 2617
569 Ga0207703_10411617 3300026035 Bacteria 1257
570 Ga0207639_10012166 3300026041 Bacteria 5987
571 Ga0207639_10203897 3300026041 Bacteria 1698
572 Ga0207639_10240540 3300026041 Bacteria 1573
573 Ga0207639_10375496 3300026041 Bacteria 1276
574 Ga0207678_10000716 3300026067 Bacteria 30304
575 Ga0207678_10008290 3300026067 Bacteria 9157
576 Ga0207678_10008664 3300026067 Bacteria 8960
577 Ga0207678_10016250 3300026067 Bacteria 6532
578 Ga0207678_10027597 3300026067 Bacteria 4954
579 Ga0207678_10063448 3300026067 Bacteria 3174
580 Ga0207678_10066035 3300026067 Bacteria 3106
581 Ga0207678_10084766 3300026067 Bacteria 2710
582 Ga0207678_10116085 3300026067 Bacteria 2284
583 Ga0207678_10163220 3300026067 Bacteria 1902
584 Ga0207702_10000072 3300026078 Bacteria 113840
585 Ga0207702_10034947 3300026078 Bacteria 4203
586 Ga0207702_10045035 3300026078 Bacteria 3711
587 Ga0207702_10090641 3300026078 Bacteria 2675
588 Ga0207702_10326691 3300026078 Bacteria 1462
589 Ga0207702_10556833 3300026078 Bacteria 1122
590 Ga0207641_10012508 3300026088 Bacteria 6956
591 Ga0207641_10121830 3300026088 Bacteria 2328
592 Ga0207641_10161978 3300026088 Bacteria 2034
593 Ga0207641_10590610 3300026088 Bacteria 1086
594 Ga0207648_10104585 3300026089 Bacteria 2483
595 Ga0207648_10108667 3300026089 Bacteria 2435
596 Ga0207676_10010149 3300026095 Bacteria 6704
597 Ga0207676_10021705 3300026095 Bacteria 4712
598 Ga0207676_10030671 3300026095 Bacteria 4038
599 Ga0207674_10001057 3300026116 Bacteria 35856
600 Ga0207674_10008780 3300026116 Bacteria 11638
601 Ga0207674_10027289 3300026116 Bacteria 6044
602 Ga0207674_10042347 3300026116 Bacteria 4703
603 Ga0207674_10098050 3300026116 Bacteria 2915
604 Ga0207674_10160114 3300026116 Bacteria 2206
605 Ga0207674_10392382 3300026116 Bacteria 1342
606 Ga0207674_10869939 3300026116 Bacteria 869
607 Ga0207675_100035826 3300026118 Bacteria 4629
608 Ga0207675_100517290 3300026118 Bacteria 1189
609 Ga0207683_10155374 3300026121 Bacteria 2066
610 Ga0207698_10000401 3300026142 Bacteria 25075
611 Ga0207698_10002246 3300026142 Bacteria 11425
612 Ga0207698_10005358 3300026142 Bacteria 7914
613 Ga0207698_10029937 3300026142 Bacteria 3907
614 Ga0207698_10173327 3300026142 Bacteria 1902
615 Ga0207698_10203429 3300026142 Bacteria 1775
616 Ga0207698_10373548 3300026142 Bacteria 1354
617 Ga0207698_10415676 3300026142 Bacteria 1289
618 Ga0207698_11143710 3300026142 Bacteria 792
619 Ga0207698_11273998 3300026142 Bacteria 750
620 Ga0207698_11296417 3300026142 Bacteria 743
621 Ga0207698_11680659 3300026142 Bacteria 650
622 Ga0207698_12498212 3300026142 Bacteria 527
623 Ga0209967_1027559 3300027364 Bacteria 845
624 Ga0210002_1017256 3300027617 Bacteria 1147
625 Ga0209971_1050533 3300027682 Bacteria 1004
626 Ga0209974_10058112 3300027876 Bacteria 1307
627 Ga0268266_10011662 3300028379 Bacteria 7629
628 Ga0268266_10022624 3300028379 Bacteria 5352
629 Ga0268266_10030267 3300028379 Bacteria 4600
630 Ga0268266_12005992 3300028379 Bacteria 552
631 Ga0268265_10020109 3300028380 Bacteria 4655
632 Ga0268265_10417872 3300028380 Bacteria 1244
633 Ga0268265_12000959 3300028380 Bacteria 586
634 Ga0268264_10016442 3300028381 Bacteria 6057
635 Ga0268264_10526155 3300028381 Bacteria 1157
636 Ga0314311_1052117 3300030733 Bacteria 1142
637 Ga0316178_1013034 3300030735 Bacteria 1117
638 Ga0316183_1159422 3300030742 Bacteria 1242
639 Ga0316182_1233204 3300030745 Bacteria 1947
640 Ga0307408_100049375 3300031548 Bacteria 3022
641 Ga0307408_100091306 3300031548 Bacteria 2299
642 Ga0307408_100109614 3300031548 Bacteria 2118
643 Ga0307408_100118065 3300031548 Bacteria 2050
644 Ga0307408_100235975 3300031548 Bacteria 1500
645 Ga0307408_100343269 3300031548 Bacteria 1264
646 Ga0307408_100434449 3300031548 Bacteria 1135
647 Ga0307408_100841569 3300031548 Bacteria 836
648 Ga0307408_101407127 3300031548 Bacteria 657
649 Ga0307405_10039077 3300031731 Bacteria 2865
650 Ga0307405_10050678 3300031731 Bacteria 2572
651 Ga0307405_10080307 3300031731 Bacteria 2129
652 Ga0307405_10082817 3300031731 Bacteria 2101
653 Ga0307405_10118719 3300031731 Bacteria 1806
654 Ga0307405_10650852 3300031731 Bacteria 867
655 Ga0307413_10047533 3300031824 Bacteria 2559
656 Ga0307413_10111561 3300031824 Bacteria 1832
657 Ga0307413_10246025 3300031824 Bacteria 1323
658 Ga0307413_10487100 3300031824 Bacteria 987
659 Ga0307413_10528779 3300031824 Bacteria 952
660 Ga0307413_11285145 3300031824 Bacteria 639
661 Ga0307410_10062242 3300031852 Bacteria 2556
662 Ga0307410_10086647 3300031852 Bacteria 2212
663 Ga0307410_10111353 3300031852 Bacteria 1981
664 Ga0307410_10119223 3300031852 Bacteria 1921
665 Ga0307410_10184133 3300031852 Bacteria 1583
666 Ga0307410_10287056 3300031852 Bacteria 1293
667 Ga0307410_10407712 3300031852 Bacteria 1100
668 Ga0307406_10022227 3300031901 Bacteria 3760
669 Ga0307406_10022776 3300031901 Bacteria 3719
670 Ga0307406_10152900 3300031901 Bacteria 1648
671 Ga0307406_10249767 3300031901 Bacteria 1335
672 Ga0307406_10421956 3300031901 Bacteria 1063
673 Ga0307406_10481494 3300031901 Bacteria 1002
674 Ga0307406_11610412 3300031901 Bacteria 574
675 Ga0307407_10056015 3300031903 Bacteria 2280
676 Ga0307407_10237943 3300031903 Bacteria 1240
677 Ga0307407_10332743 3300031903 Bacteria 1069
678 Ga0307407_10530843 3300031903 Bacteria 867
679 Ga0307407_10661251 3300031903 Bacteria 783
680 Ga0307412_10006486 3300031911 Bacteria 6617
681 Ga0307412_10006588 3300031911 Bacteria 6575
682 Ga0307412_10063942 3300031911 Bacteria 2484
683 Ga0307412_10070448 3300031911 Bacteria 2383
684 Ga0307412_10178547 3300031911 Bacteria 1594
685 Ga0307412_10496664 3300031911 Bacteria 1015
686 Ga0307412_11123318 3300031911 Bacteria 700
687 Ga0307412_12200223 3300031911 Bacteria 513
688 Ga0307409_100019902 3300031995 Bacteria 4558
689 Ga0307409_100057294 3300031995 Bacteria 3018
690 Ga0307409_100263662 3300031995 Bacteria 1583
691 Ga0307409_101140802 3300031995 Bacteria 801
692 Ga0307409_101735873 3300031995 Bacteria 653
693 Ga0307416_100006186 3300032002 Bacteria 7467
694 Ga0307416_100048216 3300032002 Bacteria 3377
695 Ga0307416_100064621 3300032002 Bacteria 3003
696 Ga0307416_100243883 3300032002 Bacteria 1743
697 Ga0307416_100263414 3300032002 Bacteria 1686
698 Ga0307416_100431112 3300032002 Bacteria 1365
699 Ga0307416_100500248 3300032002 Bacteria 1280
700 Ga0307416_101518818 3300032002 Bacteria 775
701 Ga0307416_103276237 3300032002 Bacteria 542
702 Ga0307414_10005634 3300032004 Bacteria 6909
703 Ga0307414_10006399 3300032004 Bacteria 6565
704 Ga0307414_10101017 3300032004 Bacteria 2170
705 Ga0307414_10269319 3300032004 Bacteria 1425
706 Ga0307414_10537695 3300032004 Bacteria 1039
707 Ga0307411_10006500 3300032005 Bacteria 5856
708 Ga0307411_10133436 3300032005 Bacteria 1818
709 Ga0307411_10140610 3300032005 Bacteria 1779
710 Ga0307411_10171765 3300032005 Bacteria 1635
711 Ga0307411_10180986 3300032005 Bacteria 1600
712 Ga0307411_10181714 3300032005 Bacteria 1597
713 Ga0307411_10487207 3300032005 Bacteria 1039
714 Ga0307411_10644141 3300032005 Bacteria 916
715 Ga0307411_11003098 3300032005 Bacteria 747
716 Ga0307411_11260355 3300032005 Bacteria 672
717 Ga0307415_100009297 3300032126 Bacteria 5498
718 Ga0307415_100012333 3300032126 Bacteria 4938
719 Ga0307415_100048836 3300032126 Bacteria 2857
720 Ga0307415_100079878 3300032126 Bacteria 2331
721 Ga0307415_100239797 3300032126 Bacteria 1466
722 Ga0307415_100298067 3300032126 Bacteria 1334
723 Ga0307415_100465738 3300032126 Bacteria 1096
724 Ga0307415_100490420 3300032126 Bacteria 1072
725 Ga0307415_100623974 3300032126 Bacteria 963
726 Ga0307415_101889983 3300032126 Bacteria 579
727 Ga0373949_0222039 3300035090 Bacteria 575
728 Ga0373941_0212516 3300035115 Unclassified 740
729 Ga0373960_0048676 3300035121 Bacteria 1251
730 Ga0373960_0294607 3300035121 Bacteria 602
731 Ga0373943_0002991 3300035170 Bacteria 7677
732 Ga0373943_0701021 3300035170 Bacteria 600
733 Ga0373942_0063085 3300035207 Bacteria 1066
734 Ga0373961_0106608 3300035241 Bacteria 913
735 Ga0373962_0056396 3300035242 Bacteria 1144
736 Ga0373931_0163811 3300035691 Bacteria 1305
737 Ga0373947_0225381 3300035725 Bacteria 1233
738 Ga0373925_0017811 3300037068 Bacteria 5154
739 Ga0395899_0000804 3300037312 Bacteria 30745
740 Ga0395899_0008182 3300037312 Bacteria 8057
741 Ga0395899_0018328 3300037312 Bacteria 5322
742 Ga0395899_0178023 3300037312 Bacteria 1494
743 Ga0395899_0253989 3300037312 Bacteria 1205
744 Ga0395899_0550667 3300037312 Bacteria 741
745 Ga0395899_0684988 3300037312 Bacteria 644
746 Ga0395899_0705834 3300037312 Bacteria 632
747 Ga0395900_0001255 3300037418 Bacteria 31098
748 Ga0395900_0024744 3300037418 Bacteria 6145
749 Ga0395900_0025967 3300037418 Bacteria 5998
750 Ga0395900_0028095 3300037418 Bacteria 5760
751 Ga0395900_0039865 3300037418 Bacteria 4841
752 Ga0395900_0046815 3300037418 Bacteria 4453
753 Ga0395900_0050547 3300037418 Bacteria 4281
754 Ga0395900_0059192 3300037418 Bacteria 3943
755 Ga0395900_0143347 3300037418 Bacteria 2445
756 Ga0395900_0168130 3300037418 Bacteria 2234
757 Ga0395900_0271030 3300037418 Bacteria 1692
758 Ga0395900_0352040 3300037418 Bacteria 1446
759 Ga0395900_0637246 3300037418 Bacteria 1003
760 Ga0395900_0934257 3300037418 Bacteria 789
761 Ga0395898_0004581 3300037466 Bacteria 15090
762 Ga0395898_0013178 3300037466 Bacteria 8517
763 Ga0395898_0019790 3300037466 Bacteria 6845
764 Ga0395898_0021025 3300037466 Bacteria 6620
765 Ga0395898_0063939 3300037466 Bacteria 3570
766 Ga0395898_0080689 3300037466 Bacteria 3137
767 Ga0395898_0099013 3300037466 Bacteria 2800
768 Ga0395898_0145415 3300037466 Bacteria 2269
769 Ga0395898_0231311 3300037466 Bacteria 1763
770 Ga0395898_0233448 3300037466 Bacteria 1754
771 Ga0395898_0286871 3300037466 Bacteria 1570
772 Ga0395898_0413431 3300037466 Bacteria 1286
773 Ga0395898_0793655 3300037466 Bacteria 887
774 Ga0395898_1126888 3300037466 Bacteria 717
775 Ga0395905_0001765 3300037471 Bacteria 25140
776 Ga0395905_0006827 3300037471 Bacteria 11423
777 Ga0395905_0018990 3300037471 Bacteria 6519
778 Ga0395905_0025496 3300037471 Bacteria 5576
779 Ga0395905_0033709 3300037471 Bacteria 4809
780 Ga0395905_0038084 3300037471 Bacteria 4512
781 Ga0395905_0040973 3300037471 Bacteria 4345
782 Ga0395905_0044686 3300037471 Bacteria 4156
783 Ga0395905_0045444 3300037471 Bacteria 4118
784 Ga0395905_0047313 3300037471 Bacteria 4031
785 Ga0395905_0072818 3300037471 Bacteria 3221
786 Ga0395905_0094601 3300037471 Bacteria 2803
787 Ga0395905_0119430 3300037471 Bacteria 2477
788 Ga0395905_0132180 3300037471 Bacteria 2347
789 Ga0395905_0161418 3300037471 Bacteria 2106
790 Ga0395905_0279521 3300037471 Bacteria 1555
791 Ga0395905_0461580 3300037471 Bacteria 1168
792 Ga0395905_0649891 3300037471 Bacteria 957
793 Ga0395905_0794708 3300037471 Bacteria 849
794 Ga0395905_1227166 3300037471 Bacteria 653
795 Ga0395905_1463891 3300037471 Bacteria 587
796 Ga0395901_0001481 3300038443 Bacteria 24431
797 Ga0395901_0005056 3300038443 Bacteria 13319
798 Ga0395901_0010390 3300038443 Bacteria 9430
799 Ga0395901_0020018 3300038443 Bacteria 6846
800 Ga0395901_0023789 3300038443 Bacteria 6282
801 Ga0395901_0037448 3300038443 Bacteria 5016
802 Ga0395901_0085261 3300038443 Bacteria 3302
803 Ga0395901_0181397 3300038443 Bacteria 2208
804 Ga0395901_0185866 3300038443 Bacteria 2179
805 Ga0395901_0308710 3300038443 Bacteria 1639
806 Ga0395901_0391934 3300038443 Bacteria 1428
807 Ga0395901_0446771 3300038443 Bacteria 1323
808 Ga0395901_0985980 3300038443 Bacteria 819
809 Ga0395901_1044486 3300038443 Bacteria 790
810 Ga0395901_1659293 3300038443 Bacteria 591
811 Ga0439465_0041653 3300041413 Bacteria 1487
812 Ga0451853_1009202 3300041512 Bacteria 504
813 Ga0439445_0095145 3300042004 Bacteria 842
814 Ga0439432_016963 3300042006 Bacteria 2447
815 Ga0439432_022289 3300042006 Bacteria 2092
816 Ga0439432_033260 3300042006 Bacteria 1660
817 Ga0439449_0048452 3300042007 Bacteria 1573
818 Ga0439449_0311047 3300042007 Bacteria 595
819 Ga0439455_0032544 3300042012 Bacteria 1304
820 Ga0439458_0002361 3300042157 Bacteria 4627
821 Ga0450916_030715 3300042530 Bacteria 782
822 Ga0466969_0024732 3300044656 Bacteria 3089
823 Ga0466969_0132382 3300044656 Bacteria 1156
824 Ga0466972_0045663 3300044658 Bacteria 2123
825 Ga0466965_0482004 3300044683 Bacteria 694
826 Ga0466966_0050183 3300044684 Bacteria 2655
827 Ga0466966_0128694 3300044684 Bacteria 1551
828 Ga0466961_0077704 3300044693 Bacteria 2102
829 Ga0466961_0087877 3300044693 Bacteria 1964
830 Ga0466961_0105504 3300044693 Bacteria 1774
831 Ga0466961_0122036 3300044693 Bacteria 1635
832 Ga0466961_0126569 3300044693 Bacteria 1602
833 Ga0466963_0115074 3300044694 Bacteria 1848
834 Ga0466963_0431367 3300044694 Bacteria 929
835 Ga0466963_0742340 3300044694 Bacteria 692
836 Ga0466963_1063413 3300044694 Bacteria 569
837 Ga0466964_0062337 3300044706 Bacteria 1554
838 Ga0466964_0331205 3300044706 Bacteria 777
839 Ga0466964_0718645 3300044706 Bacteria 558
840 Ga0466971_0001138 3300044719 Bacteria 11048
841 Ga0466968_0005658 3300044735 Bacteria 4682
842 Ga0466970_0068563 3300044765 Bacteria 1905
843 Ga0466970_0113975 3300044765 Bacteria 1477
844 Ga0466970_0322725 3300044765 Bacteria 873
845 Ga0466970_0595448 3300044765 Bacteria 641
846 Ga0466957_0027560 3300044842 Bacteria 3377
847 Ga0466957_0058778 3300044842 Bacteria 2355
848 Ga0466957_0094351 3300044842 Bacteria 1879
849 Ga0466957_0118526 3300044842 Bacteria 1686
850 Ga0466959_0010905 3300045049 Bacteria 6515
851 Ga0466959_0108714 3300045049 Bacteria 1980
852 Ga0466959_0134865 3300045049 Bacteria 1748
853 Ga0466959_0509724 3300045049 Bacteria 813
854 Ga0466959_0591742 3300045049 Bacteria 747
855 Ga0466958_0046514 3300045836 Bacteria 2618
856 Ga0466958_0089663 3300045836 Bacteria 1901
857 Ga0466958_0111283 3300045836 Bacteria 1709
858 Ga0466958_0952422 3300045836 Bacteria 560
859 Ga0466967_0052395 3300045976 Bacteria 3582
860 Ga0466967_0083661 3300045976 Bacteria 2886
861 Ga0466967_0103957 3300045976 Bacteria 2599
862 Ga0466967_0168554 3300045976 Bacteria 2059
863 Ga0466967_0328382 3300045976 Bacteria 1477
864 Ga0495629_1129312 3300046459 Bacteria 506
865 Ga0495663_0018884 3300046525 Bacteria 1966
866 Ga0495663_0041496 3300046525 Bacteria 1400
867 Ga0495663_0198017 3300046525 Bacteria 700
868 Ga0495621_0002275 3300046539 Bacteria 5141
869 Ga0495621_0005527 3300046539 Bacteria 3636
870 Ga0495621_0342927 3300046539 Bacteria 625
871 Ga0495633_0011741 3300046558 Bacteria 4703
872 Ga0495668_0668634 3300046616 Bacteria 574
873 Ga0495659_0012774 3300046664 Bacteria 2726
874 Ga0495659_0167098 3300046664 Bacteria 891
875 Ga0495669_0000398 3300046684 Bacteria 21390
876 Ga0495669_0002491 3300046684 Bacteria 7519
877 Ga0495670_0000265 3300046691 Bacteria 24414
878 Ga0495670_0015052 3300046691 Bacteria 3805
879 Ga0495670_0084084 3300046691 Bacteria 1624
880 Ga0495670_0344867 3300046691 Bacteria 801
881 Ga0495636_0241964 3300047318 Bacteria 833
882 Ga0495683_0128025 3300047323 Bacteria 1200
883 Ga0495677_0008959 3300047445 Bacteria 3702
884 Ga0495677_0070792 3300047445 Bacteria 1300
885 Ga0495677_0072553 3300047445 Bacteria 1284
886 Ga0496100_0085083 3300048903 Bacteria 2145
887 Ga0496100_1053907 3300048903 Bacteria 640
888 Ga0496101_1097705 3300048904 Bacteria 625
889 Ga0496102_0864297 3300048905 Bacteria 826
890 Ga0496102_1076188 3300048905 Bacteria 724
891 Ga0496103_0076255 3300048906 Bacteria 2103
892 Ga0496104_0233993 3300048907 Bacteria 1749
893 Ga0496104_0384869 3300048907 Bacteria 1315
894 Ga0496106_0873921 3300048909 Bacteria 711
895 Ga0496107_0576461 3300048910 Unclassified 832
896 Ga0496108_0019106 3300048911 Bacteria 5622
897 Ga0496108_0025663 3300048911 Bacteria 4858
898 Ga0496109_0010272 3300048912 Bacteria 7993
899 Ga0496109_0126702 3300048912 Bacteria 2381
900 Ga0496109_0284682 3300048912 Bacteria 1558
901 Ga0496109_0989337 3300048912 Bacteria 779
902 Ga0496109_1541514 3300048912 Unclassified 599
903 Ga0496109_1562982 3300048912 Bacteria 594
904 Ga0496110_0002670 3300048913 Bacteria 13468
905 Ga0496110_0020991 3300048913 Bacteria 5519
906 Ga0496110_0058937 3300048913 Bacteria 3382
907 Ga0496110_0083978 3300048913 Bacteria 2842
908 Ga0496111_0006573 3300048914 Bacteria 7560
909 Ga0496111_0008220 3300048914 Bacteria 6897
910 Ga0496111_0085326 3300048914 Bacteria 2309
911 Ga0496112_0007106 3300048915 Bacteria 9899
912 Ga0496112_0020797 3300048915 Bacteria 6228
913 Ga0496112_0062992 3300048915 Bacteria 3658
914 Ga0496112_0158361 3300048915 Bacteria 2231
915 Ga0496112_0293183 3300048915 Bacteria 1573
916 Ga0496112_0342629 3300048915 Bacteria 1438
917 Ga0496112_0370907 3300048915 Bacteria 1373
918 Ga0496113_0066232 3300048916 Bacteria 2735
919 Ga0496113_0182848 3300048916 Bacteria 1662
920 Ga0496113_0894159 3300048916 Bacteria 703
921 Ga0496114_0000130 3300048917 Bacteria 54437
922 Ga0496114_1110497 3300048917 Bacteria 676
923 Ga0501067_0076212 3300049583 Bacteria 1858
924 Ga0501068_0447843 3300049584 Bacteria 835
925 Ga0501209_116140 3300049656 Bacteria 792
926 Ga0501217_030409 3300049661 Bacteria 1326
927 Ga0501223_006051 3300049663 Bacteria 2517
928 Ga0501233_011309 3300049668 Bacteria 1773
929 Ga0501245_088074 3300049708 Bacteria 611
930 Ga0501080_0618971 3300049742 Bacteria 960
931 Ga0501241_117479 3300049758 Bacteria 588
932 Ga0501263_006368 3300049760 Bacteria 1361
933 Ga0501270_010438 3300049767 Bacteria 1223
934 Ga0501283_107490 3300049779 Bacteria 549
935 nmdc:mga0k408_845769_c1 3300050493 Bacteria 532
936 nmdc:mga0qj67_575084_c1 3300050509 Bacteria 902
937 nmdc:mga08y16_1317997_c1 3300050511 Bacteria 688
938 Ga0495655_0006404 3300053083 Bacteria 2138
939 Ga0466962_0015781 3300061719 Bacteria 3643
940 Ga0466962_0022080 3300061719 Bacteria 3057
941 Ga0466962_0600639 3300061719 Bacteria 561
942 2885428453 2885427238 Bacteria 2291351
943 2896430503 2896429255 Bacteria 2557483
944 Ga0070659_100468315
945 JGI24741J21665_1006508
946 JGI24747J21853_1004086
947 JGI24740J21852_10005667
948 JGI24739J22299_10005106
949 JGI24739J22299_10005954
950 JGI24739J22299_10011414
951 JGI24737J22298_10000422
952 JGI24743J22301_10006458
953 JGI24735J21928_10002159
954 JGI24735J21928_10007891
955 JGI24735J21928_10055911
956 JGI24738J21930_10001939
957 JGI24738J21930_10004649
958 Ga0070658_10012936
959 Ga0070658_10015921
960 Ga0070658_10023474
961 Ga0070658_10048731
962 Ga0070658_10106727
963 Ga0070658_10107796
964 Ga0070658_10130728
965 Ga0070658_10194692
966 Ga0070658_10218497
967 Ga0070658_10493840
968 Ga0070658_11081880
969 Ga0070658_11132446
970 Ga0070658_11177128
971 Ga0070658_11251927
972 Ga0070658_11878739
973 Ga0070676_10070423
974 Ga0070676_10101812
975 Ga0070676_10167729
976 Ga0070676_10295220
977 Ga0070676_11151739
978 Ga0070683_100000644
979 Ga0070683_100012323
980 Ga0070683_100040893
981 Ga0070683_100083467
982 Ga0070683_100432648
983 Ga0070683_101531359
984 Ga0070690_100012038
985 Ga0070690_100137374
986 Ga0070690_100168729
987 Ga0070670_100011264
988 Ga0070670_100027542
989 Ga0070670_100044913
990 Ga0070670_100829920
991 Ga0070677_10348195
992 Ga0070666_10000346
993 Ga0070666_10016985
994 Ga0070666_10018053
995 Ga0070666_10022405
996 Ga0070666_10185932
997 Ga0070680_100004746
998 Ga0070680_100195661
999 Ga0070680_100288469
1000 Ga0070682_100017248
1001 Ga0070682_100095445
1002 Ga0070682_100107007
1003 Ga0068868_100033307
1004 Ga0070660_100000350
1005 Ga0070660_100007777
1006 Ga0070660_100008243
1007 Ga0070660_100020719
1008 Ga0070660_100027712
1009 Ga0070660_100050213
1010 Ga0070660_100062648
1011 Ga0070660_100120369
1012 Ga0070687_100370419
1013 Ga0070661_100000536
1014 Ga0070661_100003274
1015 Ga0070661_100004872
1016 Ga0070661_100006434
1017 Ga0070661_100007774
1018 Ga0070661_100020420
1019 Ga0070661_100043316
1020 Ga0070661_100048009
1021 Ga0070661_100089346
1022 Ga0070661_100296981
1023 Ga0070661_100405509
1024 Ga0070661_100534838
1025 Ga0070692_10076721
1026 Ga0070692_10274597
1027 Ga0070692_10545273
1028 Ga0070692_10787483
1029 Ga0070668_100364073
1030 Ga0070668_100429802
1031 Ga0070668_100520799
1032 Ga0070669_100155690
1033 Ga0070675_100116649
1034 Ga0070675_100219839
1035 Ga0070671_100004623
1036 Ga0070671_100012009
1037 Ga0070671_100020835
1038 Ga0070671_100026271
1039 Ga0070671_100062212
1040 Ga0070671_100070915
1041 Ga0070671_100071087
1042 Ga0070671_100072787
1043 Ga0070674_100014903
1044 Ga0070674_100036773
1045 Ga0070674_100059398
1046 Ga0070673_100017318
1047 Ga0070673_100058691
1048 Ga0070673_100081879
1049 Ga0070673_100285111
1050 Ga0070673_100600052
1051 Ga0070673_100685767
1052 Ga0070659_100000139
1053 Ga0070659_100002650
1054 Ga0070659_100017396
1055 Ga0070659_100035232
1056 Ga0070659_100061107
1057 Ga0070659_100072894
1058 Ga0070659_100086055
1059 Ga0070659_100274356
1060 Ga0070659_100580947
1061 Ga0070659_100617677
1062 Ga0070659_101149083
1063 Ga0070659_101495815
1064 Ga0070667_100009737
1065 Ga0070667_100011453
1066 Ga0070667_100011779
1067 Ga0070667_100024847
1068 Ga0070667_100029058
1069 Ga0070667_101157351
1070 Ga0070667_101247933
1071 Ga0070714_100035769
1072 Ga0070714_100128294
1073 Ga0070714_100186984
1074 Ga0070713_100091068
1075 Ga0070713_100186690
1076 Ga0070711_100705544
1077 Ga0070663_100004900
1078 Ga0070663_100016745
1079 Ga0070663_100039757
1080 Ga0070663_100045477
1081 Ga0070663_100061660
1082 Ga0070663_100096737
1083 Ga0070663_100244932
1084 Ga0070663_100635171
1085 Ga0070678_100128031
1086 Ga0070678_100387912
1087 Ga0070662_100000024
1088 Ga0070662_100001022
1089 Ga0070662_100008953
1090 Ga0070662_100016566
1091 Ga0070662_100031305
1092 Ga0070662_100085640
1093 Ga0070662_100189414
1094 Ga0070662_100227490
1095 Ga0070662_100486441
1096 Ga0070662_100910392
1097 Ga0070662_100929896
1098 Ga0070662_101603118
1099 Ga0070681_10007319
1100 Ga0070681_10039471
1101 Ga0070681_10181234
1102 Ga0070681_11076860
1103 Ga0068867_100028916
1104 Ga0070679_100016119
1105 Ga0070679_100171166
1106 Ga0070679_100234572
1107 Ga0070679_100276772
1108 Ga0070679_100570217
1109 Ga0070679_100917471
1110 Ga0070684_100033437
1111 Ga0070684_100043691
1112 Ga0070684_100132721
1113 Ga0070684_100474304
1114 Ga0070684_101507210
1115 Ga0070684_101529843
1116 Ga0068853_100000342
1117 Ga0068853_100009064
1118 Ga0068853_100087423
1119 Ga0068853_100102888
1120 Ga0068853_100158027
1121 Ga0068853_100209354
1122 Ga0068853_100947246
1123 Ga0068853_101286542
1124 Ga0070672_100006707
1125 Ga0070672_100021543
1126 Ga0070672_100042656
1127 Ga0070672_100974369
1128 Ga0070672_101554667
1129 Ga0070686_100066840
1130 Ga0070686_100870845
1131 Ga0070686_101499532
1132 Ga0070696_100250881
1133 Ga0070693_100000870
1134 Ga0070693_100339225
1135 Ga0070665_100014111
1136 Ga0070665_100023145
1137 Ga0070665_100863825
1138 Ga0070665_102363366
1139 Ga0068855_100015488
1140 Ga0068855_100017881
1141 Ga0068855_100021596
1142 Ga0068855_100027432
1143 Ga0068855_100042302
1144 Ga0068855_100092966
1145 Ga0068855_100257759
1146 Ga0068855_101853963
1147 Ga0070664_100000082
1148 Ga0070664_100000446
1149 Ga0070664_100001856
1150 Ga0070664_100002946
1151 Ga0070664_100029443
1152 Ga0070664_100031851
1153 Ga0070664_100072114
1154 Ga0070664_100086865
1155 Ga0070664_100122336
1156 Ga0070664_101233790
1157 Ga0068857_100004407
1158 Ga0068857_100004836
1159 Ga0068857_100005624
1160 Ga0068857_100097208
1161 Ga0068857_100239752
1162 Ga0068857_100640955
1163 Ga0068857_101215477
1164 Ga0068857_101579937
1165 Ga0068854_100017161
1166 Ga0068854_100021380
1167 Ga0068854_100039529
1168 Ga0068854_100165928
1169 Ga0068854_100272826
1170 Ga0068854_100279902
1171 Ga0068854_100374544
1172 Ga0068854_100421151
1173 Ga0068854_100454289
1174 Ga0068854_100880824
1175 Ga0068856_100002271
1176 Ga0068856_100033360
1177 Ga0068856_100041454
1178 Ga0068856_100048587
1179 Ga0068856_100176690
1180 Ga0068856_100426828
1181 Ga0068856_100536307
1182 Ga0068856_100569955
1183 Ga0068856_101842204
1184 Ga0068852_100000442
1185 Ga0068852_100004452
1186 Ga0068852_100011074
1187 Ga0068852_100013406
1188 Ga0068852_100025443
1189 Ga0068852_100054137
1190 Ga0068852_100158396
1191 Ga0068852_100406327
1192 Ga0068852_100443746
1193 Ga0068852_100680628
1194 Ga0068852_100790748
1195 Ga0068852_101903420
1196 Ga0068859_100032384
1197 Ga0068859_100628853
1198 Ga0068864_100023721
1199 Ga0068864_100328318
1200 Ga0068866_11323862
1201 Ga0068861_100078926
1202 Ga0068861_101723312
1203 Ga0068851_10002364
1204 Ga0068851_10024058
1205 Ga0068851_10030480
1206 Ga0068851_10037997
1207 Ga0068851_10038992
1208 Ga0068851_10054222
1209 Ga0068863_100010487
1210 Ga0068863_100020844
1211 Ga0068863_100275138
1212 Ga0068858_100001843
1213 Ga0068858_100011050
1214 Ga0068858_100218889
1215 Ga0068858_100439125
1216 Ga0068860_100014099
1217 Ga0068860_100039315
1218 Ga0068860_100667711
1219 Ga0068862_100073889
1220 Ga0068862_100505483
1221 Ga0068862_100587191
1222 Ga0081539_10052112
1223 Ga0070716_100044871
1224 Ga0070716_100252767
1225 Ga0075366_10709121
1226 Ga0097621_100009747
1227 Ga0097621_100011685
1228 Ga0097621_100074060
1229 Ga0097621_100230514
1230 Ga0068871_100011780
1231 Ga0068871_100013252
1232 Ga0068871_100036381
1233 Ga0097620_100032383
1234 Ga0097620_100330704
1235 Ga0097620_100628902
1236 Ga0075435_101756348
1237 Ga0105240_10031411
1238 Ga0105240_10062809
1239 Ga0105240_10455216
1240 Ga0105240_10529078
1241 Ga0111539_11105191
1242 Ga0105245_10021400
1243 Ga0105245_10093834
1244 Ga0105247_11029079
1245 Ga0105243_10029641
1246 Ga0105243_10104737
1247 Ga0105241_10014435
1248 Ga0105241_10271244
1249 Ga0105241_10925430
1250 Ga0105241_11532887
1251 Ga0105241_11970045
1252 Ga0105241_12324651
1253 Ga0105248_10000059
1254 Ga0105248_10004017
1255 Ga0105248_10010113
1256 Ga0105248_10029474
1257 Ga0105248_10071025
1258 Ga0105248_10178351
1259 Ga0105248_10559644
1260 Ga0105248_10925557
1261 Ga0105248_10928840
1262 Ga0105248_13214743
1263 Ga0105237_10025986
1264 Ga0105237_10158420
1265 Ga0105238_10009851
1266 Ga0105238_10009986
1267 Ga0105249_12427064
1268 Ga0105032_114107
1269 Ga0105239_10267295
1270 Ga0105239_10354061
1271 Ga0105239_10539368
1272 Ga0105246_11262195
1273 Ga0157373_10021409
1274 Ga0157373_10027757
1275 Ga0157373_10028490
1276 Ga0157373_10031145
1277 Ga0157373_10031266
1278 Ga0157373_10031869
1279 Ga0157373_10061564
1280 Ga0157373_10131278
1281 Ga0157373_10152744
1282 Ga0157373_10570416
1283 Ga0157373_10718841
1284 Ga0157373_10721087
1285 Ga0157373_10997743
1286 Ga0157373_11176616
1287 Ga0157373_11572309
1288 Ga0157371_10001377
1289 Ga0157371_10025702
1290 Ga0157371_10031308
1291 Ga0157371_10041133
1292 Ga0157371_10076620
1293 Ga0157371_10106222
1294 Ga0157371_10108056
1295 Ga0157371_10179820
1296 Ga0157371_10265627
1297 Ga0157371_10499551
1298 Ga0157371_10541687
1299 Ga0157371_10550291
1300 Ga0157371_10782361
1301 Ga0157370_10004183
1302 Ga0157370_10015902
1303 Ga0157370_10018260
1304 Ga0157370_10042309
1305 Ga0157370_11230264
1306 Ga0157369_10000457
1307 Ga0157369_10041372
1308 Ga0157369_10228825
1309 Ga0157369_10378868
1310 Ga0157369_10552822
1311 Ga0157369_11147941
1312 Ga0157369_11384412
1313 Ga0157369_11467256
1314 Ga0157369_12594729
1315 Ga0157374_10009657
1316 Ga0157374_10181851
1317 Ga0157374_10490086
1318 Ga0157374_10600473
1319 Ga0157378_10430906
1320 Ga0163162_10007460
1321 Ga0163162_10148629
1322 Ga0157372_10023084
1323 Ga0157372_10053618
1324 Ga0157372_10093824
1325 Ga0157372_10173303
1326 Ga0157372_10604915
1327 Ga0157372_10907361
1328 Ga0157372_12361487
1329 Ga0157372_12637339
1330 Ga0157372_12896285
1331 Ga0157375_10004536
1332 Ga0157375_10234026
1333 Ga0157375_10479198
1334 Ga0163163_10001588
1335 Ga0163163_10011294
1336 Ga0163163_10046192
1337 Ga0163163_11625893
1338 Ga0157380_10001828
1339 Ga0157380_10972460
1340 Ga0157380_11724043
1341 Ga0182008_10195689
1342 Ga0182008_10252637
1343 Ga0157379_10045768
1344 Ga0157379_10053629
1345 Ga0157379_10500506
1346 Ga0157376_10159828
1347 Ga0197907_10114585
1348 Ga0197907_10985389
1349 Ga0206356_11773638
1350 Ga0206354_11653543
1351 Ga0206353_10677093
1352 Ga0213876_10058141
1353 Ga0224712_10237661
1354 Ga0224712_10345548
1355 Ga0207656_10089896
1356 Ga0207656_10372467
1357 Ga0207642_10821860
1358 Ga0207680_10000874
1359 Ga0207680_10055789
1360 Ga0207680_10059338
1361 Ga0207647_10019612
1362 Ga0207647_10032503
1363 Ga0207645_10005127
1364 Ga0207645_10094922
1365 Ga0207645_10390059
1366 Ga0207705_10000062
1367 Ga0207705_10000192
1368 Ga0207705_10001710
1369 Ga0207705_10022394
1370 Ga0207705_10036827
1371 Ga0207705_10113817
1372 Ga0207705_10309627
1373 Ga0207705_10328303
1374 Ga0207705_10372648
1375 Ga0207707_10404128
1376 Ga0207707_11107345
1377 Ga0207707_11372860
1378 Ga0207707_11663277
1379 Ga0207695_10018769
1380 Ga0207671_10041187
1381 Ga0207671_10457803
1382 Ga0207693_10008153
1383 Ga0207660_10003522
1384 Ga0207660_10030369
1385 Ga0207660_10119029
1386 Ga0207660_10607254
1387 Ga0207657_10000015
1388 Ga0207657_10000924
1389 Ga0207657_10001620
1390 Ga0207657_10011425
1391 Ga0207657_10014904
1392 Ga0207657_10044733
1393 Ga0207657_10049034
1394 Ga0207657_10092466
1395 Ga0207657_10150698
1396 Ga0207657_10157627
1397 Ga0207649_10000264
1398 Ga0207649_10002895
1399 Ga0207649_10032781
1400 Ga0207649_10053105
1401 Ga0207649_10070690
1402 Ga0207649_10207302
1403 Ga0207649_10213874
1404 Ga0207649_10233182
1405 Ga0207649_10261086
1406 Ga0207649_10281478
1407 Ga0207649_10315132
1408 Ga0207649_10768683
1409 Ga0207652_10028353
1410 Ga0207652_10275023
1411 Ga0207652_10315937
1412 Ga0207652_10621600
1413 Ga0207652_10759782
1414 Ga0207652_10856952
1415 Ga0207652_11807014
1416 Ga0207681_10060355
1417 Ga0207681_10087119
1418 Ga0207650_10006533
1419 Ga0207650_10027132
1420 Ga0207650_10047240
1421 Ga0207650_10222605
1422 Ga0207650_10768661
1423 Ga0207659_10211331
1424 Ga0207687_10054425
1425 Ga0207700_10323958
1426 Ga0207700_10808072
1427 Ga0207664_10022983
1428 Ga0207664_10270472
1429 Ga0207664_10324223
1430 Ga0207644_10003121
1431 Ga0207644_10005596
1432 Ga0207644_10036823
1433 Ga0207644_10058621
1434 Ga0207644_10118549
1435 Ga0207690_10000032
1436 Ga0207690_10011885
1437 Ga0207690_10031694
1438 Ga0207690_10061657
1439 Ga0207690_10257671
1440 Ga0207690_10259046
1441 Ga0207690_10262082
1442 Ga0207690_10304873
1443 Ga0207690_10646763
1444 Ga0207690_11001532
1445 Ga0207690_11312423
1446 Ga0207690_11671078
1447 Ga0207706_10000032
1448 Ga0207706_10036477
1449 Ga0207706_10061386
1450 Ga0207706_10147339
1451 Ga0207706_10307425
1452 Ga0207706_10625759
1453 Ga0207669_10659457
1454 Ga0207669_10862618
1455 Ga0207665_10032193
1456 Ga0207665_10041392
1457 Ga0207691_10037688
1458 Ga0207691_10362750
1459 Ga0207691_10415376
1460 Ga0207711_10000476
1461 Ga0207711_10003388
1462 Ga0207711_10003405
1463 Ga0207711_10331279
1464 Ga0207711_10726092
1465 Ga0207711_11481784
1466 Ga0207711_11664807
1467 Ga0207661_10007272
1468 Ga0207661_10074005
1469 Ga0207661_10384409
1470 Ga0207679_10002831
1471 Ga0207679_10008801
1472 Ga0207679_10019442
1473 Ga0207679_10029126
1474 Ga0207679_10031196
1475 Ga0207679_10060099
1476 Ga0207679_11002128
1477 Ga0207667_10006833
1478 Ga0207667_10012957
1479 Ga0207667_10086411
1480 Ga0207667_10086548
1481 Ga0207667_10101868
1482 Ga0207667_10112445
1483 Ga0207667_10117262
1484 Ga0207667_10230328
1485 Ga0207667_10389942
1486 Ga0207667_10769372
1487 Ga0207651_10001385
1488 Ga0207651_10006626
1489 Ga0207651_10371764
1490 Ga0207651_10407530
1491 Ga0207651_11852377
1492 Ga0207668_10062639
1493 Ga0207668_10116082
1494 Ga0207668_10222351
1495 Ga0207668_10312846
1496 Ga0207640_10005181
1497 Ga0207640_10025454
1498 Ga0207640_10036832
1499 Ga0207640_10188022
1500 Ga0207640_10597914
1501 Ga0207640_11674363
1502 Ga0207658_10012412
1503 Ga0207658_10012532
1504 Ga0207658_10028041
1505 Ga0207658_10039859
1506 Ga0207658_11080238
1507 Ga0207658_11827643
1508 Ga0207677_10027828
1509 Ga0207677_10180400
1510 Ga0207703_10061367
1511 Ga0207703_10087145
1512 Ga0207703_10411617
1513 Ga0207639_10012166
1514 Ga0207639_10203897
1515 Ga0207639_10240540
1516 Ga0207639_10375496
1517 Ga0207678_10000716
1518 Ga0207678_10008290
1519 Ga0207678_10008664
1520 Ga0207678_10016250
1521 Ga0207678_10027597
1522 Ga0207678_10063448
1523 Ga0207678_10066035
1524 Ga0207678_10084766
1525 Ga0207678_10116085
1526 Ga0207678_10163220
1527 Ga0207702_10000072
1528 Ga0207702_10034947
1529 Ga0207702_10045035
1530 Ga0207702_10090641
1531 Ga0207702_10326691
1532 Ga0207702_10556833
1533 Ga0207641_10012508
1534 Ga0207641_10121830
1535 Ga0207641_10161978
1536 Ga0207641_10590610
1537 Ga0207648_10104585
1538 Ga0207648_10108667
1539 Ga0207676_10010149
1540 Ga0207676_10021705
1541 Ga0207676_10030671
1542 Ga0207674_10001057
1543 Ga0207674_10008780
1544 Ga0207674_10027289
1545 Ga0207674_10042347
1546 Ga0207674_10098050
1547 Ga0207674_10160114
1548 Ga0207674_10392382
1549 Ga0207674_10869939
1550 Ga0207675_100035826
1551 Ga0207675_100517290
1552 Ga0207683_10155374
1553 Ga0207698_10000401
1554 Ga0207698_10002246
1555 Ga0207698_10005358
1556 Ga0207698_10029937
1557 Ga0207698_10173327
1558 Ga0207698_10203429
1559 Ga0207698_10373548
1560 Ga0207698_10415676
1561 Ga0207698_11143710
1562 Ga0207698_11273998
1563 Ga0207698_11296417
1564 Ga0207698_11680659
1565 Ga0207698_12498212
1566 Ga0209967_1027559
1567 Ga0210002_1017256
1568 Ga0209971_1050533
1569 Ga0209974_10058112
1570 Ga0268266_10011662
1571 Ga0268266_10022624
1572 Ga0268266_10030267
1573 Ga0268266_12005992
1574 Ga0268265_10020109
1575 Ga0268265_10417872
1576 Ga0268265_12000959
1577 Ga0268264_10016442
1578 Ga0268264_10526155
1579 Ga0314311_1052117
1580 Ga0316178_1013034
1581 Ga0316183_1159422
1582 Ga0316182_1233204
1583 Ga0307408_100049375
1584 Ga0307408_100091306
1585 Ga0307408_100109614
1586 Ga0307408_100118065
1587 Ga0307408_100235975
1588 Ga0307408_100343269
1589 Ga0307408_100434449
1590 Ga0307408_100841569
1591 Ga0307408_101407127
1592 Ga0307405_10039077
1593 Ga0307405_10050678
1594 Ga0307405_10080307
1595 Ga0307405_10082817
1596 Ga0307405_10118719
1597 Ga0307405_10650852
1598 Ga0307413_10047533
1599 Ga0307413_10111561
1600 Ga0307413_10246025
1601 Ga0307413_10487100
1602 Ga0307413_10528779
1603 Ga0307413_11285145
1604 Ga0307410_10062242
1605 Ga0307410_10086647
1606 Ga0307410_10111353
1607 Ga0307410_10119223
1608 Ga0307410_10184133
1609 Ga0307410_10287056
1610 Ga0307410_10407712
1611 Ga0307406_10022227
1612 Ga0307406_10022776
1613 Ga0307406_10152900
1614 Ga0307406_10249767
1615 Ga0307406_10421956
1616 Ga0307406_10481494
1617 Ga0307406_11610412
1618 Ga0307407_10056015
1619 Ga0307407_10237943
1620 Ga0307407_10332743
1621 Ga0307407_10530843
1622 Ga0307407_10661251
1623 Ga0307412_10006486
1624 Ga0307412_10006588
1625 Ga0307412_10063942
1626 Ga0307412_10070448
1627 Ga0307412_10178547
1628 Ga0307412_10496664
1629 Ga0307412_11123318
1630 Ga0307412_12200223
1631 Ga0307409_100019902
1632 Ga0307409_100057294
1633 Ga0307409_100263662
1634 Ga0307409_101140802
1635 Ga0307409_101735873
1636 Ga0307416_100006186
1637 Ga0307416_100048216
1638 Ga0307416_100064621
1639 Ga0307416_100243883
1640 Ga0307416_100263414
1641 Ga0307416_100431112
1642 Ga0307416_100500248
1643 Ga0307416_101518818
1644 Ga0307416_103276237
1645 Ga0307414_10005634
1646 Ga0307414_10006399
1647 Ga0307414_10101017
1648 Ga0307414_10269319
1649 Ga0307414_10537695
1650 Ga0307411_10006500
1651 Ga0307411_10133436
1652 Ga0307411_10140610
1653 Ga0307411_10171765
1654 Ga0307411_10180986
1655 Ga0307411_10181714
1656 Ga0307411_10487207
1657 Ga0307411_10644141
1658 Ga0307411_11003098
1659 Ga0307411_11260355
1660 Ga0307415_100009297
1661 Ga0307415_100012333
1662 Ga0307415_100048836
1663 Ga0307415_100079878
1664 Ga0307415_100239797
1665 Ga0307415_100298067
1666 Ga0307415_100465738
1667 Ga0307415_100490420
1668 Ga0307415_100623974
1669 Ga0307415_101889983
1670 Ga0373949_0222039
1671 Ga0373941_0212516
1672 Ga0373960_0048676
1673 Ga0373960_0294607
1674 Ga0373943_0002991
1675 Ga0373943_0701021
1676 Ga0373942_0063085
1677 Ga0373961_0106608
1678 Ga0373962_0056396
1679 Ga0373931_0163811
1680 Ga0373947_0225381
1681 Ga0373925_0017811
1682 Ga0395899_0000804
1683 Ga0395899_0008182
1684 Ga0395899_0018328
1685 Ga0395899_0178023
1686 Ga0395899_0253989
1687 Ga0395899_0550667
1688 Ga0395899_0684988
1689 Ga0395899_0705834
1690 Ga0395900_0001255
1691 Ga0395900_0024744
1692 Ga0395900_0025967
1693 Ga0395900_0028095
1694 Ga0395900_0039865
1695 Ga0395900_0046815
1696 Ga0395900_0050547
1697 Ga0395900_0059192
1698 Ga0395900_0143347
1699 Ga0395900_0168130
1700 Ga0395900_0271030
1701 Ga0395900_0352040
1702 Ga0395900_0637246
1703 Ga0395900_0934257
1704 Ga0395898_0004581
1705 Ga0395898_0013178
1706 Ga0395898_0019790
1707 Ga0395898_0021025
1708 Ga0395898_0063939
1709 Ga0395898_0080689
1710 Ga0395898_0099013
1711 Ga0395898_0145415
1712 Ga0395898_0231311
1713 Ga0395898_0233448
1714 Ga0395898_0286871
1715 Ga0395898_0413431
1716 Ga0395898_0793655
1717 Ga0395898_1126888
1718 Ga0395905_0001765
1719 Ga0395905_0006827
1720 Ga0395905_0018990
1721 Ga0395905_0025496
1722 Ga0395905_0033709
1723 Ga0395905_0038084
1724 Ga0395905_0040973
1725 Ga0395905_0044686
1726 Ga0395905_0045444
1727 Ga0395905_0047313
1728 Ga0395905_0072818
1729 Ga0395905_0094601
1730 Ga0395905_0119430
1731 Ga0395905_0132180
1732 Ga0395905_0161418
1733 Ga0395905_0279521
1734 Ga0395905_0461580
1735 Ga0395905_0649891
1736 Ga0395905_0794708
1737 Ga0395905_1227166
1738 Ga0395905_1463891
1739 Ga0395901_0001481
1740 Ga0395901_0005056
1741 Ga0395901_0010390
1742 Ga0395901_0020018
1743 Ga0395901_0023789
1744 Ga0395901_0037448
1745 Ga0395901_0085261
1746 Ga0395901_0181397
1747 Ga0395901_0185866
1748 Ga0395901_0308710
1749 Ga0395901_0391934
1750 Ga0395901_0446771
1751 Ga0395901_0985980
1752 Ga0395901_1044486
1753 Ga0395901_1659293
1754 Ga0439465_0041653
1755 Ga0451853_1009202
1756 Ga0439445_0095145
1757 Ga0439432_016963
1758 Ga0439432_022289
1759 Ga0439432_033260
1760 Ga0439449_0048452
1761 Ga0439449_0311047
1762 Ga0439455_0032544
1763 Ga0439458_0002361
1764 Ga0450916_030715
1765 Ga0466969_0024732
1766 Ga0466969_0132382
1767 Ga0466972_0045663
1768 Ga0466965_0482004
1769 Ga0466966_0050183
1770 Ga0466966_0128694
1771 Ga0466961_0077704
1772 Ga0466961_0087877
1773 Ga0466961_0105504
1774 Ga0466961_0122036
1775 Ga0466961_0126569
1776 Ga0466963_0115074
1777 Ga0466963_0431367
1778 Ga0466963_0742340
1779 Ga0466963_1063413
1780 Ga0466964_0062337
1781 Ga0466964_0331205
1782 Ga0466964_0718645
1783 Ga0466971_0001138
1784 Ga0466968_0005658
1785 Ga0466970_0068563
1786 Ga0466970_0113975
1787 Ga0466970_0322725
1788 Ga0466970_0595448
1789 Ga0466957_0027560
1790 Ga0466957_0058778
1791 Ga0466957_0094351
1792 Ga0466957_0118526
1793 Ga0466959_0010905
1794 Ga0466959_0108714
1795 Ga0466959_0134865
1796 Ga0466959_0509724
1797 Ga0466959_0591742
1798 Ga0466958_0046514
1799 Ga0466958_0089663
1800 Ga0466958_0111283
1801 Ga0466958_0952422
1802 Ga0466967_0052395
1803 Ga0466967_0083661
1804 Ga0466967_0103957
1805 Ga0466967_0168554
1806 Ga0466967_0328382
1807 Ga0495629_1129312
1808 Ga0495663_0018884
1809 Ga0495663_0041496
1810 Ga0495663_0198017
1811 Ga0495621_0002275
1812 Ga0495621_0005527
1813 Ga0495621_0342927
1814 Ga0495633_0011741
1815 Ga0495668_0668634
1816 Ga0495659_0012774
1817 Ga0495659_0167098
1818 Ga0495669_0000398
1819 Ga0495669_0002491
1820 Ga0495670_0000265
1821 Ga0495670_0015052
1822 Ga0495670_0084084
1823 Ga0495670_0344867
1824 Ga0495636_0241964
1825 Ga0495683_0128025
1826 Ga0495677_0008959
1827 Ga0495677_0070792
1828 Ga0495677_0072553
1829 Ga0496100_0085083
1830 Ga0496100_1053907
1831 Ga0496101_1097705
1832 Ga0496102_0864297
1833 Ga0496102_1076188
1834 Ga0496103_0076255
1835 Ga0496104_0233993
1836 Ga0496104_0384869
1837 Ga0496106_0873921
1838 Ga0496107_0576461
1839 Ga0496108_0019106
1840 Ga0496108_0025663
1841 Ga0496109_0010272
1842 Ga0496109_0126702
1843 Ga0496109_0284682
1844 Ga0496109_0989337
1845 Ga0496109_1541514
1846 Ga0496109_1562982
1847 Ga0496110_0002670
1848 Ga0496110_0020991
1849 Ga0496110_0058937
1850 Ga0496110_0083978
1851 Ga0496111_0006573
1852 Ga0496111_0008220
1853 Ga0496111_0085326
1854 Ga0496112_0007106
1855 Ga0496112_0020797
1856 Ga0496112_0062992
1857 Ga0496112_0158361
1858 Ga0496112_0293183
1859 Ga0496112_0342629
1860 Ga0496112_0370907
1861 Ga0496113_0066232
1862 Ga0496113_0182848
1863 Ga0496113_0894159
1864 Ga0496114_0000130
1865 Ga0496114_1110497
1866 Ga0501067_0076212
1867 Ga0501068_0447843
1868 Ga0501209_116140
1869 Ga0501217_030409
1870 Ga0501223_006051
1871 Ga0501233_011309
1872 Ga0501245_088074
1873 Ga0501080_0618971
1874 Ga0501241_117479
1875 Ga0501263_006368
1876 Ga0501270_010438
1877 Ga0501283_107490
1878 nmdc:mga0k408_845769_c1
1879 nmdc:mga0qj67_575084_c1
1880 nmdc:mga08y16_1317997_c1
1881 Ga0495655_0006404
1882 Ga0466962_0015781
1883 Ga0466962_0022080
1884 Ga0466962_0600639
1885 2885428453
1886 2896430503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

14

58

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w1m-assembly1.cif.gz_D cryo-em structure of human cohesin-ctcf-dna complex 0.9078 2 68
4abm-assembly1.cif.gz_A crystal structure of chmp4b hairpin 0.8958 2 69
6thk-assembly1.cif.gz_A structural mechanism of pyocin s5 import into pseudomonas aeruginosa 0.8917 4 74
3jc1-assembly1.cif.gz_Ab electron cryo-microscopy of the ist1-chmp1b escrt-iii copolymer 0.8893 2 73
6wg3-assembly1.cif.gz_D cryo-em structure of human cohesin-nipbl-dna complex 0.8803 2 69
ID Description Score Start End Superfamily
4k2oA02 Special;Helix non-globular;Helix Hairpins; 0.912 1 72 6.10.140.680
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.9047 1 72 6.10.140.680
af_Q8I560_31_409_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8991 2 67 1.25.40.10
af_Q8I560_72_417_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8991 2 67 1.25.40.10
1setA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8819 2 69 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A2E6H2X1-F1-model_v4 C4-type zinc ribbon domain-containing protein 0.9006 2 72
AF-A0A2D8NYS1-F1-model_v4 deleted 0.8951 5 77
AF-A0A1I8G8F7-F1-model_v4 TPR_MLP1_2 domain-containing protein 0.8938 2 74 GO:0005794
GO:0031267
GO:0048193
AF-A0A3R7VQD1-F1-model_v4 Uncharacterized protein 0.893 2 79 GO:0016020
AF-A0A2E7GD68-F1-model_v4 deleted 0.892 2 73

Map