F486380

General Info

Members Datasets Scaffolds Average Seq Length
943 311 1886 145

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1003542|Ga0081540_10035427
Length 164
Sequence MSLGAKYHLHKKRKYAISEGRPNSDINVTPLVDVVLVLLIIFMVVTPLLEKDIQVRVPDDTEQETDPVDMQDQLVVSIDPSGQIRLNSEALDDEAYKTRIKRALAAKSYEEKLVFFIPDDKAPYPRVVQALDWTRSAGAFILGVVTEPVAANAIPGAAPGGGTK

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
300 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
304 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.56
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1003542 3300005983 Bacteria 12300
2 MRS1b_contig_7737215 2162886011 Bacteria 1229
3 MBSR1b_contig_3451468 2162886012 Bacteria 2341
4 MBSR1b_contig_4076216 2162886012 Bacteria 2339
5 JGI24747J21853_1002278 3300001978 Bacteria 1547
6 JGI24740J21852_10172682 3300001979 Unclassified 536
7 JGI24748J21848_1004858 3300002074 Bacteria 1548
8 JGI24749J21850_1004413 3300002076 Bacteria 1965
9 JGI24034J26672_10006748 3300002239 Bacteria 1659
10 JGI24751J29686_10001820 3300002459 Unclassified 4364
11 JGI25404J52841_10001143 3300003659 Bacteria 4495
12 Ga0065712_10085263 3300005290 Bacteria 2708
13 Ga0065712_10096114 3300005290 Bacteria 2189
14 Ga0065715_10279403 3300005293 Unclassified 1090
15 Ga0070658_10001235 3300005327 Bacteria 21911
16 Ga0070658_10018327 3300005327 Bacteria 5604
17 Ga0070676_10001424 3300005328 Bacteria 12085
18 Ga0070676_10003769 3300005328 Bacteria 7947
19 Ga0070676_10087797 3300005328 Bacteria 1899
20 Ga0070676_10463061 3300005328 Bacteria 894
21 Ga0070683_100000291 3300005329 Bacteria 34555
22 Ga0070683_100004199 3300005329 Bacteria 11817
23 Ga0070683_100090257 3300005329 Bacteria 2877
24 Ga0070683_100149161 3300005329 Bacteria 2217
25 Ga0070683_100249584 3300005329 Bacteria 1688
26 Ga0070690_100001147 3300005330 Bacteria 13638
27 Ga0070690_100097071 3300005330 Bacteria 1948
28 Ga0070690_100135454 3300005330 Bacteria 1668
29 Ga0070670_100008312 3300005331 Bacteria 8844
30 Ga0070670_100043198 3300005331 Bacteria 3875
31 Ga0070677_10000913 3300005333 Bacteria 9632
32 Ga0070677_10329988 3300005333 Bacteria 784
33 Ga0068869_100000703 3300005334 Bacteria 18957
34 Ga0068869_100025466 3300005334 Bacteria 4109
35 Ga0068869_100053009 3300005334 Bacteria 2947
36 Ga0070666_10000963 3300005335 Bacteria 17565
37 Ga0070666_10091098 3300005335 Bacteria 2094
38 Ga0070666_10245908 3300005335 Bacteria 1265
39 Ga0070680_100035436 3300005336 Bacteria 4029
40 Ga0070680_100175235 3300005336 Bacteria 1805
41 Ga0070682_100007963 3300005337 Bacteria 5963
42 Ga0070682_100111690 3300005337 Bacteria 1822
43 Ga0068868_100001177 3300005338 Bacteria 17910
44 Ga0068868_100009233 3300005338 Bacteria 7089
45 Ga0068868_100037710 3300005338 Bacteria 3748
46 Ga0068868_100037730 3300005338 Bacteria 3747
47 Ga0068868_100187424 3300005338 Bacteria 1719
48 Ga0068868_101271973 3300005338 Bacteria 682
49 Ga0070660_100001708 3300005339 Bacteria 15056
50 Ga0070660_100003689 3300005339 Bacteria 10568
51 Ga0070660_100042394 3300005339 Bacteria 3473
52 Ga0070689_100001228 3300005340 Bacteria 16276
53 Ga0070689_100001287 3300005340 Bacteria 15961
54 Ga0070689_100232312 3300005340 Bacteria 1516
55 Ga0070691_10074682 3300005341 Bacteria 1650
56 Ga0070687_100000840 3300005343 Bacteria 10247
57 Ga0070687_100012555 3300005343 Bacteria 3744
58 Ga0070661_100002598 3300005344 Bacteria 12386
59 Ga0070661_100017354 3300005344 Bacteria 5106
60 Ga0070661_100025065 3300005344 Bacteria 4283
61 Ga0070692_10035200 3300005345 Bacteria 2534
62 Ga0070692_10375728 3300005345 Unclassified 890
63 Ga0070668_100001426 3300005347 Bacteria 17249
64 Ga0070668_100002621 3300005347 Bacteria 13220
65 Ga0070668_100142165 3300005347 Bacteria 1935
66 Ga0070669_100002414 3300005353 Bacteria 13516
67 Ga0070669_100006187 3300005353 Bacteria 8640
68 Ga0070675_100003381 3300005354 Bacteria 12085
69 Ga0070675_100073407 3300005354 Bacteria 2840
70 Ga0070671_100098950 3300005355 Bacteria 2446
71 Ga0070671_100107883 3300005355 Bacteria 2338
72 Ga0070671_100157498 3300005355 Bacteria 1919
73 Ga0070671_100196070 3300005355 Bacteria 1712
74 Ga0070671_100394543 3300005355 Bacteria 1183
75 Ga0070674_100012858 3300005356 Bacteria 5153
76 Ga0070674_100285543 3300005356 Unclassified 1310
77 Ga0070673_100001141 3300005364 Bacteria 15246
78 Ga0070673_100007740 3300005364 Bacteria 7109
79 Ga0070673_100112800 3300005364 Bacteria 2257
80 Ga0070688_100001356 3300005365 Bacteria 12161
81 Ga0070688_100009566 3300005365 Bacteria 5309
82 Ga0070659_100000944 3300005366 Bacteria 21377
83 Ga0070659_100004959 3300005366 Bacteria 9524
84 Ga0070659_100017618 3300005366 Bacteria 5380
85 Ga0070667_100005739 3300005367 Bacteria 10371
86 Ga0070667_100047108 3300005367 Bacteria 3627
87 Ga0070709_10040342 3300005434 Bacteria 2870
88 Ga0070709_10128024 3300005434 Bacteria 1730
89 Ga0070709_10399205 3300005434 Bacteria 1026
90 Ga0070709_10510895 3300005434 Bacteria 914
91 Ga0070709_10739784 3300005434 Bacteria 768
92 Ga0070709_10977172 3300005434 Bacteria 673
93 Ga0070714_100002643 3300005435 Bacteria 13202
94 Ga0070714_100062669 3300005435 Bacteria 3196
95 Ga0070714_100152687 3300005435 Bacteria 2082
96 Ga0070714_100283057 3300005435 Bacteria 1541
97 Ga0070714_100289677 3300005435 Bacteria 1523
98 Ga0070714_100465694 3300005435 Bacteria 1202
99 Ga0070714_101295910 3300005435 Bacteria 711
100 Ga0070714_101311373 3300005435 Bacteria 707
101 Ga0070713_100002312 3300005436 Bacteria 12408
102 Ga0070713_100003542 3300005436 Bacteria 10308
103 Ga0070713_100053408 3300005436 Bacteria 3348
104 Ga0070713_100058466 3300005436 Bacteria 3216
105 Ga0070713_100063783 3300005436 Bacteria 3090
106 Ga0070713_100323093 3300005436 Bacteria 1426
107 Ga0070713_100344032 3300005436 Bacteria 1382
108 Ga0070713_100471951 3300005436 Bacteria 1181
109 Ga0070710_10004086 3300005437 Bacteria 6933
110 Ga0070710_10055148 3300005437 Bacteria 2245
111 Ga0070710_10092908 3300005437 Bacteria 1783
112 Ga0070701_10002522 3300005438 Bacteria 7077
113 Ga0070701_10021787 3300005438 Bacteria 3064
114 Ga0070711_100000134 3300005439 Bacteria 39588
115 Ga0070711_100093904 3300005439 Bacteria 2167
116 Ga0070711_100098465 3300005439 Bacteria 2123
117 Ga0070711_100518420 3300005439 Bacteria 985
118 Ga0070711_101049468 3300005439 Bacteria 701
119 Ga0070705_100002938 3300005440 Bacteria 8424
120 Ga0070705_100312746 3300005440 Bacteria 1130
121 Ga0070705_100657389 3300005440 Bacteria 818
122 Ga0070700_100147161 3300005441 Bacteria 1607
123 Ga0070708_100000905 3300005445 Bacteria 22462
124 Ga0070708_100167236 3300005445 Bacteria 2051
125 Ga0070708_100251015 3300005445 Bacteria 1662
126 Ga0070708_100516904 3300005445 Unclassified 1126
127 Ga0070708_100519684 3300005445 Bacteria 1123
128 Ga0070708_100852989 3300005445 Bacteria 856
129 Ga0070663_100017425 3300005455 Bacteria 4688
130 Ga0070663_100018484 3300005455 Bacteria 4572
131 Ga0070663_100038312 3300005455 Bacteria 3344
132 Ga0070663_100592703 3300005455 Bacteria 931
133 Ga0070678_100001703 3300005456 Bacteria 11810
134 Ga0070678_100108726 3300005456 Bacteria 2165
135 Ga0070678_100136711 3300005456 Bacteria 1955
136 Ga0070678_100385256 3300005456 Bacteria 1214
137 Ga0070678_101125270 3300005456 Bacteria 726
138 Ga0070662_100001698 3300005457 Bacteria 13536
139 Ga0070662_100003964 3300005457 Bacteria 9278
140 Ga0070662_100070107 3300005457 Bacteria 2582
141 Ga0070681_10000378 3300005458 Bacteria 35967
142 Ga0070681_10141536 3300005458 Bacteria 2335
143 Ga0070681_10149903 3300005458 Bacteria 2259
144 Ga0070681_10378229 3300005458 Bacteria 1327
145 Ga0070681_10622838 3300005458 Bacteria 994
146 Ga0068867_100001102 3300005459 Bacteria 18462
147 Ga0068867_100030096 3300005459 Bacteria 3915
148 Ga0068867_100031437 3300005459 Bacteria 3833
149 Ga0068867_100116268 3300005459 Bacteria 2061
150 Ga0070685_10000581 3300005466 Bacteria 20412
151 Ga0070685_10003448 3300005466 Bacteria 8042
152 Ga0070706_100000677 3300005467 Bacteria 38554
153 Ga0070706_100001035 3300005467 Bacteria 30200
154 Ga0070706_100092422 3300005467 Bacteria 2807
155 Ga0070707_100044215 3300005468 Bacteria 4263
156 Ga0070707_100068824 3300005468 Bacteria 3407
157 Ga0070707_101168819 3300005468 Bacteria 735
158 Ga0070707_102331448 3300005468 Unclassified 503
159 Ga0070698_100003127 3300005471 Bacteria 18237
160 Ga0070698_100084420 3300005471 Bacteria 3164
161 Ga0070699_100090389 3300005518 Bacteria 2676
162 Ga0070699_100454196 3300005518 Bacteria 1162
163 Ga0070699_100681818 3300005518 Bacteria 938
164 Ga0070679_100321036 3300005530 Bacteria 1498
165 Ga0070679_100455313 3300005530 Bacteria 1224
166 Ga0070684_100001282 3300005535 Bacteria 18003
167 Ga0070684_100045453 3300005535 Bacteria 3803
168 Ga0070684_100047393 3300005535 Bacteria 3724
169 Ga0070684_100224576 3300005535 Bacteria 1714
170 Ga0070697_100000024 3300005536 Bacteria 129765
171 Ga0070697_100000087 3300005536 Bacteria 76603
172 Ga0070697_100000787 3300005536 Bacteria 23824
173 Ga0070697_100017459 3300005536 Bacteria 5647
174 Ga0070697_100027510 3300005536 Bacteria 4549
175 Ga0070697_100312438 3300005536 Bacteria 1352
176 Ga0070697_100394973 3300005536 Bacteria 1199
177 Ga0070697_100787979 3300005536 Bacteria 841
178 Ga0070697_101538800 3300005536 Bacteria 595
179 Ga0068853_100000370 3300005539 Bacteria 30931
180 Ga0068853_100004824 3300005539 Bacteria 10478
181 Ga0068853_100025949 3300005539 Bacteria 4917
182 Ga0068853_102067405 3300005539 Bacteria 552
183 Ga0070672_100003301 3300005543 Bacteria 10447
184 Ga0070672_100057072 3300005543 Bacteria 3064
185 Ga0070672_100107632 3300005543 Bacteria 2269
186 Ga0070686_100000763 3300005544 Bacteria 18660
187 Ga0070686_100002858 3300005544 Bacteria 9507
188 Ga0070686_100056603 3300005544 Bacteria 2516
189 Ga0070695_100092121 3300005545 Bacteria 2025
190 Ga0070696_100083894 3300005546 Bacteria 2260
191 Ga0070696_100513084 3300005546 Bacteria 955
192 Ga0070693_100011723 3300005547 Bacteria 4420
193 Ga0070693_100050324 3300005547 Bacteria 2381
194 Ga0070693_100121059 3300005547 Bacteria 1623
195 Ga0070693_100149459 3300005547 Bacteria 1478
196 Ga0070693_101052809 3300005547 Bacteria 618
197 Ga0070665_100031396 3300005548 Bacteria 5348
198 Ga0070665_101698917 3300005548 Unclassified 638
199 Ga0070704_100485912 3300005549 Bacteria 1069
200 Ga0068855_100000367 3300005563 Bacteria 55955
201 Ga0068855_100001846 3300005563 Bacteria 26356
202 Ga0068855_100009926 3300005563 Bacteria 11481
203 Ga0068855_100015302 3300005563 Bacteria 9236
204 Ga0068855_100485424 3300005563 Bacteria 1344
205 Ga0070664_100020106 3300005564 Bacteria 5497
206 Ga0070664_100024372 3300005564 Bacteria 5003
207 Ga0070664_100476933 3300005564 Bacteria 1148
208 Ga0068857_100015861 3300005577 Bacteria 6595
209 Ga0068857_100041920 3300005577 Bacteria 4059
210 Ga0068857_100042817 3300005577 Bacteria 4017
211 Ga0068857_100113036 3300005577 Bacteria 2441
212 Ga0068854_100001575 3300005578 Bacteria 13862
213 Ga0068854_100037736 3300005578 Bacteria 3393
214 Ga0068854_100116398 3300005578 Bacteria 2023
215 Ga0068854_101288541 3300005578 Unclassified 657
216 Ga0068856_100002697 3300005614 Bacteria 18208
217 Ga0068856_100002858 3300005614 Bacteria 17664
218 Ga0068856_100005914 3300005614 Bacteria 12051
219 Ga0068856_100006956 3300005614 Bacteria 11055
220 Ga0068856_100012055 3300005614 Bacteria 8374
221 Ga0068856_100012747 3300005614 Bacteria 8139
222 Ga0068856_100148340 3300005614 Bacteria 2353
223 Ga0070702_100002969 3300005615 Bacteria 7489
224 Ga0070702_100157277 3300005615 Bacteria 1465
225 Ga0070702_100491741 3300005615 Bacteria 899
226 Ga0068852_100001614 3300005616 Bacteria 15369
227 Ga0068852_100104102 3300005616 Bacteria 2568
228 Ga0068852_100135696 3300005616 Bacteria 2272
229 Ga0068852_100360288 3300005616 Bacteria 1422
230 Ga0068859_100002784 3300005617 Bacteria 17713
231 Ga0068859_100006246 3300005617 Bacteria 12094
232 Ga0068859_100046602 3300005617 Bacteria 4353
233 Ga0068864_100003031 3300005618 Bacteria 13876
234 Ga0068864_100029154 3300005618 Bacteria 4670
235 Ga0068864_100150414 3300005618 Bacteria 2108
236 Ga0068864_101840987 3300005618 Bacteria 611
237 Ga0068866_10000075 3300005718 Bacteria 39422
238 Ga0068866_10002766 3300005718 Bacteria 7234
239 Ga0068866_10030845 3300005718 Bacteria 2577
240 Ga0068866_10424080 3300005718 Bacteria 864
241 Ga0068861_100028130 3300005719 Bacteria 4101
242 Ga0068861_100036522 3300005719 Bacteria 3647
243 Ga0068861_100174184 3300005719 Bacteria 1786
244 Ga0068851_10000901 3300005834 Bacteria 12793
245 Ga0068851_10004901 3300005834 Bacteria 6063
246 Ga0068870_10000279 3300005840 Bacteria 18897
247 Ga0068870_10000373 3300005840 Bacteria 16810
248 Ga0068863_100008624 3300005841 Bacteria 9963
249 Ga0068863_100043772 3300005841 Bacteria 4250
250 Ga0068863_101685053 3300005841 Bacteria 643
251 Ga0068858_100015757 3300005842 Bacteria 7109
252 Ga0068858_100039382 3300005842 Bacteria 4383
253 Ga0068860_100024975 3300005843 Bacteria 5769
254 Ga0068860_100027884 3300005843 Bacteria 5438
255 Ga0068860_100083156 3300005843 Bacteria 3044
256 Ga0068860_100531169 3300005843 Bacteria 1177
257 Ga0068862_100003487 3300005844 Bacteria 13519
258 Ga0068862_100047509 3300005844 Bacteria 3663
259 Ga0068862_100096360 3300005844 Bacteria 2582
260 Ga0081540_1000516 3300005983 Bacteria 37841
261 Ga0081540_1044675 3300005983 Bacteria 2259
262 Ga0070717_10005209 3300006028 Bacteria 9472
263 Ga0070717_10008445 3300006028 Bacteria 7692
264 Ga0070717_10015087 3300006028 Bacteria 5958
265 Ga0070717_10021113 3300006028 Bacteria 5130
266 Ga0070717_10029266 3300006028 Bacteria 4417
267 Ga0070717_10050008 3300006028 Bacteria 3433
268 Ga0070717_10052631 3300006028 Unclassified 3355
269 Ga0070717_10088260 3300006028 Bacteria 2613
270 Ga0070717_10095015 3300006028 Bacteria 2523
271 Ga0070717_10993597 3300006028 Bacteria 764
272 Ga0070715_10010822 3300006163 Bacteria 3263
273 Ga0070715_10038213 3300006163 Bacteria 1992
274 Ga0070715_10076338 3300006163 Bacteria 1510
275 Ga0070715_10415376 3300006163 Bacteria 751
276 Ga0070715_10445581 3300006163 Bacteria 730
277 Ga0070716_100000246 3300006173 Bacteria 21675
278 Ga0070716_100000428 3300006173 Bacteria 17417
279 Ga0070716_100003091 3300006173 Bacteria 7774
280 Ga0070716_100138847 3300006173 Bacteria 1547
281 Ga0070716_100360689 3300006173 Bacteria 1032
282 Ga0070712_100000648 3300006175 Bacteria 20453
283 Ga0070712_100004024 3300006175 Bacteria 9025
284 Ga0070712_100012539 3300006175 Bacteria 5388
285 Ga0070712_100074942 3300006175 Bacteria 2432
286 Ga0070712_100181276 3300006175 Bacteria 1641
287 Ga0070712_100275652 3300006175 Bacteria 1353
288 Ga0070712_100990599 3300006175 Bacteria 727
289 Ga0097621_100000155 3300006237 Bacteria 42646
290 Ga0097621_100000641 3300006237 Bacteria 24740
291 Ga0097621_100005036 3300006237 Bacteria 9276
292 Ga0097621_100005100 3300006237 Bacteria 9222
293 Ga0097621_100025066 3300006237 Bacteria 4664
294 Ga0097621_100282445 3300006237 Bacteria 1461
295 Ga0097621_100790729 3300006237 Bacteria 878
296 Ga0068871_100000106 3300006358 Bacteria 50618
297 Ga0068871_100000601 3300006358 Bacteria 24766
298 Ga0068871_100000985 3300006358 Bacteria 19075
299 Ga0068871_100002235 3300006358 Bacteria 13149
300 Ga0068871_100031649 3300006358 Bacteria 4173
301 Ga0068871_100091597 3300006358 Bacteria 2534
302 Ga0068871_100374648 3300006358 Bacteria 1263
303 Ga0075431_100165095 3300006847 Unclassified 2276
304 Ga0075433_10001388 3300006852 Bacteria 17839
305 Ga0075433_10020791 3300006852 Bacteria 5494
306 Ga0075434_100000201 3300006871 Bacteria 40218
307 Ga0075434_100000342 3300006871 Bacteria 33644
308 Ga0075434_100046938 3300006871 Bacteria 4286
309 Ga0075434_101678456 3300006871 Bacteria 643
310 Ga0068865_100004417 3300006881 Bacteria 8479
311 Ga0068865_100074957 3300006881 Bacteria 2411
312 Ga0075436_100000474 3300006914 Bacteria 26080
313 Ga0075436_100014847 3300006914 Bacteria 5338
314 Ga0075436_100050564 3300006914 Bacteria 2868
315 Ga0075436_100065769 3300006914 Bacteria 2505
316 Ga0075436_100866613 3300006914 Bacteria 674
317 Ga0097620_100002784 3300006931 Bacteria 17713
318 Ga0097620_100006246 3300006931 Bacteria 12094
319 Ga0097620_100046600 3300006931 Bacteria 4353
320 Ga0075435_100000779 3300007076 Bacteria 19795
321 Ga0075435_100201196 3300007076 Bacteria 1688
322 Ga0075435_101364554 3300007076 Bacteria 621
323 Ga0099795_10312751 3300007788 Bacteria 694
324 Ga0105250_10057191 3300009092 Bacteria 1565
325 Ga0105250_10073878 3300009092 Bacteria 1379
326 Ga0105240_10006582 3300009093 Bacteria 17056
327 Ga0105240_10016548 3300009093 Bacteria 9981
328 Ga0105240_10253698 3300009093 Bacteria 2033
329 Ga0105240_10265149 3300009093 Bacteria 1980
330 Ga0105240_10291456 3300009093 Bacteria 1870
331 Ga0105240_10562971 3300009093 Bacteria 1259
332 Ga0105240_10680517 3300009093 Unclassified 1125
333 Ga0105245_10000739 3300009098 Bacteria 29497
334 Ga0105245_10001453 3300009098 Bacteria 21412
335 Ga0105245_10005862 3300009098 Bacteria 10788
336 Ga0105245_10050173 3300009098 Bacteria 3739
337 Ga0105247_10000216 3300009101 Bacteria 55768
338 Ga0105247_10005094 3300009101 Bacteria 8328
339 Ga0105247_10007677 3300009101 Bacteria 6602
340 Ga0114129_10130626 3300009147 Bacteria 3450
341 Ga0105243_10002558 3300009148 Bacteria 15204
342 Ga0105243_10029457 3300009148 Bacteria 4222
343 Ga0105241_10000710 3300009174 Bacteria 25194
344 Ga0105241_10013469 3300009174 Bacteria 5994
345 Ga0105241_10024790 3300009174 Bacteria 4456
346 Ga0105241_10154424 3300009174 Bacteria 1881
347 Ga0105241_10273024 3300009174 Bacteria 1441
348 Ga0105241_10301607 3300009174 Bacteria 1375
349 Ga0105242_10001883 3300009176 Bacteria 16494
350 Ga0105242_10019728 3300009176 Bacteria 5284
351 Ga0105242_10030138 3300009176 Bacteria 4332
352 Ga0105242_10250373 3300009176 Bacteria 1596
353 Ga0105242_10501667 3300009176 Bacteria 1154
354 Ga0105248_10005689 3300009177 Bacteria 13697
355 Ga0105248_10014402 3300009177 Bacteria 8704
356 Ga0105248_10036698 3300009177 Bacteria 5482
357 Ga0105237_10000516 3300009545 Bacteria 54637
358 Ga0105237_10102749 3300009545 Bacteria 2850
359 Ga0105237_10292163 3300009545 Bacteria 1633
360 Ga0105237_10620792 3300009545 Bacteria 1088
361 Ga0105237_11018685 3300009545 Bacteria 835
362 Ga0105238_10000795 3300009551 Bacteria 32731
363 Ga0105238_10001120 3300009551 Bacteria 27074
364 Ga0105238_10020701 3300009551 Bacteria 6700
365 Ga0105238_10024149 3300009551 Bacteria 6198
366 Ga0105238_11894850 3300009551 Bacteria 629
367 Ga0105249_10008252 3300009553 Bacteria 9070
368 Ga0105249_10106404 3300009553 Bacteria 2646
369 Ga0105249_10801895 3300009553 Bacteria 1006
370 Ga0105239_10001818 3300010375 Bacteria 27978
371 Ga0105239_10002009 3300010375 Bacteria 26421
372 Ga0105239_12045164 3300010375 Bacteria 665
373 Ga0105246_10001297 3300011119 Bacteria 14677
374 Ga0105246_10039851 3300011119 Bacteria 3167
375 Ga0157373_10001057 3300013100 Bacteria 21194
376 Ga0157373_10001191 3300013100 Bacteria 19898
377 Ga0157373_10001771 3300013100 Bacteria 16435
378 Ga0157373_10093236 3300013100 Bacteria 2121
379 Ga0157373_10094137 3300013100 Bacteria 2110
380 Ga0157373_10144638 3300013100 Bacteria 1672
381 Ga0157371_10009372 3300013102 Bacteria 7711
382 Ga0157371_10074431 3300013102 Bacteria 2405
383 Ga0157370_10059750 3300013104 Bacteria 3622
384 Ga0157370_10069373 3300013104 Bacteria 3330
385 Ga0157370_10349259 3300013104 Bacteria 1363
386 Ga0157370_10496600 3300013104 Bacteria 1121
387 Ga0157370_10607224 3300013104 Bacteria 1001
388 Ga0157369_10000042 3300013105 Bacteria 181784
389 Ga0157369_10018346 3300013105 Bacteria 7845
390 Ga0157369_10121855 3300013105 Bacteria 2766
391 Ga0157369_10193999 3300013105 Bacteria 2133
392 Ga0157369_10197062 3300013105 Bacteria 2114
393 Ga0157369_10273062 3300013105 Bacteria 1761
394 Ga0157369_10498014 3300013105 Bacteria 1261
395 Ga0157374_10000052 3300013296 Bacteria 125138
396 Ga0157374_10000912 3300013296 Bacteria 25705
397 Ga0157374_10001911 3300013296 Bacteria 17454
398 Ga0157374_10004255 3300013296 Bacteria 12035
399 Ga0157374_10025520 3300013296 Bacteria 5308
400 Ga0157374_10120923 3300013296 Bacteria 2527
401 Ga0157374_10136613 3300013296 Bacteria 2377
402 Ga0157374_10210235 3300013296 Bacteria 1907
403 Ga0157378_10000097 3300013297 Bacteria 82132
404 Ga0157378_10000126 3300013297 Bacteria 74527
405 Ga0157378_10001249 3300013297 Bacteria 22930
406 Ga0157378_10007655 3300013297 Bacteria 9429
407 Ga0157378_10145835 3300013297 Bacteria 2201
408 Ga0157378_10342177 3300013297 Bacteria 1459
409 Ga0163162_10007313 3300013306 Bacteria 10732
410 Ga0163162_10015517 3300013306 Bacteria 7445
411 Ga0163162_10109874 3300013306 Bacteria 2854
412 Ga0163162_10450182 3300013306 Bacteria 1419
413 Ga0157372_10000502 3300013307 Bacteria 43063
414 Ga0157372_10000740 3300013307 Bacteria 35627
415 Ga0157372_10001506 3300013307 Bacteria 25333
416 Ga0157372_10017814 3300013307 Bacteria 7628
417 Ga0157372_10022253 3300013307 Bacteria 6859
418 Ga0157372_10030259 3300013307 Bacteria 5922
419 Ga0157372_10098339 3300013307 Bacteria 3338
420 Ga0157372_10237497 3300013307 Bacteria 2114
421 Ga0157372_10994878 3300013307 Bacteria 971
422 Ga0157372_12563705 3300013307 Bacteria 585
423 Ga0157375_10004241 3300013308 Bacteria 12433
424 Ga0157375_10017228 3300013308 Bacteria 6515
425 Ga0157375_10042398 3300013308 Bacteria 4405
426 Ga0163163_10000476 3300014325 Bacteria 36424
427 Ga0163163_10002564 3300014325 Bacteria 15388
428 Ga0163163_10033688 3300014325 Bacteria 4957
429 Ga0163163_10222383 3300014325 Bacteria 1937
430 Ga0163163_10737846 3300014325 Bacteria 1048
431 Ga0163163_12668608 3300014325 Bacteria 557
432 Ga0157380_10042520 3300014326 Bacteria 3552
433 Ga0157380_10145908 3300014326 Bacteria 2039
434 Ga0182008_10271009 3300014497 Bacteria 881
435 Ga0157377_10000728 3300014745 Bacteria 13614
436 Ga0157377_10001639 3300014745 Bacteria 9765
437 Ga0157379_10002090 3300014968 Bacteria 16583
438 Ga0157379_10002401 3300014968 Bacteria 15643
439 Ga0157379_10004891 3300014968 Bacteria 11502
440 Ga0157379_10020675 3300014968 Bacteria 5824
441 Ga0157376_10003074 3300014969 Bacteria 11453
442 Ga0157376_10009941 3300014969 Bacteria 6939
443 Ga0157376_10020505 3300014969 Bacteria 5114
444 Ga0157376_10026216 3300014969 Unclassified 4603
445 Ga0157376_10362063 3300014969 Bacteria 1391
446 Ga0157376_11487522 3300014969 Bacteria 710
447 Ga0163161_10001828 3300017792 Bacteria 15545
448 Ga0163161_10047306 3300017792 Bacteria 3107
449 Ga0213874_10073025 3300021377 Bacteria 1098
450 Ga0213874_10120499 3300021377 Bacteria 891
451 Ga0224570_105255 3300022730 Bacteria 787
452 Ga0224572_1058755 3300024225 Bacteria 713
453 Ga0228598_1001337 3300024227 Bacteria 5426
454 Ga0207697_10000108 3300025315 Bacteria 38541
455 Ga0207697_10004883 3300025315 Bacteria 6322
456 Ga0207656_10005746 3300025321 Bacteria 4411
457 Ga0207656_10010871 3300025321 Unclassified 3424
458 Ga0207656_10045590 3300025321 Bacteria 1877
459 Ga0207682_10000025 3300025893 Bacteria 61972
460 Ga0207692_10002593 3300025898 Bacteria 6950
461 Ga0207692_10023495 3300025898 Bacteria 2852
462 Ga0207642_10000373 3300025899 Bacteria 13539
463 Ga0207642_10037857 3300025899 Bacteria 2082
464 Ga0207642_10049721 3300025899 Bacteria 1887
465 Ga0207642_10313819 3300025899 Bacteria 913
466 Ga0207710_10012063 3300025900 Bacteria 3632
467 Ga0207688_10000002 3300025901 Bacteria 80771
468 Ga0207688_10011157 3300025901 Bacteria 4892
469 Ga0207680_10000153 3300025903 Bacteria 33513
470 Ga0207680_10001865 3300025903 Bacteria 9883
471 Ga0207680_10016088 3300025903 Bacteria 3919
472 Ga0207680_10654139 3300025903 Bacteria 752
473 Ga0207647_10000132 3300025904 Bacteria 58515
474 Ga0207647_10001724 3300025904 Bacteria 16768
475 Ga0207647_10143444 3300025904 Bacteria 1399
476 Ga0207647_10156873 3300025904 Bacteria 1329
477 Ga0207685_10030806 3300025905 Bacteria 1914
478 Ga0207699_10017164 3300025906 Bacteria 3803
479 Ga0207699_10126854 3300025906 Bacteria 1658
480 Ga0207699_10215500 3300025906 Bacteria 1308
481 Ga0207699_10217189 3300025906 Bacteria 1303
482 Ga0207699_10248610 3300025906 Bacteria 1225
483 Ga0207699_10382285 3300025906 Bacteria 999
484 Ga0207645_10000029 3300025907 Bacteria 93895
485 Ga0207645_10000296 3300025907 Bacteria 41961
486 Ga0207645_10010040 3300025907 Bacteria 6519
487 Ga0207643_10000001 3300025908 Bacteria 235137
488 Ga0207643_10000140 3300025908 Bacteria 48979
489 Ga0207705_10002607 3300025909 Bacteria 13848
490 Ga0207705_10219786 3300025909 Bacteria 1443
491 Ga0207684_10002198 3300025910 Bacteria 19934
492 Ga0207684_10003549 3300025910 Bacteria 15195
493 Ga0207684_10094527 3300025910 Bacteria 2550
494 Ga0207654_10000678 3300025911 Bacteria 19087
495 Ga0207654_10012306 3300025911 Bacteria 4383
496 Ga0207654_10045880 3300025911 Bacteria 2490
497 Ga0207654_10071742 3300025911 Bacteria 2060
498 Ga0207654_10790211 3300025911 Unclassified 685
499 Ga0207707_10411310 3300025912 Bacteria 1161
500 Ga0207707_10500028 3300025912 Bacteria 1037
501 Ga0207695_10004833 3300025913 Bacteria 18187
502 Ga0207695_10015744 3300025913 Bacteria 8891
503 Ga0207695_10021167 3300025913 Bacteria 7427
504 Ga0207695_10071512 3300025913 Bacteria 3543
505 Ga0207695_10080660 3300025913 Unclassified 3294
506 Ga0207695_10150856 3300025913 Bacteria 2264
507 Ga0207695_10328438 3300025913 Bacteria 1418
508 Ga0207695_10505019 3300025913 Bacteria 1091
509 Ga0207695_10871746 3300025913 Unclassified 780
510 Ga0207671_10001683 3300025914 Bacteria 25081
511 Ga0207671_10018983 3300025914 Bacteria 5267
512 Ga0207671_10032446 3300025914 Bacteria 3888
513 Ga0207671_10711550 3300025914 Bacteria 798
514 Ga0207671_11397820 3300025914 Unclassified 543
515 Ga0207693_10000096 3300025915 Bacteria 78447
516 Ga0207693_10003627 3300025915 Bacteria 13191
517 Ga0207693_10005168 3300025915 Bacteria 10920
518 Ga0207693_10021155 3300025915 Bacteria 5170
519 Ga0207693_10042883 3300025915 Bacteria 3561
520 Ga0207693_10065184 3300025915 Bacteria 2853
521 Ga0207663_10059146 3300025916 Bacteria 2423
522 Ga0207663_10089875 3300025916 Bacteria 2035
523 Ga0207663_10177536 3300025916 Bacteria 1518
524 Ga0207663_10236925 3300025916 Bacteria 1336
525 Ga0207663_11205909 3300025916 Bacteria 609
526 Ga0207660_10088724 3300025917 Unclassified 2287
527 Ga0207660_10148570 3300025917 Bacteria 1798
528 Ga0207660_10266394 3300025917 Bacteria 1356
529 Ga0207662_10000067 3300025918 Bacteria 46148
530 Ga0207662_10011290 3300025918 Bacteria 4947
531 Ga0207657_10000321 3300025919 Bacteria 51030
532 Ga0207657_10000550 3300025919 Bacteria 39979
533 Ga0207657_10002557 3300025919 Bacteria 19683
534 Ga0207649_10000664 3300025920 Bacteria 22964
535 Ga0207649_10004714 3300025920 Bacteria 7380
536 Ga0207649_10017842 3300025920 Bacteria 4025
537 Ga0207649_10213184 3300025920 Bacteria 1371
538 Ga0207652_10006337 3300025921 Bacteria 9559
539 Ga0207652_10177805 3300025921 Bacteria 1911
540 Ga0207652_10298507 3300025921 Bacteria 1454
541 Ga0207646_10000499 3300025922 Bacteria 52546
542 Ga0207646_10156384 3300025922 Bacteria 2056
543 Ga0207646_10235791 3300025922 Bacteria 1653
544 Ga0207646_10758638 3300025922 Bacteria 866
545 Ga0207646_10797737 3300025922 Bacteria 841
546 Ga0207646_11474646 3300025922 Bacteria 590
547 Ga0207646_11484842 3300025922 Bacteria 587
548 Ga0207681_10000993 3300025923 Bacteria 18544
549 Ga0207681_10017582 3300025923 Bacteria 4491
550 Ga0207681_10051306 3300025923 Bacteria 2795
551 Ga0207694_10000383 3300025924 Bacteria 41198
552 Ga0207694_10003712 3300025924 Bacteria 12092
553 Ga0207650_10000040 3300025925 Bacteria 204095
554 Ga0207650_10000257 3300025925 Bacteria 56893
555 Ga0207650_10172330 3300025925 Bacteria 1720
556 Ga0207659_10000231 3300025926 Bacteria 34085
557 Ga0207659_10035714 3300025926 Bacteria 3438
558 Ga0207687_10001026 3300025927 Bacteria 18962
559 Ga0207687_10004666 3300025927 Bacteria 9116
560 Ga0207687_10160672 3300025927 Bacteria 1724
561 Ga0207700_10006676 3300025928 Bacteria 6998
562 Ga0207700_10012462 3300025928 Bacteria 5485
563 Ga0207700_10088547 3300025928 Bacteria 2438
564 Ga0207700_10104179 3300025928 Bacteria 2270
565 Ga0207700_10109508 3300025928 Bacteria 2220
566 Ga0207700_10157667 3300025928 Bacteria 1882
567 Ga0207700_10314247 3300025928 Bacteria 1356
568 Ga0207700_10449116 3300025928 Bacteria 1136
569 Ga0207700_10508785 3300025928 Bacteria 1066
570 Ga0207700_10696490 3300025928 Bacteria 907
571 Ga0207700_11245279 3300025928 Bacteria 664
572 Ga0207664_10002277 3300025929 Bacteria 12653
573 Ga0207664_10045515 3300025929 Bacteria 3441
574 Ga0207664_10089528 3300025929 Bacteria 2520
575 Ga0207664_10109453 3300025929 Bacteria 2295
576 Ga0207664_10113015 3300025929 Bacteria 2261
577 Ga0207664_10236485 3300025929 Bacteria 1589
578 Ga0207664_10302286 3300025929 Bacteria 1408
579 Ga0207644_10003287 3300025931 Bacteria 10448
580 Ga0207644_10003970 3300025931 Bacteria 9602
581 Ga0207644_10729001 3300025931 Bacteria 827
582 Ga0207644_11002694 3300025931 Bacteria 701
583 Ga0207644_11344275 3300025931 Bacteria 600
584 Ga0207690_10004069 3300025932 Bacteria 8638
585 Ga0207690_10007958 3300025932 Bacteria 6293
586 Ga0207690_10060522 3300025932 Bacteria 2570
587 Ga0207706_10000027 3300025933 Bacteria 149194
588 Ga0207706_10000370 3300025933 Bacteria 48701
589 Ga0207706_10000712 3300025933 Bacteria 34695
590 Ga0207686_10003169 3300025934 Bacteria 8855
591 Ga0207686_10209340 3300025934 Bacteria 1401
592 Ga0207709_10042435 3300025935 Bacteria 2736
593 Ga0207709_10061619 3300025935 Bacteria 2345
594 Ga0207670_10000349 3300025936 Bacteria 27393
595 Ga0207670_10002346 3300025936 Bacteria 9918
596 Ga0207670_10983384 3300025936 Bacteria 709
597 Ga0207669_10000139 3300025937 Bacteria 34857
598 Ga0207669_10183364 3300025937 Bacteria 1503
599 Ga0207669_10515151 3300025937 Unclassified 959
600 Ga0207704_10000779 3300025938 Bacteria 14032
601 Ga0207704_10006626 3300025938 Bacteria 5421
602 Ga0207665_10000054 3300025939 Bacteria 73528
603 Ga0207665_10000903 3300025939 Bacteria 20002
604 Ga0207665_10003911 3300025939 Bacteria 9969
605 Ga0207665_10046138 3300025939 Bacteria 2920
606 Ga0207665_10058585 3300025939 Bacteria 2604
607 Ga0207665_10147982 3300025939 Bacteria 1680
608 Ga0207665_10307324 3300025939 Bacteria 1187
609 Ga0207665_10446762 3300025939 Bacteria 992
610 Ga0207665_10746158 3300025939 Bacteria 771
611 Ga0207691_10000120 3300025940 Bacteria 70657
612 Ga0207691_10000193 3300025940 Bacteria 58218
613 Ga0207691_10148561 3300025940 Bacteria 2061
614 Ga0207711_10001980 3300025941 Bacteria 18559
615 Ga0207711_10004548 3300025941 Bacteria 11801
616 Ga0207711_10028119 3300025941 Bacteria 4729
617 Ga0207689_10000273 3300025942 Bacteria 46618
618 Ga0207689_10001920 3300025942 Bacteria 19653
619 Ga0207689_10045342 3300025942 Bacteria 3636
620 Ga0207661_10002402 3300025944 Bacteria 12894
621 Ga0207661_10003121 3300025944 Bacteria 11478
622 Ga0207661_10096704 3300025944 Unclassified 2471
623 Ga0207661_10158813 3300025944 Bacteria 1960
624 Ga0207661_10203934 3300025944 Bacteria 1740
625 Ga0207661_10335175 3300025944 Bacteria 1362
626 Ga0207679_10000163 3300025945 Bacteria 55053
627 Ga0207679_10002597 3300025945 Bacteria 11120
628 Ga0207679_10072017 3300025945 Bacteria 2609
629 Ga0207679_10580925 3300025945 Bacteria 1008
630 Ga0207679_10736437 3300025945 Bacteria 896
631 Ga0207667_10000433 3300025949 Bacteria 56152
632 Ga0207667_10002870 3300025949 Bacteria 21390
633 Ga0207667_10006616 3300025949 Bacteria 14010
634 Ga0207667_10045648 3300025949 Unclassified 4640
635 Ga0207667_10054092 3300025949 Bacteria 4223
636 Ga0207667_10283930 3300025949 Bacteria 1691
637 Ga0207651_10000058 3300025960 Bacteria 48948
638 Ga0207712_10001095 3300025961 Bacteria 18928
639 Ga0207712_10261346 3300025961 Unclassified 1404
640 Ga0207712_10380280 3300025961 Bacteria 1181
641 Ga0207712_10415182 3300025961 Bacteria 1134
642 Ga0207668_10000903 3300025972 Bacteria 17893
643 Ga0207668_10052770 3300025972 Bacteria 2814
644 Ga0207668_10090868 3300025972 Bacteria 2242
645 Ga0207640_10005860 3300025981 Bacteria 6703
646 Ga0207640_10037630 3300025981 Bacteria 3047
647 Ga0207640_10218914 3300025981 Bacteria 1456
648 Ga0207640_10328105 3300025981 Bacteria 1221
649 Ga0207658_10000346 3300025986 Bacteria 46016
650 Ga0207658_10013065 3300025986 Bacteria 5670
651 Ga0207658_10443915 3300025986 Bacteria 1147
652 Ga0207658_10540427 3300025986 Bacteria 1042
653 Ga0207677_10000136 3300026023 Bacteria 60243
654 Ga0207677_10015737 3300026023 Bacteria 4460
655 Ga0207677_10036313 3300026023 Unclassified 3211
656 Ga0207677_10037637 3300026023 Bacteria 3164
657 Ga0207677_10104244 3300026023 Bacteria 2096
658 Ga0207703_10000229 3300026035 Bacteria 64471
659 Ga0207703_10015744 3300026035 Bacteria 5899
660 Ga0207703_10025078 3300026035 Bacteria 4690
661 Ga0207703_10042040 3300026035 Bacteria 3664
662 Ga0207703_10568970 3300026035 Bacteria 1070
663 Ga0207639_10001838 3300026041 Bacteria 14290
664 Ga0207639_10760135 3300026041 Bacteria 901
665 Ga0207678_10000058 3300026067 Bacteria 86018
666 Ga0207678_10002033 3300026067 Bacteria 18339
667 Ga0207678_10057697 3300026067 Bacteria 3341
668 Ga0207678_10382798 3300026067 Bacteria 1216
669 Ga0207708_10104669 3300026075 Bacteria 2193
670 Ga0207708_10147480 3300026075 Bacteria 1850
671 Ga0207708_10186852 3300026075 Bacteria 1647
672 Ga0207702_10000377 3300026078 Bacteria 50931
673 Ga0207702_10000694 3300026078 Bacteria 36359
674 Ga0207702_10009853 3300026078 Bacteria 8009
675 Ga0207702_10014038 3300026078 Bacteria 6650
676 Ga0207702_10142702 3300026078 Bacteria 2169
677 Ga0207702_10400403 3300026078 Bacteria 1324
678 Ga0207641_10000009 3300026088 Bacteria 407901
679 Ga0207641_10001921 3300026088 Bacteria 19931
680 Ga0207641_10189839 3300026088 Bacteria 1888
681 Ga0207648_10000158 3300026089 Bacteria 69351
682 Ga0207648_10000596 3300026089 Bacteria 40626
683 Ga0207648_10003014 3300026089 Bacteria 17793
684 Ga0207648_10277158 3300026089 Bacteria 1499
685 Ga0207648_10475429 3300026089 Unclassified 1141
686 Ga0207648_11108806 3300026089 Bacteria 742
687 Ga0207676_10000569 3300026095 Bacteria 30573
688 Ga0207676_10001190 3300026095 Bacteria 19522
689 Ga0207676_10022125 3300026095 Bacteria 4674
690 Ga0207676_10156266 3300026095 Bacteria 1971
691 Ga0207676_11792204 3300026095 Bacteria 612
692 Ga0207674_10000010 3300026116 Bacteria 196710
693 Ga0207674_10001663 3300026116 Bacteria 28595
694 Ga0207674_10003519 3300026116 Bacteria 19110
695 Ga0207674_10007927 3300026116 Bacteria 12333
696 Ga0207674_10168096 3300026116 Bacteria 2146
697 Ga0207674_11255374 3300026116 Bacteria 710
698 Ga0207675_100000001 3300026118 Bacteria 381356
699 Ga0207675_100117671 3300026118 Bacteria 2513
700 Ga0207683_10000134 3300026121 Bacteria 61057
701 Ga0207683_10000238 3300026121 Bacteria 48939
702 Ga0207683_10275581 3300026121 Bacteria 1537
703 Ga0207683_10903468 3300026121 Bacteria 820
704 Ga0207698_10000234 3300026142 Bacteria 34667
705 Ga0207698_10009327 3300026142 Bacteria 6251
706 Ga0207698_10110351 3300026142 Bacteria 2304
707 Ga0207698_10338499 3300026142 Bacteria 1416
708 Ga0207698_10644447 3300026142 Bacteria 1049
709 Ga0209966_1009522 3300027695 Bacteria 1736
710 Ga0209998_10066422 3300027717 Bacteria 856
711 Ga0207428_10448217 3300027907 Bacteria 941
712 Ga0268266_10001519 3300028379 Bacteria 27186
713 Ga0268266_10003021 3300028379 Bacteria 17285
714 Ga0268266_10132413 3300028379 Bacteria 2231
715 Ga0268265_10001849 3300028380 Bacteria 16857
716 Ga0268265_10037588 3300028380 Bacteria 3554
717 Ga0268264_10000404 3300028381 Bacteria 61557
718 Ga0268264_10006833 3300028381 Bacteria 9582
719 Ga0268264_10262092 3300028381 Bacteria 1611
720 Ga0268264_10488529 3300028381 Bacteria 1199
721 Ga0268264_10911700 3300028381 Bacteria 882
722 Ga0265770_1005632 3300030878 Bacteria 1733
723 Ga0265760_10002735 3300031090 Bacteria 5163
724 Ga0265331_10271101 3300031250 Bacteria 761
725 Ga0307408_100178910 3300031548 Bacteria 1699
726 Ga0307408_100341678 3300031548 Bacteria 1267
727 Ga0307413_10248174 3300031824 Bacteria 1319
728 Ga0307413_10543735 3300031824 Unclassified 941
729 Ga0307410_10002911 3300031852 Bacteria 8433
730 Ga0307410_10167802 3300031852 Bacteria 1651
731 Ga0307410_10279652 3300031852 Bacteria 1309
732 Ga0307406_10064051 3300031901 Bacteria 2384
733 Ga0307406_10080511 3300031901 Bacteria 2163
734 Ga0307407_10262263 3300031903 Bacteria 1189
735 Ga0307412_10080221 3300031911 Bacteria 2254
736 Ga0307409_100053832 3300031995 Bacteria 3095
737 Ga0307409_100326953 3300031995 Bacteria 1437
738 Ga0307416_100110673 3300032002 Bacteria 2419
739 Ga0307416_100265033 3300032002 Bacteria 1682
740 Ga0307414_10135073 3300032004 Bacteria 1922
741 Ga0307411_10149373 3300032005 Bacteria 1734
742 Ga0307415_100005591 3300032126 Bacteria 6689
743 Ga0373958_0203825 3300034819 Bacteria 519
744 Ga0373926_0004073 3300035083 Bacteria 4772
745 Ga0373926_0114831 3300035083 Bacteria 1013
746 Ga0373926_0411626 3300035083 Bacteria 535
747 Ga0373929_0027655 3300035085 Bacteria 1193
748 Ga0373934_0267205 3300035086 Bacteria 708
749 Ga0373940_0061397 3300035088 Bacteria 1076
750 Ga0373923_0042286 3300035111 Bacteria 1882
751 Ga0373923_0432270 3300035111 Bacteria 637
752 Ga0373932_0393268 3300035112 Bacteria 535
753 Ga0373936_0020594 3300035113 Bacteria 2563
754 Ga0373939_0162582 3300035114 Bacteria 821
755 Ga0373941_0116435 3300035115 Bacteria 948
756 Ga0373960_0033321 3300035121 Bacteria 1452
757 Ga0373943_0031453 3300035170 Bacteria 2518
758 Ga0373943_0427767 3300035170 Unclassified 767
759 Ga0373943_0627729 3300035170 Bacteria 634
760 Ga0373942_0195922 3300035207 Bacteria 668
761 Ga0373931_0037925 3300035691 Bacteria 2518
762 Ga0373931_0088048 3300035691 Bacteria 1725
763 Ga0373931_0115077 3300035691 Bacteria 1530
764 Ga0373931_0162035 3300035691 Bacteria 1312
765 Ga0373931_0275037 3300035691 Bacteria 1032
766 Ga0373931_0285645 3300035691 Bacteria 1014
767 Ga0373931_0290569 3300035691 Bacteria 1006
768 Ga0373935_1082714 3300035692 Bacteria 596
769 Ga0373935_1107385 3300035692 Bacteria 589
770 Ga0373927_0005398 3300035695 Bacteria 8826
771 Ga0373927_0076013 3300035695 Bacteria 2175
772 Ga0373927_0129245 3300035695 Bacteria 1650
773 Ga0373927_0294593 3300035695 Bacteria 1068
774 Ga0373927_0634131 3300035695 Bacteria 706
775 Ga0373927_1046482 3300035695 Bacteria 538
776 Ga0373947_0017090 3300035725 Bacteria 4171
777 Ga0373947_0248215 3300035725 Bacteria 1176
778 Ga0373947_0433045 3300035725 Bacteria 890
779 Ga0373937_0270398 3300036401 Bacteria 1604
780 Ga0373937_1114845 3300036401 Bacteria 738
781 Ga0373925_0000886 3300037068 Bacteria 27341
782 Ga0373925_0005819 3300037068 Bacteria 9152
783 Ga0373925_0022748 3300037068 Bacteria 4574
784 Ga0373925_0864442 3300037068 Bacteria 745
785 Ga0395900_0973580 3300037418 Bacteria 769
786 Ga0395905_0021069 3300037471 Bacteria 6173
787 Ga0395905_0113110 3300037471 Bacteria 2550
788 Ga0395901_0407635 3300038443 Bacteria 1396
789 Ga0436365_0144416 3300039437 Bacteria 740
790 Ga0436365_0556939 3300039437 Bacteria 1318
791 Ga0436365_0750101 3300039437 Bacteria 589
792 Ga0436360_0418756 3300039438 Bacteria 586
793 Ga0436363_0675650 3300039450 Unclassified 772
794 Ga0436363_0749692 3300039450 Bacteria 1275
795 Ga0436363_0863545 3300039450 Bacteria 1785
796 Ga0436363_0945599 3300039450 Unclassified 2773
797 Ga0436363_1381201 3300039450 Bacteria 1249
798 Ga0436363_1534816 3300039450 Bacteria 1468
799 Ga0439455_0043972 3300042012 Bacteria 1151
800 Ga0439458_0018870 3300042157 Bacteria 1583
801 Ga0451577_0031283 3300042876 Bacteria 4803
802 Ga0451577_1061753 3300042876 Bacteria 726
803 Ga0451577_1913463 3300042876 Unclassified 519
804 Ga0466966_0201006 3300044684 Bacteria 1206
805 Ga0466966_0272121 3300044684 Bacteria 1019
806 Ga0466961_0108614 3300044693 Bacteria 1746
807 Ga0466963_0052159 3300044694 Bacteria 2713
808 Ga0466963_0133012 3300044694 Bacteria 1719
809 Ga0466963_0896872 3300044694 Bacteria 625
810 Ga0453684_1824781 3300044712 Unclassified 617
811 Ga0466957_0125952 3300044842 Bacteria 1637
812 Ga0466959_0019670 3300045049 Bacteria 4967
813 Ga0451576_0020022 3300045051 Bacteria 7293
814 Ga0451576_0064271 3300045051 Bacteria 3823
815 Ga0451576_0339889 3300045051 Bacteria 1572
816 Ga0451576_0437220 3300045051 Bacteria 1373
817 Ga0466958_0024566 3300045836 Bacteria 3547
818 Ga0466958_0260695 3300045836 Bacteria 1110
819 Ga0466967_0010336 3300045976 Bacteria 6995
820 Ga0466967_0011140 3300045976 Bacteria 6793
821 Ga0466967_0571726 3300045976 Bacteria 1113
822 Ga0495603_0073043 3300046455 Bacteria 2016
823 Ga0495651_0326142 3300046462 Bacteria 1022
824 Ga0495651_0352848 3300046462 Bacteria 972
825 Ga0495580_0000554 3300046472 Bacteria 31613
826 Ga0495580_0000743 3300046472 Bacteria 27919
827 Ga0495580_0001479 3300046472 Bacteria 20611
828 Ga0495580_0012394 3300046472 Bacteria 6536
829 Ga0495580_0034127 3300046472 Bacteria 3663
830 Ga0495580_0050028 3300046472 Unclassified 2955
831 Ga0495580_0055922 3300046472 Bacteria 2779
832 Ga0495580_0060872 3300046472 Bacteria 2652
833 Ga0495580_0103543 3300046472 Bacteria 1978
834 Ga0495580_0172547 3300046472 Bacteria 1494
835 Ga0495580_0344747 3300046472 Bacteria 1010
836 Ga0495580_0639416 3300046472 Bacteria 700
837 Ga0495582_0004490 3300046473 Bacteria 7845
838 Ga0495582_0111689 3300046473 Bacteria 1535
839 Ga0495582_0309420 3300046473 Bacteria 909
840 Ga0495605_0330636 3300046474 Bacteria 641
841 Ga0495639_0618939 3300046475 Bacteria 557
842 Ga0495664_0143633 3300046477 Bacteria 1447
843 Ga0495584_0077003 3300046491 Bacteria 1677
844 Ga0495594_0039275 3300046499 Bacteria 2588
845 Ga0495594_0144211 3300046499 Bacteria 1351
846 Ga0495642_0190764 3300046528 Unclassified 893
847 Ga0495665_0001027 3300046531 Bacteria 14788
848 Ga0495665_0051384 3300046531 Bacteria 2183
849 Ga0495665_0258894 3300046531 Unclassified 895
850 Ga0495665_0610441 3300046531 Bacteria 545
851 Ga0495586_0110902 3300046535 Bacteria 1527
852 Ga0495586_0329174 3300046535 Bacteria 876
853 Ga0495587_0351232 3300046536 Unclassified 822
854 Ga0495645_0340980 3300046543 Bacteria 968
855 Ga0495656_0064653 3300046615 Bacteria 1607
856 Ga0495635_0066570 3300046663 Bacteria 2471
857 Ga0495659_0433542 3300046664 Bacteria 570
858 Ga0495588_0091487 3300046674 Bacteria 1594
859 Ga0495657_0677737 3300046675 Bacteria 593
860 Ga0495623_0099981 3300046679 Bacteria 1768
861 Ga0495623_0161160 3300046679 Bacteria 1318
862 Ga0495658_0015641 3300046683 Bacteria 3894
863 Ga0495669_0060274 3300046684 Bacteria 1715
864 Ga0495669_0168465 3300046684 Bacteria 1041
865 Ga0495669_0323206 3300046684 Bacteria 745
866 Ga0495669_0366008 3300046684 Bacteria 697
867 Ga0495669_0397035 3300046684 Bacteria 668
868 Ga0495600_0230613 3300046809 Bacteria 1182
869 Ga0495600_0484576 3300046809 Bacteria 762
870 Ga0495674_0265340 3300047319 Bacteria 1410
871 Ga0495674_0985551 3300047319 Bacteria 647
872 Ga0495675_0041811 3300047444 Bacteria 2921
873 Ga0495675_0072730 3300047444 Bacteria 2169
874 Ga0495684_0318821 3300047471 Bacteria 1112
875 Ga0495602_0253445 3300048088 Bacteria 1310
876 Ga0496100_0151639 3300048903 Bacteria 1654
877 Ga0496100_0783167 3300048903 Bacteria 747
878 Ga0496101_0271791 3300048904 Bacteria 1323
879 Ga0496102_0001547 3300048905 Bacteria 20310
880 Ga0496102_0009553 3300048905 Bacteria 8342
881 Ga0496102_0121243 3300048905 Bacteria 2442
882 Ga0496102_0260363 3300048905 Bacteria 1635
883 Ga0496102_0329967 3300048905 Bacteria 1437
884 Ga0496103_0017861 3300048906 Bacteria 4250
885 Ga0496103_0069343 3300048906 Bacteria 2204
886 Ga0496104_0116144 3300048907 Bacteria 2568
887 Ga0496104_0139970 3300048907 Bacteria 2325
888 Ga0496104_0214988 3300048907 Unclassified 1834
889 Ga0496104_0733090 3300048907 Unclassified 896
890 Ga0496106_0009178 3300048909 Bacteria 7304
891 Ga0496106_0018454 3300048909 Bacteria 5158
892 Ga0496106_0337025 3300048909 Unclassified 1211
893 Ga0496107_0083797 3300048910 Bacteria 2325
894 Ga0496107_0285015 3300048910 Bacteria 1229
895 Ga0496107_0671716 3300048910 Bacteria 763
896 Ga0496108_0001657 3300048911 Bacteria 17650
897 Ga0496108_0282051 3300048911 Bacteria 1446
898 Ga0496108_1191348 3300048911 Bacteria 644
899 Ga0496109_0000795 3300048912 Bacteria 26257
900 Ga0496109_0002752 3300048912 Bacteria 14742
901 Ga0496109_0019667 3300048912 Bacteria 5957
902 Ga0496110_0025736 3300048913 Bacteria 5030
903 Ga0496110_1851492 3300048913 Bacteria 513
904 Ga0496111_0008727 3300048914 Bacteria 6726
905 Ga0496111_0581081 3300048914 Bacteria 821
906 Ga0496112_0000144 3300048915 Bacteria 44505
907 Ga0496112_0002867 3300048915 Bacteria 14017
908 Ga0496112_0004418 3300048915 Bacteria 11906
909 Ga0496112_0070742 3300048915 Bacteria 3448
910 Ga0496112_0157523 3300048915 Bacteria 2238
911 Ga0496112_0388948 3300048915 Bacteria 1335
912 Ga0496112_1031520 3300048915 Bacteria 742
913 Ga0496113_0005470 3300048916 Bacteria 7925
914 Ga0496113_0513952 3300048916 Bacteria 961
915 Ga0496115_0173173 3300048918 Bacteria 1785
916 Ga0496115_0299133 3300048918 Bacteria 1319
917 Ga0496115_0325402 3300048918 Bacteria 1257
918 Ga0496115_0591434 3300048918 Bacteria 883
919 Ga0501291_124757 3300049514 Bacteria 562
920 Ga0501298_028687 3300049521 Bacteria 1081
921 Ga0501298_072509 3300049521 Unclassified 746
922 Ga0501298_167528 3300049521 Bacteria 545
923 Ga0501225_0035813 3300049705 Bacteria 1367
924 Ga0501083_0032979 3300049744 Bacteria 3548
925 Ga0501266_101299 3300049763 Bacteria 511
926 Ga0501276_031613 3300049773 Bacteria 555
927 nmdc:mga05p37_668489_c1 3300050507 Bacteria 1160
928 nmdc:mga0n895_10040_c1 3300050512 Bacteria 8332
929 nmdc:mga0n895_1065263_c1 3300050512 Bacteria 787
930 nmdc:mga0n895_163922_c1 3300050512 Bacteria 2254
931 nmdc:mga0n895_3164_c1 3300050512 Bacteria 13154
932 nmdc:mga0n895_70544_c1 3300050512 Bacteria 3463
933 nmdc:mga0n895_718292_c1 3300050512 Bacteria 994
934 nmdc:mga0rr50_1195_c1 3300050513 Bacteria 14098
935 nmdc:mga0rr50_139829_c1 3300050513 Bacteria 1947
936 nmdc:mga0rr50_408682_c1 3300050513 Archaea 1147
937 nmdc:mga08x19_28581_c1 3300050514 Bacteria 3493
938 nmdc:mga08x19_52298_c1 3300050514 Bacteria 2627
939 nmdc:mga08x19_85001_c1 3300050514 Bacteria 2082
940 nmdc:mga0a205_16728_c1 3300050515 Bacteria 6868
941 nmdc:mga0a205_36506_c1 3300050515 Bacteria 4722
942 Ga0495612_0112024 3300053078 Bacteria 1169
943 Ga0501084_0277604 3300054114 Bacteria 1415
944 Ga0081540_1003542
945 MRS1b_contig_7737215
946 MBSR1b_contig_3451468
947 MBSR1b_contig_4076216
948 JGI24747J21853_1002278
949 JGI24740J21852_10172682
950 JGI24748J21848_1004858
951 JGI24749J21850_1004413
952 JGI24034J26672_10006748
953 JGI24751J29686_10001820
954 JGI25404J52841_10001143
955 Ga0065712_10085263
956 Ga0065712_10096114
957 Ga0065715_10279403
958 Ga0070658_10001235
959 Ga0070658_10018327
960 Ga0070676_10001424
961 Ga0070676_10003769
962 Ga0070676_10087797
963 Ga0070676_10463061
964 Ga0070683_100000291
965 Ga0070683_100004199
966 Ga0070683_100090257
967 Ga0070683_100149161
968 Ga0070683_100249584
969 Ga0070690_100001147
970 Ga0070690_100097071
971 Ga0070690_100135454
972 Ga0070670_100008312
973 Ga0070670_100043198
974 Ga0070677_10000913
975 Ga0070677_10329988
976 Ga0068869_100000703
977 Ga0068869_100025466
978 Ga0068869_100053009
979 Ga0070666_10000963
980 Ga0070666_10091098
981 Ga0070666_10245908
982 Ga0070680_100035436
983 Ga0070680_100175235
984 Ga0070682_100007963
985 Ga0070682_100111690
986 Ga0068868_100001177
987 Ga0068868_100009233
988 Ga0068868_100037710
989 Ga0068868_100037730
990 Ga0068868_100187424
991 Ga0068868_101271973
992 Ga0070660_100001708
993 Ga0070660_100003689
994 Ga0070660_100042394
995 Ga0070689_100001228
996 Ga0070689_100001287
997 Ga0070689_100232312
998 Ga0070691_10074682
999 Ga0070687_100000840
1000 Ga0070687_100012555
1001 Ga0070661_100002598
1002 Ga0070661_100017354
1003 Ga0070661_100025065
1004 Ga0070692_10035200
1005 Ga0070692_10375728
1006 Ga0070668_100001426
1007 Ga0070668_100002621
1008 Ga0070668_100142165
1009 Ga0070669_100002414
1010 Ga0070669_100006187
1011 Ga0070675_100003381
1012 Ga0070675_100073407
1013 Ga0070671_100098950
1014 Ga0070671_100107883
1015 Ga0070671_100157498
1016 Ga0070671_100196070
1017 Ga0070671_100394543
1018 Ga0070674_100012858
1019 Ga0070674_100285543
1020 Ga0070673_100001141
1021 Ga0070673_100007740
1022 Ga0070673_100112800
1023 Ga0070688_100001356
1024 Ga0070688_100009566
1025 Ga0070659_100000944
1026 Ga0070659_100004959
1027 Ga0070659_100017618
1028 Ga0070667_100005739
1029 Ga0070667_100047108
1030 Ga0070709_10040342
1031 Ga0070709_10128024
1032 Ga0070709_10399205
1033 Ga0070709_10510895
1034 Ga0070709_10739784
1035 Ga0070709_10977172
1036 Ga0070714_100002643
1037 Ga0070714_100062669
1038 Ga0070714_100152687
1039 Ga0070714_100283057
1040 Ga0070714_100289677
1041 Ga0070714_100465694
1042 Ga0070714_101295910
1043 Ga0070714_101311373
1044 Ga0070713_100002312
1045 Ga0070713_100003542
1046 Ga0070713_100053408
1047 Ga0070713_100058466
1048 Ga0070713_100063783
1049 Ga0070713_100323093
1050 Ga0070713_100344032
1051 Ga0070713_100471951
1052 Ga0070710_10004086
1053 Ga0070710_10055148
1054 Ga0070710_10092908
1055 Ga0070701_10002522
1056 Ga0070701_10021787
1057 Ga0070711_100000134
1058 Ga0070711_100093904
1059 Ga0070711_100098465
1060 Ga0070711_100518420
1061 Ga0070711_101049468
1062 Ga0070705_100002938
1063 Ga0070705_100312746
1064 Ga0070705_100657389
1065 Ga0070700_100147161
1066 Ga0070708_100000905
1067 Ga0070708_100167236
1068 Ga0070708_100251015
1069 Ga0070708_100516904
1070 Ga0070708_100519684
1071 Ga0070708_100852989
1072 Ga0070663_100017425
1073 Ga0070663_100018484
1074 Ga0070663_100038312
1075 Ga0070663_100592703
1076 Ga0070678_100001703
1077 Ga0070678_100108726
1078 Ga0070678_100136711
1079 Ga0070678_100385256
1080 Ga0070678_101125270
1081 Ga0070662_100001698
1082 Ga0070662_100003964
1083 Ga0070662_100070107
1084 Ga0070681_10000378
1085 Ga0070681_10141536
1086 Ga0070681_10149903
1087 Ga0070681_10378229
1088 Ga0070681_10622838
1089 Ga0068867_100001102
1090 Ga0068867_100030096
1091 Ga0068867_100031437
1092 Ga0068867_100116268
1093 Ga0070685_10000581
1094 Ga0070685_10003448
1095 Ga0070706_100000677
1096 Ga0070706_100001035
1097 Ga0070706_100092422
1098 Ga0070707_100044215
1099 Ga0070707_100068824
1100 Ga0070707_101168819
1101 Ga0070707_102331448
1102 Ga0070698_100003127
1103 Ga0070698_100084420
1104 Ga0070699_100090389
1105 Ga0070699_100454196
1106 Ga0070699_100681818
1107 Ga0070679_100321036
1108 Ga0070679_100455313
1109 Ga0070684_100001282
1110 Ga0070684_100045453
1111 Ga0070684_100047393
1112 Ga0070684_100224576
1113 Ga0070697_100000024
1114 Ga0070697_100000087
1115 Ga0070697_100000787
1116 Ga0070697_100017459
1117 Ga0070697_100027510
1118 Ga0070697_100312438
1119 Ga0070697_100394973
1120 Ga0070697_100787979
1121 Ga0070697_101538800
1122 Ga0068853_100000370
1123 Ga0068853_100004824
1124 Ga0068853_100025949
1125 Ga0068853_102067405
1126 Ga0070672_100003301
1127 Ga0070672_100057072
1128 Ga0070672_100107632
1129 Ga0070686_100000763
1130 Ga0070686_100002858
1131 Ga0070686_100056603
1132 Ga0070695_100092121
1133 Ga0070696_100083894
1134 Ga0070696_100513084
1135 Ga0070693_100011723
1136 Ga0070693_100050324
1137 Ga0070693_100121059
1138 Ga0070693_100149459
1139 Ga0070693_101052809
1140 Ga0070665_100031396
1141 Ga0070665_101698917
1142 Ga0070704_100485912
1143 Ga0068855_100000367
1144 Ga0068855_100001846
1145 Ga0068855_100009926
1146 Ga0068855_100015302
1147 Ga0068855_100485424
1148 Ga0070664_100020106
1149 Ga0070664_100024372
1150 Ga0070664_100476933
1151 Ga0068857_100015861
1152 Ga0068857_100041920
1153 Ga0068857_100042817
1154 Ga0068857_100113036
1155 Ga0068854_100001575
1156 Ga0068854_100037736
1157 Ga0068854_100116398
1158 Ga0068854_101288541
1159 Ga0068856_100002697
1160 Ga0068856_100002858
1161 Ga0068856_100005914
1162 Ga0068856_100006956
1163 Ga0068856_100012055
1164 Ga0068856_100012747
1165 Ga0068856_100148340
1166 Ga0070702_100002969
1167 Ga0070702_100157277
1168 Ga0070702_100491741
1169 Ga0068852_100001614
1170 Ga0068852_100104102
1171 Ga0068852_100135696
1172 Ga0068852_100360288
1173 Ga0068859_100002784
1174 Ga0068859_100006246
1175 Ga0068859_100046602
1176 Ga0068864_100003031
1177 Ga0068864_100029154
1178 Ga0068864_100150414
1179 Ga0068864_101840987
1180 Ga0068866_10000075
1181 Ga0068866_10002766
1182 Ga0068866_10030845
1183 Ga0068866_10424080
1184 Ga0068861_100028130
1185 Ga0068861_100036522
1186 Ga0068861_100174184
1187 Ga0068851_10000901
1188 Ga0068851_10004901
1189 Ga0068870_10000279
1190 Ga0068870_10000373
1191 Ga0068863_100008624
1192 Ga0068863_100043772
1193 Ga0068863_101685053
1194 Ga0068858_100015757
1195 Ga0068858_100039382
1196 Ga0068860_100024975
1197 Ga0068860_100027884
1198 Ga0068860_100083156
1199 Ga0068860_100531169
1200 Ga0068862_100003487
1201 Ga0068862_100047509
1202 Ga0068862_100096360
1203 Ga0081540_1000516
1204 Ga0081540_1044675
1205 Ga0070717_10005209
1206 Ga0070717_10008445
1207 Ga0070717_10015087
1208 Ga0070717_10021113
1209 Ga0070717_10029266
1210 Ga0070717_10050008
1211 Ga0070717_10052631
1212 Ga0070717_10088260
1213 Ga0070717_10095015
1214 Ga0070717_10993597
1215 Ga0070715_10010822
1216 Ga0070715_10038213
1217 Ga0070715_10076338
1218 Ga0070715_10415376
1219 Ga0070715_10445581
1220 Ga0070716_100000246
1221 Ga0070716_100000428
1222 Ga0070716_100003091
1223 Ga0070716_100138847
1224 Ga0070716_100360689
1225 Ga0070712_100000648
1226 Ga0070712_100004024
1227 Ga0070712_100012539
1228 Ga0070712_100074942
1229 Ga0070712_100181276
1230 Ga0070712_100275652
1231 Ga0070712_100990599
1232 Ga0097621_100000155
1233 Ga0097621_100000641
1234 Ga0097621_100005036
1235 Ga0097621_100005100
1236 Ga0097621_100025066
1237 Ga0097621_100282445
1238 Ga0097621_100790729
1239 Ga0068871_100000106
1240 Ga0068871_100000601
1241 Ga0068871_100000985
1242 Ga0068871_100002235
1243 Ga0068871_100031649
1244 Ga0068871_100091597
1245 Ga0068871_100374648
1246 Ga0075431_100165095
1247 Ga0075433_10001388
1248 Ga0075433_10020791
1249 Ga0075434_100000201
1250 Ga0075434_100000342
1251 Ga0075434_100046938
1252 Ga0075434_101678456
1253 Ga0068865_100004417
1254 Ga0068865_100074957
1255 Ga0075436_100000474
1256 Ga0075436_100014847
1257 Ga0075436_100050564
1258 Ga0075436_100065769
1259 Ga0075436_100866613
1260 Ga0097620_100002784
1261 Ga0097620_100006246
1262 Ga0097620_100046600
1263 Ga0075435_100000779
1264 Ga0075435_100201196
1265 Ga0075435_101364554
1266 Ga0099795_10312751
1267 Ga0105250_10057191
1268 Ga0105250_10073878
1269 Ga0105240_10006582
1270 Ga0105240_10016548
1271 Ga0105240_10253698
1272 Ga0105240_10265149
1273 Ga0105240_10291456
1274 Ga0105240_10562971
1275 Ga0105240_10680517
1276 Ga0105245_10000739
1277 Ga0105245_10001453
1278 Ga0105245_10005862
1279 Ga0105245_10050173
1280 Ga0105247_10000216
1281 Ga0105247_10005094
1282 Ga0105247_10007677
1283 Ga0114129_10130626
1284 Ga0105243_10002558
1285 Ga0105243_10029457
1286 Ga0105241_10000710
1287 Ga0105241_10013469
1288 Ga0105241_10024790
1289 Ga0105241_10154424
1290 Ga0105241_10273024
1291 Ga0105241_10301607
1292 Ga0105242_10001883
1293 Ga0105242_10019728
1294 Ga0105242_10030138
1295 Ga0105242_10250373
1296 Ga0105242_10501667
1297 Ga0105248_10005689
1298 Ga0105248_10014402
1299 Ga0105248_10036698
1300 Ga0105237_10000516
1301 Ga0105237_10102749
1302 Ga0105237_10292163
1303 Ga0105237_10620792
1304 Ga0105237_11018685
1305 Ga0105238_10000795
1306 Ga0105238_10001120
1307 Ga0105238_10020701
1308 Ga0105238_10024149
1309 Ga0105238_11894850
1310 Ga0105249_10008252
1311 Ga0105249_10106404
1312 Ga0105249_10801895
1313 Ga0105239_10001818
1314 Ga0105239_10002009
1315 Ga0105239_12045164
1316 Ga0105246_10001297
1317 Ga0105246_10039851
1318 Ga0157373_10001057
1319 Ga0157373_10001191
1320 Ga0157373_10001771
1321 Ga0157373_10093236
1322 Ga0157373_10094137
1323 Ga0157373_10144638
1324 Ga0157371_10009372
1325 Ga0157371_10074431
1326 Ga0157370_10059750
1327 Ga0157370_10069373
1328 Ga0157370_10349259
1329 Ga0157370_10496600
1330 Ga0157370_10607224
1331 Ga0157369_10000042
1332 Ga0157369_10018346
1333 Ga0157369_10121855
1334 Ga0157369_10193999
1335 Ga0157369_10197062
1336 Ga0157369_10273062
1337 Ga0157369_10498014
1338 Ga0157374_10000052
1339 Ga0157374_10000912
1340 Ga0157374_10001911
1341 Ga0157374_10004255
1342 Ga0157374_10025520
1343 Ga0157374_10120923
1344 Ga0157374_10136613
1345 Ga0157374_10210235
1346 Ga0157378_10000097
1347 Ga0157378_10000126
1348 Ga0157378_10001249
1349 Ga0157378_10007655
1350 Ga0157378_10145835
1351 Ga0157378_10342177
1352 Ga0163162_10007313
1353 Ga0163162_10015517
1354 Ga0163162_10109874
1355 Ga0163162_10450182
1356 Ga0157372_10000502
1357 Ga0157372_10000740
1358 Ga0157372_10001506
1359 Ga0157372_10017814
1360 Ga0157372_10022253
1361 Ga0157372_10030259
1362 Ga0157372_10098339
1363 Ga0157372_10237497
1364 Ga0157372_10994878
1365 Ga0157372_12563705
1366 Ga0157375_10004241
1367 Ga0157375_10017228
1368 Ga0157375_10042398
1369 Ga0163163_10000476
1370 Ga0163163_10002564
1371 Ga0163163_10033688
1372 Ga0163163_10222383
1373 Ga0163163_10737846
1374 Ga0163163_12668608
1375 Ga0157380_10042520
1376 Ga0157380_10145908
1377 Ga0182008_10271009
1378 Ga0157377_10000728
1379 Ga0157377_10001639
1380 Ga0157379_10002090
1381 Ga0157379_10002401
1382 Ga0157379_10004891
1383 Ga0157379_10020675
1384 Ga0157376_10003074
1385 Ga0157376_10009941
1386 Ga0157376_10020505
1387 Ga0157376_10026216
1388 Ga0157376_10362063
1389 Ga0157376_11487522
1390 Ga0163161_10001828
1391 Ga0163161_10047306
1392 Ga0213874_10073025
1393 Ga0213874_10120499
1394 Ga0224570_105255
1395 Ga0224572_1058755
1396 Ga0228598_1001337
1397 Ga0207697_10000108
1398 Ga0207697_10004883
1399 Ga0207656_10005746
1400 Ga0207656_10010871
1401 Ga0207656_10045590
1402 Ga0207682_10000025
1403 Ga0207692_10002593
1404 Ga0207692_10023495
1405 Ga0207642_10000373
1406 Ga0207642_10037857
1407 Ga0207642_10049721
1408 Ga0207642_10313819
1409 Ga0207710_10012063
1410 Ga0207688_10000002
1411 Ga0207688_10011157
1412 Ga0207680_10000153
1413 Ga0207680_10001865
1414 Ga0207680_10016088
1415 Ga0207680_10654139
1416 Ga0207647_10000132
1417 Ga0207647_10001724
1418 Ga0207647_10143444
1419 Ga0207647_10156873
1420 Ga0207685_10030806
1421 Ga0207699_10017164
1422 Ga0207699_10126854
1423 Ga0207699_10215500
1424 Ga0207699_10217189
1425 Ga0207699_10248610
1426 Ga0207699_10382285
1427 Ga0207645_10000029
1428 Ga0207645_10000296
1429 Ga0207645_10010040
1430 Ga0207643_10000001
1431 Ga0207643_10000140
1432 Ga0207705_10002607
1433 Ga0207705_10219786
1434 Ga0207684_10002198
1435 Ga0207684_10003549
1436 Ga0207684_10094527
1437 Ga0207654_10000678
1438 Ga0207654_10012306
1439 Ga0207654_10045880
1440 Ga0207654_10071742
1441 Ga0207654_10790211
1442 Ga0207707_10411310
1443 Ga0207707_10500028
1444 Ga0207695_10004833
1445 Ga0207695_10015744
1446 Ga0207695_10021167
1447 Ga0207695_10071512
1448 Ga0207695_10080660
1449 Ga0207695_10150856
1450 Ga0207695_10328438
1451 Ga0207695_10505019
1452 Ga0207695_10871746
1453 Ga0207671_10001683
1454 Ga0207671_10018983
1455 Ga0207671_10032446
1456 Ga0207671_10711550
1457 Ga0207671_11397820
1458 Ga0207693_10000096
1459 Ga0207693_10003627
1460 Ga0207693_10005168
1461 Ga0207693_10021155
1462 Ga0207693_10042883
1463 Ga0207693_10065184
1464 Ga0207663_10059146
1465 Ga0207663_10089875
1466 Ga0207663_10177536
1467 Ga0207663_10236925
1468 Ga0207663_11205909
1469 Ga0207660_10088724
1470 Ga0207660_10148570
1471 Ga0207660_10266394
1472 Ga0207662_10000067
1473 Ga0207662_10011290
1474 Ga0207657_10000321
1475 Ga0207657_10000550
1476 Ga0207657_10002557
1477 Ga0207649_10000664
1478 Ga0207649_10004714
1479 Ga0207649_10017842
1480 Ga0207649_10213184
1481 Ga0207652_10006337
1482 Ga0207652_10177805
1483 Ga0207652_10298507
1484 Ga0207646_10000499
1485 Ga0207646_10156384
1486 Ga0207646_10235791
1487 Ga0207646_10758638
1488 Ga0207646_10797737
1489 Ga0207646_11474646
1490 Ga0207646_11484842
1491 Ga0207681_10000993
1492 Ga0207681_10017582
1493 Ga0207681_10051306
1494 Ga0207694_10000383
1495 Ga0207694_10003712
1496 Ga0207650_10000040
1497 Ga0207650_10000257
1498 Ga0207650_10172330
1499 Ga0207659_10000231
1500 Ga0207659_10035714
1501 Ga0207687_10001026
1502 Ga0207687_10004666
1503 Ga0207687_10160672
1504 Ga0207700_10006676
1505 Ga0207700_10012462
1506 Ga0207700_10088547
1507 Ga0207700_10104179
1508 Ga0207700_10109508
1509 Ga0207700_10157667
1510 Ga0207700_10314247
1511 Ga0207700_10449116
1512 Ga0207700_10508785
1513 Ga0207700_10696490
1514 Ga0207700_11245279
1515 Ga0207664_10002277
1516 Ga0207664_10045515
1517 Ga0207664_10089528
1518 Ga0207664_10109453
1519 Ga0207664_10113015
1520 Ga0207664_10236485
1521 Ga0207664_10302286
1522 Ga0207644_10003287
1523 Ga0207644_10003970
1524 Ga0207644_10729001
1525 Ga0207644_11002694
1526 Ga0207644_11344275
1527 Ga0207690_10004069
1528 Ga0207690_10007958
1529 Ga0207690_10060522
1530 Ga0207706_10000027
1531 Ga0207706_10000370
1532 Ga0207706_10000712
1533 Ga0207686_10003169
1534 Ga0207686_10209340
1535 Ga0207709_10042435
1536 Ga0207709_10061619
1537 Ga0207670_10000349
1538 Ga0207670_10002346
1539 Ga0207670_10983384
1540 Ga0207669_10000139
1541 Ga0207669_10183364
1542 Ga0207669_10515151
1543 Ga0207704_10000779
1544 Ga0207704_10006626
1545 Ga0207665_10000054
1546 Ga0207665_10000903
1547 Ga0207665_10003911
1548 Ga0207665_10046138
1549 Ga0207665_10058585
1550 Ga0207665_10147982
1551 Ga0207665_10307324
1552 Ga0207665_10446762
1553 Ga0207665_10746158
1554 Ga0207691_10000120
1555 Ga0207691_10000193
1556 Ga0207691_10148561
1557 Ga0207711_10001980
1558 Ga0207711_10004548
1559 Ga0207711_10028119
1560 Ga0207689_10000273
1561 Ga0207689_10001920
1562 Ga0207689_10045342
1563 Ga0207661_10002402
1564 Ga0207661_10003121
1565 Ga0207661_10096704
1566 Ga0207661_10158813
1567 Ga0207661_10203934
1568 Ga0207661_10335175
1569 Ga0207679_10000163
1570 Ga0207679_10002597
1571 Ga0207679_10072017
1572 Ga0207679_10580925
1573 Ga0207679_10736437
1574 Ga0207667_10000433
1575 Ga0207667_10002870
1576 Ga0207667_10006616
1577 Ga0207667_10045648
1578 Ga0207667_10054092
1579 Ga0207667_10283930
1580 Ga0207651_10000058
1581 Ga0207712_10001095
1582 Ga0207712_10261346
1583 Ga0207712_10380280
1584 Ga0207712_10415182
1585 Ga0207668_10000903
1586 Ga0207668_10052770
1587 Ga0207668_10090868
1588 Ga0207640_10005860
1589 Ga0207640_10037630
1590 Ga0207640_10218914
1591 Ga0207640_10328105
1592 Ga0207658_10000346
1593 Ga0207658_10013065
1594 Ga0207658_10443915
1595 Ga0207658_10540427
1596 Ga0207677_10000136
1597 Ga0207677_10015737
1598 Ga0207677_10036313
1599 Ga0207677_10037637
1600 Ga0207677_10104244
1601 Ga0207703_10000229
1602 Ga0207703_10015744
1603 Ga0207703_10025078
1604 Ga0207703_10042040
1605 Ga0207703_10568970
1606 Ga0207639_10001838
1607 Ga0207639_10760135
1608 Ga0207678_10000058
1609 Ga0207678_10002033
1610 Ga0207678_10057697
1611 Ga0207678_10382798
1612 Ga0207708_10104669
1613 Ga0207708_10147480
1614 Ga0207708_10186852
1615 Ga0207702_10000377
1616 Ga0207702_10000694
1617 Ga0207702_10009853
1618 Ga0207702_10014038
1619 Ga0207702_10142702
1620 Ga0207702_10400403
1621 Ga0207641_10000009
1622 Ga0207641_10001921
1623 Ga0207641_10189839
1624 Ga0207648_10000158
1625 Ga0207648_10000596
1626 Ga0207648_10003014
1627 Ga0207648_10277158
1628 Ga0207648_10475429
1629 Ga0207648_11108806
1630 Ga0207676_10000569
1631 Ga0207676_10001190
1632 Ga0207676_10022125
1633 Ga0207676_10156266
1634 Ga0207676_11792204
1635 Ga0207674_10000010
1636 Ga0207674_10001663
1637 Ga0207674_10003519
1638 Ga0207674_10007927
1639 Ga0207674_10168096
1640 Ga0207674_11255374
1641 Ga0207675_100000001
1642 Ga0207675_100117671
1643 Ga0207683_10000134
1644 Ga0207683_10000238
1645 Ga0207683_10275581
1646 Ga0207683_10903468
1647 Ga0207698_10000234
1648 Ga0207698_10009327
1649 Ga0207698_10110351
1650 Ga0207698_10338499
1651 Ga0207698_10644447
1652 Ga0209966_1009522
1653 Ga0209998_10066422
1654 Ga0207428_10448217
1655 Ga0268266_10001519
1656 Ga0268266_10003021
1657 Ga0268266_10132413
1658 Ga0268265_10001849
1659 Ga0268265_10037588
1660 Ga0268264_10000404
1661 Ga0268264_10006833
1662 Ga0268264_10262092
1663 Ga0268264_10488529
1664 Ga0268264_10911700
1665 Ga0265770_1005632
1666 Ga0265760_10002735
1667 Ga0265331_10271101
1668 Ga0307408_100178910
1669 Ga0307408_100341678
1670 Ga0307413_10248174
1671 Ga0307413_10543735
1672 Ga0307410_10002911
1673 Ga0307410_10167802
1674 Ga0307410_10279652
1675 Ga0307406_10064051
1676 Ga0307406_10080511
1677 Ga0307407_10262263
1678 Ga0307412_10080221
1679 Ga0307409_100053832
1680 Ga0307409_100326953
1681 Ga0307416_100110673
1682 Ga0307416_100265033
1683 Ga0307414_10135073
1684 Ga0307411_10149373
1685 Ga0307415_100005591
1686 Ga0373958_0203825
1687 Ga0373926_0004073
1688 Ga0373926_0114831
1689 Ga0373926_0411626
1690 Ga0373929_0027655
1691 Ga0373934_0267205
1692 Ga0373940_0061397
1693 Ga0373923_0042286
1694 Ga0373923_0432270
1695 Ga0373932_0393268
1696 Ga0373936_0020594
1697 Ga0373939_0162582
1698 Ga0373941_0116435
1699 Ga0373960_0033321
1700 Ga0373943_0031453
1701 Ga0373943_0427767
1702 Ga0373943_0627729
1703 Ga0373942_0195922
1704 Ga0373931_0037925
1705 Ga0373931_0088048
1706 Ga0373931_0115077
1707 Ga0373931_0162035
1708 Ga0373931_0275037
1709 Ga0373931_0285645
1710 Ga0373931_0290569
1711 Ga0373935_1082714
1712 Ga0373935_1107385
1713 Ga0373927_0005398
1714 Ga0373927_0076013
1715 Ga0373927_0129245
1716 Ga0373927_0294593
1717 Ga0373927_0634131
1718 Ga0373927_1046482
1719 Ga0373947_0017090
1720 Ga0373947_0248215
1721 Ga0373947_0433045
1722 Ga0373937_0270398
1723 Ga0373937_1114845
1724 Ga0373925_0000886
1725 Ga0373925_0005819
1726 Ga0373925_0022748
1727 Ga0373925_0864442
1728 Ga0395900_0973580
1729 Ga0395905_0021069
1730 Ga0395905_0113110
1731 Ga0395901_0407635
1732 Ga0436365_0144416
1733 Ga0436365_0556939
1734 Ga0436365_0750101
1735 Ga0436360_0418756
1736 Ga0436363_0675650
1737 Ga0436363_0749692
1738 Ga0436363_0863545
1739 Ga0436363_0945599
1740 Ga0436363_1381201
1741 Ga0436363_1534816
1742 Ga0439455_0043972
1743 Ga0439458_0018870
1744 Ga0451577_0031283
1745 Ga0451577_1061753
1746 Ga0451577_1913463
1747 Ga0466966_0201006
1748 Ga0466966_0272121
1749 Ga0466961_0108614
1750 Ga0466963_0052159
1751 Ga0466963_0133012
1752 Ga0466963_0896872
1753 Ga0453684_1824781
1754 Ga0466957_0125952
1755 Ga0466959_0019670
1756 Ga0451576_0020022
1757 Ga0451576_0064271
1758 Ga0451576_0339889
1759 Ga0451576_0437220
1760 Ga0466958_0024566
1761 Ga0466958_0260695
1762 Ga0466967_0010336
1763 Ga0466967_0011140
1764 Ga0466967_0571726
1765 Ga0495603_0073043
1766 Ga0495651_0326142
1767 Ga0495651_0352848
1768 Ga0495580_0000554
1769 Ga0495580_0000743
1770 Ga0495580_0001479
1771 Ga0495580_0012394
1772 Ga0495580_0034127
1773 Ga0495580_0050028
1774 Ga0495580_0055922
1775 Ga0495580_0060872
1776 Ga0495580_0103543
1777 Ga0495580_0172547
1778 Ga0495580_0344747
1779 Ga0495580_0639416
1780 Ga0495582_0004490
1781 Ga0495582_0111689
1782 Ga0495582_0309420
1783 Ga0495605_0330636
1784 Ga0495639_0618939
1785 Ga0495664_0143633
1786 Ga0495584_0077003
1787 Ga0495594_0039275
1788 Ga0495594_0144211
1789 Ga0495642_0190764
1790 Ga0495665_0001027
1791 Ga0495665_0051384
1792 Ga0495665_0258894
1793 Ga0495665_0610441
1794 Ga0495586_0110902
1795 Ga0495586_0329174
1796 Ga0495587_0351232
1797 Ga0495645_0340980
1798 Ga0495656_0064653
1799 Ga0495635_0066570
1800 Ga0495659_0433542
1801 Ga0495588_0091487
1802 Ga0495657_0677737
1803 Ga0495623_0099981
1804 Ga0495623_0161160
1805 Ga0495658_0015641
1806 Ga0495669_0060274
1807 Ga0495669_0168465
1808 Ga0495669_0323206
1809 Ga0495669_0366008
1810 Ga0495669_0397035
1811 Ga0495600_0230613
1812 Ga0495600_0484576
1813 Ga0495674_0265340
1814 Ga0495674_0985551
1815 Ga0495675_0041811
1816 Ga0495675_0072730
1817 Ga0495684_0318821
1818 Ga0495602_0253445
1819 Ga0496100_0151639
1820 Ga0496100_0783167
1821 Ga0496101_0271791
1822 Ga0496102_0001547
1823 Ga0496102_0009553
1824 Ga0496102_0121243
1825 Ga0496102_0260363
1826 Ga0496102_0329967
1827 Ga0496103_0017861
1828 Ga0496103_0069343
1829 Ga0496104_0116144
1830 Ga0496104_0139970
1831 Ga0496104_0214988
1832 Ga0496104_0733090
1833 Ga0496106_0009178
1834 Ga0496106_0018454
1835 Ga0496106_0337025
1836 Ga0496107_0083797
1837 Ga0496107_0285015
1838 Ga0496107_0671716
1839 Ga0496108_0001657
1840 Ga0496108_0282051
1841 Ga0496108_1191348
1842 Ga0496109_0000795
1843 Ga0496109_0002752
1844 Ga0496109_0019667
1845 Ga0496110_0025736
1846 Ga0496110_1851492
1847 Ga0496111_0008727
1848 Ga0496111_0581081
1849 Ga0496112_0000144
1850 Ga0496112_0002867
1851 Ga0496112_0004418
1852 Ga0496112_0070742
1853 Ga0496112_0157523
1854 Ga0496112_0388948
1855 Ga0496112_1031520
1856 Ga0496113_0005470
1857 Ga0496113_0513952
1858 Ga0496115_0173173
1859 Ga0496115_0299133
1860 Ga0496115_0325402
1861 Ga0496115_0591434
1862 Ga0501291_124757
1863 Ga0501298_028687
1864 Ga0501298_072509
1865 Ga0501298_167528
1866 Ga0501225_0035813
1867 Ga0501083_0032979
1868 Ga0501266_101299
1869 Ga0501276_031613
1870 nmdc:mga05p37_668489_c1
1871 nmdc:mga0n895_10040_c1
1872 nmdc:mga0n895_1065263_c1
1873 nmdc:mga0n895_163922_c1
1874 nmdc:mga0n895_3164_c1
1875 nmdc:mga0n895_70544_c1
1876 nmdc:mga0n895_718292_c1
1877 nmdc:mga0rr50_1195_c1
1878 nmdc:mga0rr50_139829_c1
1879 nmdc:mga0rr50_408682_c1
1880 nmdc:mga08x19_28581_c1
1881 nmdc:mga08x19_52298_c1
1882 nmdc:mga08x19_85001_c1
1883 nmdc:mga0a205_16728_c1
1884 nmdc:mga0a205_36506_c1
1885 Ga0495612_0112024
1886 Ga0501084_0277604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

19

149

0.91

Map