F486386

General Info

Members Datasets Scaffolds Average Seq Length
943 368 1886 149

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10403012|Ga0163161_104030121
Length 170
Sequence MAVSRTRPPMAFRRFEGKYRMRSFEHLTDLQPLVGQTIGVSDWITVTQERIQLFADATGDHQWIHLDAERAAKGPFGTTIAHGFLTLSLLPEMGASAFEVRDTRMGVNYGLGKVRFPAPVPSGSRLRGHFKLTRYEPLEGGAQLTVEVSMEREGSDKPVCVAESLARRYT

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
234 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
235 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
236 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
343 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
344 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
349 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
350 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
354 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
355 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
358 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
359 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
360 2643221576 Nocardioides sp. Root614 Isolate Unclassified
361 2643221590 Nocardioides sp. Root682 Isolate Unclassified
362 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
363 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
364 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
365 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
366 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
367 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
368 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0.53
Rhizoplane 1.7
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10403012 3300017792 Bacteria 1097
2 rootH2_10037517 3300003320 Bacteria 1107
3 JGI25404J52841_10016749 3300003659 Bacteria 1590
4 JGI25404J52841_10054809 3300003659 Bacteria 837
5 Ga0055530_10004946 3300003791 Bacteria 6594
6 Ga0055530_10027959 3300003791 Bacteria 1530
7 Ga0055540_1000002 3300003792 Bacteria 436954
8 Ga0065715_10585454 3300005293 Bacteria 717
9 Ga0070658_10124698 3300005327 Bacteria 2143
10 Ga0070658_10314389 3300005327 Bacteria 1337
11 Ga0070676_10001571 3300005328 Bacteria 11600
12 Ga0070676_10042317 3300005328 Bacteria 2644
13 Ga0070676_10068364 3300005328 Bacteria 2126
14 Ga0070676_10387222 3300005328 Bacteria 969
15 Ga0070676_10546457 3300005328 Bacteria 828
16 Ga0070690_100033930 3300005330 Bacteria 3196
17 Ga0070670_100016337 3300005331 Bacteria 6375
18 Ga0070670_100023097 3300005331 Bacteria 5352
19 Ga0070670_100123241 3300005331 Bacteria 2236
20 Ga0070670_100141375 3300005331 Bacteria 2081
21 Ga0070670_100359317 3300005331 Bacteria 1280
22 Ga0070670_100374642 3300005331 Bacteria 1253
23 Ga0070670_100417055 3300005331 Bacteria 1186
24 Ga0070670_100954434 3300005331 Bacteria 779
25 Ga0070677_10082838 3300005333 Bacteria 1377
26 Ga0070677_10136908 3300005333 Bacteria 1125
27 Ga0068869_100239701 3300005334 Bacteria 1444
28 Ga0068869_100351437 3300005334 Bacteria 1202
29 Ga0068869_101320958 3300005334 Bacteria 637
30 Ga0068869_101787187 3300005334 Bacteria 550
31 Ga0070666_10003543 3300005335 Bacteria 9465
32 Ga0070666_10420505 3300005335 Bacteria 962
33 Ga0070666_10445832 3300005335 Bacteria 934
34 Ga0070666_10775274 3300005335 Bacteria 705
35 Ga0070666_10783492 3300005335 Bacteria 702
36 Ga0070680_100091888 3300005336 Bacteria 2513
37 Ga0070682_100280917 3300005337 Bacteria 1213
38 Ga0068868_100028329 3300005338 Bacteria 4281
39 Ga0068868_100034873 3300005338 Bacteria 3887
40 Ga0068868_100034996 3300005338 Bacteria 3881
41 Ga0068868_100057236 3300005338 Bacteria 3080
42 Ga0068868_100077111 3300005338 Bacteria 2666
43 Ga0068868_100106500 3300005338 Bacteria 2274
44 Ga0068868_100302618 3300005338 Bacteria 1358
45 Ga0070660_100047371 3300005339 Bacteria 3298
46 Ga0070660_100169936 3300005339 Bacteria 1760
47 Ga0070689_100584904 3300005340 Bacteria 965
48 Ga0070689_100929303 3300005340 Bacteria 771
49 Ga0070691_10117972 3300005341 Bacteria 1333
50 Ga0070691_10284518 3300005341 Bacteria 898
51 Ga0070687_100364528 3300005343 Bacteria 936
52 Ga0070661_100094009 3300005344 Bacteria 2221
53 Ga0070661_100484173 3300005344 Bacteria 988
54 Ga0070661_100511186 3300005344 Bacteria 962
55 Ga0070692_10303525 3300005345 Bacteria 975
56 Ga0070668_100045003 3300005347 Bacteria 3386
57 Ga0070668_100642543 3300005347 Bacteria 932
58 Ga0070668_100821385 3300005347 Bacteria 827
59 Ga0070669_100165601 3300005353 Bacteria 1720
60 Ga0070669_100176804 3300005353 Bacteria 1667
61 Ga0070669_100373046 3300005353 Bacteria 1162
62 Ga0070669_100545138 3300005353 Bacteria 966
63 Ga0070669_101486088 3300005353 Bacteria 589
64 Ga0070675_100063197 3300005354 Bacteria 3060
65 Ga0070675_100090116 3300005354 Bacteria 2568
66 Ga0070675_100154040 3300005354 Bacteria 1972
67 Ga0070675_100254286 3300005354 Bacteria 1538
68 Ga0070675_100289345 3300005354 Bacteria 1442
69 Ga0070671_100002227 3300005355 Bacteria 14969
70 Ga0070671_100045288 3300005355 Bacteria 3657
71 Ga0070671_100050018 3300005355 Bacteria 3477
72 Ga0070671_100167435 3300005355 Bacteria 1858
73 Ga0070671_100481259 3300005355 Bacteria 1067
74 Ga0070671_100499381 3300005355 Bacteria 1046
75 Ga0070671_101256382 3300005355 Bacteria 652
76 Ga0070674_100032527 3300005356 Bacteria 3464
77 Ga0070674_100033008 3300005356 Bacteria 3442
78 Ga0070674_100176767 3300005356 Bacteria 1632
79 Ga0070674_100284726 3300005356 Bacteria 1311
80 Ga0070674_100309447 3300005356 Bacteria 1262
81 Ga0070673_100018256 3300005364 Bacteria 5007
82 Ga0070673_100053712 3300005364 Bacteria 3166
83 Ga0070673_100069128 3300005364 Bacteria 2830
84 Ga0070673_100256307 3300005364 Bacteria 1527
85 Ga0070673_100332974 3300005364 Bacteria 1343
86 Ga0070673_100527740 3300005364 Bacteria 1070
87 Ga0070673_100639520 3300005364 Bacteria 973
88 Ga0070659_100147324 3300005366 Bacteria 1918
89 Ga0070659_100395090 3300005366 Bacteria 1166
90 Ga0070659_100537561 3300005366 Bacteria 999
91 Ga0070667_100000702 3300005367 Bacteria 32315
92 Ga0070667_100003128 3300005367 Bacteria 14211
93 Ga0070667_100108277 3300005367 Bacteria 2407
94 Ga0070667_100175632 3300005367 Bacteria 1893
95 Ga0070667_100400269 3300005367 Bacteria 1250
96 Ga0070667_100580586 3300005367 Bacteria 1032
97 Ga0070700_100024707 3300005441 Bacteria 3531
98 Ga0070708_100651983 3300005445 Bacteria 992
99 Ga0070663_100022607 3300005455 Bacteria 4206
100 Ga0070663_100037279 3300005455 Bacteria 3383
101 Ga0070663_100040976 3300005455 Bacteria 3245
102 Ga0070663_100273542 3300005455 Bacteria 1344
103 Ga0070663_100293745 3300005455 Bacteria 1299
104 Ga0070663_100736600 3300005455 Bacteria 841
105 Ga0070678_100015805 3300005456 Bacteria 4807
106 Ga0070678_100033253 3300005456 Bacteria 3578
107 Ga0070678_100117756 3300005456 Bacteria 2089
108 Ga0070678_100340408 3300005456 Bacteria 1287
109 Ga0070678_100776117 3300005456 Bacteria 868
110 Ga0070678_101122836 3300005456 Bacteria 726
111 Ga0070678_101827763 3300005456 Bacteria 573
112 Ga0070662_100010591 3300005457 Bacteria 6060
113 Ga0070662_100057619 3300005457 Bacteria 2823
114 Ga0070662_100117017 3300005457 Bacteria 2038
115 Ga0070662_100131601 3300005457 Bacteria 1929
116 Ga0070662_100393068 3300005457 Bacteria 1143
117 Ga0070662_100833994 3300005457 Unclassified 785
118 Ga0070681_10273319 3300005458 Bacteria 1601
119 Ga0068867_100002735 3300005459 Bacteria 12433
120 Ga0068867_100061849 3300005459 Bacteria 2781
121 Ga0068867_100068826 3300005459 Bacteria 2642
122 Ga0068867_100135893 3300005459 Bacteria 1916
123 Ga0068867_100166447 3300005459 Bacteria 1742
124 Ga0070685_10333550 3300005466 Bacteria 1032
125 Ga0070685_10746709 3300005466 Bacteria 717
126 Ga0070706_100000671 3300005467 Bacteria 38797
127 Ga0070706_100070158 3300005467 Bacteria 3241
128 Ga0070707_100009411 3300005468 Bacteria 9069
129 Ga0070679_100026370 3300005530 Bacteria 5709
130 Ga0070679_100547700 3300005530 Bacteria 1101
131 Ga0070684_101140537 3300005535 Bacteria 733
132 Ga0068853_100108400 3300005539 Bacteria 2464
133 Ga0068853_100433149 3300005539 Bacteria 1235
134 Ga0070672_100002315 3300005543 Bacteria 12032
135 Ga0070672_100028972 3300005543 Bacteria 4146
136 Ga0070672_100038652 3300005543 Bacteria 3649
137 Ga0070672_100084456 3300005543 Bacteria 2549
138 Ga0070672_100090945 3300005543 Bacteria 2462
139 Ga0070672_100136490 3300005543 Bacteria 2020
140 Ga0070672_100171686 3300005543 Bacteria 1804
141 Ga0070672_100224675 3300005543 Bacteria 1576
142 Ga0070672_100259699 3300005543 Bacteria 1464
143 Ga0070672_100397711 3300005543 Bacteria 1181
144 Ga0070672_100410615 3300005543 Bacteria 1162
145 Ga0070672_100665794 3300005543 Bacteria 910
146 Ga0070693_100071429 3300005547 Bacteria 2045
147 Ga0070665_100233384 3300005548 Bacteria 1840
148 Ga0070704_100545621 3300005549 Bacteria 1012
149 Ga0068855_100004988 3300005563 Bacteria 16202
150 Ga0068855_100729089 3300005563 Bacteria 1058
151 Ga0070664_100033760 3300005564 Bacteria 4288
152 Ga0070664_100182376 3300005564 Bacteria 1866
153 Ga0070664_100871420 3300005564 Bacteria 843
154 Ga0070664_101279357 3300005564 Bacteria 692
155 Ga0068857_100013080 3300005577 Bacteria 7231
156 Ga0068857_100089872 3300005577 Bacteria 2748
157 Ga0068854_100045777 3300005578 Bacteria 3112
158 Ga0068854_100530591 3300005578 Bacteria 995
159 Ga0068854_100543221 3300005578 Bacteria 984
160 Ga0068854_100678904 3300005578 Bacteria 887
161 Ga0070702_100150142 3300005615 Bacteria 1495
162 Ga0068852_100192879 3300005616 Bacteria 1923
163 Ga0068852_100264517 3300005616 Bacteria 1652
164 Ga0068852_100273340 3300005616 Bacteria 1627
165 Ga0068852_100409503 3300005616 Bacteria 1335
166 Ga0068852_100585553 3300005616 Bacteria 1119
167 Ga0068852_100871834 3300005616 Bacteria 916
168 Ga0068852_101784896 3300005616 Bacteria 637
169 Ga0068859_100055119 3300005617 Bacteria 4000
170 Ga0068859_100351485 3300005617 Bacteria 1569
171 Ga0068859_101416460 3300005617 Bacteria 767
172 Ga0068864_100043014 3300005618 Bacteria 3866
173 Ga0068864_100048474 3300005618 Bacteria 3652
174 Ga0068864_100181312 3300005618 Bacteria 1925
175 Ga0068866_10027930 3300005718 Bacteria 2684
176 Ga0068866_10412886 3300005718 Bacteria 874
177 Ga0068861_100004858 3300005719 Bacteria 9039
178 Ga0068861_100374752 3300005719 Bacteria 1256
179 Ga0068851_10041380 3300005834 Bacteria 2316
180 Ga0068863_100018157 3300005841 Bacteria 6736
181 Ga0068863_100023761 3300005841 Bacteria 5848
182 Ga0068863_100052850 3300005841 Bacteria 3849
183 Ga0068863_100059049 3300005841 Bacteria 3629
184 Ga0068863_100237760 3300005841 Bacteria 1758
185 Ga0068863_100971013 3300005841 Bacteria 852
186 Ga0068863_101171557 3300005841 Bacteria 774
187 Ga0068863_101516845 3300005841 Bacteria 679
188 Ga0068858_100051286 3300005842 Bacteria 3817
189 Ga0068860_100055844 3300005843 Bacteria 3754
190 Ga0068860_100064811 3300005843 Bacteria 3470
191 Ga0068860_100359658 3300005843 Bacteria 1434
192 Ga0068862_100124433 3300005844 Bacteria 2275
193 Ga0068862_101071626 3300005844 Bacteria 800
194 Ga0081455_10504311 3300005937 Bacteria 812
195 Ga0081540_1000011 3300005983 Bacteria 191880
196 Ga0081540_1000327 3300005983 Bacteria 49238
197 Ga0081540_1006280 3300005983 Bacteria 8696
198 Ga0081540_1019580 3300005983 Bacteria 4105
199 Ga0075365_10001258 3300006038 Bacteria 11238
200 Ga0075365_10013219 3300006038 Bacteria 4926
201 Ga0075365_10105522 3300006038 Bacteria 1933
202 Ga0075365_10311037 3300006038 Bacteria 1109
203 Ga0075368_10018388 3300006042 Bacteria 2626
204 Ga0075363_100006739 3300006048 Bacteria 5244
205 Ga0075363_100180366 3300006048 Bacteria 1201
206 Ga0075363_100370142 3300006048 Bacteria 839
207 Ga0075363_100722228 3300006048 Bacteria 603
208 Ga0075364_10004205 3300006051 Bacteria 8261
209 Ga0070716_100198683 3300006173 Bacteria 1331
210 Ga0075362_10009819 3300006177 Bacteria 3715
211 Ga0075362_10017212 3300006177 Bacteria 2975
212 Ga0075362_10030180 3300006177 Bacteria 2340
213 Ga0075362_10073657 3300006177 Bacteria 1563
214 Ga0075367_10000286 3300006178 Bacteria 17670
215 Ga0075367_10010668 3300006178 Bacteria 4835
216 Ga0075367_10015646 3300006178 Bacteria 4129
217 Ga0075367_10066306 3300006178 Bacteria 2163
218 Ga0075367_10186438 3300006178 Bacteria 1294
219 Ga0075369_10001735 3300006186 Bacteria 7544
220 Ga0075369_10066707 3300006186 Bacteria 1579
221 Ga0075366_10001659 3300006195 Bacteria 11175
222 Ga0075366_10140627 3300006195 Bacteria 1459
223 Ga0075366_10141490 3300006195 Bacteria 1455
224 Ga0075366_10188777 3300006195 Bacteria 1252
225 Ga0075366_10510727 3300006195 Bacteria 743
226 Ga0097621_100027899 3300006237 Bacteria 4445
227 Ga0097621_100267567 3300006237 Bacteria 1501
228 Ga0097621_100282822 3300006237 Bacteria 1460
229 Ga0097621_100513610 3300006237 Bacteria 1087
230 Ga0097621_100822595 3300006237 Bacteria 861
231 Ga0097621_101136710 3300006237 Bacteria 734
232 Ga0097621_101230784 3300006237 Bacteria 706
233 Ga0097621_101385036 3300006237 Bacteria 666
234 Ga0075370_10003013 3300006353 Bacteria 7936
235 Ga0075370_10008160 3300006353 Bacteria 5373
236 Ga0075370_10031485 3300006353 Bacteria 2961
237 Ga0075370_10040724 3300006353 Bacteria 2621
238 Ga0075370_10091911 3300006353 Bacteria 1751
239 Ga0075370_10298113 3300006353 Bacteria 958
240 Ga0075370_10345216 3300006353 Bacteria 889
241 Ga0075370_10582564 3300006353 Bacteria 677
242 Ga0068871_100048558 3300006358 Bacteria 3427
243 Ga0068871_100094270 3300006358 Bacteria 2499
244 Ga0068871_100120272 3300006358 Bacteria 2218
245 Ga0068871_100213010 3300006358 Bacteria 1671
246 Ga0068871_100240650 3300006358 Bacteria 1573
247 Ga0068871_100608077 3300006358 Bacteria 995
248 Ga0075428_100041134 3300006844 Bacteria 5084
249 Ga0075428_101223213 3300006844 Unclassified 791
250 Ga0075428_101874561 3300006844 Bacteria 623
251 Ga0075430_100146389 3300006846 Bacteria 1967
252 Ga0075430_100317471 3300006846 Bacteria 1288
253 Ga0075431_100016231 3300006847 Bacteria 7555
254 Ga0075431_100086702 3300006847 Bacteria 3231
255 Ga0075431_100274045 3300006847 Unclassified 1709
256 Ga0075429_100047414 3300006880 Bacteria 3738
257 Ga0075429_100511611 3300006880 Bacteria 1052
258 Ga0075429_100693419 3300006880 Bacteria 892
259 Ga0068865_100004931 3300006881 Bacteria 8069
260 Ga0068865_100008008 3300006881 Bacteria 6525
261 Ga0068865_100111196 3300006881 Bacteria 2021
262 Ga0068865_100282035 3300006881 Bacteria 1323
263 Ga0068865_100478896 3300006881 Bacteria 1034
264 Ga0068865_100676425 3300006881 Bacteria 880
265 Ga0075436_101000948 3300006914 Bacteria 627
266 Ga0097620_100055123 3300006931 Bacteria 4000
267 Ga0097620_100351509 3300006931 Bacteria 1569
268 Ga0097620_101416543 3300006931 Bacteria 767
269 Ga0079104_1000839 3300006946 Bacteria 25542
270 Ga0099795_10000876 3300007788 Bacteria 6045
271 Ga0099795_10011399 3300007788 Bacteria 2657
272 Ga0105240_10156411 3300009093 Bacteria 2710
273 Ga0105240_10156460 3300009093 Bacteria 2710
274 Ga0111539_10022520 3300009094 Bacteria 7740
275 Ga0111539_10030368 3300009094 Bacteria 6569
276 Ga0111539_10483084 3300009094 Bacteria 1443
277 Ga0111539_11104195 3300009094 Bacteria 922
278 Ga0105245_10189019 3300009098 Bacteria 1972
279 Ga0105245_10472989 3300009098 Bacteria 1265
280 Ga0105245_10568449 3300009098 Bacteria 1157
281 Ga0105245_10606543 3300009098 Bacteria 1122
282 Ga0105245_10875070 3300009098 Bacteria 939
283 Ga0105247_10287505 3300009101 Bacteria 1136
284 Ga0105247_10354331 3300009101 Bacteria 1033
285 Ga0114129_10025035 3300009147 Bacteria 8460
286 Ga0114129_10360430 3300009147 Bacteria 1924
287 Ga0114129_13056944 3300009147 Bacteria 548
288 Ga0105243_10262108 3300009148 Bacteria 1548
289 Ga0105243_10418367 3300009148 Bacteria 1249
290 Ga0105243_10690076 3300009148 Bacteria 994
291 Ga0105243_11475344 3300009148 Bacteria 703
292 Ga0105241_10331738 3300009174 Bacteria 1315
293 Ga0105242_10057880 3300009176 Bacteria 3175
294 Ga0105242_10541384 3300009176 Bacteria 1114
295 Ga0105242_10704468 3300009176 Bacteria 988
296 Ga0105248_10015932 3300009177 Bacteria 8278
297 Ga0105248_10044985 3300009177 Bacteria 4950
298 Ga0105248_10059293 3300009177 Bacteria 4299
299 Ga0105248_10146437 3300009177 Bacteria 2665
300 Ga0105248_10584820 3300009177 Bacteria 1260
301 Ga0105248_10648769 3300009177 Bacteria 1191
302 Ga0105248_10712936 3300009177 Bacteria 1132
303 Ga0105248_10746295 3300009177 Bacteria 1104
304 Ga0105248_10784767 3300009177 Bacteria 1075
305 Ga0105248_11176691 3300009177 Bacteria 867
306 Ga0105248_12203579 3300009177 Bacteria 627
307 Ga0105237_10015172 3300009545 Bacteria 8028
308 Ga0105237_10121851 3300009545 Bacteria 2602
309 Ga0105237_10298827 3300009545 Bacteria 1613
310 Ga0105238_10005340 3300009551 Bacteria 12696
311 Ga0105238_10063203 3300009551 Bacteria 3702
312 Ga0105238_11562495 3300009551 Bacteria 689
313 Ga0105249_10006344 3300009553 Bacteria 10278
314 Ga0105249_10010010 3300009553 Bacteria 8320
315 Ga0105249_10393485 3300009553 Bacteria 1414
316 Ga0105249_11885151 3300009553 Bacteria 670
317 Ga0099796_10093126 3300010159 Bacteria 1123
318 Ga0105239_10071838 3300010375 Bacteria 3802
319 Ga0105239_10079663 3300010375 Bacteria 3604
320 Ga0105246_10311415 3300011119 Bacteria 1275
321 Ga0105246_10613197 3300011119 Bacteria 942
322 Ga0157369_10323014 3300013105 Bacteria 1604
323 Ga0157374_10003619 3300013296 Bacteria 13010
324 Ga0157374_10040378 3300013296 Bacteria 4297
325 Ga0157374_10218393 3300013296 Bacteria 1870
326 Ga0157374_10516831 3300013296 Bacteria 1200
327 Ga0157374_10638186 3300013296 Bacteria 1076
328 Ga0157374_10716923 3300013296 Bacteria 1014
329 Ga0157378_10129320 3300013297 Bacteria 2336
330 Ga0157378_10743273 3300013297 Bacteria 1003
331 Ga0163162_10005745 3300013306 Bacteria 11999
332 Ga0163162_10131671 3300013306 Bacteria 2609
333 Ga0163162_10169211 3300013306 Bacteria 2310
334 Ga0163162_10346750 3300013306 Bacteria 1618
335 Ga0163162_10414512 3300013306 Bacteria 1479
336 Ga0163162_10957664 3300013306 Bacteria 967
337 Ga0163162_11105783 3300013306 Bacteria 898
338 Ga0163162_11152829 3300013306 Bacteria 879
339 Ga0163162_11900402 3300013306 Bacteria 681
340 Ga0157372_11888685 3300013307 Bacteria 686
341 Ga0157375_10015577 3300013308 Bacteria 6809
342 Ga0157375_10040729 3300013308 Bacteria 4481
343 Ga0157375_10087592 3300013308 Bacteria 3166
344 Ga0157375_10132947 3300013308 Bacteria 2609
345 Ga0157375_10194002 3300013308 Bacteria 2186
346 Ga0157375_10593668 3300013308 Bacteria 1267
347 Ga0157375_10807015 3300013308 Bacteria 1087
348 Ga0163163_10958237 3300014325 Bacteria 919
349 Ga0157380_10009952 3300014326 Bacteria 6824
350 Ga0157380_10044486 3300014326 Bacteria 3480
351 Ga0157380_11619408 3300014326 Bacteria 703
352 Ga0182008_10158316 3300014497 Unclassified 1138
353 Ga0157377_10830713 3300014745 Unclassified 684
354 Ga0157379_10008063 3300014968 Bacteria 9147
355 Ga0157379_10160745 3300014968 Bacteria 2027
356 Ga0157379_10387042 3300014968 Bacteria 1284
357 Ga0157376_10016653 3300014969 Bacteria 5587
358 Ga0157376_10059288 3300014969 Bacteria 3209
359 Ga0157376_10221927 3300014969 Bacteria 1751
360 Ga0157376_10673285 3300014969 Bacteria 1037
361 Ga0157376_10893854 3300014969 Bacteria 906
362 Ga0157376_11337024 3300014969 Bacteria 747
363 Ga0157376_12112069 3300014969 Bacteria 602
364 Ga0163161_10107886 3300017792 Bacteria 2078
365 Ga0163161_10596864 3300017792 Bacteria 910
366 Ga0213875_10136673 3300021388 Bacteria 1146
367 Ga0209675_1015366 3300025291 Bacteria 2277
368 Ga0209050_1001035 3300025298 Bacteria 34509
369 Ga0209050_1007995 3300025298 Bacteria 5770
370 Ga0209256_1000143 3300025299 Bacteria 151331
371 Ga0209051_1000024 3300025303 Bacteria 437007
372 Ga0209257_1000079 3300025304 Bacteria 316420
373 Ga0209257_1040119 3300025304 Bacteria 1400
374 Ga0207697_10011942 3300025315 Bacteria 3658
375 Ga0207697_10036965 3300025315 Bacteria 2000
376 Ga0207656_10084860 3300025321 Bacteria 1429
377 Ga0207656_10341297 3300025321 Bacteria 746
378 Ga0207682_10009193 3300025893 Bacteria 3903
379 Ga0207682_10018630 3300025893 Bacteria 2715
380 Ga0207682_10088909 3300025893 Bacteria 1336
381 Ga0207642_10004867 3300025899 Bacteria 4349
382 Ga0207642_10168536 3300025899 Bacteria 1183
383 Ga0207688_10077825 3300025901 Bacteria 1890
384 Ga0207688_10335936 3300025901 Bacteria 929
385 Ga0207680_10014466 3300025903 Bacteria 4085
386 Ga0207680_10379220 3300025903 Bacteria 997
387 Ga0207680_10388298 3300025903 Bacteria 985
388 Ga0207685_10145266 3300025905 Bacteria 1068
389 Ga0207645_10001208 3300025907 Bacteria 21313
390 Ga0207645_10063363 3300025907 Bacteria 2362
391 Ga0207645_10221700 3300025907 Bacteria 1247
392 Ga0207645_10230742 3300025907 Bacteria 1222
393 Ga0207645_10235704 3300025907 Bacteria 1208
394 Ga0207645_10276870 3300025907 Bacteria 1114
395 Ga0207645_10448855 3300025907 Bacteria 870
396 Ga0207643_10058333 3300025908 Bacteria 2200
397 Ga0207643_10141221 3300025908 Bacteria 1439
398 Ga0207643_10375273 3300025908 Bacteria 896
399 Ga0207705_10100307 3300025909 Bacteria 2129
400 Ga0207705_10531408 3300025909 Bacteria 914
401 Ga0207684_10000939 3300025910 Bacteria 32889
402 Ga0207684_10213189 3300025910 Bacteria 1666
403 Ga0207654_10150347 3300025911 Bacteria 1494
404 Ga0207695_10139621 3300025913 Bacteria 2373
405 Ga0207671_10026777 3300025914 Bacteria 4315
406 Ga0207671_10113189 3300025914 Bacteria 2067
407 Ga0207671_10320783 3300025914 Bacteria 1226
408 Ga0207660_10625957 3300025917 Bacteria 877
409 Ga0207662_10025459 3300025918 Bacteria 3408
410 Ga0207657_10039408 3300025919 Bacteria 4200
411 Ga0207657_10288215 3300025919 Bacteria 1302
412 Ga0207657_10544963 3300025919 Bacteria 907
413 Ga0207657_10739657 3300025919 Bacteria 762
414 Ga0207652_10096850 3300025921 Bacteria 2600
415 Ga0207652_10433227 3300025921 Bacteria 1186
416 Ga0207646_10163030 3300025922 Bacteria 2012
417 Ga0207646_10742048 3300025922 Bacteria 876
418 Ga0207681_10004559 3300025923 Bacteria 8524
419 Ga0207681_10058879 3300025923 Bacteria 2632
420 Ga0207694_10067262 3300025924 Bacteria 2797
421 Ga0207694_10168524 3300025924 Bacteria 1772
422 Ga0207650_10002985 3300025925 Bacteria 11671
423 Ga0207650_10005604 3300025925 Bacteria 8578
424 Ga0207650_10074941 3300025925 Bacteria 2552
425 Ga0207650_10101123 3300025925 Bacteria 2219
426 Ga0207650_10292567 3300025925 Bacteria 1328
427 Ga0207650_10423975 3300025925 Bacteria 1104
428 Ga0207650_10453781 3300025925 Bacteria 1067
429 Ga0207650_10713305 3300025925 Bacteria 848
430 Ga0207659_10069997 3300025926 Bacteria 2557
431 Ga0207659_10095714 3300025926 Bacteria 2227
432 Ga0207659_10116718 3300025926 Bacteria 2038
433 Ga0207659_10165772 3300025926 Bacteria 1739
434 Ga0207659_10261958 3300025926 Bacteria 1407
435 Ga0207659_10298933 3300025926 Bacteria 1321
436 Ga0207659_10319657 3300025926 Bacteria 1280
437 Ga0207659_10335299 3300025926 Bacteria 1251
438 Ga0207659_10580741 3300025926 Bacteria 954
439 Ga0207687_10075351 3300025927 Bacteria 2421
440 Ga0207687_10082961 3300025927 Bacteria 2319
441 Ga0207687_10118635 3300025927 Bacteria 1975
442 Ga0207664_10685375 3300025929 Bacteria 921
443 Ga0207644_10008221 3300025931 Bacteria 6834
444 Ga0207644_10086886 3300025931 Bacteria 2323
445 Ga0207644_10127733 3300025931 Bacteria 1942
446 Ga0207644_10153745 3300025931 Bacteria 1782
447 Ga0207644_10155868 3300025931 Bacteria 1771
448 Ga0207644_10304472 3300025931 Bacteria 1285
449 Ga0207644_10618399 3300025931 Bacteria 900
450 Ga0207690_11545370 3300025932 Bacteria 555
451 Ga0207706_10013363 3300025933 Bacteria 7469
452 Ga0207706_10102439 3300025933 Bacteria 2519
453 Ga0207706_10159032 3300025933 Bacteria 1986
454 Ga0207706_10172280 3300025933 Bacteria 1902
455 Ga0207706_10355061 3300025933 Bacteria 1274
456 Ga0207706_10395302 3300025933 Bacteria 1199
457 Ga0207706_10709514 3300025933 Bacteria 859
458 Ga0207706_11265749 3300025933 Bacteria 611
459 Ga0207686_10012711 3300025934 Bacteria 4634
460 Ga0207686_10236380 3300025934 Bacteria 1328
461 Ga0207686_11108665 3300025934 Bacteria 645
462 Ga0207709_10010252 3300025935 Bacteria 5162
463 Ga0207709_10102813 3300025935 Bacteria 1892
464 Ga0207709_10131907 3300025935 Bacteria 1704
465 Ga0207709_10314345 3300025935 Bacteria 1170
466 Ga0207670_10664012 3300025936 Bacteria 860
467 Ga0207670_11307063 3300025936 Bacteria 615
468 Ga0207669_10003010 3300025937 Bacteria 7252
469 Ga0207669_10025177 3300025937 Bacteria 3211
470 Ga0207669_10174143 3300025937 Bacteria 1535
471 Ga0207669_10655080 3300025937 Bacteria 859
472 Ga0207704_10090498 3300025938 Bacteria 2008
473 Ga0207704_10127219 3300025938 Bacteria 1756
474 Ga0207704_10415419 3300025938 Bacteria 1065
475 Ga0207704_10571005 3300025938 Bacteria 922
476 Ga0207704_10896347 3300025938 Bacteria 746
477 Ga0207691_10001739 3300025940 Bacteria 21471
478 Ga0207691_10004984 3300025940 Bacteria 12808
479 Ga0207691_10005163 3300025940 Bacteria 12608
480 Ga0207691_10075981 3300025940 Bacteria 3028
481 Ga0207691_10195709 3300025940 Bacteria 1761
482 Ga0207691_10215824 3300025940 Bacteria 1665
483 Ga0207691_10267612 3300025940 Bacteria 1472
484 Ga0207691_10369720 3300025940 Bacteria 1225
485 Ga0207691_10371320 3300025940 Bacteria 1222
486 Ga0207691_10654788 3300025940 Bacteria 887
487 Ga0207711_10006629 3300025941 Bacteria 9754
488 Ga0207711_10011087 3300025941 Bacteria 7491
489 Ga0207711_10121741 3300025941 Bacteria 2330
490 Ga0207711_10307864 3300025941 Bacteria 1462
491 Ga0207711_10474460 3300025941 Bacteria 1165
492 Ga0207689_10043632 3300025942 Bacteria 3707
493 Ga0207689_10178173 3300025942 Bacteria 1753
494 Ga0207689_10184318 3300025942 Bacteria 1722
495 Ga0207689_10241921 3300025942 Bacteria 1492
496 Ga0207689_10249506 3300025942 Bacteria 1468
497 Ga0207689_10310633 3300025942 Bacteria 1307
498 Ga0207689_11000290 3300025942 Bacteria 705
499 Ga0207679_10192108 3300025945 Bacteria 1698
500 Ga0207679_11274601 3300025945 Bacteria 674
501 Ga0207679_11685404 3300025945 Bacteria 580
502 Ga0207667_10126181 3300025949 Bacteria 2636
503 Ga0207667_10589870 3300025949 Bacteria 1121
504 Ga0207651_10017871 3300025960 Bacteria 4202
505 Ga0207651_10051418 3300025960 Bacteria 2803
506 Ga0207651_10055941 3300025960 Bacteria 2712
507 Ga0207651_10085627 3300025960 Bacteria 2287
508 Ga0207651_10153823 3300025960 Bacteria 1794
509 Ga0207651_10218471 3300025960 Bacteria 1539
510 Ga0207651_10758327 3300025960 Bacteria 858
511 Ga0207651_11344336 3300025960 Bacteria 643
512 Ga0207712_10024976 3300025961 Bacteria 3965
513 Ga0207668_10001265 3300025972 Bacteria 15064
514 Ga0207668_10177563 3300025972 Unclassified 1677
515 Ga0207668_10457355 3300025972 Bacteria 1091
516 Ga0207668_10566690 3300025972 Bacteria 986
517 Ga0207640_10028863 3300025981 Bacteria 3398
518 Ga0207640_10029852 3300025981 Bacteria 3352
519 Ga0207640_10086364 3300025981 Bacteria 2160
520 Ga0207640_10849834 3300025981 Bacteria 794
521 Ga0207640_11077226 3300025981 Bacteria 710
522 Ga0207658_10001317 3300025986 Bacteria 19462
523 Ga0207658_10001833 3300025986 Bacteria 15912
524 Ga0207658_10101284 3300025986 Bacteria 2257
525 Ga0207658_10233773 3300025986 Bacteria 1553
526 Ga0207658_10971784 3300025986 Bacteria 774
527 Ga0207677_10039410 3300026023 Bacteria 3106
528 Ga0207677_10042848 3300026023 Bacteria 3005
529 Ga0207677_10069882 3300026023 Bacteria 2472
530 Ga0207677_10072814 3300026023 Bacteria 2431
531 Ga0207677_10113911 3300026023 Bacteria 2020
532 Ga0207677_10316112 3300026023 Bacteria 1296
533 Ga0207677_10502920 3300026023 Bacteria 1048
534 Ga0207677_11191401 3300026023 Bacteria 697
535 Ga0207703_10010751 3300026035 Bacteria 7144
536 Ga0207703_10772824 3300026035 Bacteria 916
537 Ga0207639_10417404 3300026041 Bacteria 1212
538 Ga0207639_10451271 3300026041 Bacteria 1167
539 Ga0207639_10611751 3300026041 Bacteria 1005
540 Ga0207678_10041283 3300026067 Bacteria 4000
541 Ga0207678_10139706 3300026067 Bacteria 2067
542 Ga0207678_10164477 3300026067 Bacteria 1895
543 Ga0207678_10169289 3300026067 Bacteria 1865
544 Ga0207678_10189384 3300026067 Bacteria 1758
545 Ga0207678_11067837 3300026067 Bacteria 715
546 Ga0207708_10004053 3300026075 Bacteria 10768
547 Ga0207708_10254625 3300026075 Bacteria 1416
548 Ga0207708_11277283 3300026075 Bacteria 643
549 Ga0207702_10260894 3300026078 Bacteria 1631
550 Ga0207641_10004293 3300026088 Bacteria 12387
551 Ga0207641_10009403 3300026088 Bacteria 8054
552 Ga0207641_10044969 3300026088 Bacteria 3715
553 Ga0207641_10180189 3300026088 Bacteria 1935
554 Ga0207641_10556671 3300026088 Bacteria 1119
555 Ga0207648_10002159 3300026089 Bacteria 21380
556 Ga0207648_10023940 3300026089 Bacteria 5459
557 Ga0207648_10035287 3300026089 Bacteria 4406
558 Ga0207648_10048342 3300026089 Bacteria 3724
559 Ga0207648_10156235 3300026089 Bacteria 2014
560 Ga0207648_10328313 3300026089 Bacteria 1376
561 Ga0207648_10389766 3300026089 Bacteria 1261
562 Ga0207648_10429984 3300026089 Bacteria 1200
563 Ga0207676_10017462 3300026095 Bacteria 5200
564 Ga0207676_10032829 3300026095 Bacteria 3916
565 Ga0207676_10073828 3300026095 Bacteria 2746
566 Ga0207676_10429247 3300026095 Bacteria 1241
567 Ga0207676_10786405 3300026095 Bacteria 927
568 Ga0207674_10029584 3300026116 Bacteria 5766
569 Ga0207674_11771012 3300026116 Bacteria 585
570 Ga0207675_100003876 3300026118 Bacteria 14539
571 Ga0207675_100290182 3300026118 Bacteria 1591
572 Ga0207683_10045327 3300026121 Bacteria 3845
573 Ga0207683_10075715 3300026121 Bacteria 2979
574 Ga0207683_10076066 3300026121 Bacteria 2973
575 Ga0207683_10153509 3300026121 Bacteria 2079
576 Ga0207683_10164948 3300026121 Bacteria 2004
577 Ga0207683_10274998 3300026121 Bacteria 1539
578 Ga0207698_10095185 3300026142 Bacteria 2451
579 Ga0207698_10154618 3300026142 Bacteria 1996
580 Ga0207698_10160940 3300026142 Bacteria 1963
581 Ga0207698_10197965 3300026142 Bacteria 1796
582 Ga0207698_10240499 3300026142 Bacteria 1650
583 Ga0209281_1000307 3300027111 Bacteria 87401
584 Ga0209813_10001234 3300027866 Bacteria 5705
585 Ga0209813_10089852 3300027866 Bacteria 1029
586 Ga0207428_10018366 3300027907 Bacteria 5975
587 Ga0268266_10187818 3300028379 Bacteria 1885
588 Ga0268266_10197401 3300028379 Bacteria 1840
589 Ga0268266_10617744 3300028379 Bacteria 1042
590 Ga0268265_10006093 3300028380 Bacteria 8188
591 Ga0268265_11781884 3300028380 Bacteria 622
592 Ga0268264_10001228 3300028381 Bacteria 24612
593 Ga0268264_10426928 3300028381 Bacteria 1279
594 Ga0307517_10001591 3300028786 Bacteria 37812
595 Ga0307517_10088858 3300028786 Bacteria 2550
596 Ga0307517_10138346 3300028786 Bacteria 1721
597 Ga0307515_10058252 3300028794 Bacteria 5567
598 Ga0307515_10092799 3300028794 Bacteria 3752
599 Ga0307515_10311869 3300028794 Bacteria 1247
600 Ga0307515_10543742 3300028794 Bacteria 771
601 Ga0265338_10136903 3300028800 Bacteria 1924
602 Ga0307511_10000025 3300030521 Bacteria 112344
603 Ga0307512_10022579 3300030522 Bacteria 5647
604 Ga0307512_10135032 3300030522 Bacteria 1531
605 Ga0307512_10137616 3300030522 Bacteria 1506
606 Ga0265316_10286091 3300031344 Bacteria 1204
607 Ga0307513_10016408 3300031456 Bacteria 8931
608 Ga0307513_10512147 3300031456 Bacteria 916
609 Ga0307509_10002193 3300031507 Bacteria 32050
610 Ga0307509_10004459 3300031507 Bacteria 20160
611 Ga0307509_10050222 3300031507 Bacteria 4467
612 Ga0307509_10117181 3300031507 Bacteria 2651
613 Ga0307509_10137647 3300031507 Bacteria 2384
614 Ga0307509_10159898 3300031507 Bacteria 2152
615 Ga0307509_10271111 3300031507 Bacteria 1465
616 Ga0307509_10276381 3300031507 Bacteria 1444
617 Ga0307509_10417158 3300031507 Bacteria 1044
618 Ga0307408_100075405 3300031548 Bacteria 2506
619 Ga0307508_10002730 3300031616 Bacteria 18451
620 Ga0307508_10036341 3300031616 Bacteria 4435
621 Ga0307508_10129465 3300031616 Bacteria 2127
622 Ga0307508_10468456 3300031616 Bacteria 853
623 Ga0307514_10158267 3300031649 Bacteria 1505
624 Ga0307514_10288771 3300031649 Bacteria 930
625 Ga0307516_10047244 3300031730 Bacteria 4243
626 Ga0307516_10112068 3300031730 Bacteria 2529
627 Ga0307516_10382196 3300031730 Bacteria 1069
628 Ga0307516_10539309 3300031730 Bacteria 820
629 Ga0307516_10981260 3300031730 Bacteria 516
630 Ga0307405_10012488 3300031731 Bacteria 4499
631 Ga0307405_10656239 3300031731 Bacteria 863
632 Ga0307405_11600751 3300031731 Bacteria 575
633 Ga0307405_12071108 3300031731 Bacteria 510
634 Ga0307413_10267905 3300031824 Bacteria 1277
635 Ga0307410_10116241 3300031852 Bacteria 1943
636 Ga0307410_10203428 3300031852 Bacteria 1513
637 Ga0307410_10953155 3300031852 Bacteria 738
638 Ga0307406_10010094 3300031901 Bacteria 5318
639 Ga0307406_10029558 3300031901 Bacteria 3320
640 Ga0307406_10704297 3300031901 Bacteria 843
641 Ga0307406_11041100 3300031901 Bacteria 704
642 Ga0307407_10145162 3300031903 Bacteria 1535
643 Ga0307407_10219073 3300031903 Bacteria 1286
644 Ga0307409_100003397 3300031995 Bacteria 8643
645 Ga0307409_100036260 3300031995 Bacteria 3623
646 Ga0307409_101023067 3300031995 Bacteria 845
647 Ga0307416_100019017 3300032002 Bacteria 4859
648 Ga0307416_100082465 3300032002 Bacteria 2724
649 Ga0307416_101101464 3300032002 Bacteria 899
650 Ga0307414_10028282 3300032004 Bacteria 3634
651 Ga0307411_10009952 3300032005 Bacteria 5037
652 Ga0307411_10070966 3300032005 Bacteria 2359
653 Ga0307411_10075739 3300032005 Bacteria 2298
654 Ga0307415_100152118 3300032126 Bacteria 1782
655 Ga0307415_100332020 3300032126 Bacteria 1273
656 Ga0307415_100407844 3300032126 Bacteria 1162
657 Ga0307507_10273752 3300033179 Bacteria 1063
658 Ga0307510_10000290 3300033180 Bacteria 46315
659 Ga0307510_10106360 3300033180 Bacteria 2569
660 Ga0307510_10170824 3300033180 Bacteria 1753
661 Ga0373926_0003365 3300035083 Bacteria 5148
662 Ga0373934_0072616 3300035086 Bacteria 1377
663 Ga0373944_0049245 3300035089 Bacteria 1324
664 Ga0373944_0201187 3300035089 Bacteria 721
665 Ga0373923_0008893 3300035111 Bacteria 3603
666 Ga0373939_0140269 3300035114 Bacteria 871
667 Ga0373953_0000591 3300035117 Bacteria 10025
668 Ga0373953_0050953 3300035117 Bacteria 1673
669 Ga0373953_0578843 3300035117 Bacteria 500
670 Ga0373954_0006821 3300035118 Bacteria 4981
671 Ga0373956_0006342 3300035119 Bacteria 4735
672 Ga0373956_0229057 3300035119 Bacteria 882
673 Ga0373957_0015885 3300035120 Bacteria 2598
674 Ga0373955_0015611 3300035172 Bacteria 3722
675 Ga0373955_0039413 3300035172 Bacteria 2522
676 Ga0373924_0021284 3300035410 Bacteria 2528
677 Ga0373931_0054081 3300035691 Bacteria 2145
678 Ga0373935_0030940 3300035692 Bacteria 3318
679 Ga0373935_0110270 3300035692 Bacteria 1826
680 Ga0373935_0613644 3300035692 Bacteria 796
681 Ga0373927_0416894 3300035695 Bacteria 886
682 Ga0373933_0022323 3300035724 Bacteria 3602
683 Ga0373933_0227461 3300035724 Bacteria 1198
684 Ga0373947_0741903 3300035725 Bacteria 670
685 Ga0373937_0054971 3300036401 Bacteria 3654
686 Ga0373937_0074503 3300036401 Bacteria 3132
687 Ga0373925_0350985 3300037068 Bacteria 1198
688 Ga0373925_0476659 3300037068 Bacteria 1023
689 Ga0373925_0827938 3300037068 Bacteria 763
690 Ga0395899_0272876 3300037312 Bacteria 1153
691 Ga0395900_0009709 3300037418 Bacteria 9860
692 Ga0395900_1784244 3300037418 Bacteria 526
693 Ga0395898_0018925 3300037466 Bacteria 7016
694 Ga0395898_0088174 3300037466 Bacteria 2987
695 Ga0395905_0038456 3300037471 Bacteria 4490
696 Ga0395905_0048196 3300037471 Bacteria 3994
697 Ga0395905_1468561 3300037471 Bacteria 586
698 Ga0395901_0243359 3300038443 Bacteria 1876
699 Ga0451789_0060154 3300041443 Bacteria 1432
700 Ga0451789_0231164 3300041443 Bacteria 648
701 Ga0451789_1057507 3300041443 Bacteria 1119
702 Ga0451800_1025911 3300041459 Bacteria 860
703 Ga0451802_1266583 3300041460 Bacteria 864
704 Ga0451833_0913082 3300041491 Bacteria 783
705 Ga0451835_0713309 3300041492 Bacteria 860
706 Ga0451845_0412393 3300041501 Bacteria 727
707 Ga0451849_0639518 3300041505 Bacteria 677
708 Ga0451851_0957251 3300041507 Bacteria 811
709 Ga0451843_0227149 3300041509 Bacteria 874
710 Ga0451843_0336977 3300041509 Bacteria 1282
711 Ga0451853_1441017 3300041512 Bacteria 1832
712 Ga0451853_1589172 3300041512 Bacteria 622
713 Ga0451853_3936543 3300041512 Bacteria 763
714 Ga0439445_0100753 3300042004 Bacteria 819
715 Ga0439449_0130857 3300042007 Bacteria 933
716 Ga0439464_0018357 3300042439 Bacteria 1902
717 Ga0439460_0020142 3300042461 Bacteria 1812
718 Ga0466972_0184829 3300044658 Bacteria 977
719 Ga0453684_0006446 3300044712 Bacteria 22283
720 Ga0466960_0304251 3300044901 Bacteria 899
721 Ga0495592_0000758 3300046454 Bacteria 22458
722 Ga0495592_0000815 3300046454 Bacteria 21606
723 Ga0495592_0003273 3300046454 Bacteria 11610
724 Ga0495629_0001921 3300046459 Bacteria 16199
725 Ga0495629_0032728 3300046459 Bacteria 3680
726 Ga0495629_0070696 3300046459 Bacteria 2435
727 Ga0495629_0215131 3300046459 Bacteria 1327
728 Ga0495638_0148189 3300046460 Bacteria 1363
729 Ga0495641_0147210 3300046461 Bacteria 1052
730 Ga0495641_0214107 3300046461 Bacteria 864
731 Ga0495651_0016519 3300046462 Bacteria 5717
732 Ga0495651_0091103 3300046462 Bacteria 2286
733 Ga0495651_0771196 3300046462 Bacteria 595
734 Ga0495653_0000973 3300046463 Bacteria 21997
735 Ga0495650_0093757 3300046471 Bacteria 1138
736 Ga0495650_0140279 3300046471 Bacteria 875
737 Ga0495580_0346800 3300046472 Bacteria 1006
738 Ga0495639_0403009 3300046475 Bacteria 691
739 Ga0495584_0287920 3300046491 Bacteria 835
740 Ga0495584_0339190 3300046491 Bacteria 763
741 Ga0495606_0114523 3300046507 Bacteria 1622
742 Ga0495606_0194859 3300046507 Bacteria 1159
743 Ga0495606_0404241 3300046507 Bacteria 710
744 Ga0495608_0031249 3300046511 Bacteria 3601
745 Ga0495608_0415652 3300046511 Bacteria 821
746 Ga0495610_0015791 3300046512 Bacteria 4373
747 Ga0495616_0287770 3300046513 Bacteria 697
748 Ga0495618_0034797 3300046514 Bacteria 3161
749 Ga0495620_0051533 3300046515 Bacteria 1751
750 Ga0495620_0069357 3300046515 Bacteria 1446
751 Ga0495628_0000483 3300046516 Bacteria 36474
752 Ga0495628_0017699 3300046516 Bacteria 5924
753 Ga0495628_0253578 3300046516 Bacteria 1313
754 Ga0495631_0187702 3300046518 Bacteria 885
755 Ga0495632_0012805 3300046519 Bacteria 4815
756 Ga0495632_0113327 3300046519 Bacteria 1272
757 Ga0495643_0086659 3300046522 Bacteria 1622
758 Ga0495643_0262358 3300046522 Bacteria 802
759 Ga0495666_0070603 3300046526 Bacteria 1661
760 Ga0495652_0002769 3300046529 Bacteria 17726
761 Ga0495652_0049870 3300046529 Bacteria 3581
762 Ga0495640_0001223 3300046533 Bacteria 20101
763 Ga0495587_0010373 3300046536 Bacteria 5933
764 Ga0495598_0038578 3300046537 Bacteria 1384
765 Ga0495597_0029318 3300046542 Bacteria 2513
766 Ga0495645_0000423 3300046543 Bacteria 29063
767 Ga0495645_0011453 3300046543 Bacteria 6241
768 Ga0495645_0018798 3300046543 Bacteria 4971
769 Ga0495645_0034733 3300046543 Bacteria 3676
770 Ga0495622_0082507 3300046557 Bacteria 1479
771 Ga0495622_0274280 3300046557 Bacteria 738
772 Ga0495667_0021548 3300046559 Bacteria 4348
773 Ga0495668_0086724 3300046616 Bacteria 1717
774 Ga0495668_0151358 3300046616 Bacteria 1271
775 Ga0495634_0006090 3300046642 Bacteria 9195
776 Ga0495611_0091661 3300046648 Bacteria 1405
777 Ga0495611_0454406 3300046648 Bacteria 584
778 Ga0495625_0012637 3300046660 Bacteria 6834
779 Ga0495625_0366343 3300046660 Bacteria 907
780 Ga0495625_0730573 3300046660 Bacteria 582
781 Ga0495635_0001062 3300046663 Bacteria 18194
782 Ga0495635_0406090 3300046663 Bacteria 904
783 Ga0495657_0069620 3300046675 Bacteria 2301
784 Ga0495599_0000508 3300046678 Bacteria 22226
785 Ga0495599_0015764 3300046678 Bacteria 4691
786 Ga0495599_0665069 3300046678 Bacteria 603
787 Ga0495646_0001205 3300046680 Bacteria 15141
788 Ga0495646_0135299 3300046680 Bacteria 1383
789 Ga0495646_0145124 3300046680 Bacteria 1324
790 Ga0495647_0216257 3300046681 Bacteria 845
791 Ga0495647_0489872 3300046681 Bacteria 572
792 Ga0495658_0041005 3300046683 Bacteria 2576
793 Ga0495658_0125129 3300046683 Bacteria 1559
794 Ga0495658_0361455 3300046683 Bacteria 923
795 Ga0495613_0122566 3300046689 Bacteria 1866
796 Ga0495613_0213878 3300046689 Bacteria 1355
797 Ga0495624_0013479 3300046690 Bacteria 5573
798 Ga0495671_0067505 3300046692 Bacteria 1759
799 Ga0495671_0427783 3300046692 Bacteria 633
800 Ga0495649_0003846 3300046694 Bacteria 9942
801 Ga0495649_0659494 3300046694 Bacteria 514
802 Ga0495600_0129650 3300046809 Bacteria 1640
803 Ga0495600_0162451 3300046809 Bacteria 1443
804 Ga0495660_0016913 3300046810 Bacteria 4201
805 Ga0495581_0485219 3300047315 Bacteria 719
806 Ga0495674_0018073 3300047319 Bacteria 6564
807 Ga0495674_0485452 3300047319 Bacteria 990
808 Ga0495676_0059742 3300047321 Bacteria 2992
809 Ga0495680_0075594 3300047322 Bacteria 2555
810 Ga0495683_0278981 3300047323 Bacteria 724
811 Ga0495687_002581 3300047443 Bacteria 14284
812 Ga0495687_002812 3300047443 Bacteria 13428
813 Ga0495687_003084 3300047443 Bacteria 12483
814 Ga0495675_0409438 3300047444 Bacteria 789
815 Ga0495675_0657236 3300047444 Bacteria 590
816 Ga0495677_0174788 3300047445 Bacteria 832
817 Ga0495677_0200358 3300047445 Bacteria 776
818 Ga0495673_0054349 3300047469 Bacteria 1742
819 Ga0495673_0100002 3300047469 Bacteria 1174
820 Ga0495681_0137244 3300047470 Bacteria 1036
821 Ga0495684_0005299 3300047471 Bacteria 10042
822 Ga0495684_0181812 3300047471 Bacteria 1558
823 Ga0495686_0002064 3300047472 Bacteria 19764
824 Ga0495686_0082946 3300047472 Bacteria 1956
825 Ga0495593_0006629 3300047673 Bacteria 6775
826 Ga0495593_0024096 3300047673 Bacteria 3376
827 Ga0495614_0222708 3300048089 Bacteria 858
828 Ga0495626_0077277 3300048091 Bacteria 1484
829 Ga0496106_0112626 3300048909 Bacteria 2120
830 Ga0496108_0050302 3300048911 Bacteria 3488
831 Ga0496108_0607566 3300048911 Bacteria 953
832 Ga0496109_0084287 3300048912 Bacteria 2932
833 Ga0496110_0298147 3300048913 Bacteria 1468
834 Ga0496111_0539514 3300048914 Bacteria 857
835 Ga0496113_0130349 3300048916 Bacteria 1973
836 Ga0496113_0361350 3300048916 Bacteria 1165
837 Ga0496114_0000832 3300048917 Bacteria 23157
838 Ga0496114_0040638 3300048917 Bacteria 3851
839 Ga0496115_0108657 3300048918 Bacteria 2277
840 Ga0496117_0047473 3300048920 Bacteria 3078
841 Ga0496121_0021499 3300048924 Bacteria 6316
842 Ga0496124_0126090 3300048927 Bacteria 2039
843 Ga0496124_0273030 3300048927 Bacteria 1237
844 Ga0496125_0542280 3300048928 Bacteria 646
845 Ga0496126_0040934 3300048929 Bacteria 4293
846 Ga0495682_0072566 3300049460 Bacteria 1239
847 Ga0495682_0131467 3300049460 Bacteria 895
848 Ga0501047_0398470 3300049581 Bacteria 1209
849 Ga0501067_0538504 3300049583 Bacteria 654
850 Ga0501249_109039 3300049679 Bacteria 668
851 Ga0501259_175117 3300049688 Bacteria 541
852 nmdc:mga03683_20325_c1 3300050489 Bacteria 2547
853 nmdc:mga03683_300970_c1 3300050489 Bacteria 752
854 nmdc:mga03683_511647_c1 3300050489 Bacteria 582
855 nmdc:mga03683_6668_c1 3300050489 Bacteria 3966
856 nmdc:mga03n38_4787_c1 3300050490 Bacteria 4529
857 nmdc:mga03n38_58059_c1 3300050490 Bacteria 1752
858 nmdc:mga00v17_4622_c1 3300050491 Bacteria 7179
859 nmdc:mga00v17_55469_c1 3300050491 Bacteria 2420
860 nmdc:mga0yw44_11763_c1 3300050492 Bacteria 4535
861 nmdc:mga0yw44_29766_c1 3300050492 Bacteria 3156
862 nmdc:mga0yw44_44241_c1 3300050492 Bacteria 2662
863 nmdc:mga0k408_20661_c1 3300050493 Bacteria 3692
864 nmdc:mga0k408_2209_c1 3300050493 Bacteria 10430
865 nmdc:mga0k408_257960_c1 3300050493 Bacteria 1041
866 nmdc:mga0k408_37370_c1 3300050493 Bacteria 2788
867 nmdc:mga0k408_447946_c1 3300050493 Bacteria 767
868 nmdc:mga0k408_496228_c1 3300050493 Bacteria 724
869 nmdc:mga0k408_67699_c1 3300050493 Bacteria 2081
870 nmdc:mga0k408_83737_c1 3300050493 Bacteria 1870
871 nmdc:mga0k408_87493_c1 3300050493 Bacteria 1830
872 nmdc:mga0k408_985_c1 3300050493 Bacteria 15642
873 nmdc:mga06z11_175711_c1 3300050494 Bacteria 1232
874 nmdc:mga06z11_17881_c1 3300050494 Bacteria 3228
875 nmdc:mga06z11_284694_c1 3300050494 Bacteria 980
876 nmdc:mga06z11_57994_c1 3300050494 Bacteria 2007
877 nmdc:mga06z11_6814_c1 3300050494 Bacteria 4670
878 nmdc:mga04h51_30995_c1 3300050495 Bacteria 1687
879 nmdc:mga04h51_6047_c1 3300050495 Bacteria 3117
880 nmdc:mga07m45_106891_c1 3300050496 Bacteria 1610
881 nmdc:mga07m45_107520_c1 3300050496 Bacteria 1605
882 nmdc:mga07m45_11967_c1 3300050496 Bacteria 4572
883 nmdc:mga07m45_17318_c1 3300050496 Bacteria 3868
884 nmdc:mga07m45_1848_c1 3300050496 Bacteria 9781
885 nmdc:mga07m45_50505_c1 3300050496 Bacteria 2344
886 nmdc:mga07m45_59404_c1 3300050496 Bacteria 2164
887 nmdc:mga05p37_2001070_c1 3300050507 Bacteria 548
888 nmdc:mga05p37_3939_c1 3300050507 Bacteria 17392
889 nmdc:mga05p37_534475_c1 3300050507 Bacteria 1338
890 nmdc:mga09592_28393_c1 3300050508 Bacteria 4648
891 nmdc:mga09592_496959_c1 3300050508 Bacteria 1050
892 nmdc:mga09592_725890_c1 3300050508 Bacteria 844
893 nmdc:mga0qj67_104673_c1 3300050509 Bacteria 890
894 nmdc:mga0qj67_144969_c1 3300050509 Bacteria 1925
895 nmdc:mga06r32_4044_c1 3300050510 Bacteria 13148
896 nmdc:mga06r32_71366_c1 3300050510 Bacteria 3360
897 nmdc:mga06r32_76546_c1 3300050510 Bacteria 3249
898 nmdc:mga08y16_22844_c1 3300050511 Bacteria 6601
899 nmdc:mga08y16_274643_c1 3300050511 Bacteria 1739
900 nmdc:mga08y16_386921_c1 3300050511 Bacteria 1433
901 nmdc:mga0sz30_116965_c1 3300050516 Bacteria 1170
902 nmdc:mga0sz30_210323_c1 3300050516 Bacteria 864
903 nmdc:mga0sz30_53753_c1 3300050516 Bacteria 1712
904 Ga0495601_0031890 3300053077 Bacteria 3277
905 Ga0495601_0122040 3300053077 Bacteria 1693
906 Ga0495601_0195595 3300053077 Bacteria 1322
907 Ga0495612_0008508 3300053078 Bacteria 4161
908 Ga0495595_0008389 3300053084 Bacteria 4241
909 Ga0495595_0086143 3300053084 Bacteria 1503
910 Ga0495619_0011988 3300053085 Bacteria 5461
911 Ga0495619_0290279 3300053085 Bacteria 1133
912 Ga0500644_0036236 3300053088 Bacteria 1604
913 Ga0500646_0150626 3300053090 Bacteria 770
914 Ga0500583_0071453 3300053092 Bacteria 1660
915 Ga0500583_0200296 3300053092 Bacteria 992
916 Ga0500641_0006688 3300053096 Bacteria 4097
917 Ga0500650_0164861 3300053098 Bacteria 1021
918 Ga0500556_0000486 3300053104 Bacteria 27714
919 Ga0500594_0040029 3300053118 Bacteria 1277
920 Ga0500595_001646 3300053119 Bacteria 11737
921 Ga0500595_195075 3300053119 Bacteria 560
922 Ga0500607_139792 3300053121 Bacteria 1141
923 Ga0500618_115570 3300053125 Bacteria 607
924 Ga0500655_021221 3300053133 Bacteria 1217
925 Ga0500559_0000126 3300053136 Bacteria 59577
926 Ga0500559_0563093 3300053136 Bacteria 519
927 Ga0500589_229657 3300053147 Bacteria 693
928 Ga0500619_108190 3300053154 Bacteria 945
929 Ga0500622_0005314 3300053156 Bacteria 7764
930 Ga0500627_0392127 3300053158 Bacteria 593
931 Ga0500645_008546 3300053730 Bacteria 3490
932 Ga0500587_000588 3300053739 Bacteria 4525
933 Ga0500587_009217 3300053739 Bacteria 1263
934 2545678417 2545555834 Bacteria 8130841
935 2643892645 2643221576 Bacteria 5214352
936 2643962094 2643221590 Bacteria 5214697
937 2644245846 2643221644 Bacteria 6865017
938 2644302775 2643221654 Bacteria 5273570
939 2888424104 2888419890 Bacteria 7857137
940 2904694345 2904690495 Bacteria 9412302
941 2906643067 2906635258 Bacteria 8601019
942 2906661953 2906660503 Bacteria 8595048
943 8019601492 8019597564 Bacteria 10041141
944 Ga0163161_10403012
945 rootH2_10037517
946 JGI25404J52841_10016749
947 JGI25404J52841_10054809
948 Ga0055530_10004946
949 Ga0055530_10027959
950 Ga0055540_1000002
951 Ga0065715_10585454
952 Ga0070658_10124698
953 Ga0070658_10314389
954 Ga0070676_10001571
955 Ga0070676_10042317
956 Ga0070676_10068364
957 Ga0070676_10387222
958 Ga0070676_10546457
959 Ga0070690_100033930
960 Ga0070670_100016337
961 Ga0070670_100023097
962 Ga0070670_100123241
963 Ga0070670_100141375
964 Ga0070670_100359317
965 Ga0070670_100374642
966 Ga0070670_100417055
967 Ga0070670_100954434
968 Ga0070677_10082838
969 Ga0070677_10136908
970 Ga0068869_100239701
971 Ga0068869_100351437
972 Ga0068869_101320958
973 Ga0068869_101787187
974 Ga0070666_10003543
975 Ga0070666_10420505
976 Ga0070666_10445832
977 Ga0070666_10775274
978 Ga0070666_10783492
979 Ga0070680_100091888
980 Ga0070682_100280917
981 Ga0068868_100028329
982 Ga0068868_100034873
983 Ga0068868_100034996
984 Ga0068868_100057236
985 Ga0068868_100077111
986 Ga0068868_100106500
987 Ga0068868_100302618
988 Ga0070660_100047371
989 Ga0070660_100169936
990 Ga0070689_100584904
991 Ga0070689_100929303
992 Ga0070691_10117972
993 Ga0070691_10284518
994 Ga0070687_100364528
995 Ga0070661_100094009
996 Ga0070661_100484173
997 Ga0070661_100511186
998 Ga0070692_10303525
999 Ga0070668_100045003
1000 Ga0070668_100642543
1001 Ga0070668_100821385
1002 Ga0070669_100165601
1003 Ga0070669_100176804
1004 Ga0070669_100373046
1005 Ga0070669_100545138
1006 Ga0070669_101486088
1007 Ga0070675_100063197
1008 Ga0070675_100090116
1009 Ga0070675_100154040
1010 Ga0070675_100254286
1011 Ga0070675_100289345
1012 Ga0070671_100002227
1013 Ga0070671_100045288
1014 Ga0070671_100050018
1015 Ga0070671_100167435
1016 Ga0070671_100481259
1017 Ga0070671_100499381
1018 Ga0070671_101256382
1019 Ga0070674_100032527
1020 Ga0070674_100033008
1021 Ga0070674_100176767
1022 Ga0070674_100284726
1023 Ga0070674_100309447
1024 Ga0070673_100018256
1025 Ga0070673_100053712
1026 Ga0070673_100069128
1027 Ga0070673_100256307
1028 Ga0070673_100332974
1029 Ga0070673_100527740
1030 Ga0070673_100639520
1031 Ga0070659_100147324
1032 Ga0070659_100395090
1033 Ga0070659_100537561
1034 Ga0070667_100000702
1035 Ga0070667_100003128
1036 Ga0070667_100108277
1037 Ga0070667_100175632
1038 Ga0070667_100400269
1039 Ga0070667_100580586
1040 Ga0070700_100024707
1041 Ga0070708_100651983
1042 Ga0070663_100022607
1043 Ga0070663_100037279
1044 Ga0070663_100040976
1045 Ga0070663_100273542
1046 Ga0070663_100293745
1047 Ga0070663_100736600
1048 Ga0070678_100015805
1049 Ga0070678_100033253
1050 Ga0070678_100117756
1051 Ga0070678_100340408
1052 Ga0070678_100776117
1053 Ga0070678_101122836
1054 Ga0070678_101827763
1055 Ga0070662_100010591
1056 Ga0070662_100057619
1057 Ga0070662_100117017
1058 Ga0070662_100131601
1059 Ga0070662_100393068
1060 Ga0070662_100833994
1061 Ga0070681_10273319
1062 Ga0068867_100002735
1063 Ga0068867_100061849
1064 Ga0068867_100068826
1065 Ga0068867_100135893
1066 Ga0068867_100166447
1067 Ga0070685_10333550
1068 Ga0070685_10746709
1069 Ga0070706_100000671
1070 Ga0070706_100070158
1071 Ga0070707_100009411
1072 Ga0070679_100026370
1073 Ga0070679_100547700
1074 Ga0070684_101140537
1075 Ga0068853_100108400
1076 Ga0068853_100433149
1077 Ga0070672_100002315
1078 Ga0070672_100028972
1079 Ga0070672_100038652
1080 Ga0070672_100084456
1081 Ga0070672_100090945
1082 Ga0070672_100136490
1083 Ga0070672_100171686
1084 Ga0070672_100224675
1085 Ga0070672_100259699
1086 Ga0070672_100397711
1087 Ga0070672_100410615
1088 Ga0070672_100665794
1089 Ga0070693_100071429
1090 Ga0070665_100233384
1091 Ga0070704_100545621
1092 Ga0068855_100004988
1093 Ga0068855_100729089
1094 Ga0070664_100033760
1095 Ga0070664_100182376
1096 Ga0070664_100871420
1097 Ga0070664_101279357
1098 Ga0068857_100013080
1099 Ga0068857_100089872
1100 Ga0068854_100045777
1101 Ga0068854_100530591
1102 Ga0068854_100543221
1103 Ga0068854_100678904
1104 Ga0070702_100150142
1105 Ga0068852_100192879
1106 Ga0068852_100264517
1107 Ga0068852_100273340
1108 Ga0068852_100409503
1109 Ga0068852_100585553
1110 Ga0068852_100871834
1111 Ga0068852_101784896
1112 Ga0068859_100055119
1113 Ga0068859_100351485
1114 Ga0068859_101416460
1115 Ga0068864_100043014
1116 Ga0068864_100048474
1117 Ga0068864_100181312
1118 Ga0068866_10027930
1119 Ga0068866_10412886
1120 Ga0068861_100004858
1121 Ga0068861_100374752
1122 Ga0068851_10041380
1123 Ga0068863_100018157
1124 Ga0068863_100023761
1125 Ga0068863_100052850
1126 Ga0068863_100059049
1127 Ga0068863_100237760
1128 Ga0068863_100971013
1129 Ga0068863_101171557
1130 Ga0068863_101516845
1131 Ga0068858_100051286
1132 Ga0068860_100055844
1133 Ga0068860_100064811
1134 Ga0068860_100359658
1135 Ga0068862_100124433
1136 Ga0068862_101071626
1137 Ga0081455_10504311
1138 Ga0081540_1000011
1139 Ga0081540_1000327
1140 Ga0081540_1006280
1141 Ga0081540_1019580
1142 Ga0075365_10001258
1143 Ga0075365_10013219
1144 Ga0075365_10105522
1145 Ga0075365_10311037
1146 Ga0075368_10018388
1147 Ga0075363_100006739
1148 Ga0075363_100180366
1149 Ga0075363_100370142
1150 Ga0075363_100722228
1151 Ga0075364_10004205
1152 Ga0070716_100198683
1153 Ga0075362_10009819
1154 Ga0075362_10017212
1155 Ga0075362_10030180
1156 Ga0075362_10073657
1157 Ga0075367_10000286
1158 Ga0075367_10010668
1159 Ga0075367_10015646
1160 Ga0075367_10066306
1161 Ga0075367_10186438
1162 Ga0075369_10001735
1163 Ga0075369_10066707
1164 Ga0075366_10001659
1165 Ga0075366_10140627
1166 Ga0075366_10141490
1167 Ga0075366_10188777
1168 Ga0075366_10510727
1169 Ga0097621_100027899
1170 Ga0097621_100267567
1171 Ga0097621_100282822
1172 Ga0097621_100513610
1173 Ga0097621_100822595
1174 Ga0097621_101136710
1175 Ga0097621_101230784
1176 Ga0097621_101385036
1177 Ga0075370_10003013
1178 Ga0075370_10008160
1179 Ga0075370_10031485
1180 Ga0075370_10040724
1181 Ga0075370_10091911
1182 Ga0075370_10298113
1183 Ga0075370_10345216
1184 Ga0075370_10582564
1185 Ga0068871_100048558
1186 Ga0068871_100094270
1187 Ga0068871_100120272
1188 Ga0068871_100213010
1189 Ga0068871_100240650
1190 Ga0068871_100608077
1191 Ga0075428_100041134
1192 Ga0075428_101223213
1193 Ga0075428_101874561
1194 Ga0075430_100146389
1195 Ga0075430_100317471
1196 Ga0075431_100016231
1197 Ga0075431_100086702
1198 Ga0075431_100274045
1199 Ga0075429_100047414
1200 Ga0075429_100511611
1201 Ga0075429_100693419
1202 Ga0068865_100004931
1203 Ga0068865_100008008
1204 Ga0068865_100111196
1205 Ga0068865_100282035
1206 Ga0068865_100478896
1207 Ga0068865_100676425
1208 Ga0075436_101000948
1209 Ga0097620_100055123
1210 Ga0097620_100351509
1211 Ga0097620_101416543
1212 Ga0079104_1000839
1213 Ga0099795_10000876
1214 Ga0099795_10011399
1215 Ga0105240_10156411
1216 Ga0105240_10156460
1217 Ga0111539_10022520
1218 Ga0111539_10030368
1219 Ga0111539_10483084
1220 Ga0111539_11104195
1221 Ga0105245_10189019
1222 Ga0105245_10472989
1223 Ga0105245_10568449
1224 Ga0105245_10606543
1225 Ga0105245_10875070
1226 Ga0105247_10287505
1227 Ga0105247_10354331
1228 Ga0114129_10025035
1229 Ga0114129_10360430
1230 Ga0114129_13056944
1231 Ga0105243_10262108
1232 Ga0105243_10418367
1233 Ga0105243_10690076
1234 Ga0105243_11475344
1235 Ga0105241_10331738
1236 Ga0105242_10057880
1237 Ga0105242_10541384
1238 Ga0105242_10704468
1239 Ga0105248_10015932
1240 Ga0105248_10044985
1241 Ga0105248_10059293
1242 Ga0105248_10146437
1243 Ga0105248_10584820
1244 Ga0105248_10648769
1245 Ga0105248_10712936
1246 Ga0105248_10746295
1247 Ga0105248_10784767
1248 Ga0105248_11176691
1249 Ga0105248_12203579
1250 Ga0105237_10015172
1251 Ga0105237_10121851
1252 Ga0105237_10298827
1253 Ga0105238_10005340
1254 Ga0105238_10063203
1255 Ga0105238_11562495
1256 Ga0105249_10006344
1257 Ga0105249_10010010
1258 Ga0105249_10393485
1259 Ga0105249_11885151
1260 Ga0099796_10093126
1261 Ga0105239_10071838
1262 Ga0105239_10079663
1263 Ga0105246_10311415
1264 Ga0105246_10613197
1265 Ga0157369_10323014
1266 Ga0157374_10003619
1267 Ga0157374_10040378
1268 Ga0157374_10218393
1269 Ga0157374_10516831
1270 Ga0157374_10638186
1271 Ga0157374_10716923
1272 Ga0157378_10129320
1273 Ga0157378_10743273
1274 Ga0163162_10005745
1275 Ga0163162_10131671
1276 Ga0163162_10169211
1277 Ga0163162_10346750
1278 Ga0163162_10414512
1279 Ga0163162_10957664
1280 Ga0163162_11105783
1281 Ga0163162_11152829
1282 Ga0163162_11900402
1283 Ga0157372_11888685
1284 Ga0157375_10015577
1285 Ga0157375_10040729
1286 Ga0157375_10087592
1287 Ga0157375_10132947
1288 Ga0157375_10194002
1289 Ga0157375_10593668
1290 Ga0157375_10807015
1291 Ga0163163_10958237
1292 Ga0157380_10009952
1293 Ga0157380_10044486
1294 Ga0157380_11619408
1295 Ga0182008_10158316
1296 Ga0157377_10830713
1297 Ga0157379_10008063
1298 Ga0157379_10160745
1299 Ga0157379_10387042
1300 Ga0157376_10016653
1301 Ga0157376_10059288
1302 Ga0157376_10221927
1303 Ga0157376_10673285
1304 Ga0157376_10893854
1305 Ga0157376_11337024
1306 Ga0157376_12112069
1307 Ga0163161_10107886
1308 Ga0163161_10596864
1309 Ga0213875_10136673
1310 Ga0209675_1015366
1311 Ga0209050_1001035
1312 Ga0209050_1007995
1313 Ga0209256_1000143
1314 Ga0209051_1000024
1315 Ga0209257_1000079
1316 Ga0209257_1040119
1317 Ga0207697_10011942
1318 Ga0207697_10036965
1319 Ga0207656_10084860
1320 Ga0207656_10341297
1321 Ga0207682_10009193
1322 Ga0207682_10018630
1323 Ga0207682_10088909
1324 Ga0207642_10004867
1325 Ga0207642_10168536
1326 Ga0207688_10077825
1327 Ga0207688_10335936
1328 Ga0207680_10014466
1329 Ga0207680_10379220
1330 Ga0207680_10388298
1331 Ga0207685_10145266
1332 Ga0207645_10001208
1333 Ga0207645_10063363
1334 Ga0207645_10221700
1335 Ga0207645_10230742
1336 Ga0207645_10235704
1337 Ga0207645_10276870
1338 Ga0207645_10448855
1339 Ga0207643_10058333
1340 Ga0207643_10141221
1341 Ga0207643_10375273
1342 Ga0207705_10100307
1343 Ga0207705_10531408
1344 Ga0207684_10000939
1345 Ga0207684_10213189
1346 Ga0207654_10150347
1347 Ga0207695_10139621
1348 Ga0207671_10026777
1349 Ga0207671_10113189
1350 Ga0207671_10320783
1351 Ga0207660_10625957
1352 Ga0207662_10025459
1353 Ga0207657_10039408
1354 Ga0207657_10288215
1355 Ga0207657_10544963
1356 Ga0207657_10739657
1357 Ga0207652_10096850
1358 Ga0207652_10433227
1359 Ga0207646_10163030
1360 Ga0207646_10742048
1361 Ga0207681_10004559
1362 Ga0207681_10058879
1363 Ga0207694_10067262
1364 Ga0207694_10168524
1365 Ga0207650_10002985
1366 Ga0207650_10005604
1367 Ga0207650_10074941
1368 Ga0207650_10101123
1369 Ga0207650_10292567
1370 Ga0207650_10423975
1371 Ga0207650_10453781
1372 Ga0207650_10713305
1373 Ga0207659_10069997
1374 Ga0207659_10095714
1375 Ga0207659_10116718
1376 Ga0207659_10165772
1377 Ga0207659_10261958
1378 Ga0207659_10298933
1379 Ga0207659_10319657
1380 Ga0207659_10335299
1381 Ga0207659_10580741
1382 Ga0207687_10075351
1383 Ga0207687_10082961
1384 Ga0207687_10118635
1385 Ga0207664_10685375
1386 Ga0207644_10008221
1387 Ga0207644_10086886
1388 Ga0207644_10127733
1389 Ga0207644_10153745
1390 Ga0207644_10155868
1391 Ga0207644_10304472
1392 Ga0207644_10618399
1393 Ga0207690_11545370
1394 Ga0207706_10013363
1395 Ga0207706_10102439
1396 Ga0207706_10159032
1397 Ga0207706_10172280
1398 Ga0207706_10355061
1399 Ga0207706_10395302
1400 Ga0207706_10709514
1401 Ga0207706_11265749
1402 Ga0207686_10012711
1403 Ga0207686_10236380
1404 Ga0207686_11108665
1405 Ga0207709_10010252
1406 Ga0207709_10102813
1407 Ga0207709_10131907
1408 Ga0207709_10314345
1409 Ga0207670_10664012
1410 Ga0207670_11307063
1411 Ga0207669_10003010
1412 Ga0207669_10025177
1413 Ga0207669_10174143
1414 Ga0207669_10655080
1415 Ga0207704_10090498
1416 Ga0207704_10127219
1417 Ga0207704_10415419
1418 Ga0207704_10571005
1419 Ga0207704_10896347
1420 Ga0207691_10001739
1421 Ga0207691_10004984
1422 Ga0207691_10005163
1423 Ga0207691_10075981
1424 Ga0207691_10195709
1425 Ga0207691_10215824
1426 Ga0207691_10267612
1427 Ga0207691_10369720
1428 Ga0207691_10371320
1429 Ga0207691_10654788
1430 Ga0207711_10006629
1431 Ga0207711_10011087
1432 Ga0207711_10121741
1433 Ga0207711_10307864
1434 Ga0207711_10474460
1435 Ga0207689_10043632
1436 Ga0207689_10178173
1437 Ga0207689_10184318
1438 Ga0207689_10241921
1439 Ga0207689_10249506
1440 Ga0207689_10310633
1441 Ga0207689_11000290
1442 Ga0207679_10192108
1443 Ga0207679_11274601
1444 Ga0207679_11685404
1445 Ga0207667_10126181
1446 Ga0207667_10589870
1447 Ga0207651_10017871
1448 Ga0207651_10051418
1449 Ga0207651_10055941
1450 Ga0207651_10085627
1451 Ga0207651_10153823
1452 Ga0207651_10218471
1453 Ga0207651_10758327
1454 Ga0207651_11344336
1455 Ga0207712_10024976
1456 Ga0207668_10001265
1457 Ga0207668_10177563
1458 Ga0207668_10457355
1459 Ga0207668_10566690
1460 Ga0207640_10028863
1461 Ga0207640_10029852
1462 Ga0207640_10086364
1463 Ga0207640_10849834
1464 Ga0207640_11077226
1465 Ga0207658_10001317
1466 Ga0207658_10001833
1467 Ga0207658_10101284
1468 Ga0207658_10233773
1469 Ga0207658_10971784
1470 Ga0207677_10039410
1471 Ga0207677_10042848
1472 Ga0207677_10069882
1473 Ga0207677_10072814
1474 Ga0207677_10113911
1475 Ga0207677_10316112
1476 Ga0207677_10502920
1477 Ga0207677_11191401
1478 Ga0207703_10010751
1479 Ga0207703_10772824
1480 Ga0207639_10417404
1481 Ga0207639_10451271
1482 Ga0207639_10611751
1483 Ga0207678_10041283
1484 Ga0207678_10139706
1485 Ga0207678_10164477
1486 Ga0207678_10169289
1487 Ga0207678_10189384
1488 Ga0207678_11067837
1489 Ga0207708_10004053
1490 Ga0207708_10254625
1491 Ga0207708_11277283
1492 Ga0207702_10260894
1493 Ga0207641_10004293
1494 Ga0207641_10009403
1495 Ga0207641_10044969
1496 Ga0207641_10180189
1497 Ga0207641_10556671
1498 Ga0207648_10002159
1499 Ga0207648_10023940
1500 Ga0207648_10035287
1501 Ga0207648_10048342
1502 Ga0207648_10156235
1503 Ga0207648_10328313
1504 Ga0207648_10389766
1505 Ga0207648_10429984
1506 Ga0207676_10017462
1507 Ga0207676_10032829
1508 Ga0207676_10073828
1509 Ga0207676_10429247
1510 Ga0207676_10786405
1511 Ga0207674_10029584
1512 Ga0207674_11771012
1513 Ga0207675_100003876
1514 Ga0207675_100290182
1515 Ga0207683_10045327
1516 Ga0207683_10075715
1517 Ga0207683_10076066
1518 Ga0207683_10153509
1519 Ga0207683_10164948
1520 Ga0207683_10274998
1521 Ga0207698_10095185
1522 Ga0207698_10154618
1523 Ga0207698_10160940
1524 Ga0207698_10197965
1525 Ga0207698_10240499
1526 Ga0209281_1000307
1527 Ga0209813_10001234
1528 Ga0209813_10089852
1529 Ga0207428_10018366
1530 Ga0268266_10187818
1531 Ga0268266_10197401
1532 Ga0268266_10617744
1533 Ga0268265_10006093
1534 Ga0268265_11781884
1535 Ga0268264_10001228
1536 Ga0268264_10426928
1537 Ga0307517_10001591
1538 Ga0307517_10088858
1539 Ga0307517_10138346
1540 Ga0307515_10058252
1541 Ga0307515_10092799
1542 Ga0307515_10311869
1543 Ga0307515_10543742
1544 Ga0265338_10136903
1545 Ga0307511_10000025
1546 Ga0307512_10022579
1547 Ga0307512_10135032
1548 Ga0307512_10137616
1549 Ga0265316_10286091
1550 Ga0307513_10016408
1551 Ga0307513_10512147
1552 Ga0307509_10002193
1553 Ga0307509_10004459
1554 Ga0307509_10050222
1555 Ga0307509_10117181
1556 Ga0307509_10137647
1557 Ga0307509_10159898
1558 Ga0307509_10271111
1559 Ga0307509_10276381
1560 Ga0307509_10417158
1561 Ga0307408_100075405
1562 Ga0307508_10002730
1563 Ga0307508_10036341
1564 Ga0307508_10129465
1565 Ga0307508_10468456
1566 Ga0307514_10158267
1567 Ga0307514_10288771
1568 Ga0307516_10047244
1569 Ga0307516_10112068
1570 Ga0307516_10382196
1571 Ga0307516_10539309
1572 Ga0307516_10981260
1573 Ga0307405_10012488
1574 Ga0307405_10656239
1575 Ga0307405_11600751
1576 Ga0307405_12071108
1577 Ga0307413_10267905
1578 Ga0307410_10116241
1579 Ga0307410_10203428
1580 Ga0307410_10953155
1581 Ga0307406_10010094
1582 Ga0307406_10029558
1583 Ga0307406_10704297
1584 Ga0307406_11041100
1585 Ga0307407_10145162
1586 Ga0307407_10219073
1587 Ga0307409_100003397
1588 Ga0307409_100036260
1589 Ga0307409_101023067
1590 Ga0307416_100019017
1591 Ga0307416_100082465
1592 Ga0307416_101101464
1593 Ga0307414_10028282
1594 Ga0307411_10009952
1595 Ga0307411_10070966
1596 Ga0307411_10075739
1597 Ga0307415_100152118
1598 Ga0307415_100332020
1599 Ga0307415_100407844
1600 Ga0307507_10273752
1601 Ga0307510_10000290
1602 Ga0307510_10106360
1603 Ga0307510_10170824
1604 Ga0373926_0003365
1605 Ga0373934_0072616
1606 Ga0373944_0049245
1607 Ga0373944_0201187
1608 Ga0373923_0008893
1609 Ga0373939_0140269
1610 Ga0373953_0000591
1611 Ga0373953_0050953
1612 Ga0373953_0578843
1613 Ga0373954_0006821
1614 Ga0373956_0006342
1615 Ga0373956_0229057
1616 Ga0373957_0015885
1617 Ga0373955_0015611
1618 Ga0373955_0039413
1619 Ga0373924_0021284
1620 Ga0373931_0054081
1621 Ga0373935_0030940
1622 Ga0373935_0110270
1623 Ga0373935_0613644
1624 Ga0373927_0416894
1625 Ga0373933_0022323
1626 Ga0373933_0227461
1627 Ga0373947_0741903
1628 Ga0373937_0054971
1629 Ga0373937_0074503
1630 Ga0373925_0350985
1631 Ga0373925_0476659
1632 Ga0373925_0827938
1633 Ga0395899_0272876
1634 Ga0395900_0009709
1635 Ga0395900_1784244
1636 Ga0395898_0018925
1637 Ga0395898_0088174
1638 Ga0395905_0038456
1639 Ga0395905_0048196
1640 Ga0395905_1468561
1641 Ga0395901_0243359
1642 Ga0451789_0060154
1643 Ga0451789_0231164
1644 Ga0451789_1057507
1645 Ga0451800_1025911
1646 Ga0451802_1266583
1647 Ga0451833_0913082
1648 Ga0451835_0713309
1649 Ga0451845_0412393
1650 Ga0451849_0639518
1651 Ga0451851_0957251
1652 Ga0451843_0227149
1653 Ga0451843_0336977
1654 Ga0451853_1441017
1655 Ga0451853_1589172
1656 Ga0451853_3936543
1657 Ga0439445_0100753
1658 Ga0439449_0130857
1659 Ga0439464_0018357
1660 Ga0439460_0020142
1661 Ga0466972_0184829
1662 Ga0453684_0006446
1663 Ga0466960_0304251
1664 Ga0495592_0000758
1665 Ga0495592_0000815
1666 Ga0495592_0003273
1667 Ga0495629_0001921
1668 Ga0495629_0032728
1669 Ga0495629_0070696
1670 Ga0495629_0215131
1671 Ga0495638_0148189
1672 Ga0495641_0147210
1673 Ga0495641_0214107
1674 Ga0495651_0016519
1675 Ga0495651_0091103
1676 Ga0495651_0771196
1677 Ga0495653_0000973
1678 Ga0495650_0093757
1679 Ga0495650_0140279
1680 Ga0495580_0346800
1681 Ga0495639_0403009
1682 Ga0495584_0287920
1683 Ga0495584_0339190
1684 Ga0495606_0114523
1685 Ga0495606_0194859
1686 Ga0495606_0404241
1687 Ga0495608_0031249
1688 Ga0495608_0415652
1689 Ga0495610_0015791
1690 Ga0495616_0287770
1691 Ga0495618_0034797
1692 Ga0495620_0051533
1693 Ga0495620_0069357
1694 Ga0495628_0000483
1695 Ga0495628_0017699
1696 Ga0495628_0253578
1697 Ga0495631_0187702
1698 Ga0495632_0012805
1699 Ga0495632_0113327
1700 Ga0495643_0086659
1701 Ga0495643_0262358
1702 Ga0495666_0070603
1703 Ga0495652_0002769
1704 Ga0495652_0049870
1705 Ga0495640_0001223
1706 Ga0495587_0010373
1707 Ga0495598_0038578
1708 Ga0495597_0029318
1709 Ga0495645_0000423
1710 Ga0495645_0011453
1711 Ga0495645_0018798
1712 Ga0495645_0034733
1713 Ga0495622_0082507
1714 Ga0495622_0274280
1715 Ga0495667_0021548
1716 Ga0495668_0086724
1717 Ga0495668_0151358
1718 Ga0495634_0006090
1719 Ga0495611_0091661
1720 Ga0495611_0454406
1721 Ga0495625_0012637
1722 Ga0495625_0366343
1723 Ga0495625_0730573
1724 Ga0495635_0001062
1725 Ga0495635_0406090
1726 Ga0495657_0069620
1727 Ga0495599_0000508
1728 Ga0495599_0015764
1729 Ga0495599_0665069
1730 Ga0495646_0001205
1731 Ga0495646_0135299
1732 Ga0495646_0145124
1733 Ga0495647_0216257
1734 Ga0495647_0489872
1735 Ga0495658_0041005
1736 Ga0495658_0125129
1737 Ga0495658_0361455
1738 Ga0495613_0122566
1739 Ga0495613_0213878
1740 Ga0495624_0013479
1741 Ga0495671_0067505
1742 Ga0495671_0427783
1743 Ga0495649_0003846
1744 Ga0495649_0659494
1745 Ga0495600_0129650
1746 Ga0495600_0162451
1747 Ga0495660_0016913
1748 Ga0495581_0485219
1749 Ga0495674_0018073
1750 Ga0495674_0485452
1751 Ga0495676_0059742
1752 Ga0495680_0075594
1753 Ga0495683_0278981
1754 Ga0495687_002581
1755 Ga0495687_002812
1756 Ga0495687_003084
1757 Ga0495675_0409438
1758 Ga0495675_0657236
1759 Ga0495677_0174788
1760 Ga0495677_0200358
1761 Ga0495673_0054349
1762 Ga0495673_0100002
1763 Ga0495681_0137244
1764 Ga0495684_0005299
1765 Ga0495684_0181812
1766 Ga0495686_0002064
1767 Ga0495686_0082946
1768 Ga0495593_0006629
1769 Ga0495593_0024096
1770 Ga0495614_0222708
1771 Ga0495626_0077277
1772 Ga0496106_0112626
1773 Ga0496108_0050302
1774 Ga0496108_0607566
1775 Ga0496109_0084287
1776 Ga0496110_0298147
1777 Ga0496111_0539514
1778 Ga0496113_0130349
1779 Ga0496113_0361350
1780 Ga0496114_0000832
1781 Ga0496114_0040638
1782 Ga0496115_0108657
1783 Ga0496117_0047473
1784 Ga0496121_0021499
1785 Ga0496124_0126090
1786 Ga0496124_0273030
1787 Ga0496125_0542280
1788 Ga0496126_0040934
1789 Ga0495682_0072566
1790 Ga0495682_0131467
1791 Ga0501047_0398470
1792 Ga0501067_0538504
1793 Ga0501249_109039
1794 Ga0501259_175117
1795 nmdc:mga03683_20325_c1
1796 nmdc:mga03683_300970_c1
1797 nmdc:mga03683_511647_c1
1798 nmdc:mga03683_6668_c1
1799 nmdc:mga03n38_4787_c1
1800 nmdc:mga03n38_58059_c1
1801 nmdc:mga00v17_4622_c1
1802 nmdc:mga00v17_55469_c1
1803 nmdc:mga0yw44_11763_c1
1804 nmdc:mga0yw44_29766_c1
1805 nmdc:mga0yw44_44241_c1
1806 nmdc:mga0k408_20661_c1
1807 nmdc:mga0k408_2209_c1
1808 nmdc:mga0k408_257960_c1
1809 nmdc:mga0k408_37370_c1
1810 nmdc:mga0k408_447946_c1
1811 nmdc:mga0k408_496228_c1
1812 nmdc:mga0k408_67699_c1
1813 nmdc:mga0k408_83737_c1
1814 nmdc:mga0k408_87493_c1
1815 nmdc:mga0k408_985_c1
1816 nmdc:mga06z11_175711_c1
1817 nmdc:mga06z11_17881_c1
1818 nmdc:mga06z11_284694_c1
1819 nmdc:mga06z11_57994_c1
1820 nmdc:mga06z11_6814_c1
1821 nmdc:mga04h51_30995_c1
1822 nmdc:mga04h51_6047_c1
1823 nmdc:mga07m45_106891_c1
1824 nmdc:mga07m45_107520_c1
1825 nmdc:mga07m45_11967_c1
1826 nmdc:mga07m45_17318_c1
1827 nmdc:mga07m45_1848_c1
1828 nmdc:mga07m45_50505_c1
1829 nmdc:mga07m45_59404_c1
1830 nmdc:mga05p37_2001070_c1
1831 nmdc:mga05p37_3939_c1
1832 nmdc:mga05p37_534475_c1
1833 nmdc:mga09592_28393_c1
1834 nmdc:mga09592_496959_c1
1835 nmdc:mga09592_725890_c1
1836 nmdc:mga0qj67_104673_c1
1837 nmdc:mga0qj67_144969_c1
1838 nmdc:mga06r32_4044_c1
1839 nmdc:mga06r32_71366_c1
1840 nmdc:mga06r32_76546_c1
1841 nmdc:mga08y16_22844_c1
1842 nmdc:mga08y16_274643_c1
1843 nmdc:mga08y16_386921_c1
1844 nmdc:mga0sz30_116965_c1
1845 nmdc:mga0sz30_210323_c1
1846 nmdc:mga0sz30_53753_c1
1847 Ga0495601_0031890
1848 Ga0495601_0122040
1849 Ga0495601_0195595
1850 Ga0495612_0008508
1851 Ga0495595_0008389
1852 Ga0495595_0086143
1853 Ga0495619_0011988
1854 Ga0495619_0290279
1855 Ga0500644_0036236
1856 Ga0500646_0150626
1857 Ga0500583_0071453
1858 Ga0500583_0200296
1859 Ga0500641_0006688
1860 Ga0500650_0164861
1861 Ga0500556_0000486
1862 Ga0500594_0040029
1863 Ga0500595_001646
1864 Ga0500595_195075
1865 Ga0500607_139792
1866 Ga0500618_115570
1867 Ga0500655_021221
1868 Ga0500559_0000126
1869 Ga0500559_0563093
1870 Ga0500589_229657
1871 Ga0500619_108190
1872 Ga0500622_0005314
1873 Ga0500627_0392127
1874 Ga0500645_008546
1875 Ga0500587_000588
1876 Ga0500587_009217
1877 2545678417
1878 2643892645
1879 2643962094
1880 2644245846
1881 2644302775
1882 2888424104
1883 2904694345
1884 2906643067
1885 2906661953
1886 8019601492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

29

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9436 2 152
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9375 2 152
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.837 14 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8195 19 152
2bhm-assembly2.cif.gz_D crystal structure of virb8 from brucella suis 0.8025 107 149
ID Description Score Start End Superfamily
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9425 2 152 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9417 1 151 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9364 2 152 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9357 1 151 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.837 14 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2S6RXT6-F1-model_v4 Putative enoyl-CoA hydratase 1 (EC 4.2.1.17) 0.9839 1 152 GO:0004300
AF-A0A2D9XR98-F1-model_v4 deleted 0.9791 1 152
AF-A9BSV1-F1-model_v4 MaoC domain protein dehydratase 0.9788 1 151
AF-A0A6N7A1J6-F1-model_v4 deleted 0.9784 2 151
AF-A0A1B3PGS9-F1-model_v4 Putative enoyl-CoA hydratase 1 0.9776 1 151

Map