F486387

General Info

Members Datasets Scaffolds Average Seq Length
943 353 1856 244

Family's Representative Sequence

Representative Sequence 3300027665|Ga0209983_1047248|Ga0209983_10472481
Length 284
Sequence MESTDISQHTSRRFNEDMERVTTRVMQMGGFVEQQLQRAVTALIEGNSSLGEEVARDDYRVNQMEVEIDEECGRIIATRQPTASDLRVMVAIIKTITDLERIGDEVEKVGYIAARLATMEKPSDNYREIRHLGRLVTEMVHDALHAYARLDADEAFEVARRDRKVDEEYEAIQRQNITFMMEDPRQIRRALEIMWVVRALERIGDHAKNICEYTVYMVHGKDIRHLSLDDAERQKLEFAAQEIIWNDAPWLYLWRLPSFFGLSKKLAYDFRADNYLEPYLITYK

Samples

Sample ID Description Type Environment
1 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
176 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
177 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
178 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
183 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
242 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
246 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 4.88
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209983_1047248 3300027665 Bacteria 938
2 LJNas_1006710 3300000546 Bacteria 1247
3 JGI25406J46586_10018088 3300003203 Bacteria 2900
4 JGI25405J52794_10043613 3300003911 Bacteria 952
5 Ga0058863_11844869 3300004799 Bacteria 943
6 Ga0058862_12269979 3300004803 Bacteria 1489
7 Ga0065707_10081860 3300005295 Bacteria 33219
8 Ga0070676_10087705 3300005328 Bacteria 1900
9 Ga0070683_100046808 3300005329 Bacteria 3996
10 Ga0070683_100620753 3300005329 Bacteria 1035
11 Ga0070690_100000080 3300005330 Bacteria 46850
12 Ga0070690_100031279 3300005330 Bacteria 3314
13 Ga0070690_100080282 3300005330 Bacteria 2133
14 Ga0070690_100104574 3300005330 Bacteria 1881
15 Ga0070670_100105025 3300005331 Bacteria 2433
16 Ga0070670_100271138 3300005331 Bacteria 1481
17 Ga0070677_10106392 3300005333 Bacteria 1245
18 Ga0068869_100003796 3300005334 Bacteria 9309
19 Ga0068869_100092370 3300005334 Bacteria 2278
20 Ga0068869_100110673 3300005334 Bacteria 2089
21 Ga0068869_100126351 3300005334 Bacteria 1961
22 Ga0068869_100173890 3300005334 Bacteria 1684
23 Ga0068869_100367538 3300005334 Bacteria 1176
24 Ga0070666_10002263 3300005335 Bacteria 11639
25 Ga0070666_10017354 3300005335 Bacteria 4614
26 Ga0070666_10036532 3300005335 Bacteria 3262
27 Ga0070666_10040441 3300005335 Bacteria 3112
28 Ga0070666_10117184 3300005335 Bacteria 1845
29 Ga0070680_100004584 3300005336 Bacteria 10389
30 Ga0070680_100018917 3300005336 Bacteria 5449
31 Ga0070680_100035070 3300005336 Bacteria 4049
32 Ga0070680_100254255 3300005336 Bacteria 1486
33 Ga0070680_100540353 3300005336 Bacteria 998
34 Ga0070682_100002647 3300005337 Bacteria 9897
35 Ga0070682_100148739 3300005337 Bacteria 1604
36 Ga0070682_100175204 3300005337 Bacteria 1494
37 Ga0068868_100012821 3300005338 Bacteria 6132
38 Ga0068868_100022904 3300005338 Bacteria 4722
39 Ga0068868_100090622 3300005338 Bacteria 2463
40 Ga0068868_100220621 3300005338 Bacteria 1587
41 Ga0070660_100492125 3300005339 Bacteria 1020
42 Ga0070689_100002723 3300005340 Bacteria 11584
43 Ga0070689_100033954 3300005340 Bacteria 3891
44 Ga0070689_100234357 3300005340 Bacteria 1510
45 Ga0070691_10028184 3300005341 Bacteria 2623
46 Ga0070661_100199867 3300005344 Bacteria 1527
47 Ga0070668_100215334 3300005347 Bacteria 1582
48 Ga0070669_100085574 3300005353 Bacteria 2354
49 Ga0070675_100176608 3300005354 Bacteria 1845
50 Ga0070675_100216685 3300005354 Bacteria 1666
51 Ga0070675_100234591 3300005354 Bacteria 1601
52 Ga0070675_100294295 3300005354 Bacteria 1429
53 Ga0070671_100002412 3300005355 Bacteria 14445
54 Ga0070671_100014343 3300005355 Bacteria 6402
55 Ga0070671_100089766 3300005355 Bacteria 2573
56 Ga0070671_100159722 3300005355 Unclassified 1905
57 Ga0070674_100071717 3300005356 Bacteria 2451
58 Ga0070674_100578820 3300005356 Bacteria 946
59 Ga0070673_100528229 3300005364 Bacteria 1070
60 Ga0070673_100859055 3300005364 Bacteria 840
61 Ga0070659_100022764 3300005366 Bacteria 4787
62 Ga0070667_100000212 3300005367 Bacteria 67792
63 Ga0070667_100001034 3300005367 Bacteria 25405
64 Ga0070667_100001547 3300005367 Bacteria 20612
65 Ga0070709_10017438 3300005434 Bacteria 4119
66 Ga0070709_10080581 3300005434 Bacteria 2123
67 Ga0070714_100090501 3300005435 Bacteria 2680
68 Ga0070714_100277381 3300005435 Bacteria 1556
69 Ga0070714_100312443 3300005435 Bacteria 1468
70 Ga0070713_100005361 3300005436 Bacteria 8759
71 Ga0070713_100007460 3300005436 Bacteria 7681
72 Ga0070713_100105178 3300005436 Bacteria 2451
73 Ga0070713_100349366 3300005436 Unclassified 1372
74 Ga0070713_100439365 3300005436 Unclassified 1224
75 Ga0070701_10001290 3300005438 Bacteria 9205
76 Ga0070701_10005928 3300005438 Bacteria 5100
77 Ga0070711_100007331 3300005439 Bacteria 6711
78 Ga0070711_100059149 3300005439 Bacteria 2659
79 Ga0070711_100099637 3300005439 Bacteria 2112
80 Ga0070705_100043457 3300005440 Bacteria 2575
81 Ga0070705_100110172 3300005440 Bacteria 1757
82 Ga0070705_100389691 3300005440 Bacteria 1028
83 Ga0070705_100503143 3300005440 Bacteria 920
84 Ga0070700_100000310 3300005441 Bacteria 25261
85 Ga0070700_100001892 3300005441 Bacteria 10584
86 Ga0070700_100019535 3300005441 Bacteria 3912
87 Ga0070694_100037120 3300005444 Bacteria 3231
88 Ga0070694_100254726 3300005444 Bacteria 1329
89 Ga0070663_100108874 3300005455 Bacteria 2079
90 Ga0070663_100509209 3300005455 Bacteria 1001
91 Ga0070678_100004558 3300005456 Bacteria 7865
92 Ga0070678_100009811 3300005456 Bacteria 5821
93 Ga0070678_100242060 3300005456 Bacteria 1509
94 Ga0070678_100450708 3300005456 Bacteria 1127
95 Ga0070662_100422678 3300005457 Bacteria 1103
96 Ga0070681_10000723 3300005458 Bacteria 27344
97 Ga0070681_10009084 3300005458 Bacteria 9770
98 Ga0070681_10017799 3300005458 Bacteria 7100
99 Ga0070681_10023992 3300005458 Bacteria 6140
100 Ga0070681_10030007 3300005458 Bacteria 5457
101 Ga0070681_10049706 3300005458 Bacteria 4186
102 Ga0070681_10365804 3300005458 Bacteria 1352
103 Ga0070681_10454721 3300005458 Bacteria 1193
104 Ga0068867_100001409 3300005459 Bacteria 16608
105 Ga0068867_100060084 3300005459 Bacteria 2819
106 Ga0068867_100061504 3300005459 Bacteria 2788
107 Ga0070685_10039970 3300005466 Bacteria 2667
108 Ga0070685_10087509 3300005466 Bacteria 1880
109 Ga0070699_100065394 3300005518 Bacteria 3156
110 Ga0070679_100014468 3300005530 Bacteria 7578
111 Ga0070679_100074825 3300005530 Bacteria 3377
112 Ga0070684_100044338 3300005535 Bacteria 3847
113 Ga0068853_100007535 3300005539 Bacteria 8709
114 Ga0068853_100204285 3300005539 Bacteria 1799
115 Ga0068853_100210427 3300005539 Bacteria 1772
116 Ga0070672_100048889 3300005543 Bacteria 3288
117 Ga0070672_100058788 3300005543 Bacteria 3023
118 Ga0070672_100167044 3300005543 Bacteria 1828
119 Ga0070672_100376259 3300005543 Bacteria 1214
120 Ga0070672_100699371 3300005543 Bacteria 888
121 Ga0070686_100000934 3300005544 Bacteria 16821
122 Ga0070695_100003973 3300005545 Bacteria 8637
123 Ga0070695_100004523 3300005545 Bacteria 8164
124 Ga0070695_100164279 3300005545 Bacteria 1561
125 Ga0070696_100000163 3300005546 Bacteria 37742
126 Ga0070665_100004229 3300005548 Bacteria 15109
127 Ga0070665_100005913 3300005548 Bacteria 12535
128 Ga0070665_100017225 3300005548 Bacteria 7251
129 Ga0070665_100018843 3300005548 Bacteria 6919
130 Ga0070665_100036349 3300005548 Bacteria 4954
131 Ga0070665_100086029 3300005548 Bacteria 3150
132 Ga0070665_100093836 3300005548 Bacteria 3006
133 Ga0070665_100103073 3300005548 Bacteria 2857
134 Ga0070665_100108173 3300005548 Bacteria 2783
135 Ga0070665_100166711 3300005548 Bacteria 2205
136 Ga0070665_100184669 3300005548 Bacteria 2086
137 Ga0070704_100013120 3300005549 Bacteria 5132
138 Ga0070704_100027068 3300005549 Bacteria 3797
139 Ga0070704_100079907 3300005549 Bacteria 2404
140 Ga0068855_100018297 3300005563 Bacteria 8417
141 Ga0068855_100021622 3300005563 Bacteria 7716
142 Ga0068855_100347336 3300005563 Bacteria 1635
143 Ga0068855_100409398 3300005563 Bacteria 1485
144 Ga0068855_100570491 3300005563 Bacteria 1223
145 Ga0070664_100031193 3300005564 Bacteria 4451
146 Ga0070664_100066064 3300005564 Bacteria 3088
147 Ga0070664_100125654 3300005564 Bacteria 2250
148 Ga0068857_100026685 3300005577 Bacteria 5091
149 Ga0068854_100138699 3300005578 Bacteria 1864
150 Ga0068854_100209995 3300005578 Bacteria 1535
151 Ga0068854_100412130 3300005578 Bacteria 1120
152 Ga0068856_100015128 3300005614 Bacteria 7453
153 Ga0068856_100834985 3300005614 Bacteria 941
154 Ga0070702_100000571 3300005615 Bacteria 13448
155 Ga0070702_100000861 3300005615 Bacteria 11735
156 Ga0070702_100134904 3300005615 Bacteria 1564
157 Ga0070702_100135213 3300005615 Bacteria 1563
158 Ga0068852_100710185 3300005616 Bacteria 1016
159 Ga0068859_100000843 3300005617 Bacteria 31176
160 Ga0068859_100003716 3300005617 Bacteria 15558
161 Ga0068859_100008293 3300005617 Bacteria 10532
162 Ga0068859_100038840 3300005617 Bacteria 4775
163 Ga0068859_100067370 3300005617 Bacteria 3615
164 Ga0068859_100098708 3300005617 Bacteria 2975
165 Ga0068859_100112089 3300005617 Bacteria 2791
166 Ga0068859_100160418 3300005617 Bacteria 2328
167 Ga0068859_100221675 3300005617 Bacteria 1979
168 Ga0068859_100421147 3300005617 Bacteria 1431
169 Ga0068859_100674418 3300005617 Bacteria 1125
170 Ga0068864_100084083 3300005618 Bacteria 2796
171 Ga0068864_100180259 3300005618 Bacteria 1931
172 Ga0068864_100216729 3300005618 Unclassified 1765
173 Ga0068866_10002896 3300005718 Bacteria 7070
174 Ga0068866_10009953 3300005718 Bacteria 4058
175 Ga0068861_100003204 3300005719 Bacteria 10828
176 Ga0068861_100015315 3300005719 Bacteria 5401
177 Ga0068861_100052725 3300005719 Bacteria 3092
178 Ga0068861_100182788 3300005719 Bacteria 1747
179 Ga0068861_100233996 3300005719 Bacteria 1559
180 Ga0068851_10087029 3300005834 Bacteria 1640
181 Ga0068851_10188349 3300005834 Bacteria 1146
182 Ga0068870_10262942 3300005840 Bacteria 1074
183 Ga0068863_100008570 3300005841 Bacteria 9993
184 Ga0068863_100010255 3300005841 Bacteria 9107
185 Ga0068863_100023537 3300005841 Bacteria 5879
186 Ga0068863_100024412 3300005841 Bacteria 5766
187 Ga0068863_100062072 3300005841 Bacteria 3534
188 Ga0068863_100086378 3300005841 Bacteria 2972
189 Ga0068863_100109205 3300005841 Bacteria 2633
190 Ga0068863_100134057 3300005841 Bacteria 2366
191 Ga0068863_100435667 3300005841 Bacteria 1285
192 Ga0068858_100004273 3300005842 Bacteria 14047
193 Ga0068858_100006044 3300005842 Bacteria 11801
194 Ga0068858_100009698 3300005842 Bacteria 9174
195 Ga0068858_100026224 3300005842 Bacteria 5418
196 Ga0068858_100032532 3300005842 Bacteria 4842
197 Ga0068858_100033444 3300005842 Bacteria 4771
198 Ga0068858_100205891 3300005842 Bacteria 1861
199 Ga0068858_100808390 3300005842 Bacteria 915
200 Ga0068860_100001786 3300005843 Bacteria 22899
201 Ga0068860_100008176 3300005843 Bacteria 10414
202 Ga0068860_100010532 3300005843 Bacteria 9135
203 Ga0068860_100030017 3300005843 Bacteria 5228
204 Ga0068860_100081466 3300005843 Bacteria 3078
205 Ga0068862_100003200 3300005844 Bacteria 14186
206 Ga0068862_100003815 3300005844 Bacteria 12836
207 Ga0068862_100072225 3300005844 Bacteria 2980
208 Ga0081455_10000999 3300005937 Bacteria 35875
209 Ga0081539_10000004 3300005985 Bacteria 555600
210 Ga0081539_10000455 3300005985 Bacteria 87222
211 Ga0070717_10004905 3300006028 Bacteria 9732
212 Ga0070715_10005326 3300006163 Bacteria 4284
213 Ga0070715_10113630 3300006163 Bacteria 1281
214 Ga0070716_100005267 3300006173 Bacteria 6252
215 Ga0070716_100013576 3300006173 Bacteria 4155
216 Ga0070716_100157021 3300006173 Bacteria 1470
217 Ga0070712_100040876 3300006175 Bacteria 3181
218 Ga0070712_100054978 3300006175 Bacteria 2785
219 Ga0097621_100000834 3300006237 Bacteria 21739
220 Ga0097621_100001687 3300006237 Bacteria 15116
221 Ga0097621_100009855 3300006237 Bacteria 6955
222 Ga0097621_100062041 3300006237 Bacteria 3068
223 Ga0097621_100240798 3300006237 Bacteria 1581
224 Ga0097621_100532496 3300006237 Bacteria 1068
225 Ga0097621_100847737 3300006237 Bacteria 849
226 Ga0068871_100001505 3300006358 Bacteria 15623
227 Ga0068871_100004973 3300006358 Bacteria 9284
228 Ga0068871_100009699 3300006358 Bacteria 6990
229 Ga0068871_100016558 3300006358 Bacteria 5558
230 Ga0068871_100018232 3300006358 Bacteria 5331
231 Ga0068871_100042270 3300006358 Bacteria 3658
232 Ga0075428_100003524 3300006844 Bacteria 17140
233 Ga0075428_100556411 3300006844 Bacteria 1226
234 Ga0075431_100325947 3300006847 Bacteria 1548
235 Ga0075431_100953951 3300006847 Bacteria 826
236 Ga0075433_10000324 3300006852 Bacteria 29260
237 Ga0075434_100138051 3300006871 Bacteria 2457
238 Ga0075434_100342418 3300006871 Unclassified 1516
239 Ga0068865_100009318 3300006881 Bacteria 6082
240 Ga0068865_100031899 3300006881 Bacteria 3516
241 Ga0068865_100062176 3300006881 Bacteria 2620
242 Ga0068865_100125545 3300006881 Bacteria 1915
243 Ga0068865_100280821 3300006881 Bacteria 1325
244 Ga0097620_100000843 3300006931 Bacteria 31176
245 Ga0097620_100003716 3300006931 Bacteria 15558
246 Ga0097620_100008293 3300006931 Bacteria 10532
247 Ga0097620_100038840 3300006931 Bacteria 4775
248 Ga0097620_100067371 3300006931 Bacteria 3615
249 Ga0097620_100098708 3300006931 Bacteria 2975
250 Ga0097620_100112086 3300006931 Bacteria 2791
251 Ga0097620_100119606 3300006931 Bacteria 2701
252 Ga0097620_100160418 3300006931 Bacteria 2328
253 Ga0097620_100221680 3300006931 Bacteria 1979
254 Ga0097620_100421146 3300006931 Bacteria 1431
255 Ga0097620_100674510 3300006931 Bacteria 1125
256 Ga0075435_100050136 3300007076 Bacteria 3359
257 Ga0099795_10000003 3300007788 Bacteria 110661
258 Ga0099795_10006725 3300007788 Bacteria 3156
259 Ga0105240_10011415 3300009093 Bacteria 12373
260 Ga0105240_10023413 3300009093 Bacteria 8166
261 Ga0105240_10051530 3300009093 Bacteria 5177
262 Ga0105240_10052801 3300009093 Bacteria 5107
263 Ga0105240_10057947 3300009093 Bacteria 4837
264 Ga0105240_10097032 3300009093 Bacteria 3591
265 Ga0105240_10147351 3300009093 Unclassified 2807
266 Ga0105240_10182115 3300009093 Bacteria 2478
267 Ga0105240_10210473 3300009093 Bacteria 2273
268 Ga0105240_10213605 3300009093 Bacteria 2252
269 Ga0105240_10579087 3300009093 Bacteria 1238
270 Ga0111539_10019535 3300009094 Bacteria 8360
271 Ga0111539_10056169 3300009094 Bacteria 4680
272 Ga0111539_10245427 3300009094 Bacteria 2085
273 Ga0105245_10000241 3300009098 Bacteria 52084
274 Ga0105245_10014455 3300009098 Bacteria 6876
275 Ga0105245_10039613 3300009098 Bacteria 4194
276 Ga0105245_10043198 3300009098 Bacteria 4021
277 Ga0105245_10319439 3300009098 Bacteria 1529
278 Ga0105245_10595095 3300009098 Bacteria 1132
279 Ga0105247_10001407 3300009101 Bacteria 17443
280 Ga0105247_10015485 3300009101 Bacteria 4567
281 Ga0105247_10026852 3300009101 Unclassified 3480
282 Ga0114129_10099698 3300009147 Bacteria 4020
283 Ga0114129_10272047 3300009147 Bacteria 2266
284 Ga0105243_10000390 3300009148 Bacteria 46725
285 Ga0105243_10081924 3300009148 Bacteria 2636
286 Ga0105243_10116369 3300009148 Bacteria 2246
287 Ga0105243_10713913 3300009148 Bacteria 979
288 Ga0105241_10011725 3300009174 Bacteria 6436
289 Ga0105241_10050729 3300009174 Bacteria 3163
290 Ga0105241_10050819 3300009174 Bacteria 3160
291 Ga0105241_10361460 3300009174 Bacteria 1263
292 Ga0105242_10000924 3300009176 Bacteria 22821
293 Ga0105242_10006806 3300009176 Bacteria 8816
294 Ga0105242_10009861 3300009176 Bacteria 7316
295 Ga0105242_10031598 3300009176 Bacteria 4231
296 Ga0105242_10200366 3300009176 Bacteria 1773
297 Ga0105242_10266785 3300009176 Bacteria 1549
298 Ga0105248_10007003 3300009177 Bacteria 12349
299 Ga0105248_10010587 3300009177 Bacteria 10165
300 Ga0105248_10068368 3300009177 Bacteria 3988
301 Ga0105248_10070832 3300009177 Bacteria 3915
302 Ga0105248_10120087 3300009177 Bacteria 2965
303 Ga0105248_10161570 3300009177 Bacteria 2526
304 Ga0105248_10235155 3300009177 Bacteria 2063
305 Ga0105237_10016488 3300009545 Bacteria 7674
306 Ga0105237_10022706 3300009545 Bacteria 6438
307 Ga0105237_10050540 3300009545 Bacteria 4177
308 Ga0105237_10097015 3300009545 Bacteria 2938
309 Ga0105237_10122318 3300009545 Bacteria 2597
310 Ga0105237_10160502 3300009545 Bacteria 2246
311 Ga0105237_10179483 3300009545 Bacteria 2117
312 Ga0105237_10499523 3300009545 Bacteria 1223
313 Ga0105237_10733782 3300009545 Bacteria 994
314 Ga0105238_10032211 3300009551 Bacteria 5334
315 Ga0105238_10053847 3300009551 Bacteria 4043
316 Ga0105238_10117391 3300009551 Bacteria 2641
317 Ga0105238_10128703 3300009551 Bacteria 2510
318 Ga0105238_10625608 3300009551 Bacteria 1085
319 Ga0105238_10908709 3300009551 Bacteria 899
320 Ga0105249_10008116 3300009553 Bacteria 9153
321 Ga0105249_10014594 3300009553 Bacteria 6944
322 Ga0105249_10058567 3300009553 Bacteria 3530
323 Ga0105249_10105747 3300009553 Bacteria 2654
324 Ga0105249_10343826 3300009553 Bacteria 1509
325 Ga0105249_10417725 3300009553 Bacteria 1374
326 Ga0105249_10660151 3300009553 Unclassified 1104
327 Ga0105249_10773883 3300009553 Bacteria 1023
328 Ga0099796_10000041 3300010159 Bacteria 26122
329 Ga0099796_10006731 3300010159 Bacteria 2961
330 Ga0105239_10017634 3300010375 Bacteria 7898
331 Ga0105239_10048689 3300010375 Bacteria 4647
332 Ga0105239_10518644 3300010375 Bacteria 1356
333 Ga0105239_10522977 3300010375 Bacteria 1350
334 Ga0105239_10567294 3300010375 Bacteria 1293
335 Ga0105246_10811819 3300011119 Bacteria 831
336 Ga0157370_10020459 3300013104 Bacteria 6610
337 Ga0157369_10087862 3300013105 Bacteria 3319
338 Ga0157369_10699858 3300013105 Bacteria 1044
339 Ga0157374_10023438 3300013296 Bacteria 5521
340 Ga0157374_10040531 3300013296 Bacteria 4289
341 Ga0157374_10052976 3300013296 Bacteria 3781
342 Ga0157374_10054379 3300013296 Bacteria 3734
343 Ga0157374_10114852 3300013296 Bacteria 2593
344 Ga0157374_10649025 3300013296 Bacteria 1067
345 Ga0157378_10000691 3300013297 Bacteria 31706
346 Ga0157378_10109872 3300013297 Bacteria 2526
347 Ga0157378_10118670 3300013297 Bacteria 2435
348 Ga0157378_10227812 3300013297 Bacteria 1774
349 Ga0163162_10012692 3300013306 Bacteria 8224
350 Ga0163162_10383906 3300013306 Bacteria 1538
351 Ga0163162_10505193 3300013306 Bacteria 1339
352 Ga0163162_10840748 3300013306 Bacteria 1034
353 Ga0157372_10101891 3300013307 Bacteria 3279
354 Ga0157372_10212833 3300013307 Bacteria 2240
355 Ga0157372_10746802 3300013307 Bacteria 1138
356 Ga0157375_10004334 3300013308 Bacteria 12320
357 Ga0157375_10053894 3300013308 Bacteria 3960
358 Ga0157375_10065624 3300013308 Bacteria 3619
359 Ga0157375_10157794 3300013308 Bacteria 2409
360 Ga0157375_10377945 3300013308 Bacteria 1583
361 Ga0163163_10004906 3300014325 Bacteria 11504
362 Ga0163163_10094226 3300014325 Bacteria 3012
363 Ga0163163_10128994 3300014325 Bacteria 2568
364 Ga0163163_10317545 3300014325 Unclassified 1611
365 Ga0163163_10360591 3300014325 Bacteria 1510
366 Ga0163163_10876396 3300014325 Bacteria 961
367 Ga0157380_10004018 3300014326 Bacteria 10160
368 Ga0157380_10018655 3300014326 Bacteria 5153
369 Ga0157380_10060834 3300014326 Bacteria 3020
370 Ga0157380_10172802 3300014326 Bacteria 1890
371 Ga0157380_10182357 3300014326 Bacteria 1846
372 Ga0157377_10096364 3300014745 Bacteria 1755
373 Ga0157377_10367048 3300014745 Bacteria 971
374 Ga0157379_10000686 3300014968 Bacteria 27464
375 Ga0157379_10010622 3300014968 Bacteria 8026
376 Ga0157379_10019884 3300014968 Bacteria 5931
377 Ga0157379_10032813 3300014968 Bacteria 4630
378 Ga0157379_10049209 3300014968 Bacteria 3763
379 Ga0157379_10060447 3300014968 Bacteria 3387
380 Ga0157376_10001295 3300014969 Bacteria 16479
381 Ga0157376_10023533 3300014969 Bacteria 4822
382 Ga0157376_10244311 3300014969 Bacteria 1674
383 Ga0213876_10041849 3300021384 Bacteria 2421
384 Ga0213876_10102416 3300021384 Bacteria 1518
385 Ga0213871_10027669 3300021441 Bacteria 1458
386 Ga0207656_10203620 3300025321 Bacteria 957
387 Ga0207682_10043209 3300025893 Bacteria 1844
388 Ga0207642_10006290 3300025899 Bacteria 3941
389 Ga0207642_10037151 3300025899 Bacteria 2096
390 Ga0207642_10151652 3300025899 Bacteria 1234
391 Ga0207710_10000254 3300025900 Bacteria 44382
392 Ga0207710_10038731 3300025900 Bacteria 2108
393 Ga0207710_10097359 3300025900 Bacteria 1384
394 Ga0207688_10042071 3300025901 Bacteria 2543
395 Ga0207680_10009095 3300025903 Bacteria 4912
396 Ga0207680_10020199 3300025903 Bacteria 3579
397 Ga0207680_10132660 3300025903 Bacteria 1643
398 Ga0207685_10081513 3300025905 Bacteria 1340
399 Ga0207699_10047758 3300025906 Bacteria 2511
400 Ga0207699_10516279 3300025906 Bacteria 864
401 Ga0207643_10175154 3300025908 Bacteria 1296
402 Ga0207643_10242879 3300025908 Bacteria 1107
403 Ga0207707_10002687 3300025912 Bacteria 15893
404 Ga0207707_10003643 3300025912 Bacteria 13664
405 Ga0207707_10007933 3300025912 Bacteria 9234
406 Ga0207707_10015246 3300025912 Bacteria 6692
407 Ga0207707_10037249 3300025912 Bacteria 4250
408 Ga0207707_10044100 3300025912 Bacteria 3889
409 Ga0207707_10065169 3300025912 Bacteria 3173
410 Ga0207695_10011439 3300025913 Bacteria 10752
411 Ga0207695_10022627 3300025913 Bacteria 7127
412 Ga0207695_10026932 3300025913 Bacteria 6409
413 Ga0207695_10034621 3300025913 Bacteria 5489
414 Ga0207695_10057119 3300025913 Bacteria 4057
415 Ga0207695_10106855 3300025913 Unclassified 2784
416 Ga0207695_10114790 3300025913 Bacteria 2668
417 Ga0207695_10155161 3300025913 Unclassified 2224
418 Ga0207695_10181217 3300025913 Bacteria 2027
419 Ga0207695_10239941 3300025913 Bacteria 1714
420 Ga0207695_10398930 3300025913 Bacteria 1260
421 Ga0207671_10013547 3300025914 Bacteria 6492
422 Ga0207671_10085239 3300025914 Bacteria 2373
423 Ga0207671_10159585 3300025914 Bacteria 1746
424 Ga0207671_10209065 3300025914 Bacteria 1526
425 Ga0207693_10001960 3300025915 Bacteria 18058
426 Ga0207693_10025310 3300025915 Bacteria 4706
427 Ga0207693_10109947 3300025915 Bacteria 2161
428 Ga0207663_10010099 3300025916 Bacteria 5008
429 Ga0207663_10022025 3300025916 Bacteria 3637
430 Ga0207663_10123191 3300025916 Bacteria 1779
431 Ga0207660_10044651 3300025917 Bacteria 3118
432 Ga0207660_10243009 3300025917 Bacteria 1419
433 Ga0207662_10199413 3300025918 Bacteria 1295
434 Ga0207652_10001709 3300025921 Bacteria 19167
435 Ga0207652_10028327 3300025921 Bacteria 4674
436 Ga0207652_10153571 3300025921 Bacteria 2062
437 Ga0207681_10373286 3300025923 Bacteria 1147
438 Ga0207694_10090625 3300025924 Bacteria 2412
439 Ga0207694_10118005 3300025924 Bacteria 2116
440 Ga0207694_10138988 3300025924 Bacteria 1952
441 Ga0207694_10185523 3300025924 Bacteria 1688
442 Ga0207694_10442269 3300025924 Bacteria 1085
443 Ga0207694_10445533 3300025924 Bacteria 1080
444 Ga0207650_10120861 3300025925 Bacteria 2039
445 Ga0207659_10128349 3300025926 Bacteria 1953
446 Ga0207659_10129183 3300025926 Bacteria 1947
447 Ga0207659_10164117 3300025926 Bacteria 1747
448 Ga0207687_10000799 3300025927 Bacteria 21252
449 Ga0207687_10500948 3300025927 Bacteria 1014
450 Ga0207700_10117537 3300025928 Bacteria 2150
451 Ga0207700_10140737 3300025928 Bacteria 1982
452 Ga0207664_10065833 3300025929 Bacteria 2902
453 Ga0207644_10002165 3300025931 Bacteria 12741
454 Ga0207644_10040094 3300025931 Bacteria 3309
455 Ga0207644_10082590 3300025931 Bacteria 2377
456 Ga0207690_10219530 3300025932 Bacteria 1454
457 Ga0207706_10228197 3300025933 Bacteria 1629
458 Ga0207706_10456286 3300025933 Bacteria 1105
459 Ga0207686_10004205 3300025934 Bacteria 7723
460 Ga0207686_10044281 3300025934 Bacteria 2732
461 Ga0207686_10116623 3300025934 Bacteria 1810
462 Ga0207686_10220013 3300025934 Bacteria 1370
463 Ga0207709_10011405 3300025935 Bacteria 4904
464 Ga0207709_10104822 3300025935 Bacteria 1877
465 Ga0207670_10015764 3300025936 Bacteria 4524
466 Ga0207670_10032804 3300025936 Bacteria 3342
467 Ga0207670_10137220 3300025936 Bacteria 1799
468 Ga0207669_10240988 3300025937 Bacteria 1340
469 Ga0207669_10349811 3300025937 Bacteria 1141
470 Ga0207669_10652270 3300025937 Bacteria 861
471 Ga0207704_10019972 3300025938 Bacteria 3533
472 Ga0207704_10088835 3300025938 Bacteria 2023
473 Ga0207704_10103558 3300025938 Bacteria 1904
474 Ga0207665_10002487 3300025939 Bacteria 12412
475 Ga0207665_10020929 3300025939 Bacteria 4299
476 Ga0207665_10519013 3300025939 Bacteria 922
477 Ga0207691_10180798 3300025940 Bacteria 1843
478 Ga0207691_10462632 3300025940 Bacteria 1079
479 Ga0207691_10782717 3300025940 Bacteria 802
480 Ga0207711_10004364 3300025941 Bacteria 12071
481 Ga0207711_10054984 3300025941 Bacteria 3417
482 Ga0207711_10158514 3300025941 Bacteria 2047
483 Ga0207711_10451837 3300025941 Bacteria 1196
484 Ga0207689_10000452 3300025942 Bacteria 38652
485 Ga0207689_10000820 3300025942 Bacteria 29947
486 Ga0207689_10012333 3300025942 Bacteria 7312
487 Ga0207689_10061364 3300025942 Bacteria 3091
488 Ga0207689_10118926 3300025942 Bacteria 2173
489 Ga0207689_10305007 3300025942 Bacteria 1320
490 Ga0207689_10403972 3300025942 Bacteria 1139
491 Ga0207689_10546769 3300025942 Bacteria 972
492 Ga0207689_10629026 3300025942 Bacteria 904
493 Ga0207661_10061726 3300025944 Bacteria 3029
494 Ga0207661_10548020 3300025944 Bacteria 1059
495 Ga0207679_10051005 3300025945 Bacteria 3027
496 Ga0207679_10237496 3300025945 Bacteria 1542
497 Ga0207667_10014281 3300025949 Bacteria 9059
498 Ga0207667_10016556 3300025949 Bacteria 8327
499 Ga0207667_10049000 3300025949 Bacteria 4464
500 Ga0207667_10246814 3300025949 Bacteria 1827
501 Ga0207667_10507353 3300025949 Bacteria 1223
502 Ga0207651_10212160 3300025960 Bacteria 1559
503 Ga0207651_10273061 3300025960 Bacteria 1393
504 Ga0207651_10419508 3300025960 Bacteria 1142
505 Ga0207712_10036268 3300025961 Bacteria 3357
506 Ga0207712_10362992 3300025961 Bacteria 1207
507 Ga0207712_10432482 3300025961 Bacteria 1113
508 Ga0207668_10405728 3300025972 Bacteria 1153
509 Ga0207640_10752712 3300025981 Bacteria 840
510 Ga0207658_10000161 3300025986 Bacteria 71234
511 Ga0207658_10014587 3300025986 Bacteria 5380
512 Ga0207658_10095196 3300025986 Bacteria 2319
513 Ga0207658_10153020 3300025986 Bacteria 1881
514 Ga0207658_10224081 3300025986 Bacteria 1583
515 Ga0207677_10019760 3300026023 Bacteria 4075
516 Ga0207677_10234756 3300026023 Bacteria 1480
517 Ga0207677_10335053 3300026023 Bacteria 1262
518 Ga0207677_10396565 3300026023 Bacteria 1169
519 Ga0207703_10000183 3300026035 Bacteria 73109
520 Ga0207703_10003754 3300026035 Bacteria 12643
521 Ga0207703_10028778 3300026035 Bacteria 4383
522 Ga0207703_10037902 3300026035 Bacteria 3843
523 Ga0207703_10055425 3300026035 Bacteria 3225
524 Ga0207703_11042141 3300026035 Bacteria 785
525 Ga0207639_10160583 3300026041 Bacteria 1893
526 Ga0207678_10113068 3300026067 Unclassified 2316
527 Ga0207678_10132002 3300026067 Bacteria 2131
528 Ga0207678_10166675 3300026067 Bacteria 1881
529 Ga0207708_10000701 3300026075 Bacteria 25411
530 Ga0207708_10001120 3300026075 Bacteria 20140
531 Ga0207708_10029337 3300026075 Bacteria 4169
532 Ga0207702_10133671 3300026078 Bacteria 2235
533 Ga0207641_10003340 3300026088 Bacteria 14261
534 Ga0207641_10019717 3300026088 Bacteria 5536
535 Ga0207641_10025434 3300026088 Bacteria 4881
536 Ga0207641_10127277 3300026088 Bacteria 2282
537 Ga0207641_10156278 3300026088 Bacteria 2069
538 Ga0207641_10341755 3300026088 Bacteria 1425
539 Ga0207641_10383221 3300026088 Bacteria 1347
540 Ga0207648_10000159 3300026089 Bacteria 69221
541 Ga0207648_10029915 3300026089 Bacteria 4830
542 Ga0207648_10717182 3300026089 Bacteria 927
543 Ga0207676_10080765 3300026095 Bacteria 2640
544 Ga0207676_10174651 3300026095 Bacteria 1875
545 Ga0207676_10442120 3300026095 Unclassified 1224
546 Ga0207676_10662515 3300026095 Bacteria 1008
547 Ga0207674_10007918 3300026116 Bacteria 12341
548 Ga0207674_10700144 3300026116 Bacteria 978
549 Ga0207674_10919100 3300026116 Bacteria 843
550 Ga0207675_100000068 3300026118 Bacteria 78105
551 Ga0207675_100027528 3300026118 Bacteria 5294
552 Ga0207675_100084865 3300026118 Bacteria 2972
553 Ga0207675_100130112 3300026118 Bacteria 2386
554 Ga0207675_100133172 3300026118 Bacteria 2357
555 Ga0207675_100134829 3300026118 Bacteria 2342
556 Ga0207675_100270540 3300026118 Bacteria 1649
557 Ga0207683_10003248 3300026121 Bacteria 14184
558 Ga0207683_10013172 3300026121 Bacteria 7056
559 Ga0207683_10110409 3300026121 Bacteria 2462
560 Ga0207683_10141192 3300026121 Bacteria 2170
561 Ga0207683_10344376 3300026121 Bacteria 1367
562 Ga0207698_10590357 3300026142 Bacteria 1094
563 Ga0209179_1000050 3300027512 Bacteria 22849
564 Ga0209179_1025240 3300027512 Bacteria 1184
565 Ga0207428_10010959 3300027907 Bacteria 8064
566 Ga0265354_1001907 3300028016 Bacteria 2772
567 Ga0265356_1000692 3300028017 Bacteria 5808
568 Ga0265357_1008995 3300028023 Bacteria 987
569 Ga0265355_1000468 3300028036 Bacteria 2109
570 Ga0268266_10003316 3300028379 Bacteria 16160
571 Ga0268266_10003994 3300028379 Bacteria 14291
572 Ga0268266_10023651 3300028379 Bacteria 5229
573 Ga0268266_10025879 3300028379 Bacteria 4991
574 Ga0268266_10033156 3300028379 Bacteria 4392
575 Ga0268266_10036945 3300028379 Bacteria 4161
576 Ga0268266_10047212 3300028379 Bacteria 3688
577 Ga0268266_10135535 3300028379 Bacteria 2205
578 Ga0268266_10176161 3300028379 Bacteria 1944
579 Ga0268266_10186357 3300028379 Bacteria 1892
580 Ga0268266_10217385 3300028379 Bacteria 1755
581 Ga0268265_10004185 3300028380 Bacteria 10099
582 Ga0268265_10018361 3300028380 Bacteria 4845
583 Ga0268264_10000057 3300028381 Bacteria 309824
584 Ga0268264_10007801 3300028381 Bacteria 8910
585 Ga0268264_10110767 3300028381 Bacteria 2404
586 Ga0268264_10123709 3300028381 Bacteria 2283
587 Ga0265326_10017517 3300028558 Bacteria 2066
588 Ga0265319_1013375 3300028563 Bacteria 3266
589 Ga0265319_1056620 3300028563 Bacteria 1280
590 Ga0265334_10000857 3300028573 Bacteria 15227
591 Ga0265334_10002212 3300028573 Bacteria 9153
592 Ga0265318_10002664 3300028577 Bacteria 9395
593 Ga0265318_10042664 3300028577 Bacteria 1720
594 Ga0307515_10002761 3300028794 Bacteria 37491
595 Ga0265338_10004528 3300028800 Bacteria 18730
596 Ga0265338_10026969 3300028800 Bacteria 5778
597 Ga0265338_10065785 3300028800 Bacteria 3141
598 Ga0265338_10149536 3300028800 Bacteria 1816
599 Ga0307511_10000342 3300030521 Bacteria 49561
600 Ga0307511_10009381 3300030521 Bacteria 9759
601 Ga0265760_10000114 3300031090 Bacteria 20455
602 Ga0265760_10038943 3300031090 Bacteria 1414
603 Ga0265330_10009844 3300031235 Bacteria 4524
604 Ga0265330_10022236 3300031235 Bacteria 2887
605 Ga0265332_10009238 3300031238 Bacteria 4405
606 Ga0265328_10016712 3300031239 Bacteria 2850
607 Ga0265328_10059949 3300031239 Bacteria 1397
608 Ga0265320_10003107 3300031240 Bacteria 11271
609 Ga0265320_10022086 3300031240 Bacteria 3410
610 Ga0265325_10031059 3300031241 Bacteria 2861
611 Ga0265329_10025430 3300031242 Bacteria 1959
612 Ga0265329_10042006 3300031242 Bacteria 1465
613 Ga0265340_10022248 3300031247 Bacteria 3243
614 Ga0265340_10031844 3300031247 Bacteria 2635
615 Ga0265340_10061435 3300031247 Bacteria 1797
616 Ga0265340_10068498 3300031247 Bacteria 1686
617 Ga0265339_10039584 3300031249 Bacteria 2624
618 Ga0265339_10045506 3300031249 Bacteria 2415
619 Ga0265339_10095696 3300031249 Bacteria 1551
620 Ga0265331_10011650 3300031250 Bacteria 4808
621 Ga0265331_10019927 3300031250 Bacteria 3453
622 Ga0265316_10023141 3300031344 Bacteria 5223
623 Ga0307513_10021506 3300031456 Bacteria 7614
624 Ga0307509_10115911 3300031507 Bacteria 2670
625 Ga0307509_10271312 3300031507 Bacteria 1464
626 Ga0307509_10462900 3300031507 Bacteria 960
627 Ga0307408_100247801 3300031548 Bacteria 1468
628 Ga0307408_100275651 3300031548 Bacteria 1398
629 Ga0265313_10016630 3300031595 Bacteria 4221
630 Ga0265313_10017082 3300031595 Bacteria 4141
631 Ga0265313_10053240 3300031595 Bacteria 1927
632 Ga0316575_10035881 3300031665 Bacteria 1950
633 Ga0265314_10006771 3300031711 Bacteria 10054
634 Ga0265314_10144520 3300031711 Bacteria 1466
635 Ga0265342_10043449 3300031712 Bacteria 2712
636 Ga0265342_10123029 3300031712 Bacteria 1459
637 Ga0316576_10012885 3300031727 Bacteria 5534
638 Ga0316576_10178428 3300031727 Bacteria 1602
639 Ga0316577_10135795 3300031733 Bacteria 1385
640 Ga0307413_10048731 3300031824 Bacteria 2534
641 Ga0307413_10590288 3300031824 Bacteria 907
642 Ga0307413_10806444 3300031824 Bacteria 789
643 Ga0307410_10003260 3300031852 Bacteria 8104
644 Ga0307410_10016809 3300031852 Bacteria 4374
645 Ga0307410_10048743 3300031852 Bacteria 2839
646 Ga0307406_10048172 3300031901 Bacteria 2690
647 Ga0307406_10079936 3300031901 Bacteria 2169
648 Ga0307406_10206172 3300031901 Bacteria 1451
649 Ga0307407_10371424 3300031903 Bacteria 1018
650 Ga0307412_10122563 3300031911 Bacteria 1874
651 Ga0307412_10299648 3300031911 Bacteria 1270
652 Ga0307409_100001941 3300031995 Bacteria 10570
653 Ga0307409_100307691 3300031995 Bacteria 1477
654 Ga0307409_100338872 3300031995 Bacteria 1414
655 Ga0307409_100391037 3300031995 Bacteria 1325
656 Ga0307416_100018740 3300032002 Bacteria 4886
657 Ga0307416_100108907 3300032002 Bacteria 2435
658 Ga0307411_10000393 3300032005 Bacteria 14945
659 Ga0307411_10002266 3300032005 Bacteria 8409
660 Ga0307411_10045875 3300032005 Bacteria 2814
661 Ga0307411_10763250 3300032005 Bacteria 848
662 Ga0307415_100005339 3300032126 Bacteria 6807
663 Ga0307415_100035377 3300032126 Bacteria 3262
664 Ga0307415_100189344 3300032126 Bacteria 1622
665 Ga0307415_100347429 3300032126 Bacteria 1247
666 Ga0307415_100458643 3300032126 Bacteria 1104
667 Ga0307510_10000014 3300033180 Bacteria 271607
668 Ga0307510_10151447 3300033180 Bacteria 1937
669 Ga0373936_0006833 3300035113 Bacteria 4295
670 Ga0373945_0039480 3300035116 Bacteria 1702
671 Ga0373953_0129527 3300035117 Bacteria 1075
672 Ga0373956_0283054 3300035119 Bacteria 789
673 Ga0373943_0035647 3300035170 Bacteria 2379
674 Ga0373955_0029676 3300035172 Bacteria 2847
675 Ga0373955_0030134 3300035172 Bacteria 2829
676 Ga0373955_0354915 3300035172 Bacteria 888
677 Ga0316574_0084385 3300035398 Bacteria 2020
678 Ga0373924_0107488 3300035410 Bacteria 1204
679 Ga0373924_0140881 3300035410 Bacteria 1052
680 Ga0373927_0044984 3300035695 Bacteria 2856
681 Ga0373927_0433496 3300035695 Bacteria 868
682 Ga0373933_0113593 3300035724 Bacteria 1691
683 Ga0373933_0158812 3300035724 Bacteria 1435
684 Ga0373937_0003142 3300036401 Bacteria 13820
685 Ga0373937_0205299 3300036401 Bacteria 1853
686 Ga0373937_0246467 3300036401 Bacteria 1684
687 Ga0373937_0773291 3300036401 Bacteria 908
688 Ga0373925_0007403 3300037068 Bacteria 8010
689 Ga0395898_0013822 3300037466 Bacteria 8299
690 Ga0395898_0061276 3300037466 Bacteria 3655
691 Ga0395898_0438703 3300037466 Bacteria 1244
692 Ga0436365_1867186 3300039437 Bacteria 3907
693 Ga0436360_0672319 3300039438 Bacteria 982
694 Ga0436360_0674475 3300039438 Bacteria 19139
695 Ga0436360_0822925 3300039438 Bacteria 1544
696 Ga0436363_0487320 3300039450 Bacteria 3175
697 Ga0436363_0731737 3300039450 Bacteria 2489
698 Ga0436363_0829074 3300039450 Bacteria 17900
699 Ga0436363_0951456 3300039450 Bacteria 951
700 Ga0436362_0298024 3300039453 Bacteria 1176
701 Ga0436362_1062550 3300039453 Bacteria 1309
702 Ga0451793_0109096 3300041452 Bacteria 1261
703 Ga0451798_0977305 3300041458 Bacteria 1928
704 Ga0451802_1913096 3300041460 Bacteria 1567
705 Ga0451804_0964549 3300041463 Bacteria 1110
706 Ga0451807_0912795 3300041486 Bacteria 1227
707 Ga0451807_1119766 3300041486 Bacteria 3122
708 Ga0451807_1884568 3300041486 Bacteria 1493
709 Ga0439442_035348 3300042002 Bacteria 1045
710 Ga0450919_013650 3300042121 Bacteria 919
711 Ga0450920_000747 3300042122 Bacteria 5238
712 Ga0450923_004656 3300042125 Bacteria 2163
713 Ga0450895_000370 3300042132 Bacteria 2479
714 Ga0450907_002187 3300042146 Bacteria 3833
715 Ga0439446_0018399 3300042156 Bacteria 1957
716 Ga0450908_001358 3300042184 Bacteria 4744
717 Ga0450908_002745 3300042184 Bacteria 3436
718 Ga0439435_0001503 3300042436 Bacteria 4339
719 Ga0450916_007558 3300042530 Bacteria 1308
720 Ga0451577_0482104 3300042876 Bacteria 1126
721 Ga0466969_0002463 3300044656 Bacteria 9882
722 Ga0466969_0075929 3300044656 Bacteria 1610
723 Ga0466966_0000445 3300044684 Bacteria 26600
724 Ga0466961_0003001 3300044693 Bacteria 10473
725 Ga0466964_0000891 3300044706 Bacteria 9787
726 Ga0466971_0000422 3300044719 Bacteria 16550
727 Ga0466970_0003326 3300044765 Bacteria 7819
728 Ga0466957_0008510 3300044842 Bacteria 5838
729 Ga0466959_0001134 3300045049 Bacteria 16049
730 Ga0466959_0001608 3300045049 Bacteria 13911
731 Ga0466959_0338922 3300045049 Bacteria 1026
732 Ga0466958_0090934 3300045836 Bacteria 1889
733 Ga0495590_0001849 3300046457 Bacteria 8955
734 Ga0495638_0015464 3300046460 Bacteria 5123
735 Ga0495638_0321160 3300046460 Bacteria 827
736 Ga0495580_0002794 3300046472 Bacteria 15019
737 Ga0495616_0006441 3300046513 Bacteria 7097
738 Ga0495616_0058498 3300046513 Bacteria 1898
739 Ga0495630_0044191 3300046517 Bacteria 3329
740 Ga0495632_0061959 3300046519 Bacteria 1814
741 Ga0495632_0186105 3300046519 Bacteria 950
742 Ga0495644_0086341 3300046523 Bacteria 1183
743 Ga0495587_0057280 3300046536 Bacteria 2292
744 Ga0495668_0310580 3300046616 Bacteria 865
745 Ga0495634_0201614 3300046642 Bacteria 1236
746 Ga0495625_0101221 3300046660 Bacteria 1979
747 Ga0495647_0000569 3300046681 Bacteria 10891
748 Ga0495647_0042301 3300046681 Bacteria 1739
749 Ga0495658_0104373 3300046683 Bacteria 1696
750 Ga0495658_0197517 3300046683 Bacteria 1253
751 Ga0495669_0087440 3300046684 Bacteria 1436
752 Ga0495669_0133375 3300046684 Bacteria 1170
753 Ga0495600_0167815 3300046809 Bacteria 1418
754 Ga0495581_0341442 3300047315 Bacteria 874
755 Ga0495674_0459910 3300047319 Bacteria 1022
756 Ga0495687_032802 3300047443 Bacteria 2365
757 Ga0495687_057296 3300047443 Bacteria 1621
758 Ga0495602_0087833 3300048088 Bacteria 2590
759 Ga0496100_0021760 3300048903 Bacteria 3869
760 Ga0496100_0045455 3300048903 Bacteria 2818
761 Ga0496101_0300785 3300048904 Bacteria 1256
762 Ga0496102_0005483 3300048905 Bacteria 10766
763 Ga0496102_0057549 3300048905 Bacteria 3550
764 Ga0496102_0170300 3300048905 Bacteria 2050
765 Ga0496103_0056956 3300048906 Bacteria 2427
766 Ga0496103_0105197 3300048906 Bacteria 1789
767 Ga0496104_0000384 3300048907 Bacteria 38678
768 Ga0496104_0014083 3300048907 Bacteria 7218
769 Ga0496104_0161086 3300048907 Bacteria 2152
770 Ga0496104_0471642 3300048907 Bacteria 1166
771 Ga0496105_0007758 3300048908 Bacteria 8327
772 Ga0496105_0020969 3300048908 Bacteria 5285
773 Ga0496105_0634819 3300048908 Bacteria 825
774 Ga0496106_0003443 3300048909 Bacteria 11792
775 Ga0496108_0014413 3300048911 Bacteria 6454
776 Ga0496108_0039863 3300048911 Bacteria 3915
777 Ga0496109_0012359 3300048912 Bacteria 7371
778 Ga0496109_0015937 3300048912 Bacteria 6565
779 Ga0496109_0399823 3300048912 Unclassified 1298
780 Ga0496110_0000305 3300048913 Bacteria 32413
781 Ga0496111_0040202 3300048914 Bacteria 3354
782 Ga0496111_0060107 3300048914 Bacteria 2754
783 Ga0496112_0082332 3300048915 Bacteria 3183
784 Ga0496112_0156128 3300048915 Bacteria 2249
785 Ga0496112_0329744 3300048915 Unclassified 1470
786 Ga0496113_0095889 3300048916 Bacteria 2293
787 Ga0496114_0002619 3300048917 Bacteria 13729
788 Ga0496114_0012105 3300048917 Bacteria 6904
789 Ga0496114_0016037 3300048917 Bacteria 6028
790 Ga0496114_0255037 3300048917 Bacteria 1544
791 Ga0496115_0029559 3300048918 Bacteria 4304
792 Ga0496115_0113373 3300048918 Bacteria 2228
793 Ga0496115_0193080 3300048918 Bacteria 1682
794 Ga0496116_0052603 3300048919 Bacteria 2697
795 Ga0496117_0000156 3300048920 Bacteria 145285
796 Ga0496118_0000005 3300048921 Bacteria 697350
797 Ga0496118_0077926 3300048921 Bacteria 2348
798 Ga0496119_0003677 3300048922 Bacteria 15729
799 Ga0496119_0013116 3300048922 Bacteria 6637
800 Ga0496120_0000173 3300048923 Bacteria 109909
801 Ga0496120_0109581 3300048923 Bacteria 1444
802 Ga0496121_0000371 3300048924 Bacteria 92354
803 Ga0496121_0078632 3300048924 Bacteria 2621
804 Ga0496124_0147290 3300048927 Bacteria 1851
805 Ga0496125_0000918 3300048928 Bacteria 46373
806 Ga0496125_0003733 3300048928 Bacteria 18142
807 Ga0496125_0033402 3300048928 Bacteria 4553
808 Ga0496125_0064565 3300048928 Bacteria 2908
809 Ga0496126_0002970 3300048929 Bacteria 22024
810 Ga0496126_0026348 3300048929 Bacteria 5576
811 Ga0496126_0164842 3300048929 Bacteria 1892
812 Ga0496126_0220917 3300048929 Bacteria 1591
813 Ga0495678_074582 3300049459 Bacteria 1234
814 Ga0501031_0285158 3300049568 Bacteria 1071
815 Ga0501034_0366114 3300049571 Bacteria 1368
816 Ga0501036_0030406 3300049572 Bacteria 4562
817 Ga0501036_0066537 3300049572 Bacteria 3049
818 Ga0501036_0085648 3300049572 Bacteria 2664
819 Ga0501039_0065775 3300049575 Bacteria 2813
820 Ga0501039_0082112 3300049575 Bacteria 2509
821 Ga0501039_0100112 3300049575 Bacteria 2262
822 Ga0501039_0265762 3300049575 Bacteria 1348
823 Ga0501040_0029617 3300049576 Bacteria 3697
824 Ga0501040_0052546 3300049576 Bacteria 2789
825 Ga0501041_0001021 3300049577 Bacteria 15302
826 Ga0501041_0022279 3300049577 Bacteria 3792
827 Ga0501041_0032386 3300049577 Bacteria 3160
828 Ga0501041_0063684 3300049577 Bacteria 2258
829 Ga0501042_0013426 3300049578 Bacteria 5574
830 Ga0501042_0017774 3300049578 Bacteria 4910
831 Ga0501042_0051784 3300049578 Bacteria 2928
832 Ga0501048_0041720 3300049582 Bacteria 3286
833 Ga0501048_0062614 3300049582 Bacteria 2633
834 Ga0501068_0000431 3300049584 Bacteria 21314
835 Ga0501068_0000509 3300049584 Bacteria 19755
836 Ga0501068_0039227 3300049584 Bacteria 2840
837 Ga0501069_0253874 3300049585 Bacteria 1026
838 Ga0501070_0177793 3300049586 Bacteria 1752
839 Ga0501071_0004141 3300049587 Bacteria 9167
840 Ga0501071_0127666 3300049587 Bacteria 1888
841 Ga0501071_0129094 3300049587 Bacteria 1877
842 Ga0501071_0142169 3300049587 Bacteria 1787
843 Ga0501071_0209744 3300049587 Bacteria 1464
844 Ga0501072_0033214 3300049588 Bacteria 4043
845 Ga0501072_0197181 3300049588 Bacteria 1605
846 Ga0501073_0000354 3300049589 Bacteria 30944
847 Ga0501073_0002948 3300049589 Bacteria 12757
848 Ga0501073_0024753 3300049589 Bacteria 4309
849 Ga0501073_0086766 3300049589 Bacteria 2177
850 Ga0501073_0196038 3300049589 Bacteria 1397
851 Ga0501073_0228288 3300049589 Bacteria 1286
852 Ga0501074_0000312 3300049590 Bacteria 28193
853 Ga0501074_0024638 3300049590 Bacteria 4371
854 Ga0501074_0348418 3300049590 Bacteria 1051
855 Ga0501074_0621154 3300049590 Bacteria 764
856 Ga0501075_0005964 3300049591 Bacteria 8340
857 Ga0501075_0422032 3300049591 Bacteria 1017
858 Ga0501075_0425507 3300049591 Bacteria 1012
859 Ga0501076_0004420 3300049592 Bacteria 9993
860 Ga0501076_0047971 3300049592 Bacteria 3377
861 Ga0501076_0122604 3300049592 Bacteria 2105
862 Ga0501076_0207484 3300049592 Bacteria 1601
863 Ga0501077_0000763 3300049593 Bacteria 19440
864 Ga0501077_0016718 3300049593 Bacteria 4626
865 Ga0501077_0034724 3300049593 Bacteria 3210
866 Ga0501077_0035885 3300049593 Bacteria 3157
867 Ga0501077_0067830 3300049593 Bacteria 2262
868 Ga0501079_0000416 3300049741 Bacteria 27691
869 Ga0501079_0023458 3300049741 Bacteria 4734
870 Ga0501079_0038892 3300049741 Bacteria 3669
871 Ga0501079_0049616 3300049741 Bacteria 3239
872 Ga0501080_0000288 3300049742 Bacteria 38150
873 Ga0501080_0032384 3300049742 Bacteria 4875
874 Ga0501080_0213526 3300049742 Bacteria 1768
875 Ga0501080_0263409 3300049742 Bacteria 1570
876 Ga0501080_0264558 3300049742 Bacteria 1566
877 Ga0501080_0495604 3300049742 Bacteria 1092
878 Ga0501081_0002528 3300049743 Bacteria 11534
879 Ga0501081_0021643 3300049743 Bacteria 4292
880 Ga0501081_0068931 3300049743 Bacteria 2463
881 Ga0501081_0266500 3300049743 Bacteria 1252
882 Ga0501081_0726194 3300049743 Bacteria 746
883 Ga0501083_0012208 3300049744 Bacteria 6012
884 Ga0501083_0030576 3300049744 Bacteria 3699
885 Ga0501083_0363110 3300049744 Bacteria 941
886 Ga0501035_0252243 3300049822 Bacteria 1498
887 Ga0501035_0444927 3300049822 Bacteria 1073
888 Ga0501044_0359580 3300049823 Bacteria 1374
889 Ga0501045_0011647 3300049824 Bacteria 6176
890 Ga0501045_0038111 3300049824 Bacteria 3496
891 nmdc:mga05p37_73917_c1 3300050507 Bacteria 4195
892 nmdc:mga06r32_207886_c1 3300050510 Bacteria 1945
893 nmdc:mga06r32_928150_c1 3300050510 Bacteria 826
894 nmdc:mga08y16_25639_c1 3300050511 Bacteria 6221
895 nmdc:mga0n895_31803_c1 3300050512 Bacteria 5057
896 nmdc:mga0n895_334905_c1 3300050512 Unclassified 1533
897 nmdc:mga0rr50_64479_c1 3300050513 Bacteria 2771
898 nmdc:mga0a205_83782_c1 3300050515 Bacteria 3080
899 Ga0500583_0050881 3300053092 Bacteria 1923
900 Ga0500651_0237921 3300053093 Bacteria 1063
901 Ga0500650_0217867 3300053098 Bacteria 865
902 Ga0500556_0000832 3300053104 Bacteria 17702
903 Ga0500572_084023 3300053111 Bacteria 1001
904 Ga0500595_013047 3300053119 Bacteria 3192
905 Ga0500617_115863 3300053124 Bacteria 1113
906 Ga0500642_0085015 3300053130 Bacteria 1458
907 Ga0500658_0050308 3300053134 Bacteria 1700
908 Ga0500559_0097151 3300053136 Bacteria 1354
909 Ga0500588_0008772 3300053146 Bacteria 2376
910 Ga0500616_0000032 3300053153 Bacteria 403673
911 Ga0500637_0094930 3300053178 Bacteria 1728
912 Ga0500637_0248420 3300053178 Bacteria 993
913 Ga0500656_003982 3300053732 Bacteria 1408
914 Ga0501084_0003146 3300054114 Bacteria 13347
915 Ga0501084_0011147 3300054114 Bacteria 7447
916 Ga0501084_0140951 3300054114 Bacteria 2030
917 Ga0501084_0411268 3300054114 Bacteria 1143
918 Ga0501082_0007253 3300060353 Bacteria 9562
919 Ga0501082_0011156 3300060353 Bacteria 7725
920 Ga0501082_0043748 3300060353 Bacteria 3863
921 Ga0501082_0087751 3300060353 Bacteria 2684
922 Ga0501082_0096568 3300060353 Bacteria 2555
923 Ga0501082_0361114 3300060353 Bacteria 1267
924 Ga0501082_0393002 3300060353 Bacteria 1210
925 Ga0466962_0000274 3300061719 Bacteria 21720
926 Ga0530510_0058651 3300061734 Bacteria 2784
927 Ga0530510_0098454 3300061734 Bacteria 2138
928 Ga0530510_0139126 3300061734 Bacteria 1788
929 Ga0209983_1047248
930 LJNas_1006710
931 JGI25406J46586_10018088
932 JGI25405J52794_10043613
933 Ga0058863_11844869
934 Ga0058862_12269979
935 Ga0065707_10081860
936 Ga0070676_10087705
937 Ga0070683_100046808
938 Ga0070683_100620753
939 Ga0070690_100000080
940 Ga0070690_100031279
941 Ga0070690_100080282
942 Ga0070690_100104574
943 Ga0070670_100105025
944 Ga0070670_100271138
945 Ga0070677_10106392
946 Ga0068869_100003796
947 Ga0068869_100092370
948 Ga0068869_100110673
949 Ga0068869_100126351
950 Ga0068869_100173890
951 Ga0068869_100367538
952 Ga0070666_10002263
953 Ga0070666_10017354
954 Ga0070666_10036532
955 Ga0070666_10040441
956 Ga0070666_10117184
957 Ga0070680_100004584
958 Ga0070680_100018917
959 Ga0070680_100035070
960 Ga0070680_100254255
961 Ga0070680_100540353
962 Ga0070682_100002647
963 Ga0070682_100148739
964 Ga0070682_100175204
965 Ga0068868_100012821
966 Ga0068868_100022904
967 Ga0068868_100090622
968 Ga0068868_100220621
969 Ga0070660_100492125
970 Ga0070689_100002723
971 Ga0070689_100033954
972 Ga0070689_100234357
973 Ga0070691_10028184
974 Ga0070661_100199867
975 Ga0070668_100215334
976 Ga0070669_100085574
977 Ga0070675_100176608
978 Ga0070675_100216685
979 Ga0070675_100234591
980 Ga0070675_100294295
981 Ga0070671_100002412
982 Ga0070671_100014343
983 Ga0070671_100089766
984 Ga0070671_100159722
985 Ga0070674_100071717
986 Ga0070674_100578820
987 Ga0070673_100528229
988 Ga0070673_100859055
989 Ga0070659_100022764
990 Ga0070667_100000212
991 Ga0070667_100001034
992 Ga0070667_100001547
993 Ga0070709_10017438
994 Ga0070709_10080581
995 Ga0070714_100090501
996 Ga0070714_100277381
997 Ga0070714_100312443
998 Ga0070713_100005361
999 Ga0070713_100007460
1000 Ga0070713_100105178
1001 Ga0070713_100349366
1002 Ga0070713_100439365
1003 Ga0070701_10001290
1004 Ga0070701_10005928
1005 Ga0070711_100007331
1006 Ga0070711_100059149
1007 Ga0070711_100099637
1008 Ga0070705_100043457
1009 Ga0070705_100110172
1010 Ga0070705_100389691
1011 Ga0070705_100503143
1012 Ga0070700_100000310
1013 Ga0070700_100001892
1014 Ga0070700_100019535
1015 Ga0070694_100037120
1016 Ga0070694_100254726
1017 Ga0070663_100108874
1018 Ga0070663_100509209
1019 Ga0070678_100004558
1020 Ga0070678_100009811
1021 Ga0070678_100242060
1022 Ga0070678_100450708
1023 Ga0070662_100422678
1024 Ga0070681_10000723
1025 Ga0070681_10009084
1026 Ga0070681_10017799
1027 Ga0070681_10023992
1028 Ga0070681_10030007
1029 Ga0070681_10049706
1030 Ga0070681_10365804
1031 Ga0070681_10454721
1032 Ga0068867_100001409
1033 Ga0068867_100060084
1034 Ga0068867_100061504
1035 Ga0070685_10039970
1036 Ga0070685_10087509
1037 Ga0070699_100065394
1038 Ga0070679_100014468
1039 Ga0070679_100074825
1040 Ga0070684_100044338
1041 Ga0068853_100007535
1042 Ga0068853_100204285
1043 Ga0068853_100210427
1044 Ga0070672_100048889
1045 Ga0070672_100058788
1046 Ga0070672_100167044
1047 Ga0070672_100376259
1048 Ga0070672_100699371
1049 Ga0070686_100000934
1050 Ga0070695_100003973
1051 Ga0070695_100004523
1052 Ga0070695_100164279
1053 Ga0070696_100000163
1054 Ga0070665_100004229
1055 Ga0070665_100005913
1056 Ga0070665_100017225
1057 Ga0070665_100018843
1058 Ga0070665_100036349
1059 Ga0070665_100086029
1060 Ga0070665_100093836
1061 Ga0070665_100103073
1062 Ga0070665_100108173
1063 Ga0070665_100166711
1064 Ga0070665_100184669
1065 Ga0070704_100013120
1066 Ga0070704_100027068
1067 Ga0070704_100079907
1068 Ga0068855_100018297
1069 Ga0068855_100021622
1070 Ga0068855_100347336
1071 Ga0068855_100409398
1072 Ga0068855_100570491
1073 Ga0070664_100031193
1074 Ga0070664_100066064
1075 Ga0070664_100125654
1076 Ga0068857_100026685
1077 Ga0068854_100138699
1078 Ga0068854_100209995
1079 Ga0068854_100412130
1080 Ga0068856_100015128
1081 Ga0068856_100834985
1082 Ga0070702_100000571
1083 Ga0070702_100000861
1084 Ga0070702_100134904
1085 Ga0070702_100135213
1086 Ga0068852_100710185
1087 Ga0068859_100000843
1088 Ga0068859_100003716
1089 Ga0068859_100008293
1090 Ga0068859_100038840
1091 Ga0068859_100067370
1092 Ga0068859_100098708
1093 Ga0068859_100112089
1094 Ga0068859_100160418
1095 Ga0068859_100221675
1096 Ga0068859_100421147
1097 Ga0068859_100674418
1098 Ga0068864_100084083
1099 Ga0068864_100180259
1100 Ga0068864_100216729
1101 Ga0068866_10002896
1102 Ga0068866_10009953
1103 Ga0068861_100003204
1104 Ga0068861_100015315
1105 Ga0068861_100052725
1106 Ga0068861_100182788
1107 Ga0068861_100233996
1108 Ga0068851_10087029
1109 Ga0068851_10188349
1110 Ga0068870_10262942
1111 Ga0068863_100008570
1112 Ga0068863_100010255
1113 Ga0068863_100023537
1114 Ga0068863_100024412
1115 Ga0068863_100062072
1116 Ga0068863_100086378
1117 Ga0068863_100109205
1118 Ga0068863_100134057
1119 Ga0068863_100435667
1120 Ga0068858_100004273
1121 Ga0068858_100006044
1122 Ga0068858_100009698
1123 Ga0068858_100026224
1124 Ga0068858_100032532
1125 Ga0068858_100033444
1126 Ga0068858_100205891
1127 Ga0068858_100808390
1128 Ga0068860_100001786
1129 Ga0068860_100008176
1130 Ga0068860_100010532
1131 Ga0068860_100030017
1132 Ga0068860_100081466
1133 Ga0068862_100003200
1134 Ga0068862_100003815
1135 Ga0068862_100072225
1136 Ga0081455_10000999
1137 Ga0081539_10000004
1138 Ga0081539_10000455
1139 Ga0070717_10004905
1140 Ga0070715_10005326
1141 Ga0070715_10113630
1142 Ga0070716_100005267
1143 Ga0070716_100013576
1144 Ga0070716_100157021
1145 Ga0070712_100040876
1146 Ga0070712_100054978
1147 Ga0097621_100000834
1148 Ga0097621_100001687
1149 Ga0097621_100009855
1150 Ga0097621_100062041
1151 Ga0097621_100240798
1152 Ga0097621_100532496
1153 Ga0097621_100847737
1154 Ga0068871_100001505
1155 Ga0068871_100004973
1156 Ga0068871_100009699
1157 Ga0068871_100016558
1158 Ga0068871_100018232
1159 Ga0068871_100042270
1160 Ga0075428_100003524
1161 Ga0075428_100556411
1162 Ga0075431_100325947
1163 Ga0075431_100953951
1164 Ga0075433_10000324
1165 Ga0075434_100138051
1166 Ga0075434_100342418
1167 Ga0068865_100009318
1168 Ga0068865_100031899
1169 Ga0068865_100062176
1170 Ga0068865_100125545
1171 Ga0068865_100280821
1172 Ga0097620_100000843
1173 Ga0097620_100003716
1174 Ga0097620_100008293
1175 Ga0097620_100038840
1176 Ga0097620_100067371
1177 Ga0097620_100098708
1178 Ga0097620_100112086
1179 Ga0097620_100119606
1180 Ga0097620_100160418
1181 Ga0097620_100221680
1182 Ga0097620_100421146
1183 Ga0097620_100674510
1184 Ga0075435_100050136
1185 Ga0099795_10000003
1186 Ga0099795_10006725
1187 Ga0105240_10011415
1188 Ga0105240_10023413
1189 Ga0105240_10051530
1190 Ga0105240_10052801
1191 Ga0105240_10057947
1192 Ga0105240_10097032
1193 Ga0105240_10147351
1194 Ga0105240_10182115
1195 Ga0105240_10210473
1196 Ga0105240_10213605
1197 Ga0105240_10579087
1198 Ga0111539_10019535
1199 Ga0111539_10056169
1200 Ga0111539_10245427
1201 Ga0105245_10000241
1202 Ga0105245_10014455
1203 Ga0105245_10039613
1204 Ga0105245_10043198
1205 Ga0105245_10319439
1206 Ga0105245_10595095
1207 Ga0105247_10001407
1208 Ga0105247_10015485
1209 Ga0105247_10026852
1210 Ga0114129_10099698
1211 Ga0114129_10272047
1212 Ga0105243_10000390
1213 Ga0105243_10081924
1214 Ga0105243_10116369
1215 Ga0105243_10713913
1216 Ga0105241_10011725
1217 Ga0105241_10050729
1218 Ga0105241_10050819
1219 Ga0105241_10361460
1220 Ga0105242_10000924
1221 Ga0105242_10006806
1222 Ga0105242_10009861
1223 Ga0105242_10031598
1224 Ga0105242_10200366
1225 Ga0105242_10266785
1226 Ga0105248_10007003
1227 Ga0105248_10010587
1228 Ga0105248_10068368
1229 Ga0105248_10070832
1230 Ga0105248_10120087
1231 Ga0105248_10161570
1232 Ga0105248_10235155
1233 Ga0105237_10016488
1234 Ga0105237_10022706
1235 Ga0105237_10050540
1236 Ga0105237_10097015
1237 Ga0105237_10122318
1238 Ga0105237_10160502
1239 Ga0105237_10179483
1240 Ga0105237_10499523
1241 Ga0105237_10733782
1242 Ga0105238_10032211
1243 Ga0105238_10053847
1244 Ga0105238_10117391
1245 Ga0105238_10128703
1246 Ga0105238_10625608
1247 Ga0105238_10908709
1248 Ga0105249_10008116
1249 Ga0105249_10014594
1250 Ga0105249_10058567
1251 Ga0105249_10105747
1252 Ga0105249_10343826
1253 Ga0105249_10417725
1254 Ga0105249_10660151
1255 Ga0105249_10773883
1256 Ga0099796_10000041
1257 Ga0099796_10006731
1258 Ga0105239_10017634
1259 Ga0105239_10048689
1260 Ga0105239_10518644
1261 Ga0105239_10522977
1262 Ga0105239_10567294
1263 Ga0105246_10811819
1264 Ga0157370_10020459
1265 Ga0157369_10087862
1266 Ga0157369_10699858
1267 Ga0157374_10023438
1268 Ga0157374_10040531
1269 Ga0157374_10052976
1270 Ga0157374_10054379
1271 Ga0157374_10114852
1272 Ga0157374_10649025
1273 Ga0157378_10000691
1274 Ga0157378_10109872
1275 Ga0157378_10118670
1276 Ga0157378_10227812
1277 Ga0163162_10012692
1278 Ga0163162_10383906
1279 Ga0163162_10505193
1280 Ga0163162_10840748
1281 Ga0157372_10101891
1282 Ga0157372_10212833
1283 Ga0157372_10746802
1284 Ga0157375_10004334
1285 Ga0157375_10053894
1286 Ga0157375_10065624
1287 Ga0157375_10157794
1288 Ga0157375_10377945
1289 Ga0163163_10004906
1290 Ga0163163_10094226
1291 Ga0163163_10128994
1292 Ga0163163_10317545
1293 Ga0163163_10360591
1294 Ga0163163_10876396
1295 Ga0157380_10004018
1296 Ga0157380_10018655
1297 Ga0157380_10060834
1298 Ga0157380_10172802
1299 Ga0157380_10182357
1300 Ga0157377_10096364
1301 Ga0157377_10367048
1302 Ga0157379_10000686
1303 Ga0157379_10010622
1304 Ga0157379_10019884
1305 Ga0157379_10032813
1306 Ga0157379_10049209
1307 Ga0157379_10060447
1308 Ga0157376_10001295
1309 Ga0157376_10023533
1310 Ga0157376_10244311
1311 Ga0213876_10041849
1312 Ga0213876_10102416
1313 Ga0213871_10027669
1314 Ga0207656_10203620
1315 Ga0207682_10043209
1316 Ga0207642_10006290
1317 Ga0207642_10037151
1318 Ga0207642_10151652
1319 Ga0207710_10000254
1320 Ga0207710_10038731
1321 Ga0207710_10097359
1322 Ga0207688_10042071
1323 Ga0207680_10009095
1324 Ga0207680_10020199
1325 Ga0207680_10132660
1326 Ga0207685_10081513
1327 Ga0207699_10047758
1328 Ga0207699_10516279
1329 Ga0207643_10175154
1330 Ga0207643_10242879
1331 Ga0207707_10002687
1332 Ga0207707_10003643
1333 Ga0207707_10007933
1334 Ga0207707_10015246
1335 Ga0207707_10037249
1336 Ga0207707_10044100
1337 Ga0207707_10065169
1338 Ga0207695_10011439
1339 Ga0207695_10022627
1340 Ga0207695_10026932
1341 Ga0207695_10034621
1342 Ga0207695_10057119
1343 Ga0207695_10106855
1344 Ga0207695_10114790
1345 Ga0207695_10155161
1346 Ga0207695_10181217
1347 Ga0207695_10239941
1348 Ga0207695_10398930
1349 Ga0207671_10013547
1350 Ga0207671_10085239
1351 Ga0207671_10159585
1352 Ga0207671_10209065
1353 Ga0207693_10001960
1354 Ga0207693_10025310
1355 Ga0207693_10109947
1356 Ga0207663_10010099
1357 Ga0207663_10022025
1358 Ga0207663_10123191
1359 Ga0207660_10044651
1360 Ga0207660_10243009
1361 Ga0207662_10199413
1362 Ga0207652_10001709
1363 Ga0207652_10028327
1364 Ga0207652_10153571
1365 Ga0207681_10373286
1366 Ga0207694_10090625
1367 Ga0207694_10118005
1368 Ga0207694_10138988
1369 Ga0207694_10185523
1370 Ga0207694_10442269
1371 Ga0207694_10445533
1372 Ga0207650_10120861
1373 Ga0207659_10128349
1374 Ga0207659_10129183
1375 Ga0207659_10164117
1376 Ga0207687_10000799
1377 Ga0207687_10500948
1378 Ga0207700_10117537
1379 Ga0207700_10140737
1380 Ga0207664_10065833
1381 Ga0207644_10002165
1382 Ga0207644_10040094
1383 Ga0207644_10082590
1384 Ga0207690_10219530
1385 Ga0207706_10228197
1386 Ga0207706_10456286
1387 Ga0207686_10004205
1388 Ga0207686_10044281
1389 Ga0207686_10116623
1390 Ga0207686_10220013
1391 Ga0207709_10011405
1392 Ga0207709_10104822
1393 Ga0207670_10015764
1394 Ga0207670_10032804
1395 Ga0207670_10137220
1396 Ga0207669_10240988
1397 Ga0207669_10349811
1398 Ga0207669_10652270
1399 Ga0207704_10019972
1400 Ga0207704_10088835
1401 Ga0207704_10103558
1402 Ga0207665_10002487
1403 Ga0207665_10020929
1404 Ga0207665_10519013
1405 Ga0207691_10180798
1406 Ga0207691_10462632
1407 Ga0207691_10782717
1408 Ga0207711_10004364
1409 Ga0207711_10054984
1410 Ga0207711_10158514
1411 Ga0207711_10451837
1412 Ga0207689_10000452
1413 Ga0207689_10000820
1414 Ga0207689_10012333
1415 Ga0207689_10061364
1416 Ga0207689_10118926
1417 Ga0207689_10305007
1418 Ga0207689_10403972
1419 Ga0207689_10546769
1420 Ga0207689_10629026
1421 Ga0207661_10061726
1422 Ga0207661_10548020
1423 Ga0207679_10051005
1424 Ga0207679_10237496
1425 Ga0207667_10014281
1426 Ga0207667_10016556
1427 Ga0207667_10049000
1428 Ga0207667_10246814
1429 Ga0207667_10507353
1430 Ga0207651_10212160
1431 Ga0207651_10273061
1432 Ga0207651_10419508
1433 Ga0207712_10036268
1434 Ga0207712_10362992
1435 Ga0207712_10432482
1436 Ga0207668_10405728
1437 Ga0207640_10752712
1438 Ga0207658_10000161
1439 Ga0207658_10014587
1440 Ga0207658_10095196
1441 Ga0207658_10153020
1442 Ga0207658_10224081
1443 Ga0207677_10019760
1444 Ga0207677_10234756
1445 Ga0207677_10335053
1446 Ga0207677_10396565
1447 Ga0207703_10000183
1448 Ga0207703_10003754
1449 Ga0207703_10028778
1450 Ga0207703_10037902
1451 Ga0207703_10055425
1452 Ga0207703_11042141
1453 Ga0207639_10160583
1454 Ga0207678_10113068
1455 Ga0207678_10132002
1456 Ga0207678_10166675
1457 Ga0207708_10000701
1458 Ga0207708_10001120
1459 Ga0207708_10029337
1460 Ga0207702_10133671
1461 Ga0207641_10003340
1462 Ga0207641_10019717
1463 Ga0207641_10025434
1464 Ga0207641_10127277
1465 Ga0207641_10156278
1466 Ga0207641_10341755
1467 Ga0207641_10383221
1468 Ga0207648_10000159
1469 Ga0207648_10029915
1470 Ga0207648_10717182
1471 Ga0207676_10080765
1472 Ga0207676_10174651
1473 Ga0207676_10442120
1474 Ga0207676_10662515
1475 Ga0207674_10007918
1476 Ga0207674_10700144
1477 Ga0207674_10919100
1478 Ga0207675_100000068
1479 Ga0207675_100027528
1480 Ga0207675_100084865
1481 Ga0207675_100130112
1482 Ga0207675_100133172
1483 Ga0207675_100134829
1484 Ga0207675_100270540
1485 Ga0207683_10003248
1486 Ga0207683_10013172
1487 Ga0207683_10110409
1488 Ga0207683_10141192
1489 Ga0207683_10344376
1490 Ga0207698_10590357
1491 Ga0209179_1000050
1492 Ga0209179_1025240
1493 Ga0207428_10010959
1494 Ga0265354_1001907
1495 Ga0265356_1000692
1496 Ga0265357_1008995
1497 Ga0265355_1000468
1498 Ga0268266_10003316
1499 Ga0268266_10003994
1500 Ga0268266_10023651
1501 Ga0268266_10025879
1502 Ga0268266_10033156
1503 Ga0268266_10036945
1504 Ga0268266_10047212
1505 Ga0268266_10135535
1506 Ga0268266_10176161
1507 Ga0268266_10186357
1508 Ga0268266_10217385
1509 Ga0268265_10004185
1510 Ga0268265_10018361
1511 Ga0268264_10000057
1512 Ga0268264_10007801
1513 Ga0268264_10110767
1514 Ga0268264_10123709
1515 Ga0265326_10017517
1516 Ga0265319_1013375
1517 Ga0265319_1056620
1518 Ga0265334_10000857
1519 Ga0265334_10002212
1520 Ga0265318_10002664
1521 Ga0265318_10042664
1522 Ga0307515_10002761
1523 Ga0265338_10004528
1524 Ga0265338_10026969
1525 Ga0265338_10065785
1526 Ga0265338_10149536
1527 Ga0307511_10000342
1528 Ga0307511_10009381
1529 Ga0265760_10000114
1530 Ga0265760_10038943
1531 Ga0265330_10009844
1532 Ga0265330_10022236
1533 Ga0265332_10009238
1534 Ga0265328_10016712
1535 Ga0265328_10059949
1536 Ga0265320_10003107
1537 Ga0265320_10022086
1538 Ga0265325_10031059
1539 Ga0265329_10025430
1540 Ga0265329_10042006
1541 Ga0265340_10022248
1542 Ga0265340_10031844
1543 Ga0265340_10061435
1544 Ga0265340_10068498
1545 Ga0265339_10039584
1546 Ga0265339_10045506
1547 Ga0265339_10095696
1548 Ga0265331_10011650
1549 Ga0265331_10019927
1550 Ga0265316_10023141
1551 Ga0307513_10021506
1552 Ga0307509_10115911
1553 Ga0307509_10271312
1554 Ga0307509_10462900
1555 Ga0307408_100247801
1556 Ga0307408_100275651
1557 Ga0265313_10016630
1558 Ga0265313_10017082
1559 Ga0265313_10053240
1560 Ga0316575_10035881
1561 Ga0265314_10006771
1562 Ga0265314_10144520
1563 Ga0265342_10043449
1564 Ga0265342_10123029
1565 Ga0316576_10012885
1566 Ga0316576_10178428
1567 Ga0316577_10135795
1568 Ga0307413_10048731
1569 Ga0307413_10590288
1570 Ga0307413_10806444
1571 Ga0307410_10003260
1572 Ga0307410_10016809
1573 Ga0307410_10048743
1574 Ga0307406_10048172
1575 Ga0307406_10079936
1576 Ga0307406_10206172
1577 Ga0307407_10371424
1578 Ga0307412_10122563
1579 Ga0307412_10299648
1580 Ga0307409_100001941
1581 Ga0307409_100307691
1582 Ga0307409_100338872
1583 Ga0307409_100391037
1584 Ga0307416_100018740
1585 Ga0307416_100108907
1586 Ga0307411_10000393
1587 Ga0307411_10002266
1588 Ga0307411_10045875
1589 Ga0307411_10763250
1590 Ga0307415_100005339
1591 Ga0307415_100035377
1592 Ga0307415_100189344
1593 Ga0307415_100347429
1594 Ga0307415_100458643
1595 Ga0307510_10000014
1596 Ga0307510_10151447
1597 Ga0373936_0006833
1598 Ga0373945_0039480
1599 Ga0373953_0129527
1600 Ga0373956_0283054
1601 Ga0373943_0035647
1602 Ga0373955_0029676
1603 Ga0373955_0030134
1604 Ga0373955_0354915
1605 Ga0316574_0084385
1606 Ga0373924_0107488
1607 Ga0373924_0140881
1608 Ga0373927_0044984
1609 Ga0373927_0433496
1610 Ga0373933_0113593
1611 Ga0373933_0158812
1612 Ga0373937_0003142
1613 Ga0373937_0205299
1614 Ga0373937_0246467
1615 Ga0373937_0773291
1616 Ga0373925_0007403
1617 Ga0395898_0013822
1618 Ga0395898_0061276
1619 Ga0395898_0438703
1620 Ga0436365_1867186
1621 Ga0436360_0672319
1622 Ga0436360_0674475
1623 Ga0436360_0822925
1624 Ga0436363_0487320
1625 Ga0436363_0731737
1626 Ga0436363_0829074
1627 Ga0436363_0951456
1628 Ga0436362_0298024
1629 Ga0436362_1062550
1630 Ga0451793_0109096
1631 Ga0451798_0977305
1632 Ga0451802_1913096
1633 Ga0451804_0964549
1634 Ga0451807_0912795
1635 Ga0451807_1119766
1636 Ga0451807_1884568
1637 Ga0439442_035348
1638 Ga0450919_013650
1639 Ga0450920_000747
1640 Ga0450923_004656
1641 Ga0450895_000370
1642 Ga0450907_002187
1643 Ga0439446_0018399
1644 Ga0450908_001358
1645 Ga0450908_002745
1646 Ga0439435_0001503
1647 Ga0450916_007558
1648 Ga0451577_0482104
1649 Ga0466969_0002463
1650 Ga0466969_0075929
1651 Ga0466966_0000445
1652 Ga0466961_0003001
1653 Ga0466964_0000891
1654 Ga0466971_0000422
1655 Ga0466970_0003326
1656 Ga0466957_0008510
1657 Ga0466959_0001134
1658 Ga0466959_0001608
1659 Ga0466959_0338922
1660 Ga0466958_0090934
1661 Ga0495590_0001849
1662 Ga0495638_0015464
1663 Ga0495638_0321160
1664 Ga0495580_0002794
1665 Ga0495616_0006441
1666 Ga0495616_0058498
1667 Ga0495630_0044191
1668 Ga0495632_0061959
1669 Ga0495632_0186105
1670 Ga0495644_0086341
1671 Ga0495587_0057280
1672 Ga0495668_0310580
1673 Ga0495634_0201614
1674 Ga0495625_0101221
1675 Ga0495647_0000569
1676 Ga0495647_0042301
1677 Ga0495658_0104373
1678 Ga0495658_0197517
1679 Ga0495669_0087440
1680 Ga0495669_0133375
1681 Ga0495600_0167815
1682 Ga0495581_0341442
1683 Ga0495674_0459910
1684 Ga0495687_032802
1685 Ga0495687_057296
1686 Ga0495602_0087833
1687 Ga0496100_0021760
1688 Ga0496100_0045455
1689 Ga0496101_0300785
1690 Ga0496102_0005483
1691 Ga0496102_0057549
1692 Ga0496102_0170300
1693 Ga0496103_0056956
1694 Ga0496103_0105197
1695 Ga0496104_0000384
1696 Ga0496104_0014083
1697 Ga0496104_0161086
1698 Ga0496104_0471642
1699 Ga0496105_0007758
1700 Ga0496105_0020969
1701 Ga0496105_0634819
1702 Ga0496106_0003443
1703 Ga0496108_0014413
1704 Ga0496108_0039863
1705 Ga0496109_0012359
1706 Ga0496109_0015937
1707 Ga0496109_0399823
1708 Ga0496110_0000305
1709 Ga0496111_0040202
1710 Ga0496111_0060107
1711 Ga0496112_0082332
1712 Ga0496112_0156128
1713 Ga0496112_0329744
1714 Ga0496113_0095889
1715 Ga0496114_0002619
1716 Ga0496114_0012105
1717 Ga0496114_0016037
1718 Ga0496114_0255037
1719 Ga0496115_0029559
1720 Ga0496115_0113373
1721 Ga0496115_0193080
1722 Ga0496116_0052603
1723 Ga0496117_0000156
1724 Ga0496118_0000005
1725 Ga0496118_0077926
1726 Ga0496119_0003677
1727 Ga0496119_0013116
1728 Ga0496120_0000173
1729 Ga0496120_0109581
1730 Ga0496121_0000371
1731 Ga0496121_0078632
1732 Ga0496124_0147290
1733 Ga0496125_0000918
1734 Ga0496125_0003733
1735 Ga0496125_0033402
1736 Ga0496125_0064565
1737 Ga0496126_0002970
1738 Ga0496126_0026348
1739 Ga0496126_0164842
1740 Ga0496126_0220917
1741 Ga0495678_074582
1742 Ga0501031_0285158
1743 Ga0501034_0366114
1744 Ga0501036_0030406
1745 Ga0501036_0066537
1746 Ga0501036_0085648
1747 Ga0501039_0065775
1748 Ga0501039_0082112
1749 Ga0501039_0100112
1750 Ga0501039_0265762
1751 Ga0501040_0029617
1752 Ga0501040_0052546
1753 Ga0501041_0001021
1754 Ga0501041_0022279
1755 Ga0501041_0032386
1756 Ga0501041_0063684
1757 Ga0501042_0013426
1758 Ga0501042_0017774
1759 Ga0501042_0051784
1760 Ga0501048_0041720
1761 Ga0501048_0062614
1762 Ga0501068_0000431
1763 Ga0501068_0000509
1764 Ga0501068_0039227
1765 Ga0501069_0253874
1766 Ga0501070_0177793
1767 Ga0501071_0004141
1768 Ga0501071_0127666
1769 Ga0501071_0129094
1770 Ga0501071_0142169
1771 Ga0501071_0209744
1772 Ga0501072_0033214
1773 Ga0501072_0197181
1774 Ga0501073_0000354
1775 Ga0501073_0002948
1776 Ga0501073_0024753
1777 Ga0501073_0086766
1778 Ga0501073_0196038
1779 Ga0501073_0228288
1780 Ga0501074_0000312
1781 Ga0501074_0024638
1782 Ga0501074_0348418
1783 Ga0501074_0621154
1784 Ga0501075_0005964
1785 Ga0501075_0422032
1786 Ga0501075_0425507
1787 Ga0501076_0004420
1788 Ga0501076_0047971
1789 Ga0501076_0122604
1790 Ga0501076_0207484
1791 Ga0501077_0000763
1792 Ga0501077_0016718
1793 Ga0501077_0034724
1794 Ga0501077_0035885
1795 Ga0501077_0067830
1796 Ga0501079_0000416
1797 Ga0501079_0023458
1798 Ga0501079_0038892
1799 Ga0501079_0049616
1800 Ga0501080_0000288
1801 Ga0501080_0032384
1802 Ga0501080_0213526
1803 Ga0501080_0263409
1804 Ga0501080_0264558
1805 Ga0501080_0495604
1806 Ga0501081_0002528
1807 Ga0501081_0021643
1808 Ga0501081_0068931
1809 Ga0501081_0266500
1810 Ga0501081_0726194
1811 Ga0501083_0012208
1812 Ga0501083_0030576
1813 Ga0501083_0363110
1814 Ga0501035_0252243
1815 Ga0501035_0444927
1816 Ga0501044_0359580
1817 Ga0501045_0011647
1818 Ga0501045_0038111
1819 nmdc:mga05p37_73917_c1
1820 nmdc:mga06r32_207886_c1
1821 nmdc:mga06r32_928150_c1
1822 nmdc:mga08y16_25639_c1
1823 nmdc:mga0n895_31803_c1
1824 nmdc:mga0n895_334905_c1
1825 nmdc:mga0rr50_64479_c1
1826 nmdc:mga0a205_83782_c1
1827 Ga0500583_0050881
1828 Ga0500651_0237921
1829 Ga0500650_0217867
1830 Ga0500556_0000832
1831 Ga0500572_084023
1832 Ga0500595_013047
1833 Ga0500617_115863
1834 Ga0500642_0085015
1835 Ga0500658_0050308
1836 Ga0500559_0097151
1837 Ga0500588_0008772
1838 Ga0500616_0000032
1839 Ga0500637_0094930
1840 Ga0500637_0248420
1841 Ga0500656_003982
1842 Ga0501084_0003146
1843 Ga0501084_0011147
1844 Ga0501084_0140951
1845 Ga0501084_0411268
1846 Ga0501082_0007253
1847 Ga0501082_0011156
1848 Ga0501082_0043748
1849 Ga0501082_0087751
1850 Ga0501082_0096568
1851 Ga0501082_0361114
1852 Ga0501082_0393002
1853 Ga0466962_0000274
1854 Ga0530510_0058651
1855 Ga0530510_0098454
1856 Ga0530510_0139126

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

25

113

0.96

PF01895

PhoU

PhoU domain

129

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.9769 14 221
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.9677 14 221
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9589 11 221
1sum-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.0 a resolution 0.9555 12 222
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.9426 14 223
ID Description Score Start End Superfamily
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9893 125 221 1.20.58.220
2i0mA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9812 14 116 1.20.58.220
4q25B02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9807 125 221 1.20.58.220
af_Q58415_1_113_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9723 13 115 1.20.58.220
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9694 125 221 1.20.58.220
ID Description Score Start End GO Terms
AF-T1BVD0-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9866 27 180 GO:0003677
GO:0003918
GO:0005524
GO:0006265
GO:0030643
GO:0045936
AF-A0A4Q3Y0K0-F1-model_v4 deleted 0.9805 1 195
AF-A0A4Y3T7V7-F1-model_v4 deleted 0.9804 14 225
AF-A0A101DJE4-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9798 14 225 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-A0A2D5QEV0-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9786 9 224 GO:0005737
GO:0006817
GO:0030643
GO:0045936

Map