F486387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 943 | 353 | 1856 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300027665|Ga0209983_1047248|Ga0209983_10472481 |
| Length | 284 |
| Sequence | MESTDISQHTSRRFNEDMERVTTRVMQMGGFVEQQLQRAVTALIEGNSSLGEEVARDDYRVNQMEVEIDEECGRIIATRQPTASDLRVMVAIIKTITDLERIGDEVEKVGYIAARLATMEKPSDNYREIRHLGRLVTEMVHDALHAYARLDADEAFEVARRDRKVDEEYEAIQRQNITFMMEDPRQIRRALEIMWVVRALERIGDHAKNICEYTVYMVHGKDIRHLSLDDAERQKLEFAAQEIIWNDAPWLYLWRLPSFFGLSKKLAYDFRADNYLEPYLITYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 176 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 177 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 178 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 189 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 242 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 243 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 246 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 249 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 250 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 343 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 4.88 |
| Rhizosphere | 89.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209983_1047248 | 3300027665 | Bacteria | 938 |
| 2 | LJNas_1006710 | 3300000546 | Bacteria | 1247 |
| 3 | JGI25406J46586_10018088 | 3300003203 | Bacteria | 2900 |
| 4 | JGI25405J52794_10043613 | 3300003911 | Bacteria | 952 |
| 5 | Ga0058863_11844869 | 3300004799 | Bacteria | 943 |
| 6 | Ga0058862_12269979 | 3300004803 | Bacteria | 1489 |
| 7 | Ga0065707_10081860 | 3300005295 | Bacteria | 33219 |
| 8 | Ga0070676_10087705 | 3300005328 | Bacteria | 1900 |
| 9 | Ga0070683_100046808 | 3300005329 | Bacteria | 3996 |
| 10 | Ga0070683_100620753 | 3300005329 | Bacteria | 1035 |
| 11 | Ga0070690_100000080 | 3300005330 | Bacteria | 46850 |
| 12 | Ga0070690_100031279 | 3300005330 | Bacteria | 3314 |
| 13 | Ga0070690_100080282 | 3300005330 | Bacteria | 2133 |
| 14 | Ga0070690_100104574 | 3300005330 | Bacteria | 1881 |
| 15 | Ga0070670_100105025 | 3300005331 | Bacteria | 2433 |
| 16 | Ga0070670_100271138 | 3300005331 | Bacteria | 1481 |
| 17 | Ga0070677_10106392 | 3300005333 | Bacteria | 1245 |
| 18 | Ga0068869_100003796 | 3300005334 | Bacteria | 9309 |
| 19 | Ga0068869_100092370 | 3300005334 | Bacteria | 2278 |
| 20 | Ga0068869_100110673 | 3300005334 | Bacteria | 2089 |
| 21 | Ga0068869_100126351 | 3300005334 | Bacteria | 1961 |
| 22 | Ga0068869_100173890 | 3300005334 | Bacteria | 1684 |
| 23 | Ga0068869_100367538 | 3300005334 | Bacteria | 1176 |
| 24 | Ga0070666_10002263 | 3300005335 | Bacteria | 11639 |
| 25 | Ga0070666_10017354 | 3300005335 | Bacteria | 4614 |
| 26 | Ga0070666_10036532 | 3300005335 | Bacteria | 3262 |
| 27 | Ga0070666_10040441 | 3300005335 | Bacteria | 3112 |
| 28 | Ga0070666_10117184 | 3300005335 | Bacteria | 1845 |
| 29 | Ga0070680_100004584 | 3300005336 | Bacteria | 10389 |
| 30 | Ga0070680_100018917 | 3300005336 | Bacteria | 5449 |
| 31 | Ga0070680_100035070 | 3300005336 | Bacteria | 4049 |
| 32 | Ga0070680_100254255 | 3300005336 | Bacteria | 1486 |
| 33 | Ga0070680_100540353 | 3300005336 | Bacteria | 998 |
| 34 | Ga0070682_100002647 | 3300005337 | Bacteria | 9897 |
| 35 | Ga0070682_100148739 | 3300005337 | Bacteria | 1604 |
| 36 | Ga0070682_100175204 | 3300005337 | Bacteria | 1494 |
| 37 | Ga0068868_100012821 | 3300005338 | Bacteria | 6132 |
| 38 | Ga0068868_100022904 | 3300005338 | Bacteria | 4722 |
| 39 | Ga0068868_100090622 | 3300005338 | Bacteria | 2463 |
| 40 | Ga0068868_100220621 | 3300005338 | Bacteria | 1587 |
| 41 | Ga0070660_100492125 | 3300005339 | Bacteria | 1020 |
| 42 | Ga0070689_100002723 | 3300005340 | Bacteria | 11584 |
| 43 | Ga0070689_100033954 | 3300005340 | Bacteria | 3891 |
| 44 | Ga0070689_100234357 | 3300005340 | Bacteria | 1510 |
| 45 | Ga0070691_10028184 | 3300005341 | Bacteria | 2623 |
| 46 | Ga0070661_100199867 | 3300005344 | Bacteria | 1527 |
| 47 | Ga0070668_100215334 | 3300005347 | Bacteria | 1582 |
| 48 | Ga0070669_100085574 | 3300005353 | Bacteria | 2354 |
| 49 | Ga0070675_100176608 | 3300005354 | Bacteria | 1845 |
| 50 | Ga0070675_100216685 | 3300005354 | Bacteria | 1666 |
| 51 | Ga0070675_100234591 | 3300005354 | Bacteria | 1601 |
| 52 | Ga0070675_100294295 | 3300005354 | Bacteria | 1429 |
| 53 | Ga0070671_100002412 | 3300005355 | Bacteria | 14445 |
| 54 | Ga0070671_100014343 | 3300005355 | Bacteria | 6402 |
| 55 | Ga0070671_100089766 | 3300005355 | Bacteria | 2573 |
| 56 | Ga0070671_100159722 | 3300005355 | Unclassified | 1905 |
| 57 | Ga0070674_100071717 | 3300005356 | Bacteria | 2451 |
| 58 | Ga0070674_100578820 | 3300005356 | Bacteria | 946 |
| 59 | Ga0070673_100528229 | 3300005364 | Bacteria | 1070 |
| 60 | Ga0070673_100859055 | 3300005364 | Bacteria | 840 |
| 61 | Ga0070659_100022764 | 3300005366 | Bacteria | 4787 |
| 62 | Ga0070667_100000212 | 3300005367 | Bacteria | 67792 |
| 63 | Ga0070667_100001034 | 3300005367 | Bacteria | 25405 |
| 64 | Ga0070667_100001547 | 3300005367 | Bacteria | 20612 |
| 65 | Ga0070709_10017438 | 3300005434 | Bacteria | 4119 |
| 66 | Ga0070709_10080581 | 3300005434 | Bacteria | 2123 |
| 67 | Ga0070714_100090501 | 3300005435 | Bacteria | 2680 |
| 68 | Ga0070714_100277381 | 3300005435 | Bacteria | 1556 |
| 69 | Ga0070714_100312443 | 3300005435 | Bacteria | 1468 |
| 70 | Ga0070713_100005361 | 3300005436 | Bacteria | 8759 |
| 71 | Ga0070713_100007460 | 3300005436 | Bacteria | 7681 |
| 72 | Ga0070713_100105178 | 3300005436 | Bacteria | 2451 |
| 73 | Ga0070713_100349366 | 3300005436 | Unclassified | 1372 |
| 74 | Ga0070713_100439365 | 3300005436 | Unclassified | 1224 |
| 75 | Ga0070701_10001290 | 3300005438 | Bacteria | 9205 |
| 76 | Ga0070701_10005928 | 3300005438 | Bacteria | 5100 |
| 77 | Ga0070711_100007331 | 3300005439 | Bacteria | 6711 |
| 78 | Ga0070711_100059149 | 3300005439 | Bacteria | 2659 |
| 79 | Ga0070711_100099637 | 3300005439 | Bacteria | 2112 |
| 80 | Ga0070705_100043457 | 3300005440 | Bacteria | 2575 |
| 81 | Ga0070705_100110172 | 3300005440 | Bacteria | 1757 |
| 82 | Ga0070705_100389691 | 3300005440 | Bacteria | 1028 |
| 83 | Ga0070705_100503143 | 3300005440 | Bacteria | 920 |
| 84 | Ga0070700_100000310 | 3300005441 | Bacteria | 25261 |
| 85 | Ga0070700_100001892 | 3300005441 | Bacteria | 10584 |
| 86 | Ga0070700_100019535 | 3300005441 | Bacteria | 3912 |
| 87 | Ga0070694_100037120 | 3300005444 | Bacteria | 3231 |
| 88 | Ga0070694_100254726 | 3300005444 | Bacteria | 1329 |
| 89 | Ga0070663_100108874 | 3300005455 | Bacteria | 2079 |
| 90 | Ga0070663_100509209 | 3300005455 | Bacteria | 1001 |
| 91 | Ga0070678_100004558 | 3300005456 | Bacteria | 7865 |
| 92 | Ga0070678_100009811 | 3300005456 | Bacteria | 5821 |
| 93 | Ga0070678_100242060 | 3300005456 | Bacteria | 1509 |
| 94 | Ga0070678_100450708 | 3300005456 | Bacteria | 1127 |
| 95 | Ga0070662_100422678 | 3300005457 | Bacteria | 1103 |
| 96 | Ga0070681_10000723 | 3300005458 | Bacteria | 27344 |
| 97 | Ga0070681_10009084 | 3300005458 | Bacteria | 9770 |
| 98 | Ga0070681_10017799 | 3300005458 | Bacteria | 7100 |
| 99 | Ga0070681_10023992 | 3300005458 | Bacteria | 6140 |
| 100 | Ga0070681_10030007 | 3300005458 | Bacteria | 5457 |
| 101 | Ga0070681_10049706 | 3300005458 | Bacteria | 4186 |
| 102 | Ga0070681_10365804 | 3300005458 | Bacteria | 1352 |
| 103 | Ga0070681_10454721 | 3300005458 | Bacteria | 1193 |
| 104 | Ga0068867_100001409 | 3300005459 | Bacteria | 16608 |
| 105 | Ga0068867_100060084 | 3300005459 | Bacteria | 2819 |
| 106 | Ga0068867_100061504 | 3300005459 | Bacteria | 2788 |
| 107 | Ga0070685_10039970 | 3300005466 | Bacteria | 2667 |
| 108 | Ga0070685_10087509 | 3300005466 | Bacteria | 1880 |
| 109 | Ga0070699_100065394 | 3300005518 | Bacteria | 3156 |
| 110 | Ga0070679_100014468 | 3300005530 | Bacteria | 7578 |
| 111 | Ga0070679_100074825 | 3300005530 | Bacteria | 3377 |
| 112 | Ga0070684_100044338 | 3300005535 | Bacteria | 3847 |
| 113 | Ga0068853_100007535 | 3300005539 | Bacteria | 8709 |
| 114 | Ga0068853_100204285 | 3300005539 | Bacteria | 1799 |
| 115 | Ga0068853_100210427 | 3300005539 | Bacteria | 1772 |
| 116 | Ga0070672_100048889 | 3300005543 | Bacteria | 3288 |
| 117 | Ga0070672_100058788 | 3300005543 | Bacteria | 3023 |
| 118 | Ga0070672_100167044 | 3300005543 | Bacteria | 1828 |
| 119 | Ga0070672_100376259 | 3300005543 | Bacteria | 1214 |
| 120 | Ga0070672_100699371 | 3300005543 | Bacteria | 888 |
| 121 | Ga0070686_100000934 | 3300005544 | Bacteria | 16821 |
| 122 | Ga0070695_100003973 | 3300005545 | Bacteria | 8637 |
| 123 | Ga0070695_100004523 | 3300005545 | Bacteria | 8164 |
| 124 | Ga0070695_100164279 | 3300005545 | Bacteria | 1561 |
| 125 | Ga0070696_100000163 | 3300005546 | Bacteria | 37742 |
| 126 | Ga0070665_100004229 | 3300005548 | Bacteria | 15109 |
| 127 | Ga0070665_100005913 | 3300005548 | Bacteria | 12535 |
| 128 | Ga0070665_100017225 | 3300005548 | Bacteria | 7251 |
| 129 | Ga0070665_100018843 | 3300005548 | Bacteria | 6919 |
| 130 | Ga0070665_100036349 | 3300005548 | Bacteria | 4954 |
| 131 | Ga0070665_100086029 | 3300005548 | Bacteria | 3150 |
| 132 | Ga0070665_100093836 | 3300005548 | Bacteria | 3006 |
| 133 | Ga0070665_100103073 | 3300005548 | Bacteria | 2857 |
| 134 | Ga0070665_100108173 | 3300005548 | Bacteria | 2783 |
| 135 | Ga0070665_100166711 | 3300005548 | Bacteria | 2205 |
| 136 | Ga0070665_100184669 | 3300005548 | Bacteria | 2086 |
| 137 | Ga0070704_100013120 | 3300005549 | Bacteria | 5132 |
| 138 | Ga0070704_100027068 | 3300005549 | Bacteria | 3797 |
| 139 | Ga0070704_100079907 | 3300005549 | Bacteria | 2404 |
| 140 | Ga0068855_100018297 | 3300005563 | Bacteria | 8417 |
| 141 | Ga0068855_100021622 | 3300005563 | Bacteria | 7716 |
| 142 | Ga0068855_100347336 | 3300005563 | Bacteria | 1635 |
| 143 | Ga0068855_100409398 | 3300005563 | Bacteria | 1485 |
| 144 | Ga0068855_100570491 | 3300005563 | Bacteria | 1223 |
| 145 | Ga0070664_100031193 | 3300005564 | Bacteria | 4451 |
| 146 | Ga0070664_100066064 | 3300005564 | Bacteria | 3088 |
| 147 | Ga0070664_100125654 | 3300005564 | Bacteria | 2250 |
| 148 | Ga0068857_100026685 | 3300005577 | Bacteria | 5091 |
| 149 | Ga0068854_100138699 | 3300005578 | Bacteria | 1864 |
| 150 | Ga0068854_100209995 | 3300005578 | Bacteria | 1535 |
| 151 | Ga0068854_100412130 | 3300005578 | Bacteria | 1120 |
| 152 | Ga0068856_100015128 | 3300005614 | Bacteria | 7453 |
| 153 | Ga0068856_100834985 | 3300005614 | Bacteria | 941 |
| 154 | Ga0070702_100000571 | 3300005615 | Bacteria | 13448 |
| 155 | Ga0070702_100000861 | 3300005615 | Bacteria | 11735 |
| 156 | Ga0070702_100134904 | 3300005615 | Bacteria | 1564 |
| 157 | Ga0070702_100135213 | 3300005615 | Bacteria | 1563 |
| 158 | Ga0068852_100710185 | 3300005616 | Bacteria | 1016 |
| 159 | Ga0068859_100000843 | 3300005617 | Bacteria | 31176 |
| 160 | Ga0068859_100003716 | 3300005617 | Bacteria | 15558 |
| 161 | Ga0068859_100008293 | 3300005617 | Bacteria | 10532 |
| 162 | Ga0068859_100038840 | 3300005617 | Bacteria | 4775 |
| 163 | Ga0068859_100067370 | 3300005617 | Bacteria | 3615 |
| 164 | Ga0068859_100098708 | 3300005617 | Bacteria | 2975 |
| 165 | Ga0068859_100112089 | 3300005617 | Bacteria | 2791 |
| 166 | Ga0068859_100160418 | 3300005617 | Bacteria | 2328 |
| 167 | Ga0068859_100221675 | 3300005617 | Bacteria | 1979 |
| 168 | Ga0068859_100421147 | 3300005617 | Bacteria | 1431 |
| 169 | Ga0068859_100674418 | 3300005617 | Bacteria | 1125 |
| 170 | Ga0068864_100084083 | 3300005618 | Bacteria | 2796 |
| 171 | Ga0068864_100180259 | 3300005618 | Bacteria | 1931 |
| 172 | Ga0068864_100216729 | 3300005618 | Unclassified | 1765 |
| 173 | Ga0068866_10002896 | 3300005718 | Bacteria | 7070 |
| 174 | Ga0068866_10009953 | 3300005718 | Bacteria | 4058 |
| 175 | Ga0068861_100003204 | 3300005719 | Bacteria | 10828 |
| 176 | Ga0068861_100015315 | 3300005719 | Bacteria | 5401 |
| 177 | Ga0068861_100052725 | 3300005719 | Bacteria | 3092 |
| 178 | Ga0068861_100182788 | 3300005719 | Bacteria | 1747 |
| 179 | Ga0068861_100233996 | 3300005719 | Bacteria | 1559 |
| 180 | Ga0068851_10087029 | 3300005834 | Bacteria | 1640 |
| 181 | Ga0068851_10188349 | 3300005834 | Bacteria | 1146 |
| 182 | Ga0068870_10262942 | 3300005840 | Bacteria | 1074 |
| 183 | Ga0068863_100008570 | 3300005841 | Bacteria | 9993 |
| 184 | Ga0068863_100010255 | 3300005841 | Bacteria | 9107 |
| 185 | Ga0068863_100023537 | 3300005841 | Bacteria | 5879 |
| 186 | Ga0068863_100024412 | 3300005841 | Bacteria | 5766 |
| 187 | Ga0068863_100062072 | 3300005841 | Bacteria | 3534 |
| 188 | Ga0068863_100086378 | 3300005841 | Bacteria | 2972 |
| 189 | Ga0068863_100109205 | 3300005841 | Bacteria | 2633 |
| 190 | Ga0068863_100134057 | 3300005841 | Bacteria | 2366 |
| 191 | Ga0068863_100435667 | 3300005841 | Bacteria | 1285 |
| 192 | Ga0068858_100004273 | 3300005842 | Bacteria | 14047 |
| 193 | Ga0068858_100006044 | 3300005842 | Bacteria | 11801 |
| 194 | Ga0068858_100009698 | 3300005842 | Bacteria | 9174 |
| 195 | Ga0068858_100026224 | 3300005842 | Bacteria | 5418 |
| 196 | Ga0068858_100032532 | 3300005842 | Bacteria | 4842 |
| 197 | Ga0068858_100033444 | 3300005842 | Bacteria | 4771 |
| 198 | Ga0068858_100205891 | 3300005842 | Bacteria | 1861 |
| 199 | Ga0068858_100808390 | 3300005842 | Bacteria | 915 |
| 200 | Ga0068860_100001786 | 3300005843 | Bacteria | 22899 |
| 201 | Ga0068860_100008176 | 3300005843 | Bacteria | 10414 |
| 202 | Ga0068860_100010532 | 3300005843 | Bacteria | 9135 |
| 203 | Ga0068860_100030017 | 3300005843 | Bacteria | 5228 |
| 204 | Ga0068860_100081466 | 3300005843 | Bacteria | 3078 |
| 205 | Ga0068862_100003200 | 3300005844 | Bacteria | 14186 |
| 206 | Ga0068862_100003815 | 3300005844 | Bacteria | 12836 |
| 207 | Ga0068862_100072225 | 3300005844 | Bacteria | 2980 |
| 208 | Ga0081455_10000999 | 3300005937 | Bacteria | 35875 |
| 209 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 210 | Ga0081539_10000455 | 3300005985 | Bacteria | 87222 |
| 211 | Ga0070717_10004905 | 3300006028 | Bacteria | 9732 |
| 212 | Ga0070715_10005326 | 3300006163 | Bacteria | 4284 |
| 213 | Ga0070715_10113630 | 3300006163 | Bacteria | 1281 |
| 214 | Ga0070716_100005267 | 3300006173 | Bacteria | 6252 |
| 215 | Ga0070716_100013576 | 3300006173 | Bacteria | 4155 |
| 216 | Ga0070716_100157021 | 3300006173 | Bacteria | 1470 |
| 217 | Ga0070712_100040876 | 3300006175 | Bacteria | 3181 |
| 218 | Ga0070712_100054978 | 3300006175 | Bacteria | 2785 |
| 219 | Ga0097621_100000834 | 3300006237 | Bacteria | 21739 |
| 220 | Ga0097621_100001687 | 3300006237 | Bacteria | 15116 |
| 221 | Ga0097621_100009855 | 3300006237 | Bacteria | 6955 |
| 222 | Ga0097621_100062041 | 3300006237 | Bacteria | 3068 |
| 223 | Ga0097621_100240798 | 3300006237 | Bacteria | 1581 |
| 224 | Ga0097621_100532496 | 3300006237 | Bacteria | 1068 |
| 225 | Ga0097621_100847737 | 3300006237 | Bacteria | 849 |
| 226 | Ga0068871_100001505 | 3300006358 | Bacteria | 15623 |
| 227 | Ga0068871_100004973 | 3300006358 | Bacteria | 9284 |
| 228 | Ga0068871_100009699 | 3300006358 | Bacteria | 6990 |
| 229 | Ga0068871_100016558 | 3300006358 | Bacteria | 5558 |
| 230 | Ga0068871_100018232 | 3300006358 | Bacteria | 5331 |
| 231 | Ga0068871_100042270 | 3300006358 | Bacteria | 3658 |
| 232 | Ga0075428_100003524 | 3300006844 | Bacteria | 17140 |
| 233 | Ga0075428_100556411 | 3300006844 | Bacteria | 1226 |
| 234 | Ga0075431_100325947 | 3300006847 | Bacteria | 1548 |
| 235 | Ga0075431_100953951 | 3300006847 | Bacteria | 826 |
| 236 | Ga0075433_10000324 | 3300006852 | Bacteria | 29260 |
| 237 | Ga0075434_100138051 | 3300006871 | Bacteria | 2457 |
| 238 | Ga0075434_100342418 | 3300006871 | Unclassified | 1516 |
| 239 | Ga0068865_100009318 | 3300006881 | Bacteria | 6082 |
| 240 | Ga0068865_100031899 | 3300006881 | Bacteria | 3516 |
| 241 | Ga0068865_100062176 | 3300006881 | Bacteria | 2620 |
| 242 | Ga0068865_100125545 | 3300006881 | Bacteria | 1915 |
| 243 | Ga0068865_100280821 | 3300006881 | Bacteria | 1325 |
| 244 | Ga0097620_100000843 | 3300006931 | Bacteria | 31176 |
| 245 | Ga0097620_100003716 | 3300006931 | Bacteria | 15558 |
| 246 | Ga0097620_100008293 | 3300006931 | Bacteria | 10532 |
| 247 | Ga0097620_100038840 | 3300006931 | Bacteria | 4775 |
| 248 | Ga0097620_100067371 | 3300006931 | Bacteria | 3615 |
| 249 | Ga0097620_100098708 | 3300006931 | Bacteria | 2975 |
| 250 | Ga0097620_100112086 | 3300006931 | Bacteria | 2791 |
| 251 | Ga0097620_100119606 | 3300006931 | Bacteria | 2701 |
| 252 | Ga0097620_100160418 | 3300006931 | Bacteria | 2328 |
| 253 | Ga0097620_100221680 | 3300006931 | Bacteria | 1979 |
| 254 | Ga0097620_100421146 | 3300006931 | Bacteria | 1431 |
| 255 | Ga0097620_100674510 | 3300006931 | Bacteria | 1125 |
| 256 | Ga0075435_100050136 | 3300007076 | Bacteria | 3359 |
| 257 | Ga0099795_10000003 | 3300007788 | Bacteria | 110661 |
| 258 | Ga0099795_10006725 | 3300007788 | Bacteria | 3156 |
| 259 | Ga0105240_10011415 | 3300009093 | Bacteria | 12373 |
| 260 | Ga0105240_10023413 | 3300009093 | Bacteria | 8166 |
| 261 | Ga0105240_10051530 | 3300009093 | Bacteria | 5177 |
| 262 | Ga0105240_10052801 | 3300009093 | Bacteria | 5107 |
| 263 | Ga0105240_10057947 | 3300009093 | Bacteria | 4837 |
| 264 | Ga0105240_10097032 | 3300009093 | Bacteria | 3591 |
| 265 | Ga0105240_10147351 | 3300009093 | Unclassified | 2807 |
| 266 | Ga0105240_10182115 | 3300009093 | Bacteria | 2478 |
| 267 | Ga0105240_10210473 | 3300009093 | Bacteria | 2273 |
| 268 | Ga0105240_10213605 | 3300009093 | Bacteria | 2252 |
| 269 | Ga0105240_10579087 | 3300009093 | Bacteria | 1238 |
| 270 | Ga0111539_10019535 | 3300009094 | Bacteria | 8360 |
| 271 | Ga0111539_10056169 | 3300009094 | Bacteria | 4680 |
| 272 | Ga0111539_10245427 | 3300009094 | Bacteria | 2085 |
| 273 | Ga0105245_10000241 | 3300009098 | Bacteria | 52084 |
| 274 | Ga0105245_10014455 | 3300009098 | Bacteria | 6876 |
| 275 | Ga0105245_10039613 | 3300009098 | Bacteria | 4194 |
| 276 | Ga0105245_10043198 | 3300009098 | Bacteria | 4021 |
| 277 | Ga0105245_10319439 | 3300009098 | Bacteria | 1529 |
| 278 | Ga0105245_10595095 | 3300009098 | Bacteria | 1132 |
| 279 | Ga0105247_10001407 | 3300009101 | Bacteria | 17443 |
| 280 | Ga0105247_10015485 | 3300009101 | Bacteria | 4567 |
| 281 | Ga0105247_10026852 | 3300009101 | Unclassified | 3480 |
| 282 | Ga0114129_10099698 | 3300009147 | Bacteria | 4020 |
| 283 | Ga0114129_10272047 | 3300009147 | Bacteria | 2266 |
| 284 | Ga0105243_10000390 | 3300009148 | Bacteria | 46725 |
| 285 | Ga0105243_10081924 | 3300009148 | Bacteria | 2636 |
| 286 | Ga0105243_10116369 | 3300009148 | Bacteria | 2246 |
| 287 | Ga0105243_10713913 | 3300009148 | Bacteria | 979 |
| 288 | Ga0105241_10011725 | 3300009174 | Bacteria | 6436 |
| 289 | Ga0105241_10050729 | 3300009174 | Bacteria | 3163 |
| 290 | Ga0105241_10050819 | 3300009174 | Bacteria | 3160 |
| 291 | Ga0105241_10361460 | 3300009174 | Bacteria | 1263 |
| 292 | Ga0105242_10000924 | 3300009176 | Bacteria | 22821 |
| 293 | Ga0105242_10006806 | 3300009176 | Bacteria | 8816 |
| 294 | Ga0105242_10009861 | 3300009176 | Bacteria | 7316 |
| 295 | Ga0105242_10031598 | 3300009176 | Bacteria | 4231 |
| 296 | Ga0105242_10200366 | 3300009176 | Bacteria | 1773 |
| 297 | Ga0105242_10266785 | 3300009176 | Bacteria | 1549 |
| 298 | Ga0105248_10007003 | 3300009177 | Bacteria | 12349 |
| 299 | Ga0105248_10010587 | 3300009177 | Bacteria | 10165 |
| 300 | Ga0105248_10068368 | 3300009177 | Bacteria | 3988 |
| 301 | Ga0105248_10070832 | 3300009177 | Bacteria | 3915 |
| 302 | Ga0105248_10120087 | 3300009177 | Bacteria | 2965 |
| 303 | Ga0105248_10161570 | 3300009177 | Bacteria | 2526 |
| 304 | Ga0105248_10235155 | 3300009177 | Bacteria | 2063 |
| 305 | Ga0105237_10016488 | 3300009545 | Bacteria | 7674 |
| 306 | Ga0105237_10022706 | 3300009545 | Bacteria | 6438 |
| 307 | Ga0105237_10050540 | 3300009545 | Bacteria | 4177 |
| 308 | Ga0105237_10097015 | 3300009545 | Bacteria | 2938 |
| 309 | Ga0105237_10122318 | 3300009545 | Bacteria | 2597 |
| 310 | Ga0105237_10160502 | 3300009545 | Bacteria | 2246 |
| 311 | Ga0105237_10179483 | 3300009545 | Bacteria | 2117 |
| 312 | Ga0105237_10499523 | 3300009545 | Bacteria | 1223 |
| 313 | Ga0105237_10733782 | 3300009545 | Bacteria | 994 |
| 314 | Ga0105238_10032211 | 3300009551 | Bacteria | 5334 |
| 315 | Ga0105238_10053847 | 3300009551 | Bacteria | 4043 |
| 316 | Ga0105238_10117391 | 3300009551 | Bacteria | 2641 |
| 317 | Ga0105238_10128703 | 3300009551 | Bacteria | 2510 |
| 318 | Ga0105238_10625608 | 3300009551 | Bacteria | 1085 |
| 319 | Ga0105238_10908709 | 3300009551 | Bacteria | 899 |
| 320 | Ga0105249_10008116 | 3300009553 | Bacteria | 9153 |
| 321 | Ga0105249_10014594 | 3300009553 | Bacteria | 6944 |
| 322 | Ga0105249_10058567 | 3300009553 | Bacteria | 3530 |
| 323 | Ga0105249_10105747 | 3300009553 | Bacteria | 2654 |
| 324 | Ga0105249_10343826 | 3300009553 | Bacteria | 1509 |
| 325 | Ga0105249_10417725 | 3300009553 | Bacteria | 1374 |
| 326 | Ga0105249_10660151 | 3300009553 | Unclassified | 1104 |
| 327 | Ga0105249_10773883 | 3300009553 | Bacteria | 1023 |
| 328 | Ga0099796_10000041 | 3300010159 | Bacteria | 26122 |
| 329 | Ga0099796_10006731 | 3300010159 | Bacteria | 2961 |
| 330 | Ga0105239_10017634 | 3300010375 | Bacteria | 7898 |
| 331 | Ga0105239_10048689 | 3300010375 | Bacteria | 4647 |
| 332 | Ga0105239_10518644 | 3300010375 | Bacteria | 1356 |
| 333 | Ga0105239_10522977 | 3300010375 | Bacteria | 1350 |
| 334 | Ga0105239_10567294 | 3300010375 | Bacteria | 1293 |
| 335 | Ga0105246_10811819 | 3300011119 | Bacteria | 831 |
| 336 | Ga0157370_10020459 | 3300013104 | Bacteria | 6610 |
| 337 | Ga0157369_10087862 | 3300013105 | Bacteria | 3319 |
| 338 | Ga0157369_10699858 | 3300013105 | Bacteria | 1044 |
| 339 | Ga0157374_10023438 | 3300013296 | Bacteria | 5521 |
| 340 | Ga0157374_10040531 | 3300013296 | Bacteria | 4289 |
| 341 | Ga0157374_10052976 | 3300013296 | Bacteria | 3781 |
| 342 | Ga0157374_10054379 | 3300013296 | Bacteria | 3734 |
| 343 | Ga0157374_10114852 | 3300013296 | Bacteria | 2593 |
| 344 | Ga0157374_10649025 | 3300013296 | Bacteria | 1067 |
| 345 | Ga0157378_10000691 | 3300013297 | Bacteria | 31706 |
| 346 | Ga0157378_10109872 | 3300013297 | Bacteria | 2526 |
| 347 | Ga0157378_10118670 | 3300013297 | Bacteria | 2435 |
| 348 | Ga0157378_10227812 | 3300013297 | Bacteria | 1774 |
| 349 | Ga0163162_10012692 | 3300013306 | Bacteria | 8224 |
| 350 | Ga0163162_10383906 | 3300013306 | Bacteria | 1538 |
| 351 | Ga0163162_10505193 | 3300013306 | Bacteria | 1339 |
| 352 | Ga0163162_10840748 | 3300013306 | Bacteria | 1034 |
| 353 | Ga0157372_10101891 | 3300013307 | Bacteria | 3279 |
| 354 | Ga0157372_10212833 | 3300013307 | Bacteria | 2240 |
| 355 | Ga0157372_10746802 | 3300013307 | Bacteria | 1138 |
| 356 | Ga0157375_10004334 | 3300013308 | Bacteria | 12320 |
| 357 | Ga0157375_10053894 | 3300013308 | Bacteria | 3960 |
| 358 | Ga0157375_10065624 | 3300013308 | Bacteria | 3619 |
| 359 | Ga0157375_10157794 | 3300013308 | Bacteria | 2409 |
| 360 | Ga0157375_10377945 | 3300013308 | Bacteria | 1583 |
| 361 | Ga0163163_10004906 | 3300014325 | Bacteria | 11504 |
| 362 | Ga0163163_10094226 | 3300014325 | Bacteria | 3012 |
| 363 | Ga0163163_10128994 | 3300014325 | Bacteria | 2568 |
| 364 | Ga0163163_10317545 | 3300014325 | Unclassified | 1611 |
| 365 | Ga0163163_10360591 | 3300014325 | Bacteria | 1510 |
| 366 | Ga0163163_10876396 | 3300014325 | Bacteria | 961 |
| 367 | Ga0157380_10004018 | 3300014326 | Bacteria | 10160 |
| 368 | Ga0157380_10018655 | 3300014326 | Bacteria | 5153 |
| 369 | Ga0157380_10060834 | 3300014326 | Bacteria | 3020 |
| 370 | Ga0157380_10172802 | 3300014326 | Bacteria | 1890 |
| 371 | Ga0157380_10182357 | 3300014326 | Bacteria | 1846 |
| 372 | Ga0157377_10096364 | 3300014745 | Bacteria | 1755 |
| 373 | Ga0157377_10367048 | 3300014745 | Bacteria | 971 |
| 374 | Ga0157379_10000686 | 3300014968 | Bacteria | 27464 |
| 375 | Ga0157379_10010622 | 3300014968 | Bacteria | 8026 |
| 376 | Ga0157379_10019884 | 3300014968 | Bacteria | 5931 |
| 377 | Ga0157379_10032813 | 3300014968 | Bacteria | 4630 |
| 378 | Ga0157379_10049209 | 3300014968 | Bacteria | 3763 |
| 379 | Ga0157379_10060447 | 3300014968 | Bacteria | 3387 |
| 380 | Ga0157376_10001295 | 3300014969 | Bacteria | 16479 |
| 381 | Ga0157376_10023533 | 3300014969 | Bacteria | 4822 |
| 382 | Ga0157376_10244311 | 3300014969 | Bacteria | 1674 |
| 383 | Ga0213876_10041849 | 3300021384 | Bacteria | 2421 |
| 384 | Ga0213876_10102416 | 3300021384 | Bacteria | 1518 |
| 385 | Ga0213871_10027669 | 3300021441 | Bacteria | 1458 |
| 386 | Ga0207656_10203620 | 3300025321 | Bacteria | 957 |
| 387 | Ga0207682_10043209 | 3300025893 | Bacteria | 1844 |
| 388 | Ga0207642_10006290 | 3300025899 | Bacteria | 3941 |
| 389 | Ga0207642_10037151 | 3300025899 | Bacteria | 2096 |
| 390 | Ga0207642_10151652 | 3300025899 | Bacteria | 1234 |
| 391 | Ga0207710_10000254 | 3300025900 | Bacteria | 44382 |
| 392 | Ga0207710_10038731 | 3300025900 | Bacteria | 2108 |
| 393 | Ga0207710_10097359 | 3300025900 | Bacteria | 1384 |
| 394 | Ga0207688_10042071 | 3300025901 | Bacteria | 2543 |
| 395 | Ga0207680_10009095 | 3300025903 | Bacteria | 4912 |
| 396 | Ga0207680_10020199 | 3300025903 | Bacteria | 3579 |
| 397 | Ga0207680_10132660 | 3300025903 | Bacteria | 1643 |
| 398 | Ga0207685_10081513 | 3300025905 | Bacteria | 1340 |
| 399 | Ga0207699_10047758 | 3300025906 | Bacteria | 2511 |
| 400 | Ga0207699_10516279 | 3300025906 | Bacteria | 864 |
| 401 | Ga0207643_10175154 | 3300025908 | Bacteria | 1296 |
| 402 | Ga0207643_10242879 | 3300025908 | Bacteria | 1107 |
| 403 | Ga0207707_10002687 | 3300025912 | Bacteria | 15893 |
| 404 | Ga0207707_10003643 | 3300025912 | Bacteria | 13664 |
| 405 | Ga0207707_10007933 | 3300025912 | Bacteria | 9234 |
| 406 | Ga0207707_10015246 | 3300025912 | Bacteria | 6692 |
| 407 | Ga0207707_10037249 | 3300025912 | Bacteria | 4250 |
| 408 | Ga0207707_10044100 | 3300025912 | Bacteria | 3889 |
| 409 | Ga0207707_10065169 | 3300025912 | Bacteria | 3173 |
| 410 | Ga0207695_10011439 | 3300025913 | Bacteria | 10752 |
| 411 | Ga0207695_10022627 | 3300025913 | Bacteria | 7127 |
| 412 | Ga0207695_10026932 | 3300025913 | Bacteria | 6409 |
| 413 | Ga0207695_10034621 | 3300025913 | Bacteria | 5489 |
| 414 | Ga0207695_10057119 | 3300025913 | Bacteria | 4057 |
| 415 | Ga0207695_10106855 | 3300025913 | Unclassified | 2784 |
| 416 | Ga0207695_10114790 | 3300025913 | Bacteria | 2668 |
| 417 | Ga0207695_10155161 | 3300025913 | Unclassified | 2224 |
| 418 | Ga0207695_10181217 | 3300025913 | Bacteria | 2027 |
| 419 | Ga0207695_10239941 | 3300025913 | Bacteria | 1714 |
| 420 | Ga0207695_10398930 | 3300025913 | Bacteria | 1260 |
| 421 | Ga0207671_10013547 | 3300025914 | Bacteria | 6492 |
| 422 | Ga0207671_10085239 | 3300025914 | Bacteria | 2373 |
| 423 | Ga0207671_10159585 | 3300025914 | Bacteria | 1746 |
| 424 | Ga0207671_10209065 | 3300025914 | Bacteria | 1526 |
| 425 | Ga0207693_10001960 | 3300025915 | Bacteria | 18058 |
| 426 | Ga0207693_10025310 | 3300025915 | Bacteria | 4706 |
| 427 | Ga0207693_10109947 | 3300025915 | Bacteria | 2161 |
| 428 | Ga0207663_10010099 | 3300025916 | Bacteria | 5008 |
| 429 | Ga0207663_10022025 | 3300025916 | Bacteria | 3637 |
| 430 | Ga0207663_10123191 | 3300025916 | Bacteria | 1779 |
| 431 | Ga0207660_10044651 | 3300025917 | Bacteria | 3118 |
| 432 | Ga0207660_10243009 | 3300025917 | Bacteria | 1419 |
| 433 | Ga0207662_10199413 | 3300025918 | Bacteria | 1295 |
| 434 | Ga0207652_10001709 | 3300025921 | Bacteria | 19167 |
| 435 | Ga0207652_10028327 | 3300025921 | Bacteria | 4674 |
| 436 | Ga0207652_10153571 | 3300025921 | Bacteria | 2062 |
| 437 | Ga0207681_10373286 | 3300025923 | Bacteria | 1147 |
| 438 | Ga0207694_10090625 | 3300025924 | Bacteria | 2412 |
| 439 | Ga0207694_10118005 | 3300025924 | Bacteria | 2116 |
| 440 | Ga0207694_10138988 | 3300025924 | Bacteria | 1952 |
| 441 | Ga0207694_10185523 | 3300025924 | Bacteria | 1688 |
| 442 | Ga0207694_10442269 | 3300025924 | Bacteria | 1085 |
| 443 | Ga0207694_10445533 | 3300025924 | Bacteria | 1080 |
| 444 | Ga0207650_10120861 | 3300025925 | Bacteria | 2039 |
| 445 | Ga0207659_10128349 | 3300025926 | Bacteria | 1953 |
| 446 | Ga0207659_10129183 | 3300025926 | Bacteria | 1947 |
| 447 | Ga0207659_10164117 | 3300025926 | Bacteria | 1747 |
| 448 | Ga0207687_10000799 | 3300025927 | Bacteria | 21252 |
| 449 | Ga0207687_10500948 | 3300025927 | Bacteria | 1014 |
| 450 | Ga0207700_10117537 | 3300025928 | Bacteria | 2150 |
| 451 | Ga0207700_10140737 | 3300025928 | Bacteria | 1982 |
| 452 | Ga0207664_10065833 | 3300025929 | Bacteria | 2902 |
| 453 | Ga0207644_10002165 | 3300025931 | Bacteria | 12741 |
| 454 | Ga0207644_10040094 | 3300025931 | Bacteria | 3309 |
| 455 | Ga0207644_10082590 | 3300025931 | Bacteria | 2377 |
| 456 | Ga0207690_10219530 | 3300025932 | Bacteria | 1454 |
| 457 | Ga0207706_10228197 | 3300025933 | Bacteria | 1629 |
| 458 | Ga0207706_10456286 | 3300025933 | Bacteria | 1105 |
| 459 | Ga0207686_10004205 | 3300025934 | Bacteria | 7723 |
| 460 | Ga0207686_10044281 | 3300025934 | Bacteria | 2732 |
| 461 | Ga0207686_10116623 | 3300025934 | Bacteria | 1810 |
| 462 | Ga0207686_10220013 | 3300025934 | Bacteria | 1370 |
| 463 | Ga0207709_10011405 | 3300025935 | Bacteria | 4904 |
| 464 | Ga0207709_10104822 | 3300025935 | Bacteria | 1877 |
| 465 | Ga0207670_10015764 | 3300025936 | Bacteria | 4524 |
| 466 | Ga0207670_10032804 | 3300025936 | Bacteria | 3342 |
| 467 | Ga0207670_10137220 | 3300025936 | Bacteria | 1799 |
| 468 | Ga0207669_10240988 | 3300025937 | Bacteria | 1340 |
| 469 | Ga0207669_10349811 | 3300025937 | Bacteria | 1141 |
| 470 | Ga0207669_10652270 | 3300025937 | Bacteria | 861 |
| 471 | Ga0207704_10019972 | 3300025938 | Bacteria | 3533 |
| 472 | Ga0207704_10088835 | 3300025938 | Bacteria | 2023 |
| 473 | Ga0207704_10103558 | 3300025938 | Bacteria | 1904 |
| 474 | Ga0207665_10002487 | 3300025939 | Bacteria | 12412 |
| 475 | Ga0207665_10020929 | 3300025939 | Bacteria | 4299 |
| 476 | Ga0207665_10519013 | 3300025939 | Bacteria | 922 |
| 477 | Ga0207691_10180798 | 3300025940 | Bacteria | 1843 |
| 478 | Ga0207691_10462632 | 3300025940 | Bacteria | 1079 |
| 479 | Ga0207691_10782717 | 3300025940 | Bacteria | 802 |
| 480 | Ga0207711_10004364 | 3300025941 | Bacteria | 12071 |
| 481 | Ga0207711_10054984 | 3300025941 | Bacteria | 3417 |
| 482 | Ga0207711_10158514 | 3300025941 | Bacteria | 2047 |
| 483 | Ga0207711_10451837 | 3300025941 | Bacteria | 1196 |
| 484 | Ga0207689_10000452 | 3300025942 | Bacteria | 38652 |
| 485 | Ga0207689_10000820 | 3300025942 | Bacteria | 29947 |
| 486 | Ga0207689_10012333 | 3300025942 | Bacteria | 7312 |
| 487 | Ga0207689_10061364 | 3300025942 | Bacteria | 3091 |
| 488 | Ga0207689_10118926 | 3300025942 | Bacteria | 2173 |
| 489 | Ga0207689_10305007 | 3300025942 | Bacteria | 1320 |
| 490 | Ga0207689_10403972 | 3300025942 | Bacteria | 1139 |
| 491 | Ga0207689_10546769 | 3300025942 | Bacteria | 972 |
| 492 | Ga0207689_10629026 | 3300025942 | Bacteria | 904 |
| 493 | Ga0207661_10061726 | 3300025944 | Bacteria | 3029 |
| 494 | Ga0207661_10548020 | 3300025944 | Bacteria | 1059 |
| 495 | Ga0207679_10051005 | 3300025945 | Bacteria | 3027 |
| 496 | Ga0207679_10237496 | 3300025945 | Bacteria | 1542 |
| 497 | Ga0207667_10014281 | 3300025949 | Bacteria | 9059 |
| 498 | Ga0207667_10016556 | 3300025949 | Bacteria | 8327 |
| 499 | Ga0207667_10049000 | 3300025949 | Bacteria | 4464 |
| 500 | Ga0207667_10246814 | 3300025949 | Bacteria | 1827 |
| 501 | Ga0207667_10507353 | 3300025949 | Bacteria | 1223 |
| 502 | Ga0207651_10212160 | 3300025960 | Bacteria | 1559 |
| 503 | Ga0207651_10273061 | 3300025960 | Bacteria | 1393 |
| 504 | Ga0207651_10419508 | 3300025960 | Bacteria | 1142 |
| 505 | Ga0207712_10036268 | 3300025961 | Bacteria | 3357 |
| 506 | Ga0207712_10362992 | 3300025961 | Bacteria | 1207 |
| 507 | Ga0207712_10432482 | 3300025961 | Bacteria | 1113 |
| 508 | Ga0207668_10405728 | 3300025972 | Bacteria | 1153 |
| 509 | Ga0207640_10752712 | 3300025981 | Bacteria | 840 |
| 510 | Ga0207658_10000161 | 3300025986 | Bacteria | 71234 |
| 511 | Ga0207658_10014587 | 3300025986 | Bacteria | 5380 |
| 512 | Ga0207658_10095196 | 3300025986 | Bacteria | 2319 |
| 513 | Ga0207658_10153020 | 3300025986 | Bacteria | 1881 |
| 514 | Ga0207658_10224081 | 3300025986 | Bacteria | 1583 |
| 515 | Ga0207677_10019760 | 3300026023 | Bacteria | 4075 |
| 516 | Ga0207677_10234756 | 3300026023 | Bacteria | 1480 |
| 517 | Ga0207677_10335053 | 3300026023 | Bacteria | 1262 |
| 518 | Ga0207677_10396565 | 3300026023 | Bacteria | 1169 |
| 519 | Ga0207703_10000183 | 3300026035 | Bacteria | 73109 |
| 520 | Ga0207703_10003754 | 3300026035 | Bacteria | 12643 |
| 521 | Ga0207703_10028778 | 3300026035 | Bacteria | 4383 |
| 522 | Ga0207703_10037902 | 3300026035 | Bacteria | 3843 |
| 523 | Ga0207703_10055425 | 3300026035 | Bacteria | 3225 |
| 524 | Ga0207703_11042141 | 3300026035 | Bacteria | 785 |
| 525 | Ga0207639_10160583 | 3300026041 | Bacteria | 1893 |
| 526 | Ga0207678_10113068 | 3300026067 | Unclassified | 2316 |
| 527 | Ga0207678_10132002 | 3300026067 | Bacteria | 2131 |
| 528 | Ga0207678_10166675 | 3300026067 | Bacteria | 1881 |
| 529 | Ga0207708_10000701 | 3300026075 | Bacteria | 25411 |
| 530 | Ga0207708_10001120 | 3300026075 | Bacteria | 20140 |
| 531 | Ga0207708_10029337 | 3300026075 | Bacteria | 4169 |
| 532 | Ga0207702_10133671 | 3300026078 | Bacteria | 2235 |
| 533 | Ga0207641_10003340 | 3300026088 | Bacteria | 14261 |
| 534 | Ga0207641_10019717 | 3300026088 | Bacteria | 5536 |
| 535 | Ga0207641_10025434 | 3300026088 | Bacteria | 4881 |
| 536 | Ga0207641_10127277 | 3300026088 | Bacteria | 2282 |
| 537 | Ga0207641_10156278 | 3300026088 | Bacteria | 2069 |
| 538 | Ga0207641_10341755 | 3300026088 | Bacteria | 1425 |
| 539 | Ga0207641_10383221 | 3300026088 | Bacteria | 1347 |
| 540 | Ga0207648_10000159 | 3300026089 | Bacteria | 69221 |
| 541 | Ga0207648_10029915 | 3300026089 | Bacteria | 4830 |
| 542 | Ga0207648_10717182 | 3300026089 | Bacteria | 927 |
| 543 | Ga0207676_10080765 | 3300026095 | Bacteria | 2640 |
| 544 | Ga0207676_10174651 | 3300026095 | Bacteria | 1875 |
| 545 | Ga0207676_10442120 | 3300026095 | Unclassified | 1224 |
| 546 | Ga0207676_10662515 | 3300026095 | Bacteria | 1008 |
| 547 | Ga0207674_10007918 | 3300026116 | Bacteria | 12341 |
| 548 | Ga0207674_10700144 | 3300026116 | Bacteria | 978 |
| 549 | Ga0207674_10919100 | 3300026116 | Bacteria | 843 |
| 550 | Ga0207675_100000068 | 3300026118 | Bacteria | 78105 |
| 551 | Ga0207675_100027528 | 3300026118 | Bacteria | 5294 |
| 552 | Ga0207675_100084865 | 3300026118 | Bacteria | 2972 |
| 553 | Ga0207675_100130112 | 3300026118 | Bacteria | 2386 |
| 554 | Ga0207675_100133172 | 3300026118 | Bacteria | 2357 |
| 555 | Ga0207675_100134829 | 3300026118 | Bacteria | 2342 |
| 556 | Ga0207675_100270540 | 3300026118 | Bacteria | 1649 |
| 557 | Ga0207683_10003248 | 3300026121 | Bacteria | 14184 |
| 558 | Ga0207683_10013172 | 3300026121 | Bacteria | 7056 |
| 559 | Ga0207683_10110409 | 3300026121 | Bacteria | 2462 |
| 560 | Ga0207683_10141192 | 3300026121 | Bacteria | 2170 |
| 561 | Ga0207683_10344376 | 3300026121 | Bacteria | 1367 |
| 562 | Ga0207698_10590357 | 3300026142 | Bacteria | 1094 |
| 563 | Ga0209179_1000050 | 3300027512 | Bacteria | 22849 |
| 564 | Ga0209179_1025240 | 3300027512 | Bacteria | 1184 |
| 565 | Ga0207428_10010959 | 3300027907 | Bacteria | 8064 |
| 566 | Ga0265354_1001907 | 3300028016 | Bacteria | 2772 |
| 567 | Ga0265356_1000692 | 3300028017 | Bacteria | 5808 |
| 568 | Ga0265357_1008995 | 3300028023 | Bacteria | 987 |
| 569 | Ga0265355_1000468 | 3300028036 | Bacteria | 2109 |
| 570 | Ga0268266_10003316 | 3300028379 | Bacteria | 16160 |
| 571 | Ga0268266_10003994 | 3300028379 | Bacteria | 14291 |
| 572 | Ga0268266_10023651 | 3300028379 | Bacteria | 5229 |
| 573 | Ga0268266_10025879 | 3300028379 | Bacteria | 4991 |
| 574 | Ga0268266_10033156 | 3300028379 | Bacteria | 4392 |
| 575 | Ga0268266_10036945 | 3300028379 | Bacteria | 4161 |
| 576 | Ga0268266_10047212 | 3300028379 | Bacteria | 3688 |
| 577 | Ga0268266_10135535 | 3300028379 | Bacteria | 2205 |
| 578 | Ga0268266_10176161 | 3300028379 | Bacteria | 1944 |
| 579 | Ga0268266_10186357 | 3300028379 | Bacteria | 1892 |
| 580 | Ga0268266_10217385 | 3300028379 | Bacteria | 1755 |
| 581 | Ga0268265_10004185 | 3300028380 | Bacteria | 10099 |
| 582 | Ga0268265_10018361 | 3300028380 | Bacteria | 4845 |
| 583 | Ga0268264_10000057 | 3300028381 | Bacteria | 309824 |
| 584 | Ga0268264_10007801 | 3300028381 | Bacteria | 8910 |
| 585 | Ga0268264_10110767 | 3300028381 | Bacteria | 2404 |
| 586 | Ga0268264_10123709 | 3300028381 | Bacteria | 2283 |
| 587 | Ga0265326_10017517 | 3300028558 | Bacteria | 2066 |
| 588 | Ga0265319_1013375 | 3300028563 | Bacteria | 3266 |
| 589 | Ga0265319_1056620 | 3300028563 | Bacteria | 1280 |
| 590 | Ga0265334_10000857 | 3300028573 | Bacteria | 15227 |
| 591 | Ga0265334_10002212 | 3300028573 | Bacteria | 9153 |
| 592 | Ga0265318_10002664 | 3300028577 | Bacteria | 9395 |
| 593 | Ga0265318_10042664 | 3300028577 | Bacteria | 1720 |
| 594 | Ga0307515_10002761 | 3300028794 | Bacteria | 37491 |
| 595 | Ga0265338_10004528 | 3300028800 | Bacteria | 18730 |
| 596 | Ga0265338_10026969 | 3300028800 | Bacteria | 5778 |
| 597 | Ga0265338_10065785 | 3300028800 | Bacteria | 3141 |
| 598 | Ga0265338_10149536 | 3300028800 | Bacteria | 1816 |
| 599 | Ga0307511_10000342 | 3300030521 | Bacteria | 49561 |
| 600 | Ga0307511_10009381 | 3300030521 | Bacteria | 9759 |
| 601 | Ga0265760_10000114 | 3300031090 | Bacteria | 20455 |
| 602 | Ga0265760_10038943 | 3300031090 | Bacteria | 1414 |
| 603 | Ga0265330_10009844 | 3300031235 | Bacteria | 4524 |
| 604 | Ga0265330_10022236 | 3300031235 | Bacteria | 2887 |
| 605 | Ga0265332_10009238 | 3300031238 | Bacteria | 4405 |
| 606 | Ga0265328_10016712 | 3300031239 | Bacteria | 2850 |
| 607 | Ga0265328_10059949 | 3300031239 | Bacteria | 1397 |
| 608 | Ga0265320_10003107 | 3300031240 | Bacteria | 11271 |
| 609 | Ga0265320_10022086 | 3300031240 | Bacteria | 3410 |
| 610 | Ga0265325_10031059 | 3300031241 | Bacteria | 2861 |
| 611 | Ga0265329_10025430 | 3300031242 | Bacteria | 1959 |
| 612 | Ga0265329_10042006 | 3300031242 | Bacteria | 1465 |
| 613 | Ga0265340_10022248 | 3300031247 | Bacteria | 3243 |
| 614 | Ga0265340_10031844 | 3300031247 | Bacteria | 2635 |
| 615 | Ga0265340_10061435 | 3300031247 | Bacteria | 1797 |
| 616 | Ga0265340_10068498 | 3300031247 | Bacteria | 1686 |
| 617 | Ga0265339_10039584 | 3300031249 | Bacteria | 2624 |
| 618 | Ga0265339_10045506 | 3300031249 | Bacteria | 2415 |
| 619 | Ga0265339_10095696 | 3300031249 | Bacteria | 1551 |
| 620 | Ga0265331_10011650 | 3300031250 | Bacteria | 4808 |
| 621 | Ga0265331_10019927 | 3300031250 | Bacteria | 3453 |
| 622 | Ga0265316_10023141 | 3300031344 | Bacteria | 5223 |
| 623 | Ga0307513_10021506 | 3300031456 | Bacteria | 7614 |
| 624 | Ga0307509_10115911 | 3300031507 | Bacteria | 2670 |
| 625 | Ga0307509_10271312 | 3300031507 | Bacteria | 1464 |
| 626 | Ga0307509_10462900 | 3300031507 | Bacteria | 960 |
| 627 | Ga0307408_100247801 | 3300031548 | Bacteria | 1468 |
| 628 | Ga0307408_100275651 | 3300031548 | Bacteria | 1398 |
| 629 | Ga0265313_10016630 | 3300031595 | Bacteria | 4221 |
| 630 | Ga0265313_10017082 | 3300031595 | Bacteria | 4141 |
| 631 | Ga0265313_10053240 | 3300031595 | Bacteria | 1927 |
| 632 | Ga0316575_10035881 | 3300031665 | Bacteria | 1950 |
| 633 | Ga0265314_10006771 | 3300031711 | Bacteria | 10054 |
| 634 | Ga0265314_10144520 | 3300031711 | Bacteria | 1466 |
| 635 | Ga0265342_10043449 | 3300031712 | Bacteria | 2712 |
| 636 | Ga0265342_10123029 | 3300031712 | Bacteria | 1459 |
| 637 | Ga0316576_10012885 | 3300031727 | Bacteria | 5534 |
| 638 | Ga0316576_10178428 | 3300031727 | Bacteria | 1602 |
| 639 | Ga0316577_10135795 | 3300031733 | Bacteria | 1385 |
| 640 | Ga0307413_10048731 | 3300031824 | Bacteria | 2534 |
| 641 | Ga0307413_10590288 | 3300031824 | Bacteria | 907 |
| 642 | Ga0307413_10806444 | 3300031824 | Bacteria | 789 |
| 643 | Ga0307410_10003260 | 3300031852 | Bacteria | 8104 |
| 644 | Ga0307410_10016809 | 3300031852 | Bacteria | 4374 |
| 645 | Ga0307410_10048743 | 3300031852 | Bacteria | 2839 |
| 646 | Ga0307406_10048172 | 3300031901 | Bacteria | 2690 |
| 647 | Ga0307406_10079936 | 3300031901 | Bacteria | 2169 |
| 648 | Ga0307406_10206172 | 3300031901 | Bacteria | 1451 |
| 649 | Ga0307407_10371424 | 3300031903 | Bacteria | 1018 |
| 650 | Ga0307412_10122563 | 3300031911 | Bacteria | 1874 |
| 651 | Ga0307412_10299648 | 3300031911 | Bacteria | 1270 |
| 652 | Ga0307409_100001941 | 3300031995 | Bacteria | 10570 |
| 653 | Ga0307409_100307691 | 3300031995 | Bacteria | 1477 |
| 654 | Ga0307409_100338872 | 3300031995 | Bacteria | 1414 |
| 655 | Ga0307409_100391037 | 3300031995 | Bacteria | 1325 |
| 656 | Ga0307416_100018740 | 3300032002 | Bacteria | 4886 |
| 657 | Ga0307416_100108907 | 3300032002 | Bacteria | 2435 |
| 658 | Ga0307411_10000393 | 3300032005 | Bacteria | 14945 |
| 659 | Ga0307411_10002266 | 3300032005 | Bacteria | 8409 |
| 660 | Ga0307411_10045875 | 3300032005 | Bacteria | 2814 |
| 661 | Ga0307411_10763250 | 3300032005 | Bacteria | 848 |
| 662 | Ga0307415_100005339 | 3300032126 | Bacteria | 6807 |
| 663 | Ga0307415_100035377 | 3300032126 | Bacteria | 3262 |
| 664 | Ga0307415_100189344 | 3300032126 | Bacteria | 1622 |
| 665 | Ga0307415_100347429 | 3300032126 | Bacteria | 1247 |
| 666 | Ga0307415_100458643 | 3300032126 | Bacteria | 1104 |
| 667 | Ga0307510_10000014 | 3300033180 | Bacteria | 271607 |
| 668 | Ga0307510_10151447 | 3300033180 | Bacteria | 1937 |
| 669 | Ga0373936_0006833 | 3300035113 | Bacteria | 4295 |
| 670 | Ga0373945_0039480 | 3300035116 | Bacteria | 1702 |
| 671 | Ga0373953_0129527 | 3300035117 | Bacteria | 1075 |
| 672 | Ga0373956_0283054 | 3300035119 | Bacteria | 789 |
| 673 | Ga0373943_0035647 | 3300035170 | Bacteria | 2379 |
| 674 | Ga0373955_0029676 | 3300035172 | Bacteria | 2847 |
| 675 | Ga0373955_0030134 | 3300035172 | Bacteria | 2829 |
| 676 | Ga0373955_0354915 | 3300035172 | Bacteria | 888 |
| 677 | Ga0316574_0084385 | 3300035398 | Bacteria | 2020 |
| 678 | Ga0373924_0107488 | 3300035410 | Bacteria | 1204 |
| 679 | Ga0373924_0140881 | 3300035410 | Bacteria | 1052 |
| 680 | Ga0373927_0044984 | 3300035695 | Bacteria | 2856 |
| 681 | Ga0373927_0433496 | 3300035695 | Bacteria | 868 |
| 682 | Ga0373933_0113593 | 3300035724 | Bacteria | 1691 |
| 683 | Ga0373933_0158812 | 3300035724 | Bacteria | 1435 |
| 684 | Ga0373937_0003142 | 3300036401 | Bacteria | 13820 |
| 685 | Ga0373937_0205299 | 3300036401 | Bacteria | 1853 |
| 686 | Ga0373937_0246467 | 3300036401 | Bacteria | 1684 |
| 687 | Ga0373937_0773291 | 3300036401 | Bacteria | 908 |
| 688 | Ga0373925_0007403 | 3300037068 | Bacteria | 8010 |
| 689 | Ga0395898_0013822 | 3300037466 | Bacteria | 8299 |
| 690 | Ga0395898_0061276 | 3300037466 | Bacteria | 3655 |
| 691 | Ga0395898_0438703 | 3300037466 | Bacteria | 1244 |
| 692 | Ga0436365_1867186 | 3300039437 | Bacteria | 3907 |
| 693 | Ga0436360_0672319 | 3300039438 | Bacteria | 982 |
| 694 | Ga0436360_0674475 | 3300039438 | Bacteria | 19139 |
| 695 | Ga0436360_0822925 | 3300039438 | Bacteria | 1544 |
| 696 | Ga0436363_0487320 | 3300039450 | Bacteria | 3175 |
| 697 | Ga0436363_0731737 | 3300039450 | Bacteria | 2489 |
| 698 | Ga0436363_0829074 | 3300039450 | Bacteria | 17900 |
| 699 | Ga0436363_0951456 | 3300039450 | Bacteria | 951 |
| 700 | Ga0436362_0298024 | 3300039453 | Bacteria | 1176 |
| 701 | Ga0436362_1062550 | 3300039453 | Bacteria | 1309 |
| 702 | Ga0451793_0109096 | 3300041452 | Bacteria | 1261 |
| 703 | Ga0451798_0977305 | 3300041458 | Bacteria | 1928 |
| 704 | Ga0451802_1913096 | 3300041460 | Bacteria | 1567 |
| 705 | Ga0451804_0964549 | 3300041463 | Bacteria | 1110 |
| 706 | Ga0451807_0912795 | 3300041486 | Bacteria | 1227 |
| 707 | Ga0451807_1119766 | 3300041486 | Bacteria | 3122 |
| 708 | Ga0451807_1884568 | 3300041486 | Bacteria | 1493 |
| 709 | Ga0439442_035348 | 3300042002 | Bacteria | 1045 |
| 710 | Ga0450919_013650 | 3300042121 | Bacteria | 919 |
| 711 | Ga0450920_000747 | 3300042122 | Bacteria | 5238 |
| 712 | Ga0450923_004656 | 3300042125 | Bacteria | 2163 |
| 713 | Ga0450895_000370 | 3300042132 | Bacteria | 2479 |
| 714 | Ga0450907_002187 | 3300042146 | Bacteria | 3833 |
| 715 | Ga0439446_0018399 | 3300042156 | Bacteria | 1957 |
| 716 | Ga0450908_001358 | 3300042184 | Bacteria | 4744 |
| 717 | Ga0450908_002745 | 3300042184 | Bacteria | 3436 |
| 718 | Ga0439435_0001503 | 3300042436 | Bacteria | 4339 |
| 719 | Ga0450916_007558 | 3300042530 | Bacteria | 1308 |
| 720 | Ga0451577_0482104 | 3300042876 | Bacteria | 1126 |
| 721 | Ga0466969_0002463 | 3300044656 | Bacteria | 9882 |
| 722 | Ga0466969_0075929 | 3300044656 | Bacteria | 1610 |
| 723 | Ga0466966_0000445 | 3300044684 | Bacteria | 26600 |
| 724 | Ga0466961_0003001 | 3300044693 | Bacteria | 10473 |
| 725 | Ga0466964_0000891 | 3300044706 | Bacteria | 9787 |
| 726 | Ga0466971_0000422 | 3300044719 | Bacteria | 16550 |
| 727 | Ga0466970_0003326 | 3300044765 | Bacteria | 7819 |
| 728 | Ga0466957_0008510 | 3300044842 | Bacteria | 5838 |
| 729 | Ga0466959_0001134 | 3300045049 | Bacteria | 16049 |
| 730 | Ga0466959_0001608 | 3300045049 | Bacteria | 13911 |
| 731 | Ga0466959_0338922 | 3300045049 | Bacteria | 1026 |
| 732 | Ga0466958_0090934 | 3300045836 | Bacteria | 1889 |
| 733 | Ga0495590_0001849 | 3300046457 | Bacteria | 8955 |
| 734 | Ga0495638_0015464 | 3300046460 | Bacteria | 5123 |
| 735 | Ga0495638_0321160 | 3300046460 | Bacteria | 827 |
| 736 | Ga0495580_0002794 | 3300046472 | Bacteria | 15019 |
| 737 | Ga0495616_0006441 | 3300046513 | Bacteria | 7097 |
| 738 | Ga0495616_0058498 | 3300046513 | Bacteria | 1898 |
| 739 | Ga0495630_0044191 | 3300046517 | Bacteria | 3329 |
| 740 | Ga0495632_0061959 | 3300046519 | Bacteria | 1814 |
| 741 | Ga0495632_0186105 | 3300046519 | Bacteria | 950 |
| 742 | Ga0495644_0086341 | 3300046523 | Bacteria | 1183 |
| 743 | Ga0495587_0057280 | 3300046536 | Bacteria | 2292 |
| 744 | Ga0495668_0310580 | 3300046616 | Bacteria | 865 |
| 745 | Ga0495634_0201614 | 3300046642 | Bacteria | 1236 |
| 746 | Ga0495625_0101221 | 3300046660 | Bacteria | 1979 |
| 747 | Ga0495647_0000569 | 3300046681 | Bacteria | 10891 |
| 748 | Ga0495647_0042301 | 3300046681 | Bacteria | 1739 |
| 749 | Ga0495658_0104373 | 3300046683 | Bacteria | 1696 |
| 750 | Ga0495658_0197517 | 3300046683 | Bacteria | 1253 |
| 751 | Ga0495669_0087440 | 3300046684 | Bacteria | 1436 |
| 752 | Ga0495669_0133375 | 3300046684 | Bacteria | 1170 |
| 753 | Ga0495600_0167815 | 3300046809 | Bacteria | 1418 |
| 754 | Ga0495581_0341442 | 3300047315 | Bacteria | 874 |
| 755 | Ga0495674_0459910 | 3300047319 | Bacteria | 1022 |
| 756 | Ga0495687_032802 | 3300047443 | Bacteria | 2365 |
| 757 | Ga0495687_057296 | 3300047443 | Bacteria | 1621 |
| 758 | Ga0495602_0087833 | 3300048088 | Bacteria | 2590 |
| 759 | Ga0496100_0021760 | 3300048903 | Bacteria | 3869 |
| 760 | Ga0496100_0045455 | 3300048903 | Bacteria | 2818 |
| 761 | Ga0496101_0300785 | 3300048904 | Bacteria | 1256 |
| 762 | Ga0496102_0005483 | 3300048905 | Bacteria | 10766 |
| 763 | Ga0496102_0057549 | 3300048905 | Bacteria | 3550 |
| 764 | Ga0496102_0170300 | 3300048905 | Bacteria | 2050 |
| 765 | Ga0496103_0056956 | 3300048906 | Bacteria | 2427 |
| 766 | Ga0496103_0105197 | 3300048906 | Bacteria | 1789 |
| 767 | Ga0496104_0000384 | 3300048907 | Bacteria | 38678 |
| 768 | Ga0496104_0014083 | 3300048907 | Bacteria | 7218 |
| 769 | Ga0496104_0161086 | 3300048907 | Bacteria | 2152 |
| 770 | Ga0496104_0471642 | 3300048907 | Bacteria | 1166 |
| 771 | Ga0496105_0007758 | 3300048908 | Bacteria | 8327 |
| 772 | Ga0496105_0020969 | 3300048908 | Bacteria | 5285 |
| 773 | Ga0496105_0634819 | 3300048908 | Bacteria | 825 |
| 774 | Ga0496106_0003443 | 3300048909 | Bacteria | 11792 |
| 775 | Ga0496108_0014413 | 3300048911 | Bacteria | 6454 |
| 776 | Ga0496108_0039863 | 3300048911 | Bacteria | 3915 |
| 777 | Ga0496109_0012359 | 3300048912 | Bacteria | 7371 |
| 778 | Ga0496109_0015937 | 3300048912 | Bacteria | 6565 |
| 779 | Ga0496109_0399823 | 3300048912 | Unclassified | 1298 |
| 780 | Ga0496110_0000305 | 3300048913 | Bacteria | 32413 |
| 781 | Ga0496111_0040202 | 3300048914 | Bacteria | 3354 |
| 782 | Ga0496111_0060107 | 3300048914 | Bacteria | 2754 |
| 783 | Ga0496112_0082332 | 3300048915 | Bacteria | 3183 |
| 784 | Ga0496112_0156128 | 3300048915 | Bacteria | 2249 |
| 785 | Ga0496112_0329744 | 3300048915 | Unclassified | 1470 |
| 786 | Ga0496113_0095889 | 3300048916 | Bacteria | 2293 |
| 787 | Ga0496114_0002619 | 3300048917 | Bacteria | 13729 |
| 788 | Ga0496114_0012105 | 3300048917 | Bacteria | 6904 |
| 789 | Ga0496114_0016037 | 3300048917 | Bacteria | 6028 |
| 790 | Ga0496114_0255037 | 3300048917 | Bacteria | 1544 |
| 791 | Ga0496115_0029559 | 3300048918 | Bacteria | 4304 |
| 792 | Ga0496115_0113373 | 3300048918 | Bacteria | 2228 |
| 793 | Ga0496115_0193080 | 3300048918 | Bacteria | 1682 |
| 794 | Ga0496116_0052603 | 3300048919 | Bacteria | 2697 |
| 795 | Ga0496117_0000156 | 3300048920 | Bacteria | 145285 |
| 796 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 797 | Ga0496118_0077926 | 3300048921 | Bacteria | 2348 |
| 798 | Ga0496119_0003677 | 3300048922 | Bacteria | 15729 |
| 799 | Ga0496119_0013116 | 3300048922 | Bacteria | 6637 |
| 800 | Ga0496120_0000173 | 3300048923 | Bacteria | 109909 |
| 801 | Ga0496120_0109581 | 3300048923 | Bacteria | 1444 |
| 802 | Ga0496121_0000371 | 3300048924 | Bacteria | 92354 |
| 803 | Ga0496121_0078632 | 3300048924 | Bacteria | 2621 |
| 804 | Ga0496124_0147290 | 3300048927 | Bacteria | 1851 |
| 805 | Ga0496125_0000918 | 3300048928 | Bacteria | 46373 |
| 806 | Ga0496125_0003733 | 3300048928 | Bacteria | 18142 |
| 807 | Ga0496125_0033402 | 3300048928 | Bacteria | 4553 |
| 808 | Ga0496125_0064565 | 3300048928 | Bacteria | 2908 |
| 809 | Ga0496126_0002970 | 3300048929 | Bacteria | 22024 |
| 810 | Ga0496126_0026348 | 3300048929 | Bacteria | 5576 |
| 811 | Ga0496126_0164842 | 3300048929 | Bacteria | 1892 |
| 812 | Ga0496126_0220917 | 3300048929 | Bacteria | 1591 |
| 813 | Ga0495678_074582 | 3300049459 | Bacteria | 1234 |
| 814 | Ga0501031_0285158 | 3300049568 | Bacteria | 1071 |
| 815 | Ga0501034_0366114 | 3300049571 | Bacteria | 1368 |
| 816 | Ga0501036_0030406 | 3300049572 | Bacteria | 4562 |
| 817 | Ga0501036_0066537 | 3300049572 | Bacteria | 3049 |
| 818 | Ga0501036_0085648 | 3300049572 | Bacteria | 2664 |
| 819 | Ga0501039_0065775 | 3300049575 | Bacteria | 2813 |
| 820 | Ga0501039_0082112 | 3300049575 | Bacteria | 2509 |
| 821 | Ga0501039_0100112 | 3300049575 | Bacteria | 2262 |
| 822 | Ga0501039_0265762 | 3300049575 | Bacteria | 1348 |
| 823 | Ga0501040_0029617 | 3300049576 | Bacteria | 3697 |
| 824 | Ga0501040_0052546 | 3300049576 | Bacteria | 2789 |
| 825 | Ga0501041_0001021 | 3300049577 | Bacteria | 15302 |
| 826 | Ga0501041_0022279 | 3300049577 | Bacteria | 3792 |
| 827 | Ga0501041_0032386 | 3300049577 | Bacteria | 3160 |
| 828 | Ga0501041_0063684 | 3300049577 | Bacteria | 2258 |
| 829 | Ga0501042_0013426 | 3300049578 | Bacteria | 5574 |
| 830 | Ga0501042_0017774 | 3300049578 | Bacteria | 4910 |
| 831 | Ga0501042_0051784 | 3300049578 | Bacteria | 2928 |
| 832 | Ga0501048_0041720 | 3300049582 | Bacteria | 3286 |
| 833 | Ga0501048_0062614 | 3300049582 | Bacteria | 2633 |
| 834 | Ga0501068_0000431 | 3300049584 | Bacteria | 21314 |
| 835 | Ga0501068_0000509 | 3300049584 | Bacteria | 19755 |
| 836 | Ga0501068_0039227 | 3300049584 | Bacteria | 2840 |
| 837 | Ga0501069_0253874 | 3300049585 | Bacteria | 1026 |
| 838 | Ga0501070_0177793 | 3300049586 | Bacteria | 1752 |
| 839 | Ga0501071_0004141 | 3300049587 | Bacteria | 9167 |
| 840 | Ga0501071_0127666 | 3300049587 | Bacteria | 1888 |
| 841 | Ga0501071_0129094 | 3300049587 | Bacteria | 1877 |
| 842 | Ga0501071_0142169 | 3300049587 | Bacteria | 1787 |
| 843 | Ga0501071_0209744 | 3300049587 | Bacteria | 1464 |
| 844 | Ga0501072_0033214 | 3300049588 | Bacteria | 4043 |
| 845 | Ga0501072_0197181 | 3300049588 | Bacteria | 1605 |
| 846 | Ga0501073_0000354 | 3300049589 | Bacteria | 30944 |
| 847 | Ga0501073_0002948 | 3300049589 | Bacteria | 12757 |
| 848 | Ga0501073_0024753 | 3300049589 | Bacteria | 4309 |
| 849 | Ga0501073_0086766 | 3300049589 | Bacteria | 2177 |
| 850 | Ga0501073_0196038 | 3300049589 | Bacteria | 1397 |
| 851 | Ga0501073_0228288 | 3300049589 | Bacteria | 1286 |
| 852 | Ga0501074_0000312 | 3300049590 | Bacteria | 28193 |
| 853 | Ga0501074_0024638 | 3300049590 | Bacteria | 4371 |
| 854 | Ga0501074_0348418 | 3300049590 | Bacteria | 1051 |
| 855 | Ga0501074_0621154 | 3300049590 | Bacteria | 764 |
| 856 | Ga0501075_0005964 | 3300049591 | Bacteria | 8340 |
| 857 | Ga0501075_0422032 | 3300049591 | Bacteria | 1017 |
| 858 | Ga0501075_0425507 | 3300049591 | Bacteria | 1012 |
| 859 | Ga0501076_0004420 | 3300049592 | Bacteria | 9993 |
| 860 | Ga0501076_0047971 | 3300049592 | Bacteria | 3377 |
| 861 | Ga0501076_0122604 | 3300049592 | Bacteria | 2105 |
| 862 | Ga0501076_0207484 | 3300049592 | Bacteria | 1601 |
| 863 | Ga0501077_0000763 | 3300049593 | Bacteria | 19440 |
| 864 | Ga0501077_0016718 | 3300049593 | Bacteria | 4626 |
| 865 | Ga0501077_0034724 | 3300049593 | Bacteria | 3210 |
| 866 | Ga0501077_0035885 | 3300049593 | Bacteria | 3157 |
| 867 | Ga0501077_0067830 | 3300049593 | Bacteria | 2262 |
| 868 | Ga0501079_0000416 | 3300049741 | Bacteria | 27691 |
| 869 | Ga0501079_0023458 | 3300049741 | Bacteria | 4734 |
| 870 | Ga0501079_0038892 | 3300049741 | Bacteria | 3669 |
| 871 | Ga0501079_0049616 | 3300049741 | Bacteria | 3239 |
| 872 | Ga0501080_0000288 | 3300049742 | Bacteria | 38150 |
| 873 | Ga0501080_0032384 | 3300049742 | Bacteria | 4875 |
| 874 | Ga0501080_0213526 | 3300049742 | Bacteria | 1768 |
| 875 | Ga0501080_0263409 | 3300049742 | Bacteria | 1570 |
| 876 | Ga0501080_0264558 | 3300049742 | Bacteria | 1566 |
| 877 | Ga0501080_0495604 | 3300049742 | Bacteria | 1092 |
| 878 | Ga0501081_0002528 | 3300049743 | Bacteria | 11534 |
| 879 | Ga0501081_0021643 | 3300049743 | Bacteria | 4292 |
| 880 | Ga0501081_0068931 | 3300049743 | Bacteria | 2463 |
| 881 | Ga0501081_0266500 | 3300049743 | Bacteria | 1252 |
| 882 | Ga0501081_0726194 | 3300049743 | Bacteria | 746 |
| 883 | Ga0501083_0012208 | 3300049744 | Bacteria | 6012 |
| 884 | Ga0501083_0030576 | 3300049744 | Bacteria | 3699 |
| 885 | Ga0501083_0363110 | 3300049744 | Bacteria | 941 |
| 886 | Ga0501035_0252243 | 3300049822 | Bacteria | 1498 |
| 887 | Ga0501035_0444927 | 3300049822 | Bacteria | 1073 |
| 888 | Ga0501044_0359580 | 3300049823 | Bacteria | 1374 |
| 889 | Ga0501045_0011647 | 3300049824 | Bacteria | 6176 |
| 890 | Ga0501045_0038111 | 3300049824 | Bacteria | 3496 |
| 891 | nmdc:mga05p37_73917_c1 | 3300050507 | Bacteria | 4195 |
| 892 | nmdc:mga06r32_207886_c1 | 3300050510 | Bacteria | 1945 |
| 893 | nmdc:mga06r32_928150_c1 | 3300050510 | Bacteria | 826 |
| 894 | nmdc:mga08y16_25639_c1 | 3300050511 | Bacteria | 6221 |
| 895 | nmdc:mga0n895_31803_c1 | 3300050512 | Bacteria | 5057 |
| 896 | nmdc:mga0n895_334905_c1 | 3300050512 | Unclassified | 1533 |
| 897 | nmdc:mga0rr50_64479_c1 | 3300050513 | Bacteria | 2771 |
| 898 | nmdc:mga0a205_83782_c1 | 3300050515 | Bacteria | 3080 |
| 899 | Ga0500583_0050881 | 3300053092 | Bacteria | 1923 |
| 900 | Ga0500651_0237921 | 3300053093 | Bacteria | 1063 |
| 901 | Ga0500650_0217867 | 3300053098 | Bacteria | 865 |
| 902 | Ga0500556_0000832 | 3300053104 | Bacteria | 17702 |
| 903 | Ga0500572_084023 | 3300053111 | Bacteria | 1001 |
| 904 | Ga0500595_013047 | 3300053119 | Bacteria | 3192 |
| 905 | Ga0500617_115863 | 3300053124 | Bacteria | 1113 |
| 906 | Ga0500642_0085015 | 3300053130 | Bacteria | 1458 |
| 907 | Ga0500658_0050308 | 3300053134 | Bacteria | 1700 |
| 908 | Ga0500559_0097151 | 3300053136 | Bacteria | 1354 |
| 909 | Ga0500588_0008772 | 3300053146 | Bacteria | 2376 |
| 910 | Ga0500616_0000032 | 3300053153 | Bacteria | 403673 |
| 911 | Ga0500637_0094930 | 3300053178 | Bacteria | 1728 |
| 912 | Ga0500637_0248420 | 3300053178 | Bacteria | 993 |
| 913 | Ga0500656_003982 | 3300053732 | Bacteria | 1408 |
| 914 | Ga0501084_0003146 | 3300054114 | Bacteria | 13347 |
| 915 | Ga0501084_0011147 | 3300054114 | Bacteria | 7447 |
| 916 | Ga0501084_0140951 | 3300054114 | Bacteria | 2030 |
| 917 | Ga0501084_0411268 | 3300054114 | Bacteria | 1143 |
| 918 | Ga0501082_0007253 | 3300060353 | Bacteria | 9562 |
| 919 | Ga0501082_0011156 | 3300060353 | Bacteria | 7725 |
| 920 | Ga0501082_0043748 | 3300060353 | Bacteria | 3863 |
| 921 | Ga0501082_0087751 | 3300060353 | Bacteria | 2684 |
| 922 | Ga0501082_0096568 | 3300060353 | Bacteria | 2555 |
| 923 | Ga0501082_0361114 | 3300060353 | Bacteria | 1267 |
| 924 | Ga0501082_0393002 | 3300060353 | Bacteria | 1210 |
| 925 | Ga0466962_0000274 | 3300061719 | Bacteria | 21720 |
| 926 | Ga0530510_0058651 | 3300061734 | Bacteria | 2784 |
| 927 | Ga0530510_0098454 | 3300061734 | Bacteria | 2138 |
| 928 | Ga0530510_0139126 | 3300061734 | Bacteria | 1788 |
| 929 | Ga0209983_1047248 | |||
| 930 | LJNas_1006710 | |||
| 931 | JGI25406J46586_10018088 | |||
| 932 | JGI25405J52794_10043613 | |||
| 933 | Ga0058863_11844869 | |||
| 934 | Ga0058862_12269979 | |||
| 935 | Ga0065707_10081860 | |||
| 936 | Ga0070676_10087705 | |||
| 937 | Ga0070683_100046808 | |||
| 938 | Ga0070683_100620753 | |||
| 939 | Ga0070690_100000080 | |||
| 940 | Ga0070690_100031279 | |||
| 941 | Ga0070690_100080282 | |||
| 942 | Ga0070690_100104574 | |||
| 943 | Ga0070670_100105025 | |||
| 944 | Ga0070670_100271138 | |||
| 945 | Ga0070677_10106392 | |||
| 946 | Ga0068869_100003796 | |||
| 947 | Ga0068869_100092370 | |||
| 948 | Ga0068869_100110673 | |||
| 949 | Ga0068869_100126351 | |||
| 950 | Ga0068869_100173890 | |||
| 951 | Ga0068869_100367538 | |||
| 952 | Ga0070666_10002263 | |||
| 953 | Ga0070666_10017354 | |||
| 954 | Ga0070666_10036532 | |||
| 955 | Ga0070666_10040441 | |||
| 956 | Ga0070666_10117184 | |||
| 957 | Ga0070680_100004584 | |||
| 958 | Ga0070680_100018917 | |||
| 959 | Ga0070680_100035070 | |||
| 960 | Ga0070680_100254255 | |||
| 961 | Ga0070680_100540353 | |||
| 962 | Ga0070682_100002647 | |||
| 963 | Ga0070682_100148739 | |||
| 964 | Ga0070682_100175204 | |||
| 965 | Ga0068868_100012821 | |||
| 966 | Ga0068868_100022904 | |||
| 967 | Ga0068868_100090622 | |||
| 968 | Ga0068868_100220621 | |||
| 969 | Ga0070660_100492125 | |||
| 970 | Ga0070689_100002723 | |||
| 971 | Ga0070689_100033954 | |||
| 972 | Ga0070689_100234357 | |||
| 973 | Ga0070691_10028184 | |||
| 974 | Ga0070661_100199867 | |||
| 975 | Ga0070668_100215334 | |||
| 976 | Ga0070669_100085574 | |||
| 977 | Ga0070675_100176608 | |||
| 978 | Ga0070675_100216685 | |||
| 979 | Ga0070675_100234591 | |||
| 980 | Ga0070675_100294295 | |||
| 981 | Ga0070671_100002412 | |||
| 982 | Ga0070671_100014343 | |||
| 983 | Ga0070671_100089766 | |||
| 984 | Ga0070671_100159722 | |||
| 985 | Ga0070674_100071717 | |||
| 986 | Ga0070674_100578820 | |||
| 987 | Ga0070673_100528229 | |||
| 988 | Ga0070673_100859055 | |||
| 989 | Ga0070659_100022764 | |||
| 990 | Ga0070667_100000212 | |||
| 991 | Ga0070667_100001034 | |||
| 992 | Ga0070667_100001547 | |||
| 993 | Ga0070709_10017438 | |||
| 994 | Ga0070709_10080581 | |||
| 995 | Ga0070714_100090501 | |||
| 996 | Ga0070714_100277381 | |||
| 997 | Ga0070714_100312443 | |||
| 998 | Ga0070713_100005361 | |||
| 999 | Ga0070713_100007460 | |||
| 1000 | Ga0070713_100105178 | |||
| 1001 | Ga0070713_100349366 | |||
| 1002 | Ga0070713_100439365 | |||
| 1003 | Ga0070701_10001290 | |||
| 1004 | Ga0070701_10005928 | |||
| 1005 | Ga0070711_100007331 | |||
| 1006 | Ga0070711_100059149 | |||
| 1007 | Ga0070711_100099637 | |||
| 1008 | Ga0070705_100043457 | |||
| 1009 | Ga0070705_100110172 | |||
| 1010 | Ga0070705_100389691 | |||
| 1011 | Ga0070705_100503143 | |||
| 1012 | Ga0070700_100000310 | |||
| 1013 | Ga0070700_100001892 | |||
| 1014 | Ga0070700_100019535 | |||
| 1015 | Ga0070694_100037120 | |||
| 1016 | Ga0070694_100254726 | |||
| 1017 | Ga0070663_100108874 | |||
| 1018 | Ga0070663_100509209 | |||
| 1019 | Ga0070678_100004558 | |||
| 1020 | Ga0070678_100009811 | |||
| 1021 | Ga0070678_100242060 | |||
| 1022 | Ga0070678_100450708 | |||
| 1023 | Ga0070662_100422678 | |||
| 1024 | Ga0070681_10000723 | |||
| 1025 | Ga0070681_10009084 | |||
| 1026 | Ga0070681_10017799 | |||
| 1027 | Ga0070681_10023992 | |||
| 1028 | Ga0070681_10030007 | |||
| 1029 | Ga0070681_10049706 | |||
| 1030 | Ga0070681_10365804 | |||
| 1031 | Ga0070681_10454721 | |||
| 1032 | Ga0068867_100001409 | |||
| 1033 | Ga0068867_100060084 | |||
| 1034 | Ga0068867_100061504 | |||
| 1035 | Ga0070685_10039970 | |||
| 1036 | Ga0070685_10087509 | |||
| 1037 | Ga0070699_100065394 | |||
| 1038 | Ga0070679_100014468 | |||
| 1039 | Ga0070679_100074825 | |||
| 1040 | Ga0070684_100044338 | |||
| 1041 | Ga0068853_100007535 | |||
| 1042 | Ga0068853_100204285 | |||
| 1043 | Ga0068853_100210427 | |||
| 1044 | Ga0070672_100048889 | |||
| 1045 | Ga0070672_100058788 | |||
| 1046 | Ga0070672_100167044 | |||
| 1047 | Ga0070672_100376259 | |||
| 1048 | Ga0070672_100699371 | |||
| 1049 | Ga0070686_100000934 | |||
| 1050 | Ga0070695_100003973 | |||
| 1051 | Ga0070695_100004523 | |||
| 1052 | Ga0070695_100164279 | |||
| 1053 | Ga0070696_100000163 | |||
| 1054 | Ga0070665_100004229 | |||
| 1055 | Ga0070665_100005913 | |||
| 1056 | Ga0070665_100017225 | |||
| 1057 | Ga0070665_100018843 | |||
| 1058 | Ga0070665_100036349 | |||
| 1059 | Ga0070665_100086029 | |||
| 1060 | Ga0070665_100093836 | |||
| 1061 | Ga0070665_100103073 | |||
| 1062 | Ga0070665_100108173 | |||
| 1063 | Ga0070665_100166711 | |||
| 1064 | Ga0070665_100184669 | |||
| 1065 | Ga0070704_100013120 | |||
| 1066 | Ga0070704_100027068 | |||
| 1067 | Ga0070704_100079907 | |||
| 1068 | Ga0068855_100018297 | |||
| 1069 | Ga0068855_100021622 | |||
| 1070 | Ga0068855_100347336 | |||
| 1071 | Ga0068855_100409398 | |||
| 1072 | Ga0068855_100570491 | |||
| 1073 | Ga0070664_100031193 | |||
| 1074 | Ga0070664_100066064 | |||
| 1075 | Ga0070664_100125654 | |||
| 1076 | Ga0068857_100026685 | |||
| 1077 | Ga0068854_100138699 | |||
| 1078 | Ga0068854_100209995 | |||
| 1079 | Ga0068854_100412130 | |||
| 1080 | Ga0068856_100015128 | |||
| 1081 | Ga0068856_100834985 | |||
| 1082 | Ga0070702_100000571 | |||
| 1083 | Ga0070702_100000861 | |||
| 1084 | Ga0070702_100134904 | |||
| 1085 | Ga0070702_100135213 | |||
| 1086 | Ga0068852_100710185 | |||
| 1087 | Ga0068859_100000843 | |||
| 1088 | Ga0068859_100003716 | |||
| 1089 | Ga0068859_100008293 | |||
| 1090 | Ga0068859_100038840 | |||
| 1091 | Ga0068859_100067370 | |||
| 1092 | Ga0068859_100098708 | |||
| 1093 | Ga0068859_100112089 | |||
| 1094 | Ga0068859_100160418 | |||
| 1095 | Ga0068859_100221675 | |||
| 1096 | Ga0068859_100421147 | |||
| 1097 | Ga0068859_100674418 | |||
| 1098 | Ga0068864_100084083 | |||
| 1099 | Ga0068864_100180259 | |||
| 1100 | Ga0068864_100216729 | |||
| 1101 | Ga0068866_10002896 | |||
| 1102 | Ga0068866_10009953 | |||
| 1103 | Ga0068861_100003204 | |||
| 1104 | Ga0068861_100015315 | |||
| 1105 | Ga0068861_100052725 | |||
| 1106 | Ga0068861_100182788 | |||
| 1107 | Ga0068861_100233996 | |||
| 1108 | Ga0068851_10087029 | |||
| 1109 | Ga0068851_10188349 | |||
| 1110 | Ga0068870_10262942 | |||
| 1111 | Ga0068863_100008570 | |||
| 1112 | Ga0068863_100010255 | |||
| 1113 | Ga0068863_100023537 | |||
| 1114 | Ga0068863_100024412 | |||
| 1115 | Ga0068863_100062072 | |||
| 1116 | Ga0068863_100086378 | |||
| 1117 | Ga0068863_100109205 | |||
| 1118 | Ga0068863_100134057 | |||
| 1119 | Ga0068863_100435667 | |||
| 1120 | Ga0068858_100004273 | |||
| 1121 | Ga0068858_100006044 | |||
| 1122 | Ga0068858_100009698 | |||
| 1123 | Ga0068858_100026224 | |||
| 1124 | Ga0068858_100032532 | |||
| 1125 | Ga0068858_100033444 | |||
| 1126 | Ga0068858_100205891 | |||
| 1127 | Ga0068858_100808390 | |||
| 1128 | Ga0068860_100001786 | |||
| 1129 | Ga0068860_100008176 | |||
| 1130 | Ga0068860_100010532 | |||
| 1131 | Ga0068860_100030017 | |||
| 1132 | Ga0068860_100081466 | |||
| 1133 | Ga0068862_100003200 | |||
| 1134 | Ga0068862_100003815 | |||
| 1135 | Ga0068862_100072225 | |||
| 1136 | Ga0081455_10000999 | |||
| 1137 | Ga0081539_10000004 | |||
| 1138 | Ga0081539_10000455 | |||
| 1139 | Ga0070717_10004905 | |||
| 1140 | Ga0070715_10005326 | |||
| 1141 | Ga0070715_10113630 | |||
| 1142 | Ga0070716_100005267 | |||
| 1143 | Ga0070716_100013576 | |||
| 1144 | Ga0070716_100157021 | |||
| 1145 | Ga0070712_100040876 | |||
| 1146 | Ga0070712_100054978 | |||
| 1147 | Ga0097621_100000834 | |||
| 1148 | Ga0097621_100001687 | |||
| 1149 | Ga0097621_100009855 | |||
| 1150 | Ga0097621_100062041 | |||
| 1151 | Ga0097621_100240798 | |||
| 1152 | Ga0097621_100532496 | |||
| 1153 | Ga0097621_100847737 | |||
| 1154 | Ga0068871_100001505 | |||
| 1155 | Ga0068871_100004973 | |||
| 1156 | Ga0068871_100009699 | |||
| 1157 | Ga0068871_100016558 | |||
| 1158 | Ga0068871_100018232 | |||
| 1159 | Ga0068871_100042270 | |||
| 1160 | Ga0075428_100003524 | |||
| 1161 | Ga0075428_100556411 | |||
| 1162 | Ga0075431_100325947 | |||
| 1163 | Ga0075431_100953951 | |||
| 1164 | Ga0075433_10000324 | |||
| 1165 | Ga0075434_100138051 | |||
| 1166 | Ga0075434_100342418 | |||
| 1167 | Ga0068865_100009318 | |||
| 1168 | Ga0068865_100031899 | |||
| 1169 | Ga0068865_100062176 | |||
| 1170 | Ga0068865_100125545 | |||
| 1171 | Ga0068865_100280821 | |||
| 1172 | Ga0097620_100000843 | |||
| 1173 | Ga0097620_100003716 | |||
| 1174 | Ga0097620_100008293 | |||
| 1175 | Ga0097620_100038840 | |||
| 1176 | Ga0097620_100067371 | |||
| 1177 | Ga0097620_100098708 | |||
| 1178 | Ga0097620_100112086 | |||
| 1179 | Ga0097620_100119606 | |||
| 1180 | Ga0097620_100160418 | |||
| 1181 | Ga0097620_100221680 | |||
| 1182 | Ga0097620_100421146 | |||
| 1183 | Ga0097620_100674510 | |||
| 1184 | Ga0075435_100050136 | |||
| 1185 | Ga0099795_10000003 | |||
| 1186 | Ga0099795_10006725 | |||
| 1187 | Ga0105240_10011415 | |||
| 1188 | Ga0105240_10023413 | |||
| 1189 | Ga0105240_10051530 | |||
| 1190 | Ga0105240_10052801 | |||
| 1191 | Ga0105240_10057947 | |||
| 1192 | Ga0105240_10097032 | |||
| 1193 | Ga0105240_10147351 | |||
| 1194 | Ga0105240_10182115 | |||
| 1195 | Ga0105240_10210473 | |||
| 1196 | Ga0105240_10213605 | |||
| 1197 | Ga0105240_10579087 | |||
| 1198 | Ga0111539_10019535 | |||
| 1199 | Ga0111539_10056169 | |||
| 1200 | Ga0111539_10245427 | |||
| 1201 | Ga0105245_10000241 | |||
| 1202 | Ga0105245_10014455 | |||
| 1203 | Ga0105245_10039613 | |||
| 1204 | Ga0105245_10043198 | |||
| 1205 | Ga0105245_10319439 | |||
| 1206 | Ga0105245_10595095 | |||
| 1207 | Ga0105247_10001407 | |||
| 1208 | Ga0105247_10015485 | |||
| 1209 | Ga0105247_10026852 | |||
| 1210 | Ga0114129_10099698 | |||
| 1211 | Ga0114129_10272047 | |||
| 1212 | Ga0105243_10000390 | |||
| 1213 | Ga0105243_10081924 | |||
| 1214 | Ga0105243_10116369 | |||
| 1215 | Ga0105243_10713913 | |||
| 1216 | Ga0105241_10011725 | |||
| 1217 | Ga0105241_10050729 | |||
| 1218 | Ga0105241_10050819 | |||
| 1219 | Ga0105241_10361460 | |||
| 1220 | Ga0105242_10000924 | |||
| 1221 | Ga0105242_10006806 | |||
| 1222 | Ga0105242_10009861 | |||
| 1223 | Ga0105242_10031598 | |||
| 1224 | Ga0105242_10200366 | |||
| 1225 | Ga0105242_10266785 | |||
| 1226 | Ga0105248_10007003 | |||
| 1227 | Ga0105248_10010587 | |||
| 1228 | Ga0105248_10068368 | |||
| 1229 | Ga0105248_10070832 | |||
| 1230 | Ga0105248_10120087 | |||
| 1231 | Ga0105248_10161570 | |||
| 1232 | Ga0105248_10235155 | |||
| 1233 | Ga0105237_10016488 | |||
| 1234 | Ga0105237_10022706 | |||
| 1235 | Ga0105237_10050540 | |||
| 1236 | Ga0105237_10097015 | |||
| 1237 | Ga0105237_10122318 | |||
| 1238 | Ga0105237_10160502 | |||
| 1239 | Ga0105237_10179483 | |||
| 1240 | Ga0105237_10499523 | |||
| 1241 | Ga0105237_10733782 | |||
| 1242 | Ga0105238_10032211 | |||
| 1243 | Ga0105238_10053847 | |||
| 1244 | Ga0105238_10117391 | |||
| 1245 | Ga0105238_10128703 | |||
| 1246 | Ga0105238_10625608 | |||
| 1247 | Ga0105238_10908709 | |||
| 1248 | Ga0105249_10008116 | |||
| 1249 | Ga0105249_10014594 | |||
| 1250 | Ga0105249_10058567 | |||
| 1251 | Ga0105249_10105747 | |||
| 1252 | Ga0105249_10343826 | |||
| 1253 | Ga0105249_10417725 | |||
| 1254 | Ga0105249_10660151 | |||
| 1255 | Ga0105249_10773883 | |||
| 1256 | Ga0099796_10000041 | |||
| 1257 | Ga0099796_10006731 | |||
| 1258 | Ga0105239_10017634 | |||
| 1259 | Ga0105239_10048689 | |||
| 1260 | Ga0105239_10518644 | |||
| 1261 | Ga0105239_10522977 | |||
| 1262 | Ga0105239_10567294 | |||
| 1263 | Ga0105246_10811819 | |||
| 1264 | Ga0157370_10020459 | |||
| 1265 | Ga0157369_10087862 | |||
| 1266 | Ga0157369_10699858 | |||
| 1267 | Ga0157374_10023438 | |||
| 1268 | Ga0157374_10040531 | |||
| 1269 | Ga0157374_10052976 | |||
| 1270 | Ga0157374_10054379 | |||
| 1271 | Ga0157374_10114852 | |||
| 1272 | Ga0157374_10649025 | |||
| 1273 | Ga0157378_10000691 | |||
| 1274 | Ga0157378_10109872 | |||
| 1275 | Ga0157378_10118670 | |||
| 1276 | Ga0157378_10227812 | |||
| 1277 | Ga0163162_10012692 | |||
| 1278 | Ga0163162_10383906 | |||
| 1279 | Ga0163162_10505193 | |||
| 1280 | Ga0163162_10840748 | |||
| 1281 | Ga0157372_10101891 | |||
| 1282 | Ga0157372_10212833 | |||
| 1283 | Ga0157372_10746802 | |||
| 1284 | Ga0157375_10004334 | |||
| 1285 | Ga0157375_10053894 | |||
| 1286 | Ga0157375_10065624 | |||
| 1287 | Ga0157375_10157794 | |||
| 1288 | Ga0157375_10377945 | |||
| 1289 | Ga0163163_10004906 | |||
| 1290 | Ga0163163_10094226 | |||
| 1291 | Ga0163163_10128994 | |||
| 1292 | Ga0163163_10317545 | |||
| 1293 | Ga0163163_10360591 | |||
| 1294 | Ga0163163_10876396 | |||
| 1295 | Ga0157380_10004018 | |||
| 1296 | Ga0157380_10018655 | |||
| 1297 | Ga0157380_10060834 | |||
| 1298 | Ga0157380_10172802 | |||
| 1299 | Ga0157380_10182357 | |||
| 1300 | Ga0157377_10096364 | |||
| 1301 | Ga0157377_10367048 | |||
| 1302 | Ga0157379_10000686 | |||
| 1303 | Ga0157379_10010622 | |||
| 1304 | Ga0157379_10019884 | |||
| 1305 | Ga0157379_10032813 | |||
| 1306 | Ga0157379_10049209 | |||
| 1307 | Ga0157379_10060447 | |||
| 1308 | Ga0157376_10001295 | |||
| 1309 | Ga0157376_10023533 | |||
| 1310 | Ga0157376_10244311 | |||
| 1311 | Ga0213876_10041849 | |||
| 1312 | Ga0213876_10102416 | |||
| 1313 | Ga0213871_10027669 | |||
| 1314 | Ga0207656_10203620 | |||
| 1315 | Ga0207682_10043209 | |||
| 1316 | Ga0207642_10006290 | |||
| 1317 | Ga0207642_10037151 | |||
| 1318 | Ga0207642_10151652 | |||
| 1319 | Ga0207710_10000254 | |||
| 1320 | Ga0207710_10038731 | |||
| 1321 | Ga0207710_10097359 | |||
| 1322 | Ga0207688_10042071 | |||
| 1323 | Ga0207680_10009095 | |||
| 1324 | Ga0207680_10020199 | |||
| 1325 | Ga0207680_10132660 | |||
| 1326 | Ga0207685_10081513 | |||
| 1327 | Ga0207699_10047758 | |||
| 1328 | Ga0207699_10516279 | |||
| 1329 | Ga0207643_10175154 | |||
| 1330 | Ga0207643_10242879 | |||
| 1331 | Ga0207707_10002687 | |||
| 1332 | Ga0207707_10003643 | |||
| 1333 | Ga0207707_10007933 | |||
| 1334 | Ga0207707_10015246 | |||
| 1335 | Ga0207707_10037249 | |||
| 1336 | Ga0207707_10044100 | |||
| 1337 | Ga0207707_10065169 | |||
| 1338 | Ga0207695_10011439 | |||
| 1339 | Ga0207695_10022627 | |||
| 1340 | Ga0207695_10026932 | |||
| 1341 | Ga0207695_10034621 | |||
| 1342 | Ga0207695_10057119 | |||
| 1343 | Ga0207695_10106855 | |||
| 1344 | Ga0207695_10114790 | |||
| 1345 | Ga0207695_10155161 | |||
| 1346 | Ga0207695_10181217 | |||
| 1347 | Ga0207695_10239941 | |||
| 1348 | Ga0207695_10398930 | |||
| 1349 | Ga0207671_10013547 | |||
| 1350 | Ga0207671_10085239 | |||
| 1351 | Ga0207671_10159585 | |||
| 1352 | Ga0207671_10209065 | |||
| 1353 | Ga0207693_10001960 | |||
| 1354 | Ga0207693_10025310 | |||
| 1355 | Ga0207693_10109947 | |||
| 1356 | Ga0207663_10010099 | |||
| 1357 | Ga0207663_10022025 | |||
| 1358 | Ga0207663_10123191 | |||
| 1359 | Ga0207660_10044651 | |||
| 1360 | Ga0207660_10243009 | |||
| 1361 | Ga0207662_10199413 | |||
| 1362 | Ga0207652_10001709 | |||
| 1363 | Ga0207652_10028327 | |||
| 1364 | Ga0207652_10153571 | |||
| 1365 | Ga0207681_10373286 | |||
| 1366 | Ga0207694_10090625 | |||
| 1367 | Ga0207694_10118005 | |||
| 1368 | Ga0207694_10138988 | |||
| 1369 | Ga0207694_10185523 | |||
| 1370 | Ga0207694_10442269 | |||
| 1371 | Ga0207694_10445533 | |||
| 1372 | Ga0207650_10120861 | |||
| 1373 | Ga0207659_10128349 | |||
| 1374 | Ga0207659_10129183 | |||
| 1375 | Ga0207659_10164117 | |||
| 1376 | Ga0207687_10000799 | |||
| 1377 | Ga0207687_10500948 | |||
| 1378 | Ga0207700_10117537 | |||
| 1379 | Ga0207700_10140737 | |||
| 1380 | Ga0207664_10065833 | |||
| 1381 | Ga0207644_10002165 | |||
| 1382 | Ga0207644_10040094 | |||
| 1383 | Ga0207644_10082590 | |||
| 1384 | Ga0207690_10219530 | |||
| 1385 | Ga0207706_10228197 | |||
| 1386 | Ga0207706_10456286 | |||
| 1387 | Ga0207686_10004205 | |||
| 1388 | Ga0207686_10044281 | |||
| 1389 | Ga0207686_10116623 | |||
| 1390 | Ga0207686_10220013 | |||
| 1391 | Ga0207709_10011405 | |||
| 1392 | Ga0207709_10104822 | |||
| 1393 | Ga0207670_10015764 | |||
| 1394 | Ga0207670_10032804 | |||
| 1395 | Ga0207670_10137220 | |||
| 1396 | Ga0207669_10240988 | |||
| 1397 | Ga0207669_10349811 | |||
| 1398 | Ga0207669_10652270 | |||
| 1399 | Ga0207704_10019972 | |||
| 1400 | Ga0207704_10088835 | |||
| 1401 | Ga0207704_10103558 | |||
| 1402 | Ga0207665_10002487 | |||
| 1403 | Ga0207665_10020929 | |||
| 1404 | Ga0207665_10519013 | |||
| 1405 | Ga0207691_10180798 | |||
| 1406 | Ga0207691_10462632 | |||
| 1407 | Ga0207691_10782717 | |||
| 1408 | Ga0207711_10004364 | |||
| 1409 | Ga0207711_10054984 | |||
| 1410 | Ga0207711_10158514 | |||
| 1411 | Ga0207711_10451837 | |||
| 1412 | Ga0207689_10000452 | |||
| 1413 | Ga0207689_10000820 | |||
| 1414 | Ga0207689_10012333 | |||
| 1415 | Ga0207689_10061364 | |||
| 1416 | Ga0207689_10118926 | |||
| 1417 | Ga0207689_10305007 | |||
| 1418 | Ga0207689_10403972 | |||
| 1419 | Ga0207689_10546769 | |||
| 1420 | Ga0207689_10629026 | |||
| 1421 | Ga0207661_10061726 | |||
| 1422 | Ga0207661_10548020 | |||
| 1423 | Ga0207679_10051005 | |||
| 1424 | Ga0207679_10237496 | |||
| 1425 | Ga0207667_10014281 | |||
| 1426 | Ga0207667_10016556 | |||
| 1427 | Ga0207667_10049000 | |||
| 1428 | Ga0207667_10246814 | |||
| 1429 | Ga0207667_10507353 | |||
| 1430 | Ga0207651_10212160 | |||
| 1431 | Ga0207651_10273061 | |||
| 1432 | Ga0207651_10419508 | |||
| 1433 | Ga0207712_10036268 | |||
| 1434 | Ga0207712_10362992 | |||
| 1435 | Ga0207712_10432482 | |||
| 1436 | Ga0207668_10405728 | |||
| 1437 | Ga0207640_10752712 | |||
| 1438 | Ga0207658_10000161 | |||
| 1439 | Ga0207658_10014587 | |||
| 1440 | Ga0207658_10095196 | |||
| 1441 | Ga0207658_10153020 | |||
| 1442 | Ga0207658_10224081 | |||
| 1443 | Ga0207677_10019760 | |||
| 1444 | Ga0207677_10234756 | |||
| 1445 | Ga0207677_10335053 | |||
| 1446 | Ga0207677_10396565 | |||
| 1447 | Ga0207703_10000183 | |||
| 1448 | Ga0207703_10003754 | |||
| 1449 | Ga0207703_10028778 | |||
| 1450 | Ga0207703_10037902 | |||
| 1451 | Ga0207703_10055425 | |||
| 1452 | Ga0207703_11042141 | |||
| 1453 | Ga0207639_10160583 | |||
| 1454 | Ga0207678_10113068 | |||
| 1455 | Ga0207678_10132002 | |||
| 1456 | Ga0207678_10166675 | |||
| 1457 | Ga0207708_10000701 | |||
| 1458 | Ga0207708_10001120 | |||
| 1459 | Ga0207708_10029337 | |||
| 1460 | Ga0207702_10133671 | |||
| 1461 | Ga0207641_10003340 | |||
| 1462 | Ga0207641_10019717 | |||
| 1463 | Ga0207641_10025434 | |||
| 1464 | Ga0207641_10127277 | |||
| 1465 | Ga0207641_10156278 | |||
| 1466 | Ga0207641_10341755 | |||
| 1467 | Ga0207641_10383221 | |||
| 1468 | Ga0207648_10000159 | |||
| 1469 | Ga0207648_10029915 | |||
| 1470 | Ga0207648_10717182 | |||
| 1471 | Ga0207676_10080765 | |||
| 1472 | Ga0207676_10174651 | |||
| 1473 | Ga0207676_10442120 | |||
| 1474 | Ga0207676_10662515 | |||
| 1475 | Ga0207674_10007918 | |||
| 1476 | Ga0207674_10700144 | |||
| 1477 | Ga0207674_10919100 | |||
| 1478 | Ga0207675_100000068 | |||
| 1479 | Ga0207675_100027528 | |||
| 1480 | Ga0207675_100084865 | |||
| 1481 | Ga0207675_100130112 | |||
| 1482 | Ga0207675_100133172 | |||
| 1483 | Ga0207675_100134829 | |||
| 1484 | Ga0207675_100270540 | |||
| 1485 | Ga0207683_10003248 | |||
| 1486 | Ga0207683_10013172 | |||
| 1487 | Ga0207683_10110409 | |||
| 1488 | Ga0207683_10141192 | |||
| 1489 | Ga0207683_10344376 | |||
| 1490 | Ga0207698_10590357 | |||
| 1491 | Ga0209179_1000050 | |||
| 1492 | Ga0209179_1025240 | |||
| 1493 | Ga0207428_10010959 | |||
| 1494 | Ga0265354_1001907 | |||
| 1495 | Ga0265356_1000692 | |||
| 1496 | Ga0265357_1008995 | |||
| 1497 | Ga0265355_1000468 | |||
| 1498 | Ga0268266_10003316 | |||
| 1499 | Ga0268266_10003994 | |||
| 1500 | Ga0268266_10023651 | |||
| 1501 | Ga0268266_10025879 | |||
| 1502 | Ga0268266_10033156 | |||
| 1503 | Ga0268266_10036945 | |||
| 1504 | Ga0268266_10047212 | |||
| 1505 | Ga0268266_10135535 | |||
| 1506 | Ga0268266_10176161 | |||
| 1507 | Ga0268266_10186357 | |||
| 1508 | Ga0268266_10217385 | |||
| 1509 | Ga0268265_10004185 | |||
| 1510 | Ga0268265_10018361 | |||
| 1511 | Ga0268264_10000057 | |||
| 1512 | Ga0268264_10007801 | |||
| 1513 | Ga0268264_10110767 | |||
| 1514 | Ga0268264_10123709 | |||
| 1515 | Ga0265326_10017517 | |||
| 1516 | Ga0265319_1013375 | |||
| 1517 | Ga0265319_1056620 | |||
| 1518 | Ga0265334_10000857 | |||
| 1519 | Ga0265334_10002212 | |||
| 1520 | Ga0265318_10002664 | |||
| 1521 | Ga0265318_10042664 | |||
| 1522 | Ga0307515_10002761 | |||
| 1523 | Ga0265338_10004528 | |||
| 1524 | Ga0265338_10026969 | |||
| 1525 | Ga0265338_10065785 | |||
| 1526 | Ga0265338_10149536 | |||
| 1527 | Ga0307511_10000342 | |||
| 1528 | Ga0307511_10009381 | |||
| 1529 | Ga0265760_10000114 | |||
| 1530 | Ga0265760_10038943 | |||
| 1531 | Ga0265330_10009844 | |||
| 1532 | Ga0265330_10022236 | |||
| 1533 | Ga0265332_10009238 | |||
| 1534 | Ga0265328_10016712 | |||
| 1535 | Ga0265328_10059949 | |||
| 1536 | Ga0265320_10003107 | |||
| 1537 | Ga0265320_10022086 | |||
| 1538 | Ga0265325_10031059 | |||
| 1539 | Ga0265329_10025430 | |||
| 1540 | Ga0265329_10042006 | |||
| 1541 | Ga0265340_10022248 | |||
| 1542 | Ga0265340_10031844 | |||
| 1543 | Ga0265340_10061435 | |||
| 1544 | Ga0265340_10068498 | |||
| 1545 | Ga0265339_10039584 | |||
| 1546 | Ga0265339_10045506 | |||
| 1547 | Ga0265339_10095696 | |||
| 1548 | Ga0265331_10011650 | |||
| 1549 | Ga0265331_10019927 | |||
| 1550 | Ga0265316_10023141 | |||
| 1551 | Ga0307513_10021506 | |||
| 1552 | Ga0307509_10115911 | |||
| 1553 | Ga0307509_10271312 | |||
| 1554 | Ga0307509_10462900 | |||
| 1555 | Ga0307408_100247801 | |||
| 1556 | Ga0307408_100275651 | |||
| 1557 | Ga0265313_10016630 | |||
| 1558 | Ga0265313_10017082 | |||
| 1559 | Ga0265313_10053240 | |||
| 1560 | Ga0316575_10035881 | |||
| 1561 | Ga0265314_10006771 | |||
| 1562 | Ga0265314_10144520 | |||
| 1563 | Ga0265342_10043449 | |||
| 1564 | Ga0265342_10123029 | |||
| 1565 | Ga0316576_10012885 | |||
| 1566 | Ga0316576_10178428 | |||
| 1567 | Ga0316577_10135795 | |||
| 1568 | Ga0307413_10048731 | |||
| 1569 | Ga0307413_10590288 | |||
| 1570 | Ga0307413_10806444 | |||
| 1571 | Ga0307410_10003260 | |||
| 1572 | Ga0307410_10016809 | |||
| 1573 | Ga0307410_10048743 | |||
| 1574 | Ga0307406_10048172 | |||
| 1575 | Ga0307406_10079936 | |||
| 1576 | Ga0307406_10206172 | |||
| 1577 | Ga0307407_10371424 | |||
| 1578 | Ga0307412_10122563 | |||
| 1579 | Ga0307412_10299648 | |||
| 1580 | Ga0307409_100001941 | |||
| 1581 | Ga0307409_100307691 | |||
| 1582 | Ga0307409_100338872 | |||
| 1583 | Ga0307409_100391037 | |||
| 1584 | Ga0307416_100018740 | |||
| 1585 | Ga0307416_100108907 | |||
| 1586 | Ga0307411_10000393 | |||
| 1587 | Ga0307411_10002266 | |||
| 1588 | Ga0307411_10045875 | |||
| 1589 | Ga0307411_10763250 | |||
| 1590 | Ga0307415_100005339 | |||
| 1591 | Ga0307415_100035377 | |||
| 1592 | Ga0307415_100189344 | |||
| 1593 | Ga0307415_100347429 | |||
| 1594 | Ga0307415_100458643 | |||
| 1595 | Ga0307510_10000014 | |||
| 1596 | Ga0307510_10151447 | |||
| 1597 | Ga0373936_0006833 | |||
| 1598 | Ga0373945_0039480 | |||
| 1599 | Ga0373953_0129527 | |||
| 1600 | Ga0373956_0283054 | |||
| 1601 | Ga0373943_0035647 | |||
| 1602 | Ga0373955_0029676 | |||
| 1603 | Ga0373955_0030134 | |||
| 1604 | Ga0373955_0354915 | |||
| 1605 | Ga0316574_0084385 | |||
| 1606 | Ga0373924_0107488 | |||
| 1607 | Ga0373924_0140881 | |||
| 1608 | Ga0373927_0044984 | |||
| 1609 | Ga0373927_0433496 | |||
| 1610 | Ga0373933_0113593 | |||
| 1611 | Ga0373933_0158812 | |||
| 1612 | Ga0373937_0003142 | |||
| 1613 | Ga0373937_0205299 | |||
| 1614 | Ga0373937_0246467 | |||
| 1615 | Ga0373937_0773291 | |||
| 1616 | Ga0373925_0007403 | |||
| 1617 | Ga0395898_0013822 | |||
| 1618 | Ga0395898_0061276 | |||
| 1619 | Ga0395898_0438703 | |||
| 1620 | Ga0436365_1867186 | |||
| 1621 | Ga0436360_0672319 | |||
| 1622 | Ga0436360_0674475 | |||
| 1623 | Ga0436360_0822925 | |||
| 1624 | Ga0436363_0487320 | |||
| 1625 | Ga0436363_0731737 | |||
| 1626 | Ga0436363_0829074 | |||
| 1627 | Ga0436363_0951456 | |||
| 1628 | Ga0436362_0298024 | |||
| 1629 | Ga0436362_1062550 | |||
| 1630 | Ga0451793_0109096 | |||
| 1631 | Ga0451798_0977305 | |||
| 1632 | Ga0451802_1913096 | |||
| 1633 | Ga0451804_0964549 | |||
| 1634 | Ga0451807_0912795 | |||
| 1635 | Ga0451807_1119766 | |||
| 1636 | Ga0451807_1884568 | |||
| 1637 | Ga0439442_035348 | |||
| 1638 | Ga0450919_013650 | |||
| 1639 | Ga0450920_000747 | |||
| 1640 | Ga0450923_004656 | |||
| 1641 | Ga0450895_000370 | |||
| 1642 | Ga0450907_002187 | |||
| 1643 | Ga0439446_0018399 | |||
| 1644 | Ga0450908_001358 | |||
| 1645 | Ga0450908_002745 | |||
| 1646 | Ga0439435_0001503 | |||
| 1647 | Ga0450916_007558 | |||
| 1648 | Ga0451577_0482104 | |||
| 1649 | Ga0466969_0002463 | |||
| 1650 | Ga0466969_0075929 | |||
| 1651 | Ga0466966_0000445 | |||
| 1652 | Ga0466961_0003001 | |||
| 1653 | Ga0466964_0000891 | |||
| 1654 | Ga0466971_0000422 | |||
| 1655 | Ga0466970_0003326 | |||
| 1656 | Ga0466957_0008510 | |||
| 1657 | Ga0466959_0001134 | |||
| 1658 | Ga0466959_0001608 | |||
| 1659 | Ga0466959_0338922 | |||
| 1660 | Ga0466958_0090934 | |||
| 1661 | Ga0495590_0001849 | |||
| 1662 | Ga0495638_0015464 | |||
| 1663 | Ga0495638_0321160 | |||
| 1664 | Ga0495580_0002794 | |||
| 1665 | Ga0495616_0006441 | |||
| 1666 | Ga0495616_0058498 | |||
| 1667 | Ga0495630_0044191 | |||
| 1668 | Ga0495632_0061959 | |||
| 1669 | Ga0495632_0186105 | |||
| 1670 | Ga0495644_0086341 | |||
| 1671 | Ga0495587_0057280 | |||
| 1672 | Ga0495668_0310580 | |||
| 1673 | Ga0495634_0201614 | |||
| 1674 | Ga0495625_0101221 | |||
| 1675 | Ga0495647_0000569 | |||
| 1676 | Ga0495647_0042301 | |||
| 1677 | Ga0495658_0104373 | |||
| 1678 | Ga0495658_0197517 | |||
| 1679 | Ga0495669_0087440 | |||
| 1680 | Ga0495669_0133375 | |||
| 1681 | Ga0495600_0167815 | |||
| 1682 | Ga0495581_0341442 | |||
| 1683 | Ga0495674_0459910 | |||
| 1684 | Ga0495687_032802 | |||
| 1685 | Ga0495687_057296 | |||
| 1686 | Ga0495602_0087833 | |||
| 1687 | Ga0496100_0021760 | |||
| 1688 | Ga0496100_0045455 | |||
| 1689 | Ga0496101_0300785 | |||
| 1690 | Ga0496102_0005483 | |||
| 1691 | Ga0496102_0057549 | |||
| 1692 | Ga0496102_0170300 | |||
| 1693 | Ga0496103_0056956 | |||
| 1694 | Ga0496103_0105197 | |||
| 1695 | Ga0496104_0000384 | |||
| 1696 | Ga0496104_0014083 | |||
| 1697 | Ga0496104_0161086 | |||
| 1698 | Ga0496104_0471642 | |||
| 1699 | Ga0496105_0007758 | |||
| 1700 | Ga0496105_0020969 | |||
| 1701 | Ga0496105_0634819 | |||
| 1702 | Ga0496106_0003443 | |||
| 1703 | Ga0496108_0014413 | |||
| 1704 | Ga0496108_0039863 | |||
| 1705 | Ga0496109_0012359 | |||
| 1706 | Ga0496109_0015937 | |||
| 1707 | Ga0496109_0399823 | |||
| 1708 | Ga0496110_0000305 | |||
| 1709 | Ga0496111_0040202 | |||
| 1710 | Ga0496111_0060107 | |||
| 1711 | Ga0496112_0082332 | |||
| 1712 | Ga0496112_0156128 | |||
| 1713 | Ga0496112_0329744 | |||
| 1714 | Ga0496113_0095889 | |||
| 1715 | Ga0496114_0002619 | |||
| 1716 | Ga0496114_0012105 | |||
| 1717 | Ga0496114_0016037 | |||
| 1718 | Ga0496114_0255037 | |||
| 1719 | Ga0496115_0029559 | |||
| 1720 | Ga0496115_0113373 | |||
| 1721 | Ga0496115_0193080 | |||
| 1722 | Ga0496116_0052603 | |||
| 1723 | Ga0496117_0000156 | |||
| 1724 | Ga0496118_0000005 | |||
| 1725 | Ga0496118_0077926 | |||
| 1726 | Ga0496119_0003677 | |||
| 1727 | Ga0496119_0013116 | |||
| 1728 | Ga0496120_0000173 | |||
| 1729 | Ga0496120_0109581 | |||
| 1730 | Ga0496121_0000371 | |||
| 1731 | Ga0496121_0078632 | |||
| 1732 | Ga0496124_0147290 | |||
| 1733 | Ga0496125_0000918 | |||
| 1734 | Ga0496125_0003733 | |||
| 1735 | Ga0496125_0033402 | |||
| 1736 | Ga0496125_0064565 | |||
| 1737 | Ga0496126_0002970 | |||
| 1738 | Ga0496126_0026348 | |||
| 1739 | Ga0496126_0164842 | |||
| 1740 | Ga0496126_0220917 | |||
| 1741 | Ga0495678_074582 | |||
| 1742 | Ga0501031_0285158 | |||
| 1743 | Ga0501034_0366114 | |||
| 1744 | Ga0501036_0030406 | |||
| 1745 | Ga0501036_0066537 | |||
| 1746 | Ga0501036_0085648 | |||
| 1747 | Ga0501039_0065775 | |||
| 1748 | Ga0501039_0082112 | |||
| 1749 | Ga0501039_0100112 | |||
| 1750 | Ga0501039_0265762 | |||
| 1751 | Ga0501040_0029617 | |||
| 1752 | Ga0501040_0052546 | |||
| 1753 | Ga0501041_0001021 | |||
| 1754 | Ga0501041_0022279 | |||
| 1755 | Ga0501041_0032386 | |||
| 1756 | Ga0501041_0063684 | |||
| 1757 | Ga0501042_0013426 | |||
| 1758 | Ga0501042_0017774 | |||
| 1759 | Ga0501042_0051784 | |||
| 1760 | Ga0501048_0041720 | |||
| 1761 | Ga0501048_0062614 | |||
| 1762 | Ga0501068_0000431 | |||
| 1763 | Ga0501068_0000509 | |||
| 1764 | Ga0501068_0039227 | |||
| 1765 | Ga0501069_0253874 | |||
| 1766 | Ga0501070_0177793 | |||
| 1767 | Ga0501071_0004141 | |||
| 1768 | Ga0501071_0127666 | |||
| 1769 | Ga0501071_0129094 | |||
| 1770 | Ga0501071_0142169 | |||
| 1771 | Ga0501071_0209744 | |||
| 1772 | Ga0501072_0033214 | |||
| 1773 | Ga0501072_0197181 | |||
| 1774 | Ga0501073_0000354 | |||
| 1775 | Ga0501073_0002948 | |||
| 1776 | Ga0501073_0024753 | |||
| 1777 | Ga0501073_0086766 | |||
| 1778 | Ga0501073_0196038 | |||
| 1779 | Ga0501073_0228288 | |||
| 1780 | Ga0501074_0000312 | |||
| 1781 | Ga0501074_0024638 | |||
| 1782 | Ga0501074_0348418 | |||
| 1783 | Ga0501074_0621154 | |||
| 1784 | Ga0501075_0005964 | |||
| 1785 | Ga0501075_0422032 | |||
| 1786 | Ga0501075_0425507 | |||
| 1787 | Ga0501076_0004420 | |||
| 1788 | Ga0501076_0047971 | |||
| 1789 | Ga0501076_0122604 | |||
| 1790 | Ga0501076_0207484 | |||
| 1791 | Ga0501077_0000763 | |||
| 1792 | Ga0501077_0016718 | |||
| 1793 | Ga0501077_0034724 | |||
| 1794 | Ga0501077_0035885 | |||
| 1795 | Ga0501077_0067830 | |||
| 1796 | Ga0501079_0000416 | |||
| 1797 | Ga0501079_0023458 | |||
| 1798 | Ga0501079_0038892 | |||
| 1799 | Ga0501079_0049616 | |||
| 1800 | Ga0501080_0000288 | |||
| 1801 | Ga0501080_0032384 | |||
| 1802 | Ga0501080_0213526 | |||
| 1803 | Ga0501080_0263409 | |||
| 1804 | Ga0501080_0264558 | |||
| 1805 | Ga0501080_0495604 | |||
| 1806 | Ga0501081_0002528 | |||
| 1807 | Ga0501081_0021643 | |||
| 1808 | Ga0501081_0068931 | |||
| 1809 | Ga0501081_0266500 | |||
| 1810 | Ga0501081_0726194 | |||
| 1811 | Ga0501083_0012208 | |||
| 1812 | Ga0501083_0030576 | |||
| 1813 | Ga0501083_0363110 | |||
| 1814 | Ga0501035_0252243 | |||
| 1815 | Ga0501035_0444927 | |||
| 1816 | Ga0501044_0359580 | |||
| 1817 | Ga0501045_0011647 | |||
| 1818 | Ga0501045_0038111 | |||
| 1819 | nmdc:mga05p37_73917_c1 | |||
| 1820 | nmdc:mga06r32_207886_c1 | |||
| 1821 | nmdc:mga06r32_928150_c1 | |||
| 1822 | nmdc:mga08y16_25639_c1 | |||
| 1823 | nmdc:mga0n895_31803_c1 | |||
| 1824 | nmdc:mga0n895_334905_c1 | |||
| 1825 | nmdc:mga0rr50_64479_c1 | |||
| 1826 | nmdc:mga0a205_83782_c1 | |||
| 1827 | Ga0500583_0050881 | |||
| 1828 | Ga0500651_0237921 | |||
| 1829 | Ga0500650_0217867 | |||
| 1830 | Ga0500556_0000832 | |||
| 1831 | Ga0500572_084023 | |||
| 1832 | Ga0500595_013047 | |||
| 1833 | Ga0500617_115863 | |||
| 1834 | Ga0500642_0085015 | |||
| 1835 | Ga0500658_0050308 | |||
| 1836 | Ga0500559_0097151 | |||
| 1837 | Ga0500588_0008772 | |||
| 1838 | Ga0500616_0000032 | |||
| 1839 | Ga0500637_0094930 | |||
| 1840 | Ga0500637_0248420 | |||
| 1841 | Ga0500656_003982 | |||
| 1842 | Ga0501084_0003146 | |||
| 1843 | Ga0501084_0011147 | |||
| 1844 | Ga0501084_0140951 | |||
| 1845 | Ga0501084_0411268 | |||
| 1846 | Ga0501082_0007253 | |||
| 1847 | Ga0501082_0011156 | |||
| 1848 | Ga0501082_0043748 | |||
| 1849 | Ga0501082_0087751 | |||
| 1850 | Ga0501082_0096568 | |||
| 1851 | Ga0501082_0361114 | |||
| 1852 | Ga0501082_0393002 | |||
| 1853 | Ga0466962_0000274 | |||
| 1854 | Ga0530510_0058651 | |||
| 1855 | Ga0530510_0098454 | |||
| 1856 | Ga0530510_0139126 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q25-assembly1.cif.gz_B | crystal structure of phou from pseudomonas aeruginosa | 0.9769 | 14 | 221 |
| 4q25-assembly1.cif.gz_B | crystal structure of phou from pseudomonas aeruginosa | 0.9677 | 14 | 221 |
| 1t72-assembly1.cif.gz_A | crystal structure of phosphate transport system protein phou from aquifex aeolicus | 0.9589 | 11 | 221 |
| 1sum-assembly1.cif.gz_B | crystal structure of a hypothetical protein at 2.0 a resolution | 0.9555 | 12 | 222 |
| 2i0m-assembly1.cif.gz_A | crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae | 0.9426 | 14 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4q25A02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9893 | 125 | 221 | 1.20.58.220 |
| 2i0mA01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9812 | 14 | 116 | 1.20.58.220 |
| 4q25B02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9807 | 125 | 221 | 1.20.58.220 |
| af_Q58415_1_113_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9723 | 13 | 115 | 1.20.58.220 |
| 4q25A02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9694 | 125 | 221 | 1.20.58.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1BVD0-F1-model_v4 | Phosphate transport system regulatory protein PhoU | 0.9866 | 27 | 180 |
GO:0003677
GO:0003918 GO:0005524 GO:0006265 GO:0030643 GO:0045936 |
| AF-A0A4Q3Y0K0-F1-model_v4 | deleted | 0.9805 | 1 | 195 |
|
| AF-A0A4Y3T7V7-F1-model_v4 | deleted | 0.9804 | 14 | 225 |
|
| AF-A0A101DJE4-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9798 | 14 | 225 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
| AF-A0A2D5QEV0-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9786 | 9 | 224 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |