F486394

General Info

Members Datasets Scaffolds Average Seq Length
943 315 1887 332

Family's Representative Sequence

Representative Sequence 3300049703|Ga0501219_000570|Ga0501219_000570_3272_4396
Length 374
Sequence VAIPAQIPACTSRQQDIPFGRWTLFPQICLRFMLPIQDLYPLLKTPRKVVITMHQKPDADAMGSALGLYHFLIQLGHHVTVISPTNWAKWLNWMPGCNKVVDFELTREKAESILKETEWVFCLDFNILLRTKHMAPIIKALDVTRILIDHHAQPDTPTFAYGVSDTTKSSTSEMIYDFIVNAGYKDLVNKEVAQCLYAGVMTDTGSFRFPAASAAVHRMIADFKDQGLDHTKVHEHIYDNYLENRLRFIGHVLLHRMEVYYEYNTALIAITKKDLLRYEIKTGDTEGLVNYPLSIQGIRLAAIVIDRDEERKWSFRSKGDFDVNTFARKYFEGGGHFNAAGGRSSASLEDTVEHFMQAIQENEAALQQERTSSN

Samples

Sample ID Description Type Environment
1 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
262 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
267 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
271 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
292 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 2738541278 Niastella sp. CF465 Isolate Unclassified
302 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
303 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
304 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
305 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
306 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
307 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
308 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
309 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
310 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
311 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
312 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
313 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
314 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
315 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 0.53
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501219_000570 3300049703 Bacteria 5389
2 MRS1b_contig_305419 2162886011 Bacteria 1173
3 JGI24740J21852_10015209 3300001979 Bacteria 2816
4 JGI24739J22299_10016692 3300001989 Bacteria 2654
5 JGI24744J21845_10020387 3300002077 Bacteria 1307
6 JGI25154J39366_1000202 3300002738 Bacteria 42933
7 JGI25158J39367_1007218 3300002739 Bacteria 1572
8 JGI25153J46596_10004261 3300003215 Bacteria 7742
9 rootH1_10028377 3300003316 Unclassified 1981
10 rootH2_10041831 3300003320 Bacteria 11217
11 rootH2_10088952 3300003320 Bacteria 3763
12 rootH2_10097470 3300003320 Bacteria 7940
13 rootH2_10170421 3300003320 Bacteria 5458
14 rootH2_10175738 3300003320 Bacteria 1645
15 rootH2_10188889 3300003320 Unclassified 2955
16 rootL2_10046167 3300003322 Bacteria 3328
17 rootL2_10073329 3300003322 Bacteria 3296
18 rootL2_10105999 3300003322 Bacteria 3198
19 rootL2_10124366 3300003322 Bacteria 5869
20 rootL2_10124367 3300003322 Bacteria 3670
21 rootL2_10235807 3300003322 Unclassified 1765
22 rootH1_10009908 3300003323 Bacteria 24135
23 rootH1_10011504 3300003323 Bacteria 2627
24 rootH1_10011519 3300003316 Bacteria 1319
25 rootH1_10011519 3300003323 Bacteria 7301
26 rootH1_10055264 3300003323 Bacteria 17621
27 rootH1_10081773 3300003323 Bacteria 2208
28 rootH1_10115930 3300003323 Bacteria 8260
29 JGI25160J50197_1001825 3300003354 Bacteria 10265
30 JGI25160J50197_1007286 3300003354 Bacteria 4349
31 Ga0055526_1017058 3300003771 Bacteria 2800
32 Ga0055528_1001774 3300003790 Bacteria 12382
33 Ga0065165_1000536 3300005262 Bacteria 57578
34 Ga0065165_1055388 3300005262 Bacteria 1107
35 Ga0065714_10022651 3300005288 Bacteria 1779
36 Ga0065704_10106193 3300005289 Bacteria 2090
37 Ga0065704_10126587 3300005289 Bacteria 1687
38 Ga0065712_10004890 3300005290 Bacteria 4771
39 Ga0065715_10148252 3300005293 Bacteria 1761
40 Ga0070658_10051423 3300005327 Bacteria 3339
41 Ga0070676_10001984 3300005328 Bacteria 10406
42 Ga0070676_10009689 3300005328 Bacteria 5210
43 Ga0070676_10034700 3300005328 Bacteria 2897
44 Ga0070683_100003213 3300005329 Bacteria 13195
45 Ga0070683_100011584 3300005329 Bacteria 7630
46 Ga0070683_100022517 3300005329 Bacteria 5632
47 Ga0070683_100045166 3300005329 Bacteria 4066
48 Ga0070690_100003637 3300005330 Bacteria 8488
49 Ga0070690_100060756 3300005330 Unclassified 2433
50 Ga0070670_100053915 3300005331 Bacteria 3452
51 Ga0070670_100055378 3300005331 Unclassified 3404
52 Ga0070670_100119394 3300005331 Bacteria 2274
53 Ga0070670_100175826 3300005331 Bacteria 1858
54 Ga0070670_100182610 3300005331 Bacteria 1822
55 Ga0070670_100215010 3300005331 Bacteria 1672
56 Ga0070670_100219576 3300005331 Bacteria 1653
57 Ga0070670_100359944 3300005331 Bacteria 1279
58 Ga0070670_100451206 3300005331 Bacteria 1140
59 Ga0070677_10014695 3300005333 Bacteria 2761
60 Ga0068869_100002528 3300005334 Bacteria 11039
61 Ga0068869_100008103 3300005334 Bacteria 6758
62 Ga0068869_100016690 3300005334 Unclassified 4953
63 Ga0068869_100022932 3300005334 Bacteria 4306
64 Ga0068869_100024531 3300005334 Bacteria 4177
65 Ga0068869_100040114 3300005334 Bacteria 3346
66 Ga0068869_100042374 3300005334 Bacteria 3263
67 Ga0068869_100053984 3300005334 Bacteria 2923
68 Ga0068869_100067094 3300005334 Bacteria 2646
69 Ga0068869_100083154 3300005334 Bacteria 2394
70 Ga0068869_100108366 3300005334 Bacteria 2110
71 Ga0068869_100127106 3300005334 Bacteria 1956
72 Ga0068869_100188517 3300005334 Bacteria 1621
73 Ga0070666_10000024 3300005335 Bacteria 161355
74 Ga0070666_10000782 3300005335 Bacteria 19260
75 Ga0070666_10017711 3300005335 Unclassified 4571
76 Ga0070666_10024808 3300005335 Unclassified 3909
77 Ga0070666_10069861 3300005335 Bacteria 2388
78 Ga0070666_10115292 3300005335 Bacteria 1860
79 Ga0070680_100000594 3300005336 Bacteria 24977
80 Ga0070680_100044954 3300005336 Bacteria 3589
81 Ga0070682_100000306 3300005337 Bacteria 34011
82 Ga0070682_100005351 3300005337 Bacteria 7143
83 Ga0070682_100006804 3300005337 Bacteria 6418
84 Ga0068868_100002309 3300005338 Bacteria 13196
85 Ga0068868_100006673 3300005338 Bacteria 8190
86 Ga0068868_100014084 3300005338 Bacteria 5887
87 Ga0068868_100018557 3300005338 Bacteria 5203
88 Ga0068868_100043871 3300005338 Unclassified 3494
89 Ga0068868_100045564 3300005338 Bacteria 3431
90 Ga0068868_100061234 3300005338 Bacteria 2981
91 Ga0068868_100062227 3300005338 Bacteria 2958
92 Ga0068868_100079155 3300005338 Bacteria 2633
93 Ga0068868_100101143 3300005338 Bacteria 2333
94 Ga0068868_100139929 3300005338 Bacteria 1986
95 Ga0070660_100007954 3300005339 Bacteria 7404
96 Ga0070660_100054699 3300005339 Bacteria 3082
97 Ga0070660_100093222 3300005339 Bacteria 2378
98 Ga0070660_100104875 3300005339 Bacteria 2243
99 Ga0070660_100156732 3300005339 Bacteria 1833
100 Ga0070660_100177165 3300005339 Bacteria 1724
101 Ga0070689_100003067 3300005340 Bacteria 11001
102 Ga0070689_100062416 3300005340 Bacteria 2899
103 Ga0070689_100095130 3300005340 Unclassified 2353
104 Ga0070689_100098657 3300005340 Bacteria 2311
105 Ga0070691_10005329 3300005341 Bacteria 5847
106 Ga0070687_100020390 3300005343 Unclassified 3099
107 Ga0070661_100004768 3300005344 Bacteria 9334
108 Ga0070661_100051883 3300005344 Bacteria 3002
109 Ga0070661_100095329 3300005344 Bacteria 2207
110 Ga0070661_100184397 3300005344 Unclassified 1589
111 Ga0070668_100000077 3300005347 Bacteria 60697
112 Ga0070668_100007250 3300005347 Bacteria 8223
113 Ga0070668_100084166 3300005347 Bacteria 2498
114 Ga0070668_100245623 3300005347 Bacteria 1484
115 Ga0070669_100007472 3300005353 Bacteria 7830
116 Ga0070669_100032967 3300005353 Bacteria 3744
117 Ga0070669_100033440 3300005353 Bacteria 3719
118 Ga0070669_100085527 3300005353 Unclassified 2355
119 Ga0070669_100127110 3300005353 Bacteria 1952
120 Ga0070675_100003118 3300005354 Bacteria 12537
121 Ga0070675_100019256 3300005354 Bacteria 5437
122 Ga0070675_100048228 3300005354 Unclassified 3491
123 Ga0070675_100081723 3300005354 Bacteria 2695
124 Ga0070675_100162110 3300005354 Bacteria 1923
125 Ga0070671_100019485 3300005355 Bacteria 5523
126 Ga0070671_100023754 3300005355 Bacteria 5018
127 Ga0070671_100050432 3300005355 Unclassified 3462
128 Ga0070671_100056674 3300005355 Bacteria 3260
129 Ga0070674_100052548 3300005356 Bacteria 2811
130 Ga0070673_100000458 3300005364 Bacteria 21582
131 Ga0070673_100005255 3300005364 Bacteria 8266
132 Ga0070673_100010574 3300005364 Bacteria 6252
133 Ga0070673_100013705 3300005364 Bacteria 5620
134 Ga0070673_100039228 3300005364 Bacteria 3623
135 Ga0070673_100070133 3300005364 Bacteria 2811
136 Ga0070673_100081086 3300005364 Unclassified 2630
137 Ga0070673_100153815 3300005364 Bacteria 1950
138 Ga0070688_100001769 3300005365 Bacteria 10810
139 Ga0070688_100014670 3300005365 Bacteria 4443
140 Ga0070688_100017681 3300005365 Bacteria 4096
141 Ga0070688_100108990 3300005365 Unclassified 1838
142 Ga0070659_100002170 3300005366 Bacteria 13976
143 Ga0070659_100005743 3300005366 Bacteria 8932
144 Ga0070659_100007759 3300005366 Bacteria 7805
145 Ga0070659_100016883 3300005366 Bacteria 5486
146 Ga0070659_100029344 3300005366 Bacteria 4250
147 Ga0070659_100072052 3300005366 Unclassified 2749
148 Ga0070659_100090709 3300005366 Bacteria 2449
149 Ga0070667_100000382 3300005367 Bacteria 48246
150 Ga0070667_100034349 3300005367 Bacteria 4243
151 Ga0070667_100077684 3300005367 Bacteria 2835
152 Ga0070667_100133846 3300005367 Bacteria 2166
153 Ga0070701_10100030 3300005438 Bacteria 1604
154 Ga0070663_100059620 3300005455 Bacteria 2743
155 Ga0070678_100038502 3300005456 Bacteria 3367
156 Ga0070678_100065559 3300005456 Unclassified 2697
157 Ga0070678_100105679 3300005456 Bacteria 2192
158 Ga0070678_100278779 3300005456 Bacteria 1413
159 Ga0070662_100021354 3300005457 Bacteria 4420
160 Ga0070662_100023594 3300005457 Bacteria 4227
161 Ga0070662_100028482 3300005457 Bacteria 3887
162 Ga0070662_100080643 3300005457 Bacteria 2423
163 Ga0070662_100134038 3300005457 Unclassified 1913
164 Ga0070681_10012525 3300005458 Bacteria 8417
165 Ga0070681_10024895 3300005458 Bacteria 6022
166 Ga0070681_10057753 3300005458 Bacteria 3861
167 Ga0070681_10058013 3300005458 Bacteria 3851
168 Ga0070681_10163426 3300005458 Bacteria 2150
169 Ga0068867_100029117 3300005459 Unclassified 3979
170 Ga0068867_100029264 3300005459 Bacteria 3968
171 Ga0068867_100054027 3300005459 Unclassified 2967
172 Ga0068867_100081605 3300005459 Bacteria 2438
173 Ga0068867_100124422 3300005459 Bacteria 1997
174 Ga0070685_10008317 3300005466 Bacteria 5326
175 Ga0070698_100004775 3300005471 Bacteria 14871
176 Ga0070698_100016643 3300005471 Bacteria 7760
177 Ga0070698_100040360 3300005471 Unclassified 4797
178 Ga0070698_100123380 3300005471 Bacteria 2548
179 Ga0070679_100027054 3300005530 Bacteria 5640
180 Ga0070679_100087084 3300005530 Bacteria 3110
181 Ga0070679_100173703 3300005530 Unclassified 2127
182 Ga0070684_100005358 3300005535 Bacteria 9829
183 Ga0070684_100054132 3300005535 Bacteria 3496
184 Ga0070684_100055125 3300005535 Bacteria 3464
185 Ga0068853_100002018 3300005539 Bacteria 15006
186 Ga0068853_100011817 3300005539 Bacteria 7098
187 Ga0068853_100011848 3300005539 Bacteria 7089
188 Ga0068853_100017276 3300005539 Bacteria 5955
189 Ga0068853_100042528 3300005539 Bacteria 3885
190 Ga0068853_100111113 3300005539 Unclassified 2435
191 Ga0068853_100161914 3300005539 Bacteria 2020
192 Ga0068853_100436742 3300005539 Unclassified 1230
193 Ga0070672_100000010 3300005543 Bacteria 84105
194 Ga0070672_100020432 3300005543 Bacteria 4830
195 Ga0070672_100027534 3300005543 Unclassified 4240
196 Ga0070672_100039837 3300005543 Bacteria 3602
197 Ga0070672_100060129 3300005543 Bacteria 2991
198 Ga0070672_100080786 3300005543 Bacteria 2605
199 Ga0070672_100129898 3300005543 Bacteria 2069
200 Ga0070686_100005054 3300005544 Bacteria 7283
201 Ga0070665_100000031 3300005548 Bacteria 333365
202 Ga0070665_100002045 3300005548 Bacteria 22705
203 Ga0068855_100000108 3300005563 Bacteria 103059
204 Ga0068855_100000732 3300005563 Bacteria 40298
205 Ga0068855_100012864 3300005563 Bacteria 10097
206 Ga0068855_100014994 3300005563 Bacteria 9334
207 Ga0068855_100019957 3300005563 Bacteria 8050
208 Ga0068855_100022269 3300005563 Bacteria 7593
209 Ga0068855_100042012 3300005563 Bacteria 5418
210 Ga0068855_100261154 3300005563 Bacteria 1929
211 Ga0070664_100013453 3300005564 Bacteria 6663
212 Ga0070664_100030559 3300005564 Unclassified 4495
213 Ga0070664_100045280 3300005564 Bacteria 3716
214 Ga0070664_100055778 3300005564 Bacteria 3356
215 Ga0070664_100080039 3300005564 Bacteria 2814
216 Ga0070664_100204228 3300005564 Bacteria 1764
217 Ga0068857_100001355 3300005577 Bacteria 19285
218 Ga0068857_100005870 3300005577 Bacteria 10483
219 Ga0068857_100026627 3300005577 Bacteria 5097
220 Ga0068857_100054793 3300005577 Bacteria 3539
221 Ga0068857_100115816 3300005577 Bacteria 2411
222 Ga0068857_100151221 3300005577 Bacteria 2103
223 Ga0068857_100434064 3300005577 Bacteria 1226
224 Ga0068854_100010810 3300005578 Bacteria 5923
225 Ga0068854_100094355 3300005578 Bacteria 2232
226 Ga0068854_100102519 3300005578 Unclassified 2147
227 Ga0068854_100152739 3300005578 Unclassified 1782
228 Ga0068856_100024579 3300005614 Bacteria 5865
229 Ga0068856_100177228 3300005614 Bacteria 2144
230 Ga0068856_100615091 3300005614 Bacteria 1107
231 Ga0070702_100020838 3300005615 Unclassified 3441
232 Ga0068852_100008954 3300005616 Bacteria 7408
233 Ga0068852_100011843 3300005616 Bacteria 6591
234 Ga0068852_100026755 3300005616 Unclassified 4694
235 Ga0068852_100032181 3300005616 Bacteria 4339
236 Ga0068852_100066504 3300005616 Bacteria 3148
237 Ga0068852_100071994 3300005616 Bacteria 3037
238 Ga0068852_100216697 3300005616 Unclassified 1819
239 Ga0068859_100000018 3300005617 Bacteria 248813
240 Ga0068859_100012863 3300005617 Bacteria 8406
241 Ga0068859_100027796 3300005617 Bacteria 5673
242 Ga0068859_100034823 3300005617 Bacteria 5053
243 Ga0068859_100046643 3300005617 Bacteria 4351
244 Ga0068859_100049098 3300005617 Bacteria 4238
245 Ga0068859_100052662 3300005617 Unclassified 4092
246 Ga0068864_100000389 3300005618 Bacteria 38410
247 Ga0068864_100004617 3300005618 Bacteria 11298
248 Ga0068864_100087906 3300005618 Bacteria 2736
249 Ga0068864_100133607 3300005618 Bacteria 2232
250 Ga0068864_100159238 3300005618 Bacteria 2051
251 Ga0068864_100198647 3300005618 Bacteria 1841
252 Ga0068864_100320961 3300005618 Bacteria 1455
253 Ga0068861_100001157 3300005719 Bacteria 16428
254 Ga0068861_100053405 3300005719 Bacteria 3074
255 Ga0068861_100057170 3300005719 Bacteria 2979
256 Ga0068861_100086839 3300005719 Bacteria 2460
257 Ga0068861_100143850 3300005719 Bacteria 1949
258 Ga0068861_100179902 3300005719 Bacteria 1759
259 Ga0068851_10000503 3300005834 Bacteria 17049
260 Ga0068851_10049868 3300005834 Bacteria 2125
261 Ga0068870_10006403 3300005840 Bacteria 5188
262 Ga0068863_100001416 3300005841 Bacteria 23764
263 Ga0068863_100012262 3300005841 Bacteria 8276
264 Ga0068863_100061353 3300005841 Bacteria 3555
265 Ga0068863_100069014 3300005841 Bacteria 3343
266 Ga0068863_100244281 3300005841 Bacteria 1733
267 Ga0068858_100002897 3300005842 Bacteria 17254
268 Ga0068858_100015268 3300005842 Bacteria 7227
269 Ga0068858_100060556 3300005842 Unclassified 3499
270 Ga0068858_100090976 3300005842 Bacteria 2840
271 Ga0068858_100198625 3300005842 Bacteria 1896
272 Ga0068860_100000072 3300005843 Bacteria 174997
273 Ga0068860_100006531 3300005843 Bacteria 11706
274 Ga0068860_100010513 3300005843 Bacteria 9150
275 Ga0068860_100013037 3300005843 Bacteria 8161
276 Ga0068860_100023829 3300005843 Bacteria 5917
277 Ga0068860_100023830 3300005843 Bacteria 5917
278 Ga0068860_100061726 3300005843 Bacteria 3561
279 Ga0068860_100069377 3300005843 Bacteria 3350
280 Ga0068860_100096179 3300005843 Bacteria 2823
281 Ga0068860_100159690 3300005843 Bacteria 2173
282 Ga0068860_100224908 3300005843 Bacteria 1823
283 Ga0068860_100463113 3300005843 Unclassified 1262
284 Ga0068862_100017201 3300005844 Bacteria 6017
285 Ga0068862_100031657 3300005844 Bacteria 4467
286 Ga0068862_100066075 3300005844 Bacteria 3116
287 Ga0068862_100187044 3300005844 Bacteria 1862
288 Ga0081539_10000899 3300005985 Bacteria 56635
289 Ga0075366_10030100 3300006195 Bacteria 3190
290 Ga0097621_100000122 3300006237 Bacteria 44726
291 Ga0097621_100002697 3300006237 Bacteria 12142
292 Ga0097621_100003855 3300006237 Bacteria 10385
293 Ga0097621_100028270 3300006237 Bacteria 4419
294 Ga0097621_100070050 3300006237 Bacteria 2895
295 Ga0097621_100213454 3300006237 Bacteria 1679
296 Ga0068871_100000412 3300006358 Bacteria 29568
297 Ga0068871_100001186 3300006358 Bacteria 17453
298 Ga0068871_100008450 3300006358 Bacteria 7407
299 Ga0068871_100010459 3300006358 Bacteria 6772
300 Ga0068871_100033468 3300006358 Bacteria 4070
301 Ga0068871_100057524 3300006358 Bacteria 3163
302 Ga0068871_100071524 3300006358 Bacteria 2853
303 Ga0068871_100220008 3300006358 Bacteria 1645
304 Ga0075428_100006899 3300006844 Bacteria 12614
305 Ga0075428_100008539 3300006844 Bacteria 11364
306 Ga0075430_100020469 3300006846 Bacteria 5628
307 Ga0075430_100081376 3300006846 Bacteria 2713
308 Ga0075431_100011318 3300006847 Bacteria 8987
309 Ga0075429_100012224 3300006880 Bacteria 7442
310 Ga0075429_100151805 3300006880 Bacteria 2028
311 Ga0068865_100004773 3300006881 Bacteria 8195
312 Ga0068865_100047126 3300006881 Bacteria 2960
313 Ga0068865_100049844 3300006881 Bacteria 2890
314 Ga0068865_100178757 3300006881 Bacteria 1632
315 Ga0097620_100000018 3300006931 Bacteria 248813
316 Ga0097620_100012863 3300006931 Bacteria 8406
317 Ga0097620_100027796 3300006931 Bacteria 5673
318 Ga0097620_100034824 3300006931 Bacteria 5053
319 Ga0097620_100046639 3300006931 Bacteria 4351
320 Ga0097620_100049103 3300006931 Bacteria 4238
321 Ga0097620_100052661 3300006931 Unclassified 4092
322 Ga0105251_10039608 3300009011 Bacteria 2301
323 Ga0105240_10000152 3300009093 Bacteria 141054
324 Ga0105240_10001109 3300009093 Bacteria 47404
325 Ga0105240_10002195 3300009093 Bacteria 31863
326 Ga0105240_10015841 3300009093 Bacteria 10228
327 Ga0105240_10023875 3300009093 Bacteria 8076
328 Ga0105240_10038968 3300009093 Bacteria 6091
329 Ga0105240_10045267 3300009093 Bacteria 5584
330 Ga0105240_10057451 3300009093 Bacteria 4861
331 Ga0105240_10081585 3300009093 Bacteria 3974
332 Ga0105240_10272185 3300009093 Bacteria 1949
333 Ga0105240_10302117 3300009093 Bacteria 1831
334 Ga0105240_10328061 3300009093 Bacteria 1742
335 Ga0105240_10497778 3300009093 Bacteria 1356
336 Ga0111539_10006032 3300009094 Bacteria 15656
337 Ga0111539_10015984 3300009094 Bacteria 9322
338 Ga0105247_10034255 3300009101 Bacteria 3093
339 Ga0105247_10277396 3300009101 Bacteria 1155
340 Ga0114129_10090762 3300009147 Bacteria 4234
341 Ga0114129_10144051 3300009147 Bacteria 3265
342 Ga0114129_10150623 3300009147 Bacteria 3184
343 Ga0105241_10000813 3300009174 Bacteria 23714
344 Ga0105241_10000893 3300009174 Bacteria 22522
345 Ga0105241_10001132 3300009174 Bacteria 20319
346 Ga0105241_10013390 3300009174 Bacteria 6011
347 Ga0105241_10213285 3300009174 Bacteria 1619
348 Ga0105241_10232474 3300009174 Unclassified 1555
349 Ga0105242_10043806 3300009176 Bacteria 3622
350 Ga0105242_10110984 3300009176 Bacteria 2338
351 Ga0105242_10161945 3300009176 Bacteria 1959
352 Ga0105242_10244724 3300009176 Bacteria 1614
353 Ga0105248_10189402 3300009177 Bacteria 2318
354 Ga0105237_10001480 3300009545 Bacteria 30945
355 Ga0105237_10004983 3300009545 Bacteria 15140
356 Ga0105237_10013064 3300009545 Bacteria 8720
357 Ga0105237_10016323 3300009545 Bacteria 7719
358 Ga0105237_10179837 3300009545 Bacteria 2115
359 Ga0105237_10243373 3300009545 Bacteria 1800
360 Ga0105237_10293737 3300009545 Bacteria 1628
361 Ga0105238_10003001 3300009551 Bacteria 16856
362 Ga0105238_10003918 3300009551 Bacteria 14774
363 Ga0105249_10001879 3300009553 Bacteria 18195
364 Ga0105249_10003364 3300009553 Bacteria 13842
365 Ga0105249_10003657 3300009553 Bacteria 13275
366 Ga0105249_10010234 3300009553 Bacteria 8236
367 Ga0105249_10020220 3300009553 Bacteria 5950
368 Ga0105249_10033600 3300009553 Bacteria 4645
369 Ga0105249_10122316 3300009553 Unclassified 2475
370 Ga0105249_10241071 3300009553 Bacteria 1788
371 Ga0105249_10294460 3300009553 Bacteria 1625
372 Ga0105239_10000596 3300010375 Bacteria 51547
373 Ga0105239_10020350 3300010375 Bacteria 7319
374 Ga0105239_10088598 3300010375 Bacteria 3412
375 Ga0105239_10141382 3300010375 Unclassified 2682
376 Ga0105239_10264157 3300010375 Bacteria 1935
377 Ga0105239_10357919 3300010375 Bacteria 1648
378 Ga0105246_10178567 3300011119 Unclassified 1632
379 Ga0105246_10304429 3300011119 Bacteria 1288
380 Ga0157373_10016489 3300013100 Bacteria 5387
381 Ga0157373_10036339 3300013100 Bacteria 3536
382 Ga0157373_10058483 3300013100 Unclassified 2733
383 Ga0157373_10065185 3300013100 Bacteria 2578
384 Ga0157373_10079985 3300013100 Bacteria 2305
385 Ga0157371_10000642 3300013102 Bacteria 41406
386 Ga0157371_10002222 3300013102 Bacteria 18778
387 Ga0157371_10003513 3300013102 Bacteria 14156
388 Ga0157371_10040430 3300013102 Bacteria 3330
389 Ga0157371_10045602 3300013102 Bacteria 3119
390 Ga0157371_10052236 3300013102 Bacteria 2903
391 Ga0157371_10052931 3300013102 Bacteria 2883
392 Ga0157371_10066274 3300013102 Bacteria 2557
393 Ga0157370_10002063 3300013104 Bacteria 24617
394 Ga0157370_10006351 3300013104 Bacteria 13053
395 Ga0157370_10022658 3300013104 Bacteria 6250
396 Ga0157370_10022981 3300013104 Bacteria 6197
397 Ga0157370_10035467 3300013104 Unclassified 4847
398 Ga0157370_10038922 3300013104 Bacteria 4598
399 Ga0157370_10132764 3300013104 Bacteria 2322
400 Ga0157370_10224545 3300013104 Unclassified 1739
401 Ga0157370_10407449 3300013104 Bacteria 1251
402 Ga0157370_10418920 3300013104 Bacteria 1232
403 Ga0157369_10008609 3300013105 Bacteria 11700
404 Ga0157369_10026680 3300013105 Bacteria 6405
405 Ga0157369_10029377 3300013105 Bacteria 6075
406 Ga0157369_10035700 3300013105 Bacteria 5449
407 Ga0157369_10129758 3300013105 Bacteria 2672
408 Ga0157369_10165532 3300013105 Bacteria 2332
409 Ga0157369_10279892 3300013105 Bacteria 1737
410 Ga0157374_10000440 3300013296 Bacteria 37662
411 Ga0157374_10003152 3300013296 Bacteria 13864
412 Ga0157374_10014074 3300013296 Bacteria 6995
413 Ga0157374_10015844 3300013296 Bacteria 6623
414 Ga0157374_10023036 3300013296 Bacteria 5564
415 Ga0157374_10033267 3300013296 Bacteria 4703
416 Ga0157374_10050029 3300013296 Bacteria 3883
417 Ga0157374_10119431 3300013296 Unclassified 2543
418 Ga0157374_10151088 3300013296 Bacteria 2258
419 Ga0157378_10002826 3300013297 Bacteria 15482
420 Ga0157378_10054560 3300013297 Bacteria 3558
421 Ga0157378_10055935 3300013297 Bacteria 3515
422 Ga0157378_10073674 3300013297 Bacteria 3070
423 Ga0157378_10110351 3300013297 Bacteria 2521
424 Ga0157378_10142972 3300013297 Bacteria 2223
425 Ga0157378_10157602 3300013297 Bacteria 2120
426 Ga0157378_10456506 3300013297 Bacteria 1269
427 Ga0163162_10001022 3300013306 Bacteria 25996
428 Ga0163162_10001731 3300013306 Bacteria 20442
429 Ga0163162_10003497 3300013306 Bacteria 15015
430 Ga0163162_10003748 3300013306 Bacteria 14565
431 Ga0163162_10003960 3300013306 Bacteria 14208
432 Ga0163162_10004143 3300013306 Bacteria 13922
433 Ga0163162_10005187 3300013306 Bacteria 12565
434 Ga0163162_10005457 3300013306 Bacteria 12287
435 Ga0163162_10114034 3300013306 Bacteria 2801
436 Ga0163162_10159301 3300013306 Bacteria 2379
437 Ga0163162_10253463 3300013306 Bacteria 1892
438 Ga0163162_10376241 3300013306 Bacteria 1553
439 Ga0157372_10007217 3300013307 Bacteria 11833
440 Ga0157372_10008579 3300013307 Bacteria 10859
441 Ga0157372_10010299 3300013307 Bacteria 9934
442 Ga0157372_10029448 3300013307 Bacteria 5995
443 Ga0157372_10041683 3300013307 Bacteria 5075
444 Ga0157372_10051606 3300013307 Bacteria 4577
445 Ga0157372_10054553 3300013307 Bacteria 4459
446 Ga0157372_10069856 3300013307 Bacteria 3950
447 Ga0157372_10081900 3300013307 Bacteria 3653
448 Ga0157372_10104725 3300013307 Bacteria 3235
449 Ga0157372_10107147 3300013307 Bacteria 3197
450 Ga0157372_10114364 3300013307 Bacteria 3093
451 Ga0157372_10129989 3300013307 Bacteria 2897
452 Ga0157372_10185237 3300013307 Bacteria 2411
453 Ga0157372_10204036 3300013307 Unclassified 2290
454 Ga0157372_10244481 3300013307 Unclassified 2082
455 Ga0157372_10391786 3300013307 Unclassified 1619
456 Ga0157375_10000219 3300013308 Bacteria 53586
457 Ga0157375_10001037 3300013308 Bacteria 23988
458 Ga0157375_10033496 3300013308 Bacteria 4883
459 Ga0157375_10047606 3300013308 Bacteria 4189
460 Ga0157375_10083582 3300013308 Bacteria 3238
461 Ga0157375_10088836 3300013308 Bacteria 3146
462 Ga0157375_10124081 3300013308 Unclassified 2696
463 Ga0157375_10129469 3300013308 Unclassified 2642
464 Ga0157375_10190895 3300013308 Bacteria 2203
465 Ga0157375_10233021 3300013308 Bacteria 2000
466 Ga0157375_10256455 3300013308 Bacteria 1910
467 Ga0157375_10373881 3300013308 Bacteria 1591
468 Ga0157375_10640006 3300013308 Bacteria 1220
469 Ga0163163_10000803 3300014325 Bacteria 26650
470 Ga0163163_10000936 3300014325 Bacteria 24752
471 Ga0163163_10002011 3300014325 Bacteria 17173
472 Ga0163163_10013408 3300014325 Bacteria 7505
473 Ga0163163_10110318 3300014325 Bacteria 2779
474 Ga0163163_10357610 3300014325 Unclassified 1517
475 Ga0163163_10389172 3300014325 Unclassified 1452
476 Ga0157380_10011402 3300014326 Bacteria 6423
477 Ga0157380_10084098 3300014326 Bacteria 2608
478 Ga0157380_10101399 3300014326 Bacteria 2398
479 Ga0157380_10448069 3300014326 Unclassified 1239
480 Ga0157377_10000734 3300014745 Bacteria 13544
481 Ga0157377_10010123 3300014745 Bacteria 4653
482 Ga0157377_10023786 3300014745 Bacteria 3251
483 Ga0157377_10031424 3300014745 Bacteria 2885
484 Ga0157379_10000078 3300014968 Bacteria 63565
485 Ga0157379_10019816 3300014968 Bacteria 5944
486 Ga0157379_10030868 3300014968 Bacteria 4773
487 Ga0157379_10118285 3300014968 Bacteria 2383
488 Ga0157376_10000219 3300014969 Bacteria 39583
489 Ga0157376_10000554 3300014969 Bacteria 24053
490 Ga0157376_10010474 3300014969 Bacteria 6783
491 Ga0157376_10056150 3300014969 Bacteria 3288
492 Ga0157376_10188407 3300014969 Bacteria 1890
493 Ga0157376_10207468 3300014969 Bacteria 1807
494 Ga0157376_10221657 3300014969 Bacteria 1752
495 Ga0182005_1000126 3300015265 Bacteria 53914
496 Ga0163161_10001931 3300017792 Bacteria 15120
497 Ga0163161_10005543 3300017792 Bacteria 8745
498 Ga0163161_10022094 3300017792 Bacteria 4477
499 Ga0163161_10022100 3300017792 Bacteria 4477
500 Ga0163161_10023331 3300017792 Bacteria 4365
501 Ga0213876_10011837 3300021384 Bacteria 4651
502 Ga0209436_101280 3300025208 Bacteria 8995
503 Ga0209258_100098 3300025242 Bacteria 215216
504 Ga0209646_1000006 3300025246 Bacteria 694084
505 Ga0209148_1000682 3300025254 Bacteria 28368
506 Ga0209673_1000299 3300025273 Bacteria 91734
507 Ga0209130_1001255 3300025284 Bacteria 17694
508 Ga0209564_1024014 3300025295 Bacteria 2096
509 Ga0209564_1043407 3300025295 Bacteria 1180
510 Ga0209758_1000497 3300025297 Bacteria 64050
511 Ga0209758_1007875 3300025297 Bacteria 7084
512 Ga0209758_1011427 3300025297 Bacteria 5146
513 Ga0209050_1000771 3300025298 Bacteria 46024
514 Ga0207426_1000019 3300025302 Bacteria 558579
515 Ga0207426_1000137 3300025302 Bacteria 199010
516 Ga0207426_1000562 3300025302 Bacteria 50691
517 Ga0207426_1001710 3300025302 Bacteria 16850
518 Ga0207426_1004272 3300025302 Bacteria 7076
519 Ga0209257_1000013 3300025304 Bacteria 1047305
520 Ga0209257_1006112 3300025304 Bacteria 7991
521 Ga0207697_10015466 3300025315 Bacteria 3153
522 Ga0207697_10016329 3300025315 Bacteria 3058
523 Ga0207682_10032721 3300025893 Bacteria 2091
524 Ga0207682_10037618 3300025893 Bacteria 1961
525 Ga0207710_10046686 3300025900 Bacteria 1934
526 Ga0207688_10012491 3300025901 Bacteria 4622
527 Ga0207680_10000026 3300025903 Bacteria 79960
528 Ga0207680_10012305 3300025903 Bacteria 4354
529 Ga0207680_10027008 3300025903 Bacteria 3189
530 Ga0207680_10052847 3300025903 Bacteria 2436
531 Ga0207680_10127099 3300025903 Bacteria 1675
532 Ga0207680_10188834 3300025903 Bacteria 1397
533 Ga0207647_10095497 3300025904 Bacteria 1770
534 Ga0207645_10002365 3300025907 Bacteria 14880
535 Ga0207645_10015737 3300025907 Bacteria 5016
536 Ga0207645_10041085 3300025907 Bacteria 2962
537 Ga0207643_10048056 3300025908 Bacteria 2416
538 Ga0207643_10072292 3300025908 Bacteria 1987
539 Ga0207705_10002848 3300025909 Bacteria 13228
540 Ga0207705_10031133 3300025909 Bacteria 3807
541 Ga0207705_10044128 3300025909 Bacteria 3204
542 Ga0207705_10087541 3300025909 Bacteria 2278
543 Ga0207654_10033997 3300025911 Bacteria 2829
544 Ga0207654_10044405 3300025911 Bacteria 2524
545 Ga0207654_10096438 3300025911 Bacteria 1814
546 Ga0207707_10012158 3300025912 Bacteria 7482
547 Ga0207707_10083205 3300025912 Bacteria 2794
548 Ga0207707_10144588 3300025912 Unclassified 2079
549 Ga0207695_10000060 3300025913 Bacteria 360217
550 Ga0207695_10000185 3300025913 Bacteria 180225
551 Ga0207695_10000666 3300025913 Bacteria 67698
552 Ga0207695_10002019 3300025913 Bacteria 31240
553 Ga0207695_10020493 3300025913 Bacteria 7571
554 Ga0207695_10024469 3300025913 Bacteria 6793
555 Ga0207695_10029572 3300025913 Bacteria 6048
556 Ga0207695_10058683 3300025913 Bacteria 3994
557 Ga0207695_10091007 3300025913 Bacteria 3065
558 Ga0207695_10145924 3300025913 Bacteria 2310
559 Ga0207695_10266310 3300025913 Bacteria 1610
560 Ga0207671_10001263 3300025914 Bacteria 29797
561 Ga0207671_10001265 3300025914 Bacteria 29785
562 Ga0207671_10001378 3300025914 Bacteria 28270
563 Ga0207671_10006612 3300025914 Bacteria 10285
564 Ga0207671_10014115 3300025914 Bacteria 6328
565 Ga0207660_10006788 3300025917 Bacteria 7414
566 Ga0207660_10053868 3300025917 Unclassified 2869
567 Ga0207660_10102611 3300025917 Unclassified 2138
568 Ga0207662_10048369 3300025918 Bacteria 2519
569 Ga0207662_10072413 3300025918 Unclassified 2088
570 Ga0207657_10032389 3300025919 Bacteria 4723
571 Ga0207657_10040514 3300025919 Bacteria 4127
572 Ga0207657_10063023 3300025919 Bacteria 3172
573 Ga0207657_10110558 3300025919 Bacteria 2270
574 Ga0207657_10233716 3300025919 Bacteria 1470
575 Ga0207657_10239665 3300025919 Bacteria 1448
576 Ga0207652_10001065 3300025921 Bacteria 24919
577 Ga0207652_10038245 3300025921 Bacteria 4066
578 Ga0207652_10083509 3300025921 Bacteria 2796
579 Ga0207681_10002862 3300025923 Bacteria 10905
580 Ga0207681_10055724 3300025923 Unclassified 2694
581 Ga0207681_10083863 3300025923 Unclassified 2257
582 Ga0207694_10006677 3300025924 Bacteria 8765
583 Ga0207650_10018608 3300025925 Bacteria 4876
584 Ga0207650_10049594 3300025925 Bacteria 3101
585 Ga0207650_10053698 3300025925 Bacteria 2987
586 Ga0207650_10088656 3300025925 Bacteria 2360
587 Ga0207650_10100680 3300025925 Bacteria 2223
588 Ga0207650_10229509 3300025925 Bacteria 1497
589 Ga0207650_10247637 3300025925 Bacteria 1442
590 Ga0207659_10025913 3300025926 Bacteria 3949
591 Ga0207659_10028295 3300025926 Bacteria 3807
592 Ga0207659_10028428 3300025926 Bacteria 3800
593 Ga0207659_10059965 3300025926 Unclassified 2737
594 Ga0207659_10122479 3300025926 Bacteria 1995
595 Ga0207659_10200649 3300025926 Bacteria 1593
596 Ga0207644_10046471 3300025931 Bacteria 3093
597 Ga0207644_10065845 3300025931 Unclassified 2636
598 Ga0207644_10102007 3300025931 Bacteria 2157
599 Ga0207644_10144300 3300025931 Bacteria 1836
600 Ga0207644_10149983 3300025931 Unclassified 1803
601 Ga0207644_10160775 3300025931 Bacteria 1746
602 Ga0207690_10030536 3300025932 Bacteria 3438
603 Ga0207690_10049221 3300025932 Bacteria 2808
604 Ga0207690_10068265 3300025932 Bacteria 2442
605 Ga0207690_10152511 3300025932 Bacteria 1714
606 Ga0207706_10006315 3300025933 Bacteria 11014
607 Ga0207706_10007207 3300025933 Bacteria 10280
608 Ga0207706_10010930 3300025933 Bacteria 8279
609 Ga0207706_10015400 3300025933 Bacteria 6909
610 Ga0207706_10045085 3300025933 Bacteria 3907
611 Ga0207706_10083471 3300025933 Bacteria 2809
612 Ga0207686_10000909 3300025934 Bacteria 17772
613 Ga0207670_10012581 3300025936 Bacteria 4956
614 Ga0207670_10036851 3300025936 Bacteria 3184
615 Ga0207670_10154655 3300025936 Bacteria 1706
616 Ga0207704_10014245 3300025938 Bacteria 4010
617 Ga0207704_10020109 3300025938 Bacteria 3524
618 Ga0207704_10043471 3300025938 Bacteria 2654
619 Ga0207704_10103824 3300025938 Bacteria 1902
620 Ga0207704_10234801 3300025938 Bacteria 1366
621 Ga0207691_10000014 3300025940 Bacteria 142542
622 Ga0207691_10008260 3300025940 Bacteria 9996
623 Ga0207691_10030869 3300025940 Bacteria 5004
624 Ga0207691_10055796 3300025940 Unclassified 3600
625 Ga0207691_10142619 3300025940 Bacteria 2110
626 Ga0207689_10001523 3300025942 Bacteria 22061
627 Ga0207689_10003713 3300025942 Bacteria 13913
628 Ga0207689_10006429 3300025942 Bacteria 10389
629 Ga0207689_10012708 3300025942 Bacteria 7192
630 Ga0207689_10012737 3300025942 Bacteria 7184
631 Ga0207689_10012764 3300025942 Bacteria 7179
632 Ga0207689_10015373 3300025942 Bacteria 6479
633 Ga0207689_10025133 3300025942 Unclassified 4992
634 Ga0207689_10067011 3300025942 Bacteria 2951
635 Ga0207689_10166791 3300025942 Bacteria 1814
636 Ga0207661_10083764 3300025944 Unclassified 2639
637 Ga0207661_10092617 3300025944 Bacteria 2520
638 Ga0207679_10003675 3300025945 Bacteria 9506
639 Ga0207679_10006982 3300025945 Bacteria 7157
640 Ga0207679_10017302 3300025945 Bacteria 4806
641 Ga0207679_10052759 3300025945 Bacteria 2984
642 Ga0207667_10000084 3300025949 Bacteria 152086
643 Ga0207667_10018078 3300025949 Bacteria 7916
644 Ga0207667_10018411 3300025949 Bacteria 7833
645 Ga0207667_10032284 3300025949 Bacteria 5644
646 Ga0207667_10050187 3300025949 Bacteria 4403
647 Ga0207667_10056603 3300025949 Bacteria 4119
648 Ga0207651_10000262 3300025960 Bacteria 22471
649 Ga0207651_10045863 3300025960 Bacteria 2934
650 Ga0207651_10074988 3300025960 Unclassified 2411
651 Ga0207651_10079716 3300025960 Bacteria 2353
652 Ga0207651_10080914 3300025960 Bacteria 2340
653 Ga0207651_10420173 3300025960 Bacteria 1141
654 Ga0207712_10005936 3300025961 Bacteria 7700
655 Ga0207712_10008329 3300025961 Bacteria 6555
656 Ga0207712_10019440 3300025961 Bacteria 4436
657 Ga0207712_10020327 3300025961 Bacteria 4348
658 Ga0207712_10025376 3300025961 Bacteria 3937
659 Ga0207712_10070709 3300025961 Bacteria 2508
660 Ga0207668_10000544 3300025972 Bacteria 23682
661 Ga0207668_10091391 3300025972 Bacteria 2237
662 Ga0207668_10145279 3300025972 Bacteria 1829
663 Ga0207668_10255037 3300025972 Unclassified 1427
664 Ga0207640_10042857 3300025981 Bacteria 2888
665 Ga0207640_10054981 3300025981 Bacteria 2605
666 Ga0207640_10162811 3300025981 Bacteria 1653
667 Ga0207658_10001505 3300025986 Bacteria 18119
668 Ga0207658_10022600 3300025986 Bacteria 4381
669 Ga0207658_10068965 3300025986 Bacteria 2670
670 Ga0207658_10162623 3300025986 Bacteria 1831
671 Ga0207658_10198554 3300025986 Bacteria 1673
672 Ga0207658_10199397 3300025986 Bacteria 1670
673 Ga0207658_10264992 3300025986 Unclassified 1466
674 Ga0207677_10001128 3300026023 Bacteria 14558
675 Ga0207677_10007816 3300026023 Bacteria 5937
676 Ga0207677_10010583 3300026023 Bacteria 5226
677 Ga0207677_10023852 3300026023 Bacteria 3787
678 Ga0207677_10038954 3300026023 Unclassified 3121
679 Ga0207677_10097786 3300026023 Bacteria 2151
680 Ga0207677_10125325 3300026023 Bacteria 1940
681 Ga0207703_10001897 3300026035 Bacteria 18529
682 Ga0207703_10013153 3300026035 Bacteria 6448
683 Ga0207703_10100930 3300026035 Bacteria 2446
684 Ga0207703_10305589 3300026035 Unclassified 1452
685 Ga0207639_10006748 3300026041 Bacteria 7812
686 Ga0207639_10017197 3300026041 Bacteria 5126
687 Ga0207639_10020984 3300026041 Bacteria 4685
688 Ga0207639_10031409 3300026041 Bacteria 3903
689 Ga0207639_10031413 3300026041 Bacteria 3903
690 Ga0207639_10068232 3300026041 Bacteria 2770
691 Ga0207639_10230510 3300026041 Bacteria 1605
692 Ga0207639_10300518 3300026041 Unclassified 1419
693 Ga0207678_10020230 3300026067 Bacteria 5844
694 Ga0207708_10030217 3300026075 Bacteria 4109
695 Ga0207702_10052731 3300026078 Bacteria 3443
696 Ga0207702_10055832 3300026078 Bacteria 3350
697 Ga0207702_10164291 3300026078 Bacteria 2030
698 Ga0207641_10000167 3300026088 Bacteria 92790
699 Ga0207641_10004744 3300026088 Bacteria 11719
700 Ga0207641_10040147 3300026088 Bacteria 3916
701 Ga0207641_10091214 3300026088 Bacteria 2666
702 Ga0207641_10136343 3300026088 Bacteria 2209
703 Ga0207641_10259736 3300026088 Unclassified 1626
704 Ga0207648_10002320 3300026089 Bacteria 20536
705 Ga0207648_10007356 3300026089 Bacteria 10841
706 Ga0207648_10105071 3300026089 Bacteria 2477
707 Ga0207648_10156979 3300026089 Bacteria 2008
708 Ga0207648_10170140 3300026089 Bacteria 1926
709 Ga0207648_10218022 3300026089 Bacteria 1695
710 Ga0207676_10004203 3300026095 Bacteria 10171
711 Ga0207676_10004336 3300026095 Bacteria 10037
712 Ga0207676_10047269 3300026095 Bacteria 3334
713 Ga0207676_10080028 3300026095 Bacteria 2651
714 Ga0207676_10132549 3300026095 Unclassified 2121
715 Ga0207676_10285905 3300026095 Bacteria 1499
716 Ga0207676_10336095 3300026095 Bacteria 1392
717 Ga0207674_10000487 3300026116 Bacteria 52391
718 Ga0207674_10005497 3300026116 Bacteria 15045
719 Ga0207674_10030010 3300026116 Bacteria 5720
720 Ga0207674_10032755 3300026116 Bacteria 5448
721 Ga0207674_10081556 3300026116 Bacteria 3236
722 Ga0207674_10085277 3300026116 Unclassified 3154
723 Ga0207674_10111878 3300026116 Bacteria 2704
724 Ga0207674_10320599 3300026116 Bacteria 1499
725 Ga0207675_100000422 3300026118 Bacteria 40963
726 Ga0207675_100009495 3300026118 Bacteria 9105
727 Ga0207675_100135846 3300026118 Unclassified 2333
728 Ga0207675_100160098 3300026118 Bacteria 2147
729 Ga0207675_100344119 3300026118 Bacteria 1460
730 Ga0207683_10009154 3300026121 Bacteria 8436
731 Ga0207683_10012331 3300026121 Bacteria 7295
732 Ga0207683_10048639 3300026121 Bacteria 3713
733 Ga0207683_10117230 3300026121 Unclassified 2388
734 Ga0207698_10007226 3300026142 Bacteria 6958
735 Ga0207698_10016730 3300026142 Bacteria 4955
736 Ga0207698_10017808 3300026142 Bacteria 4828
737 Ga0207698_10020870 3300026142 Bacteria 4519
738 Ga0207698_10066284 3300026142 Bacteria 2841
739 Ga0207698_10081989 3300026142 Unclassified 2606
740 Ga0207698_10169232 3300026142 Bacteria 1922
741 Ga0207698_10177058 3300026142 Bacteria 1885
742 Ga0207698_10262201 3300026142 Unclassified 1588
743 Ga0207428_10085705 3300027907 Bacteria 2453
744 Ga0268266_10000088 3300028379 Bacteria 199029
745 Ga0268266_10110528 3300028379 Bacteria 2435
746 Ga0268266_10231728 3300028379 Bacteria 1701
747 Ga0268265_10002951 3300028380 Bacteria 12466
748 Ga0268265_10014053 3300028380 Bacteria 5455
749 Ga0268265_10329279 3300028380 Bacteria 1387
750 Ga0268264_10000201 3300028381 Bacteria 122060
751 Ga0268264_10009165 3300028381 Bacteria 8200
752 Ga0268264_10012038 3300028381 Bacteria 7122
753 Ga0268264_10017595 3300028381 Bacteria 5853
754 Ga0268264_10081109 3300028381 Bacteria 2772
755 Ga0268264_10225213 3300028381 Bacteria 1728
756 Ga0268264_10324735 3300028381 Unclassified 1456
757 Ga0268264_10351299 3300028381 Bacteria 1403
758 Ga0307517_10000959 3300028786 Bacteria 48920
759 Ga0307517_10113614 3300028786 Unclassified 2043
760 Ga0307515_10051447 3300028794 Bacteria 6140
761 Ga0307511_10000498 3300030521 Bacteria 42446
762 Ga0307513_10312833 3300031456 Bacteria 1332
763 Ga0307509_10075920 3300031507 Bacteria 3489
764 Ga0307508_10003711 3300031616 Bacteria 15293
765 Ga0307508_10120330 3300031616 Bacteria 2228
766 Ga0307516_10001623 3300031730 Bacteria 30968
767 Ga0307516_10024738 3300031730 Bacteria 6130
768 Ga0307410_10028683 3300031852 Bacteria 3535
769 Ga0307407_10138439 3300031903 Bacteria 1567
770 Ga0307412_10089746 3300031911 Bacteria 2147
771 Ga0307510_10007184 3300033180 Bacteria 13262
772 Ga0373934_0092050 3300035086 Unclassified 1223
773 Ga0373927_0044596 3300035695 Bacteria 2869
774 Ga0395899_0016065 3300037312 Bacteria 5707
775 Ga0395899_0060285 3300037312 Bacteria 2795
776 Ga0395900_0027549 3300037418 Bacteria 5821
777 Ga0395900_0036820 3300037418 Bacteria 5044
778 Ga0395900_0072390 3300037418 Bacteria 3543
779 Ga0395898_0006045 3300037466 Bacteria 12994
780 Ga0395898_0551266 3300037466 Bacteria 1095
781 Ga0395905_0119024 3300037471 Unclassified 2482
782 Ga0395901_0006717 3300038443 Bacteria 11625
783 Ga0436365_1688093 3300039437 Bacteria 4184
784 Ga0436365_1869494 3300039437 Unclassified 2830
785 Ga0439436_0010124 3300041404 Bacteria 2880
786 Ga0451793_0073312 3300041452 Bacteria 1012
787 Ga0451843_0497346 3300041509 Bacteria 2627
788 Ga0439431_0001387 3300041997 Bacteria 5341
789 Ga0439431_0019678 3300041997 Bacteria 1606
790 Ga0439433_0025225 3300041999 Bacteria 1342
791 Ga0439449_0013894 3300042007 Bacteria 3028
792 Ga0439457_002833 3300042014 Bacteria 4842
793 Ga0439462_0019273 3300042015 Bacteria 1775
794 Ga0439434_0013486 3300042435 Bacteria 2427
795 Ga0439444_0003799 3300042437 Bacteria 2158
796 Ga0439460_0070379 3300042461 Bacteria 1083
797 Ga0466969_0000033 3300044656 Bacteria 82227
798 Ga0466972_0000020 3300044658 Bacteria 197336
799 Ga0466972_0001881 3300044658 Bacteria 10296
800 Ga0466972_0002168 3300044658 Bacteria 9640
801 Ga0466972_0199011 3300044658 Bacteria 938
802 Ga0466966_0000543 3300044684 Bacteria 24041
803 Ga0453684_0182266 3300044712 Bacteria 2464
804 Ga0466970_0000117 3300044765 Bacteria 35460
805 Ga0466957_0228244 3300044842 Bacteria 1232
806 Ga0466957_0300318 3300044842 Bacteria 1079
807 Ga0466959_0000048 3300045049 Bacteria 83528
808 Ga0466959_0010689 3300045049 Bacteria 6572
809 Ga0466959_0011580 3300045049 Bacteria 6338
810 Ga0495627_021164 3300046453 Bacteria 2159
811 Ga0495592_0039961 3300046454 Bacteria 3522
812 Ga0495629_0090712 3300046459 Unclassified 2132
813 Ga0495638_0071348 3300046460 Bacteria 2125
814 Ga0495638_0112872 3300046460 Bacteria 1613
815 Ga0495582_0007431 3300046473 Bacteria 6067
816 Ga0495585_0196408 3300046492 Bacteria 1030
817 Ga0495618_0031904 3300046514 Bacteria 3299
818 Ga0495630_0003396 3300046517 Bacteria 11092
819 Ga0495643_0034710 3300046522 Bacteria 2781
820 Ga0495586_0139732 3300046535 Unclassified 1359
821 Ga0495633_0000059 3300046558 Bacteria 147552
822 Ga0495668_0000834 3300046616 Bacteria 35036
823 Ga0495668_0014219 3300046616 Bacteria 4674
824 Ga0495634_0042278 3300046642 Bacteria 3092
825 Ga0495611_0000213 3300046648 Bacteria 40899
826 Ga0495658_0028141 3300046683 Unclassified 3031
827 Ga0495600_0114504 3300046809 Bacteria 1756
828 Ga0495672_0011354 3300047320 Bacteria 6292
829 Ga0495672_0049750 3300047320 Bacteria 2479
830 Ga0495676_0204244 3300047321 Unclassified 1371
831 Ga0495687_000010 3300047443 Bacteria 413735
832 Ga0495684_0012571 3300047471 Bacteria 6527
833 Ga0495686_0000436 3300047472 Bacteria 64423
834 Ga0495686_0007468 3300047472 Bacteria 8190
835 Ga0496109_0062734 3300048912 Bacteria 3399
836 Ga0496109_0214149 3300048912 Bacteria 1812
837 Ga0496110_0164754 3300048913 Bacteria 2010
838 Ga0496115_0265809 3300048918 Bacteria 1410
839 Ga0496121_0000007 3300048924 Bacteria 942516
840 Ga0501299_003540 3300049522 Bacteria 2270
841 Ga0501031_0152373 3300049568 Unclassified 1511
842 Ga0501032_0006601 3300049569 Bacteria 8521
843 Ga0501032_0008334 3300049569 Bacteria 7554
844 Ga0501032_0101588 3300049569 Bacteria 1905
845 Ga0501034_0000114 3300049571 Bacteria 148505
846 Ga0501034_0006325 3300049571 Bacteria 12750
847 Ga0501034_0009097 3300049571 Bacteria 10433
848 Ga0501036_0003899 3300049572 Bacteria 11968
849 Ga0501036_0016822 3300049572 Bacteria 6109
850 Ga0501037_0218195 3300049573 Unclassified 1343
851 Ga0501038_0028657 3300049574 Unclassified 4946
852 Ga0501038_0037372 3300049574 Bacteria 4257
853 Ga0501038_0253724 3300049574 Unclassified 1392
854 Ga0501039_0027227 3300049575 Unclassified 4396
855 Ga0501039_0038486 3300049575 Bacteria 3693
856 Ga0501039_0094835 3300049575 Unclassified 2326
857 Ga0501042_0233568 3300049578 Unclassified 1327
858 Ga0501043_0007872 3300049579 Bacteria 8428
859 Ga0501043_0030942 3300049579 Bacteria 4209
860 Ga0501043_0063552 3300049579 Bacteria 2899
861 Ga0501043_0087812 3300049579 Unclassified 2443
862 Ga0501046_0005622 3300049580 Bacteria 11191
863 Ga0501046_0065271 3300049580 Bacteria 2840
864 Ga0501046_0123382 3300049580 Unclassified 1970
865 Ga0501047_0014491 3300049581 Bacteria 7498
866 Ga0501047_0034996 3300049581 Bacteria 4851
867 Ga0501047_0058133 3300049581 Bacteria 3736
868 Ga0501047_0578825 3300049581 Unclassified 946
869 Ga0501048_0010212 3300049582 Bacteria 7021
870 Ga0501067_0077400 3300049583 Unclassified 1843
871 Ga0501070_0013912 3300049586 Bacteria 6775
872 Ga0501072_0215672 3300049588 Bacteria 1530
873 Ga0501073_0052833 3300049589 Unclassified 2844
874 Ga0501074_0000510 3300049590 Bacteria 23805
875 Ga0501207_000852 3300049654 Bacteria 3634
876 Ga0501217_000867 3300049661 Bacteria 5367
877 Ga0501225_0002427 3300049705 Bacteria 5759
878 Ga0501080_0119892 3300049742 Unclassified 2438
879 Ga0501083_0007826 3300049744 Bacteria 7572
880 Ga0501266_003387 3300049763 Bacteria 1983
881 Ga0501269_001971 3300049766 Unclassified 2594
882 Ga0501035_0006493 3300049822 Bacteria 10987
883 Ga0501035_0018176 3300049822 Bacteria 6475
884 Ga0501044_0006290 3300049823 Bacteria 13124
885 Ga0501044_0008085 3300049823 Bacteria 11545
886 Ga0501044_0009879 3300049823 Bacteria 10370
887 Ga0501044_0117025 3300049823 Bacteria 2670
888 Ga0501044_0156023 3300049823 Bacteria 2262
889 Ga0501044_0216236 3300049823 Bacteria 1869
890 Ga0501044_0255008 3300049823 Bacteria 1694
891 Ga0501212_001301 3300049851 Bacteria 2783
892 Ga0501284_00080 3300050005 Bacteria 24773
893 nmdc:mga0k408_22910_c1 3300050493 Bacteria 2744
894 nmdc:mga07m45_221643_c1 3300050496 Bacteria 1100
895 nmdc:mga05p37_124069_c1 3300050507 Bacteria 3172
896 nmdc:mga05p37_503219_c1 3300050507 Bacteria 1390
897 nmdc:mga09592_92338_c1 3300050508 Unclassified 2588
898 nmdc:mga0qj67_21616_c1 3300050509 Bacteria 4936
899 nmdc:mga08y16_9852_c1 3300050511 Bacteria 10032
900 nmdc:mga0n895_403083_c1 3300050512 Bacteria 1383
901 Ga0495619_0017768 3300053085 Bacteria 4506
902 Ga0495619_0018313 3300053085 Unclassified 4444
903 Ga0500644_0000040 3300053088 Bacteria 77696
904 Ga0500646_0007548 3300053090 Bacteria 2782
905 Ga0500646_0024527 3300053090 Bacteria 1624
906 Ga0500583_0000031 3300053092 Bacteria 104319
907 Ga0500583_0064229 3300053092 Bacteria 1740
908 Ga0500651_0112249 3300053093 Bacteria 1662
909 Ga0500641_0011168 3300053096 Bacteria 3258
910 Ga0500556_0020243 3300053104 Bacteria 2127
911 Ga0500556_0063308 3300053104 Bacteria 1367
912 Ga0500569_000346 3300053109 Bacteria 7465
913 Ga0500652_051860 3300053131 Bacteria 1676
914 Ga0500658_0004538 3300053134 Bacteria 5177
915 Ga0500559_0031530 3300053136 Bacteria 2274
916 Ga0500568_0000990 3300053139 Bacteria 19487
917 Ga0500568_0046411 3300053139 Bacteria 1724
918 Ga0500577_0001512 3300053142 Bacteria 5925
919 Ga0500589_005564 3300053147 Bacteria 4927
920 Ga0500616_0002295 3300053153 Bacteria 16178
921 Ga0500622_0000110 3300053156 Bacteria 83911
922 Ga0500622_0000736 3300053156 Bacteria 28546
923 Ga0500627_0007790 3300053158 Bacteria 3760
924 Ga0500636_0073784 3300053177 Bacteria 1976
925 Ga0500637_0076557 3300053178 Bacteria 1930
926 Ga0500611_000043 3300053727 Bacteria 58183
927 Ga0500645_034758 3300053730 Bacteria 1505
928 Ga0501082_0128407 3300060353 Bacteria 2199
929 Ga0501082_0133240 3300060353 Unclassified 2156
930 2738730495 2738541278 Bacteria 9755573
931 2819678345 2818991460 Bacteria 7595395
932 2821138200 2821136567 Bacteria 8080116
933 2881957303 2881955468 Bacteria 3545609
934 2883068592 2883068021 Bacteria 6192739
935 2884793205 2884791551 Bacteria 8511252
936 2896089660 2896085136 Bacteria 6129793
937 2896110919 2896109856 Bacteria 7140722
938 2904468995 2904467357 Bacteria 8057758
939 2929180941 2929177148 Bacteria 7883697
940 2929242878 2929239360 Bacteria 7745570
941 2929925142 2929921140 Bacteria 8649150
942 2945983340 2945977869 Bacteria 7777518
943 2946017270 2946013367 Bacteria 7766675
944 8003155161 8003151029 Bacteria 8187759
945 Ga0501219_000570
946 MRS1b_contig_305419
947 JGI24740J21852_10015209
948 JGI24739J22299_10016692
949 JGI24744J21845_10020387
950 JGI25154J39366_1000202
951 JGI25158J39367_1007218
952 JGI25153J46596_10004261
953 rootH1_10028377
954 rootH2_10041831
955 rootH2_10088952
956 rootH2_10097470
957 rootH2_10170421
958 rootH2_10175738
959 rootH2_10188889
960 rootL2_10046167
961 rootL2_10073329
962 rootL2_10105999
963 rootL2_10124366
964 rootL2_10124367
965 rootL2_10235807
966 rootH1_10009908
967 rootH1_10011504
968 rootH1_10011519
969 rootH1_10055264
970 rootH1_10081773
971 rootH1_10115930
972 JGI25160J50197_1001825
973 JGI25160J50197_1007286
974 Ga0055526_1017058
975 Ga0055528_1001774
976 Ga0065165_1000536
977 Ga0065165_1055388
978 Ga0065714_10022651
979 Ga0065704_10106193
980 Ga0065704_10126587
981 Ga0065712_10004890
982 Ga0065715_10148252
983 Ga0070658_10051423
984 Ga0070676_10001984
985 Ga0070676_10009689
986 Ga0070676_10034700
987 Ga0070683_100003213
988 Ga0070683_100011584
989 Ga0070683_100022517
990 Ga0070683_100045166
991 Ga0070690_100003637
992 Ga0070690_100060756
993 Ga0070670_100053915
994 Ga0070670_100055378
995 Ga0070670_100119394
996 Ga0070670_100175826
997 Ga0070670_100182610
998 Ga0070670_100215010
999 Ga0070670_100219576
1000 Ga0070670_100359944
1001 Ga0070670_100451206
1002 Ga0070677_10014695
1003 Ga0068869_100002528
1004 Ga0068869_100008103
1005 Ga0068869_100016690
1006 Ga0068869_100022932
1007 Ga0068869_100024531
1008 Ga0068869_100040114
1009 Ga0068869_100042374
1010 Ga0068869_100053984
1011 Ga0068869_100067094
1012 Ga0068869_100083154
1013 Ga0068869_100108366
1014 Ga0068869_100127106
1015 Ga0068869_100188517
1016 Ga0070666_10000024
1017 Ga0070666_10000782
1018 Ga0070666_10017711
1019 Ga0070666_10024808
1020 Ga0070666_10069861
1021 Ga0070666_10115292
1022 Ga0070680_100000594
1023 Ga0070680_100044954
1024 Ga0070682_100000306
1025 Ga0070682_100005351
1026 Ga0070682_100006804
1027 Ga0068868_100002309
1028 Ga0068868_100006673
1029 Ga0068868_100014084
1030 Ga0068868_100018557
1031 Ga0068868_100043871
1032 Ga0068868_100045564
1033 Ga0068868_100061234
1034 Ga0068868_100062227
1035 Ga0068868_100079155
1036 Ga0068868_100101143
1037 Ga0068868_100139929
1038 Ga0070660_100007954
1039 Ga0070660_100054699
1040 Ga0070660_100093222
1041 Ga0070660_100104875
1042 Ga0070660_100156732
1043 Ga0070660_100177165
1044 Ga0070689_100003067
1045 Ga0070689_100062416
1046 Ga0070689_100095130
1047 Ga0070689_100098657
1048 Ga0070691_10005329
1049 Ga0070687_100020390
1050 Ga0070661_100004768
1051 Ga0070661_100051883
1052 Ga0070661_100095329
1053 Ga0070661_100184397
1054 Ga0070668_100000077
1055 Ga0070668_100007250
1056 Ga0070668_100084166
1057 Ga0070668_100245623
1058 Ga0070669_100007472
1059 Ga0070669_100032967
1060 Ga0070669_100033440
1061 Ga0070669_100085527
1062 Ga0070669_100127110
1063 Ga0070675_100003118
1064 Ga0070675_100019256
1065 Ga0070675_100048228
1066 Ga0070675_100081723
1067 Ga0070675_100162110
1068 Ga0070671_100019485
1069 Ga0070671_100023754
1070 Ga0070671_100050432
1071 Ga0070671_100056674
1072 Ga0070674_100052548
1073 Ga0070673_100000458
1074 Ga0070673_100005255
1075 Ga0070673_100010574
1076 Ga0070673_100013705
1077 Ga0070673_100039228
1078 Ga0070673_100070133
1079 Ga0070673_100081086
1080 Ga0070673_100153815
1081 Ga0070688_100001769
1082 Ga0070688_100014670
1083 Ga0070688_100017681
1084 Ga0070688_100108990
1085 Ga0070659_100002170
1086 Ga0070659_100005743
1087 Ga0070659_100007759
1088 Ga0070659_100016883
1089 Ga0070659_100029344
1090 Ga0070659_100072052
1091 Ga0070659_100090709
1092 Ga0070667_100000382
1093 Ga0070667_100034349
1094 Ga0070667_100077684
1095 Ga0070667_100133846
1096 Ga0070701_10100030
1097 Ga0070663_100059620
1098 Ga0070678_100038502
1099 Ga0070678_100065559
1100 Ga0070678_100105679
1101 Ga0070678_100278779
1102 Ga0070662_100021354
1103 Ga0070662_100023594
1104 Ga0070662_100028482
1105 Ga0070662_100080643
1106 Ga0070662_100134038
1107 Ga0070681_10012525
1108 Ga0070681_10024895
1109 Ga0070681_10057753
1110 Ga0070681_10058013
1111 Ga0070681_10163426
1112 Ga0068867_100029117
1113 Ga0068867_100029264
1114 Ga0068867_100054027
1115 Ga0068867_100081605
1116 Ga0068867_100124422
1117 Ga0070685_10008317
1118 Ga0070698_100004775
1119 Ga0070698_100016643
1120 Ga0070698_100040360
1121 Ga0070698_100123380
1122 Ga0070679_100027054
1123 Ga0070679_100087084
1124 Ga0070679_100173703
1125 Ga0070684_100005358
1126 Ga0070684_100054132
1127 Ga0070684_100055125
1128 Ga0068853_100002018
1129 Ga0068853_100011817
1130 Ga0068853_100011848
1131 Ga0068853_100017276
1132 Ga0068853_100042528
1133 Ga0068853_100111113
1134 Ga0068853_100161914
1135 Ga0068853_100436742
1136 Ga0070672_100000010
1137 Ga0070672_100020432
1138 Ga0070672_100027534
1139 Ga0070672_100039837
1140 Ga0070672_100060129
1141 Ga0070672_100080786
1142 Ga0070672_100129898
1143 Ga0070686_100005054
1144 Ga0070665_100000031
1145 Ga0070665_100002045
1146 Ga0068855_100000108
1147 Ga0068855_100000732
1148 Ga0068855_100012864
1149 Ga0068855_100014994
1150 Ga0068855_100019957
1151 Ga0068855_100022269
1152 Ga0068855_100042012
1153 Ga0068855_100261154
1154 Ga0070664_100013453
1155 Ga0070664_100030559
1156 Ga0070664_100045280
1157 Ga0070664_100055778
1158 Ga0070664_100080039
1159 Ga0070664_100204228
1160 Ga0068857_100001355
1161 Ga0068857_100005870
1162 Ga0068857_100026627
1163 Ga0068857_100054793
1164 Ga0068857_100115816
1165 Ga0068857_100151221
1166 Ga0068857_100434064
1167 Ga0068854_100010810
1168 Ga0068854_100094355
1169 Ga0068854_100102519
1170 Ga0068854_100152739
1171 Ga0068856_100024579
1172 Ga0068856_100177228
1173 Ga0068856_100615091
1174 Ga0070702_100020838
1175 Ga0068852_100008954
1176 Ga0068852_100011843
1177 Ga0068852_100026755
1178 Ga0068852_100032181
1179 Ga0068852_100066504
1180 Ga0068852_100071994
1181 Ga0068852_100216697
1182 Ga0068859_100000018
1183 Ga0068859_100012863
1184 Ga0068859_100027796
1185 Ga0068859_100034823
1186 Ga0068859_100046643
1187 Ga0068859_100049098
1188 Ga0068859_100052662
1189 Ga0068864_100000389
1190 Ga0068864_100004617
1191 Ga0068864_100087906
1192 Ga0068864_100133607
1193 Ga0068864_100159238
1194 Ga0068864_100198647
1195 Ga0068864_100320961
1196 Ga0068861_100001157
1197 Ga0068861_100053405
1198 Ga0068861_100057170
1199 Ga0068861_100086839
1200 Ga0068861_100143850
1201 Ga0068861_100179902
1202 Ga0068851_10000503
1203 Ga0068851_10049868
1204 Ga0068870_10006403
1205 Ga0068863_100001416
1206 Ga0068863_100012262
1207 Ga0068863_100061353
1208 Ga0068863_100069014
1209 Ga0068863_100244281
1210 Ga0068858_100002897
1211 Ga0068858_100015268
1212 Ga0068858_100060556
1213 Ga0068858_100090976
1214 Ga0068858_100198625
1215 Ga0068860_100000072
1216 Ga0068860_100006531
1217 Ga0068860_100010513
1218 Ga0068860_100013037
1219 Ga0068860_100023829
1220 Ga0068860_100023830
1221 Ga0068860_100061726
1222 Ga0068860_100069377
1223 Ga0068860_100096179
1224 Ga0068860_100159690
1225 Ga0068860_100224908
1226 Ga0068860_100463113
1227 Ga0068862_100017201
1228 Ga0068862_100031657
1229 Ga0068862_100066075
1230 Ga0068862_100187044
1231 Ga0081539_10000899
1232 Ga0075366_10030100
1233 Ga0097621_100000122
1234 Ga0097621_100002697
1235 Ga0097621_100003855
1236 Ga0097621_100028270
1237 Ga0097621_100070050
1238 Ga0097621_100213454
1239 Ga0068871_100000412
1240 Ga0068871_100001186
1241 Ga0068871_100008450
1242 Ga0068871_100010459
1243 Ga0068871_100033468
1244 Ga0068871_100057524
1245 Ga0068871_100071524
1246 Ga0068871_100220008
1247 Ga0075428_100006899
1248 Ga0075428_100008539
1249 Ga0075430_100020469
1250 Ga0075430_100081376
1251 Ga0075431_100011318
1252 Ga0075429_100012224
1253 Ga0075429_100151805
1254 Ga0068865_100004773
1255 Ga0068865_100047126
1256 Ga0068865_100049844
1257 Ga0068865_100178757
1258 Ga0097620_100000018
1259 Ga0097620_100012863
1260 Ga0097620_100027796
1261 Ga0097620_100034824
1262 Ga0097620_100046639
1263 Ga0097620_100049103
1264 Ga0097620_100052661
1265 Ga0105251_10039608
1266 Ga0105240_10000152
1267 Ga0105240_10001109
1268 Ga0105240_10002195
1269 Ga0105240_10015841
1270 Ga0105240_10023875
1271 Ga0105240_10038968
1272 Ga0105240_10045267
1273 Ga0105240_10057451
1274 Ga0105240_10081585
1275 Ga0105240_10272185
1276 Ga0105240_10302117
1277 Ga0105240_10328061
1278 Ga0105240_10497778
1279 Ga0111539_10006032
1280 Ga0111539_10015984
1281 Ga0105247_10034255
1282 Ga0105247_10277396
1283 Ga0114129_10090762
1284 Ga0114129_10144051
1285 Ga0114129_10150623
1286 Ga0105241_10000813
1287 Ga0105241_10000893
1288 Ga0105241_10001132
1289 Ga0105241_10013390
1290 Ga0105241_10213285
1291 Ga0105241_10232474
1292 Ga0105242_10043806
1293 Ga0105242_10110984
1294 Ga0105242_10161945
1295 Ga0105242_10244724
1296 Ga0105248_10189402
1297 Ga0105237_10001480
1298 Ga0105237_10004983
1299 Ga0105237_10013064
1300 Ga0105237_10016323
1301 Ga0105237_10179837
1302 Ga0105237_10243373
1303 Ga0105237_10293737
1304 Ga0105238_10003001
1305 Ga0105238_10003918
1306 Ga0105249_10001879
1307 Ga0105249_10003364
1308 Ga0105249_10003657
1309 Ga0105249_10010234
1310 Ga0105249_10020220
1311 Ga0105249_10033600
1312 Ga0105249_10122316
1313 Ga0105249_10241071
1314 Ga0105249_10294460
1315 Ga0105239_10000596
1316 Ga0105239_10020350
1317 Ga0105239_10088598
1318 Ga0105239_10141382
1319 Ga0105239_10264157
1320 Ga0105239_10357919
1321 Ga0105246_10178567
1322 Ga0105246_10304429
1323 Ga0157373_10016489
1324 Ga0157373_10036339
1325 Ga0157373_10058483
1326 Ga0157373_10065185
1327 Ga0157373_10079985
1328 Ga0157371_10000642
1329 Ga0157371_10002222
1330 Ga0157371_10003513
1331 Ga0157371_10040430
1332 Ga0157371_10045602
1333 Ga0157371_10052236
1334 Ga0157371_10052931
1335 Ga0157371_10066274
1336 Ga0157370_10002063
1337 Ga0157370_10006351
1338 Ga0157370_10022658
1339 Ga0157370_10022981
1340 Ga0157370_10035467
1341 Ga0157370_10038922
1342 Ga0157370_10132764
1343 Ga0157370_10224545
1344 Ga0157370_10407449
1345 Ga0157370_10418920
1346 Ga0157369_10008609
1347 Ga0157369_10026680
1348 Ga0157369_10029377
1349 Ga0157369_10035700
1350 Ga0157369_10129758
1351 Ga0157369_10165532
1352 Ga0157369_10279892
1353 Ga0157374_10000440
1354 Ga0157374_10003152
1355 Ga0157374_10014074
1356 Ga0157374_10015844
1357 Ga0157374_10023036
1358 Ga0157374_10033267
1359 Ga0157374_10050029
1360 Ga0157374_10119431
1361 Ga0157374_10151088
1362 Ga0157378_10002826
1363 Ga0157378_10054560
1364 Ga0157378_10055935
1365 Ga0157378_10073674
1366 Ga0157378_10110351
1367 Ga0157378_10142972
1368 Ga0157378_10157602
1369 Ga0157378_10456506
1370 Ga0163162_10001022
1371 Ga0163162_10001731
1372 Ga0163162_10003497
1373 Ga0163162_10003748
1374 Ga0163162_10003960
1375 Ga0163162_10004143
1376 Ga0163162_10005187
1377 Ga0163162_10005457
1378 Ga0163162_10114034
1379 Ga0163162_10159301
1380 Ga0163162_10253463
1381 Ga0163162_10376241
1382 Ga0157372_10007217
1383 Ga0157372_10008579
1384 Ga0157372_10010299
1385 Ga0157372_10029448
1386 Ga0157372_10041683
1387 Ga0157372_10051606
1388 Ga0157372_10054553
1389 Ga0157372_10069856
1390 Ga0157372_10081900
1391 Ga0157372_10104725
1392 Ga0157372_10107147
1393 Ga0157372_10114364
1394 Ga0157372_10129989
1395 Ga0157372_10185237
1396 Ga0157372_10204036
1397 Ga0157372_10244481
1398 Ga0157372_10391786
1399 Ga0157375_10000219
1400 Ga0157375_10001037
1401 Ga0157375_10033496
1402 Ga0157375_10047606
1403 Ga0157375_10083582
1404 Ga0157375_10088836
1405 Ga0157375_10124081
1406 Ga0157375_10129469
1407 Ga0157375_10190895
1408 Ga0157375_10233021
1409 Ga0157375_10256455
1410 Ga0157375_10373881
1411 Ga0157375_10640006
1412 Ga0163163_10000803
1413 Ga0163163_10000936
1414 Ga0163163_10002011
1415 Ga0163163_10013408
1416 Ga0163163_10110318
1417 Ga0163163_10357610
1418 Ga0163163_10389172
1419 Ga0157380_10011402
1420 Ga0157380_10084098
1421 Ga0157380_10101399
1422 Ga0157380_10448069
1423 Ga0157377_10000734
1424 Ga0157377_10010123
1425 Ga0157377_10023786
1426 Ga0157377_10031424
1427 Ga0157379_10000078
1428 Ga0157379_10019816
1429 Ga0157379_10030868
1430 Ga0157379_10118285
1431 Ga0157376_10000219
1432 Ga0157376_10000554
1433 Ga0157376_10010474
1434 Ga0157376_10056150
1435 Ga0157376_10188407
1436 Ga0157376_10207468
1437 Ga0157376_10221657
1438 Ga0182005_1000126
1439 Ga0163161_10001931
1440 Ga0163161_10005543
1441 Ga0163161_10022094
1442 Ga0163161_10022100
1443 Ga0163161_10023331
1444 Ga0213876_10011837
1445 Ga0209436_101280
1446 Ga0209258_100098
1447 Ga0209646_1000006
1448 Ga0209148_1000682
1449 Ga0209673_1000299
1450 Ga0209130_1001255
1451 Ga0209564_1024014
1452 Ga0209564_1043407
1453 Ga0209758_1000497
1454 Ga0209758_1007875
1455 Ga0209758_1011427
1456 Ga0209050_1000771
1457 Ga0207426_1000019
1458 Ga0207426_1000137
1459 Ga0207426_1000562
1460 Ga0207426_1001710
1461 Ga0207426_1004272
1462 Ga0209257_1000013
1463 Ga0209257_1006112
1464 Ga0207697_10015466
1465 Ga0207697_10016329
1466 Ga0207682_10032721
1467 Ga0207682_10037618
1468 Ga0207710_10046686
1469 Ga0207688_10012491
1470 Ga0207680_10000026
1471 Ga0207680_10012305
1472 Ga0207680_10027008
1473 Ga0207680_10052847
1474 Ga0207680_10127099
1475 Ga0207680_10188834
1476 Ga0207647_10095497
1477 Ga0207645_10002365
1478 Ga0207645_10015737
1479 Ga0207645_10041085
1480 Ga0207643_10048056
1481 Ga0207643_10072292
1482 Ga0207705_10002848
1483 Ga0207705_10031133
1484 Ga0207705_10044128
1485 Ga0207705_10087541
1486 Ga0207654_10033997
1487 Ga0207654_10044405
1488 Ga0207654_10096438
1489 Ga0207707_10012158
1490 Ga0207707_10083205
1491 Ga0207707_10144588
1492 Ga0207695_10000060
1493 Ga0207695_10000185
1494 Ga0207695_10000666
1495 Ga0207695_10002019
1496 Ga0207695_10020493
1497 Ga0207695_10024469
1498 Ga0207695_10029572
1499 Ga0207695_10058683
1500 Ga0207695_10091007
1501 Ga0207695_10145924
1502 Ga0207695_10266310
1503 Ga0207671_10001263
1504 Ga0207671_10001265
1505 Ga0207671_10001378
1506 Ga0207671_10006612
1507 Ga0207671_10014115
1508 Ga0207660_10006788
1509 Ga0207660_10053868
1510 Ga0207660_10102611
1511 Ga0207662_10048369
1512 Ga0207662_10072413
1513 Ga0207657_10032389
1514 Ga0207657_10040514
1515 Ga0207657_10063023
1516 Ga0207657_10110558
1517 Ga0207657_10233716
1518 Ga0207657_10239665
1519 Ga0207652_10001065
1520 Ga0207652_10038245
1521 Ga0207652_10083509
1522 Ga0207681_10002862
1523 Ga0207681_10055724
1524 Ga0207681_10083863
1525 Ga0207694_10006677
1526 Ga0207650_10018608
1527 Ga0207650_10049594
1528 Ga0207650_10053698
1529 Ga0207650_10088656
1530 Ga0207650_10100680
1531 Ga0207650_10229509
1532 Ga0207650_10247637
1533 Ga0207659_10025913
1534 Ga0207659_10028295
1535 Ga0207659_10028428
1536 Ga0207659_10059965
1537 Ga0207659_10122479
1538 Ga0207659_10200649
1539 Ga0207644_10046471
1540 Ga0207644_10065845
1541 Ga0207644_10102007
1542 Ga0207644_10144300
1543 Ga0207644_10149983
1544 Ga0207644_10160775
1545 Ga0207690_10030536
1546 Ga0207690_10049221
1547 Ga0207690_10068265
1548 Ga0207690_10152511
1549 Ga0207706_10006315
1550 Ga0207706_10007207
1551 Ga0207706_10010930
1552 Ga0207706_10015400
1553 Ga0207706_10045085
1554 Ga0207706_10083471
1555 Ga0207686_10000909
1556 Ga0207670_10012581
1557 Ga0207670_10036851
1558 Ga0207670_10154655
1559 Ga0207704_10014245
1560 Ga0207704_10020109
1561 Ga0207704_10043471
1562 Ga0207704_10103824
1563 Ga0207704_10234801
1564 Ga0207691_10000014
1565 Ga0207691_10008260
1566 Ga0207691_10030869
1567 Ga0207691_10055796
1568 Ga0207691_10142619
1569 Ga0207689_10001523
1570 Ga0207689_10003713
1571 Ga0207689_10006429
1572 Ga0207689_10012708
1573 Ga0207689_10012737
1574 Ga0207689_10012764
1575 Ga0207689_10015373
1576 Ga0207689_10025133
1577 Ga0207689_10067011
1578 Ga0207689_10166791
1579 Ga0207661_10083764
1580 Ga0207661_10092617
1581 Ga0207679_10003675
1582 Ga0207679_10006982
1583 Ga0207679_10017302
1584 Ga0207679_10052759
1585 Ga0207667_10000084
1586 Ga0207667_10018078
1587 Ga0207667_10018411
1588 Ga0207667_10032284
1589 Ga0207667_10050187
1590 Ga0207667_10056603
1591 Ga0207651_10000262
1592 Ga0207651_10045863
1593 Ga0207651_10074988
1594 Ga0207651_10079716
1595 Ga0207651_10080914
1596 Ga0207651_10420173
1597 Ga0207712_10005936
1598 Ga0207712_10008329
1599 Ga0207712_10019440
1600 Ga0207712_10020327
1601 Ga0207712_10025376
1602 Ga0207712_10070709
1603 Ga0207668_10000544
1604 Ga0207668_10091391
1605 Ga0207668_10145279
1606 Ga0207668_10255037
1607 Ga0207640_10042857
1608 Ga0207640_10054981
1609 Ga0207640_10162811
1610 Ga0207658_10001505
1611 Ga0207658_10022600
1612 Ga0207658_10068965
1613 Ga0207658_10162623
1614 Ga0207658_10198554
1615 Ga0207658_10199397
1616 Ga0207658_10264992
1617 Ga0207677_10001128
1618 Ga0207677_10007816
1619 Ga0207677_10010583
1620 Ga0207677_10023852
1621 Ga0207677_10038954
1622 Ga0207677_10097786
1623 Ga0207677_10125325
1624 Ga0207703_10001897
1625 Ga0207703_10013153
1626 Ga0207703_10100930
1627 Ga0207703_10305589
1628 Ga0207639_10006748
1629 Ga0207639_10017197
1630 Ga0207639_10020984
1631 Ga0207639_10031409
1632 Ga0207639_10031413
1633 Ga0207639_10068232
1634 Ga0207639_10230510
1635 Ga0207639_10300518
1636 Ga0207678_10020230
1637 Ga0207708_10030217
1638 Ga0207702_10052731
1639 Ga0207702_10055832
1640 Ga0207702_10164291
1641 Ga0207641_10000167
1642 Ga0207641_10004744
1643 Ga0207641_10040147
1644 Ga0207641_10091214
1645 Ga0207641_10136343
1646 Ga0207641_10259736
1647 Ga0207648_10002320
1648 Ga0207648_10007356
1649 Ga0207648_10105071
1650 Ga0207648_10156979
1651 Ga0207648_10170140
1652 Ga0207648_10218022
1653 Ga0207676_10004203
1654 Ga0207676_10004336
1655 Ga0207676_10047269
1656 Ga0207676_10080028
1657 Ga0207676_10132549
1658 Ga0207676_10285905
1659 Ga0207676_10336095
1660 Ga0207674_10000487
1661 Ga0207674_10005497
1662 Ga0207674_10030010
1663 Ga0207674_10032755
1664 Ga0207674_10081556
1665 Ga0207674_10085277
1666 Ga0207674_10111878
1667 Ga0207674_10320599
1668 Ga0207675_100000422
1669 Ga0207675_100009495
1670 Ga0207675_100135846
1671 Ga0207675_100160098
1672 Ga0207675_100344119
1673 Ga0207683_10009154
1674 Ga0207683_10012331
1675 Ga0207683_10048639
1676 Ga0207683_10117230
1677 Ga0207698_10007226
1678 Ga0207698_10016730
1679 Ga0207698_10017808
1680 Ga0207698_10020870
1681 Ga0207698_10066284
1682 Ga0207698_10081989
1683 Ga0207698_10169232
1684 Ga0207698_10177058
1685 Ga0207698_10262201
1686 Ga0207428_10085705
1687 Ga0268266_10000088
1688 Ga0268266_10110528
1689 Ga0268266_10231728
1690 Ga0268265_10002951
1691 Ga0268265_10014053
1692 Ga0268265_10329279
1693 Ga0268264_10000201
1694 Ga0268264_10009165
1695 Ga0268264_10012038
1696 Ga0268264_10017595
1697 Ga0268264_10081109
1698 Ga0268264_10225213
1699 Ga0268264_10324735
1700 Ga0268264_10351299
1701 Ga0307517_10000959
1702 Ga0307517_10113614
1703 Ga0307515_10051447
1704 Ga0307511_10000498
1705 Ga0307513_10312833
1706 Ga0307509_10075920
1707 Ga0307508_10003711
1708 Ga0307508_10120330
1709 Ga0307516_10001623
1710 Ga0307516_10024738
1711 Ga0307410_10028683
1712 Ga0307407_10138439
1713 Ga0307412_10089746
1714 Ga0307510_10007184
1715 Ga0373934_0092050
1716 Ga0373927_0044596
1717 Ga0395899_0016065
1718 Ga0395899_0060285
1719 Ga0395900_0027549
1720 Ga0395900_0036820
1721 Ga0395900_0072390
1722 Ga0395898_0006045
1723 Ga0395898_0551266
1724 Ga0395905_0119024
1725 Ga0395901_0006717
1726 Ga0436365_1688093
1727 Ga0436365_1869494
1728 Ga0439436_0010124
1729 Ga0451793_0073312
1730 Ga0451843_0497346
1731 Ga0439431_0001387
1732 Ga0439431_0019678
1733 Ga0439433_0025225
1734 Ga0439449_0013894
1735 Ga0439457_002833
1736 Ga0439462_0019273
1737 Ga0439434_0013486
1738 Ga0439444_0003799
1739 Ga0439460_0070379
1740 Ga0466969_0000033
1741 Ga0466972_0000020
1742 Ga0466972_0001881
1743 Ga0466972_0002168
1744 Ga0466972_0199011
1745 Ga0466966_0000543
1746 Ga0453684_0182266
1747 Ga0466970_0000117
1748 Ga0466957_0228244
1749 Ga0466957_0300318
1750 Ga0466959_0000048
1751 Ga0466959_0010689
1752 Ga0466959_0011580
1753 Ga0495627_021164
1754 Ga0495592_0039961
1755 Ga0495629_0090712
1756 Ga0495638_0071348
1757 Ga0495638_0112872
1758 Ga0495582_0007431
1759 Ga0495585_0196408
1760 Ga0495618_0031904
1761 Ga0495630_0003396
1762 Ga0495643_0034710
1763 Ga0495586_0139732
1764 Ga0495633_0000059
1765 Ga0495668_0000834
1766 Ga0495668_0014219
1767 Ga0495634_0042278
1768 Ga0495611_0000213
1769 Ga0495658_0028141
1770 Ga0495600_0114504
1771 Ga0495672_0011354
1772 Ga0495672_0049750
1773 Ga0495676_0204244
1774 Ga0495687_000010
1775 Ga0495684_0012571
1776 Ga0495686_0000436
1777 Ga0495686_0007468
1778 Ga0496109_0062734
1779 Ga0496109_0214149
1780 Ga0496110_0164754
1781 Ga0496115_0265809
1782 Ga0496121_0000007
1783 Ga0501299_003540
1784 Ga0501031_0152373
1785 Ga0501032_0006601
1786 Ga0501032_0008334
1787 Ga0501032_0101588
1788 Ga0501034_0000114
1789 Ga0501034_0006325
1790 Ga0501034_0009097
1791 Ga0501036_0003899
1792 Ga0501036_0016822
1793 Ga0501037_0218195
1794 Ga0501038_0028657
1795 Ga0501038_0037372
1796 Ga0501038_0253724
1797 Ga0501039_0027227
1798 Ga0501039_0038486
1799 Ga0501039_0094835
1800 Ga0501042_0233568
1801 Ga0501043_0007872
1802 Ga0501043_0030942
1803 Ga0501043_0063552
1804 Ga0501043_0087812
1805 Ga0501046_0005622
1806 Ga0501046_0065271
1807 Ga0501046_0123382
1808 Ga0501047_0014491
1809 Ga0501047_0034996
1810 Ga0501047_0058133
1811 Ga0501047_0578825
1812 Ga0501048_0010212
1813 Ga0501067_0077400
1814 Ga0501070_0013912
1815 Ga0501072_0215672
1816 Ga0501073_0052833
1817 Ga0501074_0000510
1818 Ga0501207_000852
1819 Ga0501217_000867
1820 Ga0501225_0002427
1821 Ga0501080_0119892
1822 Ga0501083_0007826
1823 Ga0501266_003387
1824 Ga0501269_001971
1825 Ga0501035_0006493
1826 Ga0501035_0018176
1827 Ga0501044_0006290
1828 Ga0501044_0008085
1829 Ga0501044_0009879
1830 Ga0501044_0117025
1831 Ga0501044_0156023
1832 Ga0501044_0216236
1833 Ga0501044_0255008
1834 Ga0501212_001301
1835 Ga0501284_00080
1836 nmdc:mga0k408_22910_c1
1837 nmdc:mga07m45_221643_c1
1838 nmdc:mga05p37_124069_c1
1839 nmdc:mga05p37_503219_c1
1840 nmdc:mga09592_92338_c1
1841 nmdc:mga0qj67_21616_c1
1842 nmdc:mga08y16_9852_c1
1843 nmdc:mga0n895_403083_c1
1844 Ga0495619_0017768
1845 Ga0495619_0018313
1846 Ga0500644_0000040
1847 Ga0500646_0007548
1848 Ga0500646_0024527
1849 Ga0500583_0000031
1850 Ga0500583_0064229
1851 Ga0500651_0112249
1852 Ga0500641_0011168
1853 Ga0500556_0020243
1854 Ga0500556_0063308
1855 Ga0500569_000346
1856 Ga0500652_051860
1857 Ga0500658_0004538
1858 Ga0500559_0031530
1859 Ga0500568_0000990
1860 Ga0500568_0046411
1861 Ga0500577_0001512
1862 Ga0500589_005564
1863 Ga0500616_0002295
1864 Ga0500622_0000110
1865 Ga0500622_0000736
1866 Ga0500627_0007790
1867 Ga0500636_0073784
1868 Ga0500637_0076557
1869 Ga0500611_000043
1870 Ga0500645_034758
1871 Ga0501082_0128407
1872 Ga0501082_0133240
1873 2738730495
1874 2819678345
1875 2821138200
1876 2881957303
1877 2883068592
1878 2884793205
1879 2896089660
1880 2896110919
1881 2904468995
1882 2929180941
1883 2929242878
1884 2929925142
1885 2945983340
1886 2946017270
1887 8003155161

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01368

DHH

DHH family

48

200

0.82

PF02272

DHHA1

DHHA1 domain

263

362

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4py9-assembly1.cif.gz_A crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 0.9069 5 334
5jju-assembly1.cif.gz_B crystal structure of rv2837c complexed with 5'-papa and 5'-amp 0.903 3 327
4py9-assembly1.cif.gz_A crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 0.8892 5 334
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.8763 3 329
5jju-assembly1.cif.gz_B crystal structure of rv2837c complexed with 5'-papa and 5'-amp 0.8713 3 327
ID Description Score Start End Superfamily
4py9A02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9755 210 334 3.10.310.30
4py9A02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9521 210 334 3.10.310.30
4py9A01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.9423 5 209 3.90.1640.10
4py9A01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8984 5 209 3.90.1640.10
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8899 216 335 3.10.310.30
ID Description Score Start End GO Terms
AF-A0A7J5WMP5-F1-model_v4 Phosphoesterase RecJ domain-containing 0.9959 21 172
AF-A0A522E7W8-F1-model_v4 DHH family phosphoesterase 0.9911 1 103
AF-A0A359AV32-F1-model_v4 DHH family phosphoesterase 0.9888 25 132
AF-A0A3D4C8E0-F1-model_v4 deleted 0.9861 262 335
AF-A0A4Q3RL94-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9815 1 197

Map