F486394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 943 | 315 | 1887 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300049703|Ga0501219_000570|Ga0501219_000570_3272_4396 |
| Length | 374 |
| Sequence | VAIPAQIPACTSRQQDIPFGRWTLFPQICLRFMLPIQDLYPLLKTPRKVVITMHQKPDADAMGSALGLYHFLIQLGHHVTVISPTNWAKWLNWMPGCNKVVDFELTREKAESILKETEWVFCLDFNILLRTKHMAPIIKALDVTRILIDHHAQPDTPTFAYGVSDTTKSSTSEMIYDFIVNAGYKDLVNKEVAQCLYAGVMTDTGSFRFPAASAAVHRMIADFKDQGLDHTKVHEHIYDNYLENRLRFIGHVLLHRMEVYYEYNTALIAITKKDLLRYEIKTGDTEGLVNYPLSIQGIRLAAIVIDRDEERKWSFRSKGDFDVNTFARKYFEGGGHFNAAGGRSSASLEDTVEHFMQAIQENEAALQQERTSSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 203 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 204 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 262 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 267 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 271 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 285 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 287 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 288 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 290 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 292 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 293 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 295 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 298 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 302 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 303 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 304 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 305 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 306 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 307 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 308 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 309 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 310 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 311 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 312 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 313 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 314 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 315 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0 |
| Isolates | 1.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.73 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 88.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501219_000570 | 3300049703 | Bacteria | 5389 |
| 2 | MRS1b_contig_305419 | 2162886011 | Bacteria | 1173 |
| 3 | JGI24740J21852_10015209 | 3300001979 | Bacteria | 2816 |
| 4 | JGI24739J22299_10016692 | 3300001989 | Bacteria | 2654 |
| 5 | JGI24744J21845_10020387 | 3300002077 | Bacteria | 1307 |
| 6 | JGI25154J39366_1000202 | 3300002738 | Bacteria | 42933 |
| 7 | JGI25158J39367_1007218 | 3300002739 | Bacteria | 1572 |
| 8 | JGI25153J46596_10004261 | 3300003215 | Bacteria | 7742 |
| 9 | rootH1_10028377 | 3300003316 | Unclassified | 1981 |
| 10 | rootH2_10041831 | 3300003320 | Bacteria | 11217 |
| 11 | rootH2_10088952 | 3300003320 | Bacteria | 3763 |
| 12 | rootH2_10097470 | 3300003320 | Bacteria | 7940 |
| 13 | rootH2_10170421 | 3300003320 | Bacteria | 5458 |
| 14 | rootH2_10175738 | 3300003320 | Bacteria | 1645 |
| 15 | rootH2_10188889 | 3300003320 | Unclassified | 2955 |
| 16 | rootL2_10046167 | 3300003322 | Bacteria | 3328 |
| 17 | rootL2_10073329 | 3300003322 | Bacteria | 3296 |
| 18 | rootL2_10105999 | 3300003322 | Bacteria | 3198 |
| 19 | rootL2_10124366 | 3300003322 | Bacteria | 5869 |
| 20 | rootL2_10124367 | 3300003322 | Bacteria | 3670 |
| 21 | rootL2_10235807 | 3300003322 | Unclassified | 1765 |
| 22 | rootH1_10009908 | 3300003323 | Bacteria | 24135 |
| 23 | rootH1_10011504 | 3300003323 | Bacteria | 2627 |
| 24 | rootH1_10011519 | 3300003316 | Bacteria | 1319 |
| 25 | rootH1_10011519 | 3300003323 | Bacteria | 7301 |
| 26 | rootH1_10055264 | 3300003323 | Bacteria | 17621 |
| 27 | rootH1_10081773 | 3300003323 | Bacteria | 2208 |
| 28 | rootH1_10115930 | 3300003323 | Bacteria | 8260 |
| 29 | JGI25160J50197_1001825 | 3300003354 | Bacteria | 10265 |
| 30 | JGI25160J50197_1007286 | 3300003354 | Bacteria | 4349 |
| 31 | Ga0055526_1017058 | 3300003771 | Bacteria | 2800 |
| 32 | Ga0055528_1001774 | 3300003790 | Bacteria | 12382 |
| 33 | Ga0065165_1000536 | 3300005262 | Bacteria | 57578 |
| 34 | Ga0065165_1055388 | 3300005262 | Bacteria | 1107 |
| 35 | Ga0065714_10022651 | 3300005288 | Bacteria | 1779 |
| 36 | Ga0065704_10106193 | 3300005289 | Bacteria | 2090 |
| 37 | Ga0065704_10126587 | 3300005289 | Bacteria | 1687 |
| 38 | Ga0065712_10004890 | 3300005290 | Bacteria | 4771 |
| 39 | Ga0065715_10148252 | 3300005293 | Bacteria | 1761 |
| 40 | Ga0070658_10051423 | 3300005327 | Bacteria | 3339 |
| 41 | Ga0070676_10001984 | 3300005328 | Bacteria | 10406 |
| 42 | Ga0070676_10009689 | 3300005328 | Bacteria | 5210 |
| 43 | Ga0070676_10034700 | 3300005328 | Bacteria | 2897 |
| 44 | Ga0070683_100003213 | 3300005329 | Bacteria | 13195 |
| 45 | Ga0070683_100011584 | 3300005329 | Bacteria | 7630 |
| 46 | Ga0070683_100022517 | 3300005329 | Bacteria | 5632 |
| 47 | Ga0070683_100045166 | 3300005329 | Bacteria | 4066 |
| 48 | Ga0070690_100003637 | 3300005330 | Bacteria | 8488 |
| 49 | Ga0070690_100060756 | 3300005330 | Unclassified | 2433 |
| 50 | Ga0070670_100053915 | 3300005331 | Bacteria | 3452 |
| 51 | Ga0070670_100055378 | 3300005331 | Unclassified | 3404 |
| 52 | Ga0070670_100119394 | 3300005331 | Bacteria | 2274 |
| 53 | Ga0070670_100175826 | 3300005331 | Bacteria | 1858 |
| 54 | Ga0070670_100182610 | 3300005331 | Bacteria | 1822 |
| 55 | Ga0070670_100215010 | 3300005331 | Bacteria | 1672 |
| 56 | Ga0070670_100219576 | 3300005331 | Bacteria | 1653 |
| 57 | Ga0070670_100359944 | 3300005331 | Bacteria | 1279 |
| 58 | Ga0070670_100451206 | 3300005331 | Bacteria | 1140 |
| 59 | Ga0070677_10014695 | 3300005333 | Bacteria | 2761 |
| 60 | Ga0068869_100002528 | 3300005334 | Bacteria | 11039 |
| 61 | Ga0068869_100008103 | 3300005334 | Bacteria | 6758 |
| 62 | Ga0068869_100016690 | 3300005334 | Unclassified | 4953 |
| 63 | Ga0068869_100022932 | 3300005334 | Bacteria | 4306 |
| 64 | Ga0068869_100024531 | 3300005334 | Bacteria | 4177 |
| 65 | Ga0068869_100040114 | 3300005334 | Bacteria | 3346 |
| 66 | Ga0068869_100042374 | 3300005334 | Bacteria | 3263 |
| 67 | Ga0068869_100053984 | 3300005334 | Bacteria | 2923 |
| 68 | Ga0068869_100067094 | 3300005334 | Bacteria | 2646 |
| 69 | Ga0068869_100083154 | 3300005334 | Bacteria | 2394 |
| 70 | Ga0068869_100108366 | 3300005334 | Bacteria | 2110 |
| 71 | Ga0068869_100127106 | 3300005334 | Bacteria | 1956 |
| 72 | Ga0068869_100188517 | 3300005334 | Bacteria | 1621 |
| 73 | Ga0070666_10000024 | 3300005335 | Bacteria | 161355 |
| 74 | Ga0070666_10000782 | 3300005335 | Bacteria | 19260 |
| 75 | Ga0070666_10017711 | 3300005335 | Unclassified | 4571 |
| 76 | Ga0070666_10024808 | 3300005335 | Unclassified | 3909 |
| 77 | Ga0070666_10069861 | 3300005335 | Bacteria | 2388 |
| 78 | Ga0070666_10115292 | 3300005335 | Bacteria | 1860 |
| 79 | Ga0070680_100000594 | 3300005336 | Bacteria | 24977 |
| 80 | Ga0070680_100044954 | 3300005336 | Bacteria | 3589 |
| 81 | Ga0070682_100000306 | 3300005337 | Bacteria | 34011 |
| 82 | Ga0070682_100005351 | 3300005337 | Bacteria | 7143 |
| 83 | Ga0070682_100006804 | 3300005337 | Bacteria | 6418 |
| 84 | Ga0068868_100002309 | 3300005338 | Bacteria | 13196 |
| 85 | Ga0068868_100006673 | 3300005338 | Bacteria | 8190 |
| 86 | Ga0068868_100014084 | 3300005338 | Bacteria | 5887 |
| 87 | Ga0068868_100018557 | 3300005338 | Bacteria | 5203 |
| 88 | Ga0068868_100043871 | 3300005338 | Unclassified | 3494 |
| 89 | Ga0068868_100045564 | 3300005338 | Bacteria | 3431 |
| 90 | Ga0068868_100061234 | 3300005338 | Bacteria | 2981 |
| 91 | Ga0068868_100062227 | 3300005338 | Bacteria | 2958 |
| 92 | Ga0068868_100079155 | 3300005338 | Bacteria | 2633 |
| 93 | Ga0068868_100101143 | 3300005338 | Bacteria | 2333 |
| 94 | Ga0068868_100139929 | 3300005338 | Bacteria | 1986 |
| 95 | Ga0070660_100007954 | 3300005339 | Bacteria | 7404 |
| 96 | Ga0070660_100054699 | 3300005339 | Bacteria | 3082 |
| 97 | Ga0070660_100093222 | 3300005339 | Bacteria | 2378 |
| 98 | Ga0070660_100104875 | 3300005339 | Bacteria | 2243 |
| 99 | Ga0070660_100156732 | 3300005339 | Bacteria | 1833 |
| 100 | Ga0070660_100177165 | 3300005339 | Bacteria | 1724 |
| 101 | Ga0070689_100003067 | 3300005340 | Bacteria | 11001 |
| 102 | Ga0070689_100062416 | 3300005340 | Bacteria | 2899 |
| 103 | Ga0070689_100095130 | 3300005340 | Unclassified | 2353 |
| 104 | Ga0070689_100098657 | 3300005340 | Bacteria | 2311 |
| 105 | Ga0070691_10005329 | 3300005341 | Bacteria | 5847 |
| 106 | Ga0070687_100020390 | 3300005343 | Unclassified | 3099 |
| 107 | Ga0070661_100004768 | 3300005344 | Bacteria | 9334 |
| 108 | Ga0070661_100051883 | 3300005344 | Bacteria | 3002 |
| 109 | Ga0070661_100095329 | 3300005344 | Bacteria | 2207 |
| 110 | Ga0070661_100184397 | 3300005344 | Unclassified | 1589 |
| 111 | Ga0070668_100000077 | 3300005347 | Bacteria | 60697 |
| 112 | Ga0070668_100007250 | 3300005347 | Bacteria | 8223 |
| 113 | Ga0070668_100084166 | 3300005347 | Bacteria | 2498 |
| 114 | Ga0070668_100245623 | 3300005347 | Bacteria | 1484 |
| 115 | Ga0070669_100007472 | 3300005353 | Bacteria | 7830 |
| 116 | Ga0070669_100032967 | 3300005353 | Bacteria | 3744 |
| 117 | Ga0070669_100033440 | 3300005353 | Bacteria | 3719 |
| 118 | Ga0070669_100085527 | 3300005353 | Unclassified | 2355 |
| 119 | Ga0070669_100127110 | 3300005353 | Bacteria | 1952 |
| 120 | Ga0070675_100003118 | 3300005354 | Bacteria | 12537 |
| 121 | Ga0070675_100019256 | 3300005354 | Bacteria | 5437 |
| 122 | Ga0070675_100048228 | 3300005354 | Unclassified | 3491 |
| 123 | Ga0070675_100081723 | 3300005354 | Bacteria | 2695 |
| 124 | Ga0070675_100162110 | 3300005354 | Bacteria | 1923 |
| 125 | Ga0070671_100019485 | 3300005355 | Bacteria | 5523 |
| 126 | Ga0070671_100023754 | 3300005355 | Bacteria | 5018 |
| 127 | Ga0070671_100050432 | 3300005355 | Unclassified | 3462 |
| 128 | Ga0070671_100056674 | 3300005355 | Bacteria | 3260 |
| 129 | Ga0070674_100052548 | 3300005356 | Bacteria | 2811 |
| 130 | Ga0070673_100000458 | 3300005364 | Bacteria | 21582 |
| 131 | Ga0070673_100005255 | 3300005364 | Bacteria | 8266 |
| 132 | Ga0070673_100010574 | 3300005364 | Bacteria | 6252 |
| 133 | Ga0070673_100013705 | 3300005364 | Bacteria | 5620 |
| 134 | Ga0070673_100039228 | 3300005364 | Bacteria | 3623 |
| 135 | Ga0070673_100070133 | 3300005364 | Bacteria | 2811 |
| 136 | Ga0070673_100081086 | 3300005364 | Unclassified | 2630 |
| 137 | Ga0070673_100153815 | 3300005364 | Bacteria | 1950 |
| 138 | Ga0070688_100001769 | 3300005365 | Bacteria | 10810 |
| 139 | Ga0070688_100014670 | 3300005365 | Bacteria | 4443 |
| 140 | Ga0070688_100017681 | 3300005365 | Bacteria | 4096 |
| 141 | Ga0070688_100108990 | 3300005365 | Unclassified | 1838 |
| 142 | Ga0070659_100002170 | 3300005366 | Bacteria | 13976 |
| 143 | Ga0070659_100005743 | 3300005366 | Bacteria | 8932 |
| 144 | Ga0070659_100007759 | 3300005366 | Bacteria | 7805 |
| 145 | Ga0070659_100016883 | 3300005366 | Bacteria | 5486 |
| 146 | Ga0070659_100029344 | 3300005366 | Bacteria | 4250 |
| 147 | Ga0070659_100072052 | 3300005366 | Unclassified | 2749 |
| 148 | Ga0070659_100090709 | 3300005366 | Bacteria | 2449 |
| 149 | Ga0070667_100000382 | 3300005367 | Bacteria | 48246 |
| 150 | Ga0070667_100034349 | 3300005367 | Bacteria | 4243 |
| 151 | Ga0070667_100077684 | 3300005367 | Bacteria | 2835 |
| 152 | Ga0070667_100133846 | 3300005367 | Bacteria | 2166 |
| 153 | Ga0070701_10100030 | 3300005438 | Bacteria | 1604 |
| 154 | Ga0070663_100059620 | 3300005455 | Bacteria | 2743 |
| 155 | Ga0070678_100038502 | 3300005456 | Bacteria | 3367 |
| 156 | Ga0070678_100065559 | 3300005456 | Unclassified | 2697 |
| 157 | Ga0070678_100105679 | 3300005456 | Bacteria | 2192 |
| 158 | Ga0070678_100278779 | 3300005456 | Bacteria | 1413 |
| 159 | Ga0070662_100021354 | 3300005457 | Bacteria | 4420 |
| 160 | Ga0070662_100023594 | 3300005457 | Bacteria | 4227 |
| 161 | Ga0070662_100028482 | 3300005457 | Bacteria | 3887 |
| 162 | Ga0070662_100080643 | 3300005457 | Bacteria | 2423 |
| 163 | Ga0070662_100134038 | 3300005457 | Unclassified | 1913 |
| 164 | Ga0070681_10012525 | 3300005458 | Bacteria | 8417 |
| 165 | Ga0070681_10024895 | 3300005458 | Bacteria | 6022 |
| 166 | Ga0070681_10057753 | 3300005458 | Bacteria | 3861 |
| 167 | Ga0070681_10058013 | 3300005458 | Bacteria | 3851 |
| 168 | Ga0070681_10163426 | 3300005458 | Bacteria | 2150 |
| 169 | Ga0068867_100029117 | 3300005459 | Unclassified | 3979 |
| 170 | Ga0068867_100029264 | 3300005459 | Bacteria | 3968 |
| 171 | Ga0068867_100054027 | 3300005459 | Unclassified | 2967 |
| 172 | Ga0068867_100081605 | 3300005459 | Bacteria | 2438 |
| 173 | Ga0068867_100124422 | 3300005459 | Bacteria | 1997 |
| 174 | Ga0070685_10008317 | 3300005466 | Bacteria | 5326 |
| 175 | Ga0070698_100004775 | 3300005471 | Bacteria | 14871 |
| 176 | Ga0070698_100016643 | 3300005471 | Bacteria | 7760 |
| 177 | Ga0070698_100040360 | 3300005471 | Unclassified | 4797 |
| 178 | Ga0070698_100123380 | 3300005471 | Bacteria | 2548 |
| 179 | Ga0070679_100027054 | 3300005530 | Bacteria | 5640 |
| 180 | Ga0070679_100087084 | 3300005530 | Bacteria | 3110 |
| 181 | Ga0070679_100173703 | 3300005530 | Unclassified | 2127 |
| 182 | Ga0070684_100005358 | 3300005535 | Bacteria | 9829 |
| 183 | Ga0070684_100054132 | 3300005535 | Bacteria | 3496 |
| 184 | Ga0070684_100055125 | 3300005535 | Bacteria | 3464 |
| 185 | Ga0068853_100002018 | 3300005539 | Bacteria | 15006 |
| 186 | Ga0068853_100011817 | 3300005539 | Bacteria | 7098 |
| 187 | Ga0068853_100011848 | 3300005539 | Bacteria | 7089 |
| 188 | Ga0068853_100017276 | 3300005539 | Bacteria | 5955 |
| 189 | Ga0068853_100042528 | 3300005539 | Bacteria | 3885 |
| 190 | Ga0068853_100111113 | 3300005539 | Unclassified | 2435 |
| 191 | Ga0068853_100161914 | 3300005539 | Bacteria | 2020 |
| 192 | Ga0068853_100436742 | 3300005539 | Unclassified | 1230 |
| 193 | Ga0070672_100000010 | 3300005543 | Bacteria | 84105 |
| 194 | Ga0070672_100020432 | 3300005543 | Bacteria | 4830 |
| 195 | Ga0070672_100027534 | 3300005543 | Unclassified | 4240 |
| 196 | Ga0070672_100039837 | 3300005543 | Bacteria | 3602 |
| 197 | Ga0070672_100060129 | 3300005543 | Bacteria | 2991 |
| 198 | Ga0070672_100080786 | 3300005543 | Bacteria | 2605 |
| 199 | Ga0070672_100129898 | 3300005543 | Bacteria | 2069 |
| 200 | Ga0070686_100005054 | 3300005544 | Bacteria | 7283 |
| 201 | Ga0070665_100000031 | 3300005548 | Bacteria | 333365 |
| 202 | Ga0070665_100002045 | 3300005548 | Bacteria | 22705 |
| 203 | Ga0068855_100000108 | 3300005563 | Bacteria | 103059 |
| 204 | Ga0068855_100000732 | 3300005563 | Bacteria | 40298 |
| 205 | Ga0068855_100012864 | 3300005563 | Bacteria | 10097 |
| 206 | Ga0068855_100014994 | 3300005563 | Bacteria | 9334 |
| 207 | Ga0068855_100019957 | 3300005563 | Bacteria | 8050 |
| 208 | Ga0068855_100022269 | 3300005563 | Bacteria | 7593 |
| 209 | Ga0068855_100042012 | 3300005563 | Bacteria | 5418 |
| 210 | Ga0068855_100261154 | 3300005563 | Bacteria | 1929 |
| 211 | Ga0070664_100013453 | 3300005564 | Bacteria | 6663 |
| 212 | Ga0070664_100030559 | 3300005564 | Unclassified | 4495 |
| 213 | Ga0070664_100045280 | 3300005564 | Bacteria | 3716 |
| 214 | Ga0070664_100055778 | 3300005564 | Bacteria | 3356 |
| 215 | Ga0070664_100080039 | 3300005564 | Bacteria | 2814 |
| 216 | Ga0070664_100204228 | 3300005564 | Bacteria | 1764 |
| 217 | Ga0068857_100001355 | 3300005577 | Bacteria | 19285 |
| 218 | Ga0068857_100005870 | 3300005577 | Bacteria | 10483 |
| 219 | Ga0068857_100026627 | 3300005577 | Bacteria | 5097 |
| 220 | Ga0068857_100054793 | 3300005577 | Bacteria | 3539 |
| 221 | Ga0068857_100115816 | 3300005577 | Bacteria | 2411 |
| 222 | Ga0068857_100151221 | 3300005577 | Bacteria | 2103 |
| 223 | Ga0068857_100434064 | 3300005577 | Bacteria | 1226 |
| 224 | Ga0068854_100010810 | 3300005578 | Bacteria | 5923 |
| 225 | Ga0068854_100094355 | 3300005578 | Bacteria | 2232 |
| 226 | Ga0068854_100102519 | 3300005578 | Unclassified | 2147 |
| 227 | Ga0068854_100152739 | 3300005578 | Unclassified | 1782 |
| 228 | Ga0068856_100024579 | 3300005614 | Bacteria | 5865 |
| 229 | Ga0068856_100177228 | 3300005614 | Bacteria | 2144 |
| 230 | Ga0068856_100615091 | 3300005614 | Bacteria | 1107 |
| 231 | Ga0070702_100020838 | 3300005615 | Unclassified | 3441 |
| 232 | Ga0068852_100008954 | 3300005616 | Bacteria | 7408 |
| 233 | Ga0068852_100011843 | 3300005616 | Bacteria | 6591 |
| 234 | Ga0068852_100026755 | 3300005616 | Unclassified | 4694 |
| 235 | Ga0068852_100032181 | 3300005616 | Bacteria | 4339 |
| 236 | Ga0068852_100066504 | 3300005616 | Bacteria | 3148 |
| 237 | Ga0068852_100071994 | 3300005616 | Bacteria | 3037 |
| 238 | Ga0068852_100216697 | 3300005616 | Unclassified | 1819 |
| 239 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 240 | Ga0068859_100012863 | 3300005617 | Bacteria | 8406 |
| 241 | Ga0068859_100027796 | 3300005617 | Bacteria | 5673 |
| 242 | Ga0068859_100034823 | 3300005617 | Bacteria | 5053 |
| 243 | Ga0068859_100046643 | 3300005617 | Bacteria | 4351 |
| 244 | Ga0068859_100049098 | 3300005617 | Bacteria | 4238 |
| 245 | Ga0068859_100052662 | 3300005617 | Unclassified | 4092 |
| 246 | Ga0068864_100000389 | 3300005618 | Bacteria | 38410 |
| 247 | Ga0068864_100004617 | 3300005618 | Bacteria | 11298 |
| 248 | Ga0068864_100087906 | 3300005618 | Bacteria | 2736 |
| 249 | Ga0068864_100133607 | 3300005618 | Bacteria | 2232 |
| 250 | Ga0068864_100159238 | 3300005618 | Bacteria | 2051 |
| 251 | Ga0068864_100198647 | 3300005618 | Bacteria | 1841 |
| 252 | Ga0068864_100320961 | 3300005618 | Bacteria | 1455 |
| 253 | Ga0068861_100001157 | 3300005719 | Bacteria | 16428 |
| 254 | Ga0068861_100053405 | 3300005719 | Bacteria | 3074 |
| 255 | Ga0068861_100057170 | 3300005719 | Bacteria | 2979 |
| 256 | Ga0068861_100086839 | 3300005719 | Bacteria | 2460 |
| 257 | Ga0068861_100143850 | 3300005719 | Bacteria | 1949 |
| 258 | Ga0068861_100179902 | 3300005719 | Bacteria | 1759 |
| 259 | Ga0068851_10000503 | 3300005834 | Bacteria | 17049 |
| 260 | Ga0068851_10049868 | 3300005834 | Bacteria | 2125 |
| 261 | Ga0068870_10006403 | 3300005840 | Bacteria | 5188 |
| 262 | Ga0068863_100001416 | 3300005841 | Bacteria | 23764 |
| 263 | Ga0068863_100012262 | 3300005841 | Bacteria | 8276 |
| 264 | Ga0068863_100061353 | 3300005841 | Bacteria | 3555 |
| 265 | Ga0068863_100069014 | 3300005841 | Bacteria | 3343 |
| 266 | Ga0068863_100244281 | 3300005841 | Bacteria | 1733 |
| 267 | Ga0068858_100002897 | 3300005842 | Bacteria | 17254 |
| 268 | Ga0068858_100015268 | 3300005842 | Bacteria | 7227 |
| 269 | Ga0068858_100060556 | 3300005842 | Unclassified | 3499 |
| 270 | Ga0068858_100090976 | 3300005842 | Bacteria | 2840 |
| 271 | Ga0068858_100198625 | 3300005842 | Bacteria | 1896 |
| 272 | Ga0068860_100000072 | 3300005843 | Bacteria | 174997 |
| 273 | Ga0068860_100006531 | 3300005843 | Bacteria | 11706 |
| 274 | Ga0068860_100010513 | 3300005843 | Bacteria | 9150 |
| 275 | Ga0068860_100013037 | 3300005843 | Bacteria | 8161 |
| 276 | Ga0068860_100023829 | 3300005843 | Bacteria | 5917 |
| 277 | Ga0068860_100023830 | 3300005843 | Bacteria | 5917 |
| 278 | Ga0068860_100061726 | 3300005843 | Bacteria | 3561 |
| 279 | Ga0068860_100069377 | 3300005843 | Bacteria | 3350 |
| 280 | Ga0068860_100096179 | 3300005843 | Bacteria | 2823 |
| 281 | Ga0068860_100159690 | 3300005843 | Bacteria | 2173 |
| 282 | Ga0068860_100224908 | 3300005843 | Bacteria | 1823 |
| 283 | Ga0068860_100463113 | 3300005843 | Unclassified | 1262 |
| 284 | Ga0068862_100017201 | 3300005844 | Bacteria | 6017 |
| 285 | Ga0068862_100031657 | 3300005844 | Bacteria | 4467 |
| 286 | Ga0068862_100066075 | 3300005844 | Bacteria | 3116 |
| 287 | Ga0068862_100187044 | 3300005844 | Bacteria | 1862 |
| 288 | Ga0081539_10000899 | 3300005985 | Bacteria | 56635 |
| 289 | Ga0075366_10030100 | 3300006195 | Bacteria | 3190 |
| 290 | Ga0097621_100000122 | 3300006237 | Bacteria | 44726 |
| 291 | Ga0097621_100002697 | 3300006237 | Bacteria | 12142 |
| 292 | Ga0097621_100003855 | 3300006237 | Bacteria | 10385 |
| 293 | Ga0097621_100028270 | 3300006237 | Bacteria | 4419 |
| 294 | Ga0097621_100070050 | 3300006237 | Bacteria | 2895 |
| 295 | Ga0097621_100213454 | 3300006237 | Bacteria | 1679 |
| 296 | Ga0068871_100000412 | 3300006358 | Bacteria | 29568 |
| 297 | Ga0068871_100001186 | 3300006358 | Bacteria | 17453 |
| 298 | Ga0068871_100008450 | 3300006358 | Bacteria | 7407 |
| 299 | Ga0068871_100010459 | 3300006358 | Bacteria | 6772 |
| 300 | Ga0068871_100033468 | 3300006358 | Bacteria | 4070 |
| 301 | Ga0068871_100057524 | 3300006358 | Bacteria | 3163 |
| 302 | Ga0068871_100071524 | 3300006358 | Bacteria | 2853 |
| 303 | Ga0068871_100220008 | 3300006358 | Bacteria | 1645 |
| 304 | Ga0075428_100006899 | 3300006844 | Bacteria | 12614 |
| 305 | Ga0075428_100008539 | 3300006844 | Bacteria | 11364 |
| 306 | Ga0075430_100020469 | 3300006846 | Bacteria | 5628 |
| 307 | Ga0075430_100081376 | 3300006846 | Bacteria | 2713 |
| 308 | Ga0075431_100011318 | 3300006847 | Bacteria | 8987 |
| 309 | Ga0075429_100012224 | 3300006880 | Bacteria | 7442 |
| 310 | Ga0075429_100151805 | 3300006880 | Bacteria | 2028 |
| 311 | Ga0068865_100004773 | 3300006881 | Bacteria | 8195 |
| 312 | Ga0068865_100047126 | 3300006881 | Bacteria | 2960 |
| 313 | Ga0068865_100049844 | 3300006881 | Bacteria | 2890 |
| 314 | Ga0068865_100178757 | 3300006881 | Bacteria | 1632 |
| 315 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 316 | Ga0097620_100012863 | 3300006931 | Bacteria | 8406 |
| 317 | Ga0097620_100027796 | 3300006931 | Bacteria | 5673 |
| 318 | Ga0097620_100034824 | 3300006931 | Bacteria | 5053 |
| 319 | Ga0097620_100046639 | 3300006931 | Bacteria | 4351 |
| 320 | Ga0097620_100049103 | 3300006931 | Bacteria | 4238 |
| 321 | Ga0097620_100052661 | 3300006931 | Unclassified | 4092 |
| 322 | Ga0105251_10039608 | 3300009011 | Bacteria | 2301 |
| 323 | Ga0105240_10000152 | 3300009093 | Bacteria | 141054 |
| 324 | Ga0105240_10001109 | 3300009093 | Bacteria | 47404 |
| 325 | Ga0105240_10002195 | 3300009093 | Bacteria | 31863 |
| 326 | Ga0105240_10015841 | 3300009093 | Bacteria | 10228 |
| 327 | Ga0105240_10023875 | 3300009093 | Bacteria | 8076 |
| 328 | Ga0105240_10038968 | 3300009093 | Bacteria | 6091 |
| 329 | Ga0105240_10045267 | 3300009093 | Bacteria | 5584 |
| 330 | Ga0105240_10057451 | 3300009093 | Bacteria | 4861 |
| 331 | Ga0105240_10081585 | 3300009093 | Bacteria | 3974 |
| 332 | Ga0105240_10272185 | 3300009093 | Bacteria | 1949 |
| 333 | Ga0105240_10302117 | 3300009093 | Bacteria | 1831 |
| 334 | Ga0105240_10328061 | 3300009093 | Bacteria | 1742 |
| 335 | Ga0105240_10497778 | 3300009093 | Bacteria | 1356 |
| 336 | Ga0111539_10006032 | 3300009094 | Bacteria | 15656 |
| 337 | Ga0111539_10015984 | 3300009094 | Bacteria | 9322 |
| 338 | Ga0105247_10034255 | 3300009101 | Bacteria | 3093 |
| 339 | Ga0105247_10277396 | 3300009101 | Bacteria | 1155 |
| 340 | Ga0114129_10090762 | 3300009147 | Bacteria | 4234 |
| 341 | Ga0114129_10144051 | 3300009147 | Bacteria | 3265 |
| 342 | Ga0114129_10150623 | 3300009147 | Bacteria | 3184 |
| 343 | Ga0105241_10000813 | 3300009174 | Bacteria | 23714 |
| 344 | Ga0105241_10000893 | 3300009174 | Bacteria | 22522 |
| 345 | Ga0105241_10001132 | 3300009174 | Bacteria | 20319 |
| 346 | Ga0105241_10013390 | 3300009174 | Bacteria | 6011 |
| 347 | Ga0105241_10213285 | 3300009174 | Bacteria | 1619 |
| 348 | Ga0105241_10232474 | 3300009174 | Unclassified | 1555 |
| 349 | Ga0105242_10043806 | 3300009176 | Bacteria | 3622 |
| 350 | Ga0105242_10110984 | 3300009176 | Bacteria | 2338 |
| 351 | Ga0105242_10161945 | 3300009176 | Bacteria | 1959 |
| 352 | Ga0105242_10244724 | 3300009176 | Bacteria | 1614 |
| 353 | Ga0105248_10189402 | 3300009177 | Bacteria | 2318 |
| 354 | Ga0105237_10001480 | 3300009545 | Bacteria | 30945 |
| 355 | Ga0105237_10004983 | 3300009545 | Bacteria | 15140 |
| 356 | Ga0105237_10013064 | 3300009545 | Bacteria | 8720 |
| 357 | Ga0105237_10016323 | 3300009545 | Bacteria | 7719 |
| 358 | Ga0105237_10179837 | 3300009545 | Bacteria | 2115 |
| 359 | Ga0105237_10243373 | 3300009545 | Bacteria | 1800 |
| 360 | Ga0105237_10293737 | 3300009545 | Bacteria | 1628 |
| 361 | Ga0105238_10003001 | 3300009551 | Bacteria | 16856 |
| 362 | Ga0105238_10003918 | 3300009551 | Bacteria | 14774 |
| 363 | Ga0105249_10001879 | 3300009553 | Bacteria | 18195 |
| 364 | Ga0105249_10003364 | 3300009553 | Bacteria | 13842 |
| 365 | Ga0105249_10003657 | 3300009553 | Bacteria | 13275 |
| 366 | Ga0105249_10010234 | 3300009553 | Bacteria | 8236 |
| 367 | Ga0105249_10020220 | 3300009553 | Bacteria | 5950 |
| 368 | Ga0105249_10033600 | 3300009553 | Bacteria | 4645 |
| 369 | Ga0105249_10122316 | 3300009553 | Unclassified | 2475 |
| 370 | Ga0105249_10241071 | 3300009553 | Bacteria | 1788 |
| 371 | Ga0105249_10294460 | 3300009553 | Bacteria | 1625 |
| 372 | Ga0105239_10000596 | 3300010375 | Bacteria | 51547 |
| 373 | Ga0105239_10020350 | 3300010375 | Bacteria | 7319 |
| 374 | Ga0105239_10088598 | 3300010375 | Bacteria | 3412 |
| 375 | Ga0105239_10141382 | 3300010375 | Unclassified | 2682 |
| 376 | Ga0105239_10264157 | 3300010375 | Bacteria | 1935 |
| 377 | Ga0105239_10357919 | 3300010375 | Bacteria | 1648 |
| 378 | Ga0105246_10178567 | 3300011119 | Unclassified | 1632 |
| 379 | Ga0105246_10304429 | 3300011119 | Bacteria | 1288 |
| 380 | Ga0157373_10016489 | 3300013100 | Bacteria | 5387 |
| 381 | Ga0157373_10036339 | 3300013100 | Bacteria | 3536 |
| 382 | Ga0157373_10058483 | 3300013100 | Unclassified | 2733 |
| 383 | Ga0157373_10065185 | 3300013100 | Bacteria | 2578 |
| 384 | Ga0157373_10079985 | 3300013100 | Bacteria | 2305 |
| 385 | Ga0157371_10000642 | 3300013102 | Bacteria | 41406 |
| 386 | Ga0157371_10002222 | 3300013102 | Bacteria | 18778 |
| 387 | Ga0157371_10003513 | 3300013102 | Bacteria | 14156 |
| 388 | Ga0157371_10040430 | 3300013102 | Bacteria | 3330 |
| 389 | Ga0157371_10045602 | 3300013102 | Bacteria | 3119 |
| 390 | Ga0157371_10052236 | 3300013102 | Bacteria | 2903 |
| 391 | Ga0157371_10052931 | 3300013102 | Bacteria | 2883 |
| 392 | Ga0157371_10066274 | 3300013102 | Bacteria | 2557 |
| 393 | Ga0157370_10002063 | 3300013104 | Bacteria | 24617 |
| 394 | Ga0157370_10006351 | 3300013104 | Bacteria | 13053 |
| 395 | Ga0157370_10022658 | 3300013104 | Bacteria | 6250 |
| 396 | Ga0157370_10022981 | 3300013104 | Bacteria | 6197 |
| 397 | Ga0157370_10035467 | 3300013104 | Unclassified | 4847 |
| 398 | Ga0157370_10038922 | 3300013104 | Bacteria | 4598 |
| 399 | Ga0157370_10132764 | 3300013104 | Bacteria | 2322 |
| 400 | Ga0157370_10224545 | 3300013104 | Unclassified | 1739 |
| 401 | Ga0157370_10407449 | 3300013104 | Bacteria | 1251 |
| 402 | Ga0157370_10418920 | 3300013104 | Bacteria | 1232 |
| 403 | Ga0157369_10008609 | 3300013105 | Bacteria | 11700 |
| 404 | Ga0157369_10026680 | 3300013105 | Bacteria | 6405 |
| 405 | Ga0157369_10029377 | 3300013105 | Bacteria | 6075 |
| 406 | Ga0157369_10035700 | 3300013105 | Bacteria | 5449 |
| 407 | Ga0157369_10129758 | 3300013105 | Bacteria | 2672 |
| 408 | Ga0157369_10165532 | 3300013105 | Bacteria | 2332 |
| 409 | Ga0157369_10279892 | 3300013105 | Bacteria | 1737 |
| 410 | Ga0157374_10000440 | 3300013296 | Bacteria | 37662 |
| 411 | Ga0157374_10003152 | 3300013296 | Bacteria | 13864 |
| 412 | Ga0157374_10014074 | 3300013296 | Bacteria | 6995 |
| 413 | Ga0157374_10015844 | 3300013296 | Bacteria | 6623 |
| 414 | Ga0157374_10023036 | 3300013296 | Bacteria | 5564 |
| 415 | Ga0157374_10033267 | 3300013296 | Bacteria | 4703 |
| 416 | Ga0157374_10050029 | 3300013296 | Bacteria | 3883 |
| 417 | Ga0157374_10119431 | 3300013296 | Unclassified | 2543 |
| 418 | Ga0157374_10151088 | 3300013296 | Bacteria | 2258 |
| 419 | Ga0157378_10002826 | 3300013297 | Bacteria | 15482 |
| 420 | Ga0157378_10054560 | 3300013297 | Bacteria | 3558 |
| 421 | Ga0157378_10055935 | 3300013297 | Bacteria | 3515 |
| 422 | Ga0157378_10073674 | 3300013297 | Bacteria | 3070 |
| 423 | Ga0157378_10110351 | 3300013297 | Bacteria | 2521 |
| 424 | Ga0157378_10142972 | 3300013297 | Bacteria | 2223 |
| 425 | Ga0157378_10157602 | 3300013297 | Bacteria | 2120 |
| 426 | Ga0157378_10456506 | 3300013297 | Bacteria | 1269 |
| 427 | Ga0163162_10001022 | 3300013306 | Bacteria | 25996 |
| 428 | Ga0163162_10001731 | 3300013306 | Bacteria | 20442 |
| 429 | Ga0163162_10003497 | 3300013306 | Bacteria | 15015 |
| 430 | Ga0163162_10003748 | 3300013306 | Bacteria | 14565 |
| 431 | Ga0163162_10003960 | 3300013306 | Bacteria | 14208 |
| 432 | Ga0163162_10004143 | 3300013306 | Bacteria | 13922 |
| 433 | Ga0163162_10005187 | 3300013306 | Bacteria | 12565 |
| 434 | Ga0163162_10005457 | 3300013306 | Bacteria | 12287 |
| 435 | Ga0163162_10114034 | 3300013306 | Bacteria | 2801 |
| 436 | Ga0163162_10159301 | 3300013306 | Bacteria | 2379 |
| 437 | Ga0163162_10253463 | 3300013306 | Bacteria | 1892 |
| 438 | Ga0163162_10376241 | 3300013306 | Bacteria | 1553 |
| 439 | Ga0157372_10007217 | 3300013307 | Bacteria | 11833 |
| 440 | Ga0157372_10008579 | 3300013307 | Bacteria | 10859 |
| 441 | Ga0157372_10010299 | 3300013307 | Bacteria | 9934 |
| 442 | Ga0157372_10029448 | 3300013307 | Bacteria | 5995 |
| 443 | Ga0157372_10041683 | 3300013307 | Bacteria | 5075 |
| 444 | Ga0157372_10051606 | 3300013307 | Bacteria | 4577 |
| 445 | Ga0157372_10054553 | 3300013307 | Bacteria | 4459 |
| 446 | Ga0157372_10069856 | 3300013307 | Bacteria | 3950 |
| 447 | Ga0157372_10081900 | 3300013307 | Bacteria | 3653 |
| 448 | Ga0157372_10104725 | 3300013307 | Bacteria | 3235 |
| 449 | Ga0157372_10107147 | 3300013307 | Bacteria | 3197 |
| 450 | Ga0157372_10114364 | 3300013307 | Bacteria | 3093 |
| 451 | Ga0157372_10129989 | 3300013307 | Bacteria | 2897 |
| 452 | Ga0157372_10185237 | 3300013307 | Bacteria | 2411 |
| 453 | Ga0157372_10204036 | 3300013307 | Unclassified | 2290 |
| 454 | Ga0157372_10244481 | 3300013307 | Unclassified | 2082 |
| 455 | Ga0157372_10391786 | 3300013307 | Unclassified | 1619 |
| 456 | Ga0157375_10000219 | 3300013308 | Bacteria | 53586 |
| 457 | Ga0157375_10001037 | 3300013308 | Bacteria | 23988 |
| 458 | Ga0157375_10033496 | 3300013308 | Bacteria | 4883 |
| 459 | Ga0157375_10047606 | 3300013308 | Bacteria | 4189 |
| 460 | Ga0157375_10083582 | 3300013308 | Bacteria | 3238 |
| 461 | Ga0157375_10088836 | 3300013308 | Bacteria | 3146 |
| 462 | Ga0157375_10124081 | 3300013308 | Unclassified | 2696 |
| 463 | Ga0157375_10129469 | 3300013308 | Unclassified | 2642 |
| 464 | Ga0157375_10190895 | 3300013308 | Bacteria | 2203 |
| 465 | Ga0157375_10233021 | 3300013308 | Bacteria | 2000 |
| 466 | Ga0157375_10256455 | 3300013308 | Bacteria | 1910 |
| 467 | Ga0157375_10373881 | 3300013308 | Bacteria | 1591 |
| 468 | Ga0157375_10640006 | 3300013308 | Bacteria | 1220 |
| 469 | Ga0163163_10000803 | 3300014325 | Bacteria | 26650 |
| 470 | Ga0163163_10000936 | 3300014325 | Bacteria | 24752 |
| 471 | Ga0163163_10002011 | 3300014325 | Bacteria | 17173 |
| 472 | Ga0163163_10013408 | 3300014325 | Bacteria | 7505 |
| 473 | Ga0163163_10110318 | 3300014325 | Bacteria | 2779 |
| 474 | Ga0163163_10357610 | 3300014325 | Unclassified | 1517 |
| 475 | Ga0163163_10389172 | 3300014325 | Unclassified | 1452 |
| 476 | Ga0157380_10011402 | 3300014326 | Bacteria | 6423 |
| 477 | Ga0157380_10084098 | 3300014326 | Bacteria | 2608 |
| 478 | Ga0157380_10101399 | 3300014326 | Bacteria | 2398 |
| 479 | Ga0157380_10448069 | 3300014326 | Unclassified | 1239 |
| 480 | Ga0157377_10000734 | 3300014745 | Bacteria | 13544 |
| 481 | Ga0157377_10010123 | 3300014745 | Bacteria | 4653 |
| 482 | Ga0157377_10023786 | 3300014745 | Bacteria | 3251 |
| 483 | Ga0157377_10031424 | 3300014745 | Bacteria | 2885 |
| 484 | Ga0157379_10000078 | 3300014968 | Bacteria | 63565 |
| 485 | Ga0157379_10019816 | 3300014968 | Bacteria | 5944 |
| 486 | Ga0157379_10030868 | 3300014968 | Bacteria | 4773 |
| 487 | Ga0157379_10118285 | 3300014968 | Bacteria | 2383 |
| 488 | Ga0157376_10000219 | 3300014969 | Bacteria | 39583 |
| 489 | Ga0157376_10000554 | 3300014969 | Bacteria | 24053 |
| 490 | Ga0157376_10010474 | 3300014969 | Bacteria | 6783 |
| 491 | Ga0157376_10056150 | 3300014969 | Bacteria | 3288 |
| 492 | Ga0157376_10188407 | 3300014969 | Bacteria | 1890 |
| 493 | Ga0157376_10207468 | 3300014969 | Bacteria | 1807 |
| 494 | Ga0157376_10221657 | 3300014969 | Bacteria | 1752 |
| 495 | Ga0182005_1000126 | 3300015265 | Bacteria | 53914 |
| 496 | Ga0163161_10001931 | 3300017792 | Bacteria | 15120 |
| 497 | Ga0163161_10005543 | 3300017792 | Bacteria | 8745 |
| 498 | Ga0163161_10022094 | 3300017792 | Bacteria | 4477 |
| 499 | Ga0163161_10022100 | 3300017792 | Bacteria | 4477 |
| 500 | Ga0163161_10023331 | 3300017792 | Bacteria | 4365 |
| 501 | Ga0213876_10011837 | 3300021384 | Bacteria | 4651 |
| 502 | Ga0209436_101280 | 3300025208 | Bacteria | 8995 |
| 503 | Ga0209258_100098 | 3300025242 | Bacteria | 215216 |
| 504 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 505 | Ga0209148_1000682 | 3300025254 | Bacteria | 28368 |
| 506 | Ga0209673_1000299 | 3300025273 | Bacteria | 91734 |
| 507 | Ga0209130_1001255 | 3300025284 | Bacteria | 17694 |
| 508 | Ga0209564_1024014 | 3300025295 | Bacteria | 2096 |
| 509 | Ga0209564_1043407 | 3300025295 | Bacteria | 1180 |
| 510 | Ga0209758_1000497 | 3300025297 | Bacteria | 64050 |
| 511 | Ga0209758_1007875 | 3300025297 | Bacteria | 7084 |
| 512 | Ga0209758_1011427 | 3300025297 | Bacteria | 5146 |
| 513 | Ga0209050_1000771 | 3300025298 | Bacteria | 46024 |
| 514 | Ga0207426_1000019 | 3300025302 | Bacteria | 558579 |
| 515 | Ga0207426_1000137 | 3300025302 | Bacteria | 199010 |
| 516 | Ga0207426_1000562 | 3300025302 | Bacteria | 50691 |
| 517 | Ga0207426_1001710 | 3300025302 | Bacteria | 16850 |
| 518 | Ga0207426_1004272 | 3300025302 | Bacteria | 7076 |
| 519 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 520 | Ga0209257_1006112 | 3300025304 | Bacteria | 7991 |
| 521 | Ga0207697_10015466 | 3300025315 | Bacteria | 3153 |
| 522 | Ga0207697_10016329 | 3300025315 | Bacteria | 3058 |
| 523 | Ga0207682_10032721 | 3300025893 | Bacteria | 2091 |
| 524 | Ga0207682_10037618 | 3300025893 | Bacteria | 1961 |
| 525 | Ga0207710_10046686 | 3300025900 | Bacteria | 1934 |
| 526 | Ga0207688_10012491 | 3300025901 | Bacteria | 4622 |
| 527 | Ga0207680_10000026 | 3300025903 | Bacteria | 79960 |
| 528 | Ga0207680_10012305 | 3300025903 | Bacteria | 4354 |
| 529 | Ga0207680_10027008 | 3300025903 | Bacteria | 3189 |
| 530 | Ga0207680_10052847 | 3300025903 | Bacteria | 2436 |
| 531 | Ga0207680_10127099 | 3300025903 | Bacteria | 1675 |
| 532 | Ga0207680_10188834 | 3300025903 | Bacteria | 1397 |
| 533 | Ga0207647_10095497 | 3300025904 | Bacteria | 1770 |
| 534 | Ga0207645_10002365 | 3300025907 | Bacteria | 14880 |
| 535 | Ga0207645_10015737 | 3300025907 | Bacteria | 5016 |
| 536 | Ga0207645_10041085 | 3300025907 | Bacteria | 2962 |
| 537 | Ga0207643_10048056 | 3300025908 | Bacteria | 2416 |
| 538 | Ga0207643_10072292 | 3300025908 | Bacteria | 1987 |
| 539 | Ga0207705_10002848 | 3300025909 | Bacteria | 13228 |
| 540 | Ga0207705_10031133 | 3300025909 | Bacteria | 3807 |
| 541 | Ga0207705_10044128 | 3300025909 | Bacteria | 3204 |
| 542 | Ga0207705_10087541 | 3300025909 | Bacteria | 2278 |
| 543 | Ga0207654_10033997 | 3300025911 | Bacteria | 2829 |
| 544 | Ga0207654_10044405 | 3300025911 | Bacteria | 2524 |
| 545 | Ga0207654_10096438 | 3300025911 | Bacteria | 1814 |
| 546 | Ga0207707_10012158 | 3300025912 | Bacteria | 7482 |
| 547 | Ga0207707_10083205 | 3300025912 | Bacteria | 2794 |
| 548 | Ga0207707_10144588 | 3300025912 | Unclassified | 2079 |
| 549 | Ga0207695_10000060 | 3300025913 | Bacteria | 360217 |
| 550 | Ga0207695_10000185 | 3300025913 | Bacteria | 180225 |
| 551 | Ga0207695_10000666 | 3300025913 | Bacteria | 67698 |
| 552 | Ga0207695_10002019 | 3300025913 | Bacteria | 31240 |
| 553 | Ga0207695_10020493 | 3300025913 | Bacteria | 7571 |
| 554 | Ga0207695_10024469 | 3300025913 | Bacteria | 6793 |
| 555 | Ga0207695_10029572 | 3300025913 | Bacteria | 6048 |
| 556 | Ga0207695_10058683 | 3300025913 | Bacteria | 3994 |
| 557 | Ga0207695_10091007 | 3300025913 | Bacteria | 3065 |
| 558 | Ga0207695_10145924 | 3300025913 | Bacteria | 2310 |
| 559 | Ga0207695_10266310 | 3300025913 | Bacteria | 1610 |
| 560 | Ga0207671_10001263 | 3300025914 | Bacteria | 29797 |
| 561 | Ga0207671_10001265 | 3300025914 | Bacteria | 29785 |
| 562 | Ga0207671_10001378 | 3300025914 | Bacteria | 28270 |
| 563 | Ga0207671_10006612 | 3300025914 | Bacteria | 10285 |
| 564 | Ga0207671_10014115 | 3300025914 | Bacteria | 6328 |
| 565 | Ga0207660_10006788 | 3300025917 | Bacteria | 7414 |
| 566 | Ga0207660_10053868 | 3300025917 | Unclassified | 2869 |
| 567 | Ga0207660_10102611 | 3300025917 | Unclassified | 2138 |
| 568 | Ga0207662_10048369 | 3300025918 | Bacteria | 2519 |
| 569 | Ga0207662_10072413 | 3300025918 | Unclassified | 2088 |
| 570 | Ga0207657_10032389 | 3300025919 | Bacteria | 4723 |
| 571 | Ga0207657_10040514 | 3300025919 | Bacteria | 4127 |
| 572 | Ga0207657_10063023 | 3300025919 | Bacteria | 3172 |
| 573 | Ga0207657_10110558 | 3300025919 | Bacteria | 2270 |
| 574 | Ga0207657_10233716 | 3300025919 | Bacteria | 1470 |
| 575 | Ga0207657_10239665 | 3300025919 | Bacteria | 1448 |
| 576 | Ga0207652_10001065 | 3300025921 | Bacteria | 24919 |
| 577 | Ga0207652_10038245 | 3300025921 | Bacteria | 4066 |
| 578 | Ga0207652_10083509 | 3300025921 | Bacteria | 2796 |
| 579 | Ga0207681_10002862 | 3300025923 | Bacteria | 10905 |
| 580 | Ga0207681_10055724 | 3300025923 | Unclassified | 2694 |
| 581 | Ga0207681_10083863 | 3300025923 | Unclassified | 2257 |
| 582 | Ga0207694_10006677 | 3300025924 | Bacteria | 8765 |
| 583 | Ga0207650_10018608 | 3300025925 | Bacteria | 4876 |
| 584 | Ga0207650_10049594 | 3300025925 | Bacteria | 3101 |
| 585 | Ga0207650_10053698 | 3300025925 | Bacteria | 2987 |
| 586 | Ga0207650_10088656 | 3300025925 | Bacteria | 2360 |
| 587 | Ga0207650_10100680 | 3300025925 | Bacteria | 2223 |
| 588 | Ga0207650_10229509 | 3300025925 | Bacteria | 1497 |
| 589 | Ga0207650_10247637 | 3300025925 | Bacteria | 1442 |
| 590 | Ga0207659_10025913 | 3300025926 | Bacteria | 3949 |
| 591 | Ga0207659_10028295 | 3300025926 | Bacteria | 3807 |
| 592 | Ga0207659_10028428 | 3300025926 | Bacteria | 3800 |
| 593 | Ga0207659_10059965 | 3300025926 | Unclassified | 2737 |
| 594 | Ga0207659_10122479 | 3300025926 | Bacteria | 1995 |
| 595 | Ga0207659_10200649 | 3300025926 | Bacteria | 1593 |
| 596 | Ga0207644_10046471 | 3300025931 | Bacteria | 3093 |
| 597 | Ga0207644_10065845 | 3300025931 | Unclassified | 2636 |
| 598 | Ga0207644_10102007 | 3300025931 | Bacteria | 2157 |
| 599 | Ga0207644_10144300 | 3300025931 | Bacteria | 1836 |
| 600 | Ga0207644_10149983 | 3300025931 | Unclassified | 1803 |
| 601 | Ga0207644_10160775 | 3300025931 | Bacteria | 1746 |
| 602 | Ga0207690_10030536 | 3300025932 | Bacteria | 3438 |
| 603 | Ga0207690_10049221 | 3300025932 | Bacteria | 2808 |
| 604 | Ga0207690_10068265 | 3300025932 | Bacteria | 2442 |
| 605 | Ga0207690_10152511 | 3300025932 | Bacteria | 1714 |
| 606 | Ga0207706_10006315 | 3300025933 | Bacteria | 11014 |
| 607 | Ga0207706_10007207 | 3300025933 | Bacteria | 10280 |
| 608 | Ga0207706_10010930 | 3300025933 | Bacteria | 8279 |
| 609 | Ga0207706_10015400 | 3300025933 | Bacteria | 6909 |
| 610 | Ga0207706_10045085 | 3300025933 | Bacteria | 3907 |
| 611 | Ga0207706_10083471 | 3300025933 | Bacteria | 2809 |
| 612 | Ga0207686_10000909 | 3300025934 | Bacteria | 17772 |
| 613 | Ga0207670_10012581 | 3300025936 | Bacteria | 4956 |
| 614 | Ga0207670_10036851 | 3300025936 | Bacteria | 3184 |
| 615 | Ga0207670_10154655 | 3300025936 | Bacteria | 1706 |
| 616 | Ga0207704_10014245 | 3300025938 | Bacteria | 4010 |
| 617 | Ga0207704_10020109 | 3300025938 | Bacteria | 3524 |
| 618 | Ga0207704_10043471 | 3300025938 | Bacteria | 2654 |
| 619 | Ga0207704_10103824 | 3300025938 | Bacteria | 1902 |
| 620 | Ga0207704_10234801 | 3300025938 | Bacteria | 1366 |
| 621 | Ga0207691_10000014 | 3300025940 | Bacteria | 142542 |
| 622 | Ga0207691_10008260 | 3300025940 | Bacteria | 9996 |
| 623 | Ga0207691_10030869 | 3300025940 | Bacteria | 5004 |
| 624 | Ga0207691_10055796 | 3300025940 | Unclassified | 3600 |
| 625 | Ga0207691_10142619 | 3300025940 | Bacteria | 2110 |
| 626 | Ga0207689_10001523 | 3300025942 | Bacteria | 22061 |
| 627 | Ga0207689_10003713 | 3300025942 | Bacteria | 13913 |
| 628 | Ga0207689_10006429 | 3300025942 | Bacteria | 10389 |
| 629 | Ga0207689_10012708 | 3300025942 | Bacteria | 7192 |
| 630 | Ga0207689_10012737 | 3300025942 | Bacteria | 7184 |
| 631 | Ga0207689_10012764 | 3300025942 | Bacteria | 7179 |
| 632 | Ga0207689_10015373 | 3300025942 | Bacteria | 6479 |
| 633 | Ga0207689_10025133 | 3300025942 | Unclassified | 4992 |
| 634 | Ga0207689_10067011 | 3300025942 | Bacteria | 2951 |
| 635 | Ga0207689_10166791 | 3300025942 | Bacteria | 1814 |
| 636 | Ga0207661_10083764 | 3300025944 | Unclassified | 2639 |
| 637 | Ga0207661_10092617 | 3300025944 | Bacteria | 2520 |
| 638 | Ga0207679_10003675 | 3300025945 | Bacteria | 9506 |
| 639 | Ga0207679_10006982 | 3300025945 | Bacteria | 7157 |
| 640 | Ga0207679_10017302 | 3300025945 | Bacteria | 4806 |
| 641 | Ga0207679_10052759 | 3300025945 | Bacteria | 2984 |
| 642 | Ga0207667_10000084 | 3300025949 | Bacteria | 152086 |
| 643 | Ga0207667_10018078 | 3300025949 | Bacteria | 7916 |
| 644 | Ga0207667_10018411 | 3300025949 | Bacteria | 7833 |
| 645 | Ga0207667_10032284 | 3300025949 | Bacteria | 5644 |
| 646 | Ga0207667_10050187 | 3300025949 | Bacteria | 4403 |
| 647 | Ga0207667_10056603 | 3300025949 | Bacteria | 4119 |
| 648 | Ga0207651_10000262 | 3300025960 | Bacteria | 22471 |
| 649 | Ga0207651_10045863 | 3300025960 | Bacteria | 2934 |
| 650 | Ga0207651_10074988 | 3300025960 | Unclassified | 2411 |
| 651 | Ga0207651_10079716 | 3300025960 | Bacteria | 2353 |
| 652 | Ga0207651_10080914 | 3300025960 | Bacteria | 2340 |
| 653 | Ga0207651_10420173 | 3300025960 | Bacteria | 1141 |
| 654 | Ga0207712_10005936 | 3300025961 | Bacteria | 7700 |
| 655 | Ga0207712_10008329 | 3300025961 | Bacteria | 6555 |
| 656 | Ga0207712_10019440 | 3300025961 | Bacteria | 4436 |
| 657 | Ga0207712_10020327 | 3300025961 | Bacteria | 4348 |
| 658 | Ga0207712_10025376 | 3300025961 | Bacteria | 3937 |
| 659 | Ga0207712_10070709 | 3300025961 | Bacteria | 2508 |
| 660 | Ga0207668_10000544 | 3300025972 | Bacteria | 23682 |
| 661 | Ga0207668_10091391 | 3300025972 | Bacteria | 2237 |
| 662 | Ga0207668_10145279 | 3300025972 | Bacteria | 1829 |
| 663 | Ga0207668_10255037 | 3300025972 | Unclassified | 1427 |
| 664 | Ga0207640_10042857 | 3300025981 | Bacteria | 2888 |
| 665 | Ga0207640_10054981 | 3300025981 | Bacteria | 2605 |
| 666 | Ga0207640_10162811 | 3300025981 | Bacteria | 1653 |
| 667 | Ga0207658_10001505 | 3300025986 | Bacteria | 18119 |
| 668 | Ga0207658_10022600 | 3300025986 | Bacteria | 4381 |
| 669 | Ga0207658_10068965 | 3300025986 | Bacteria | 2670 |
| 670 | Ga0207658_10162623 | 3300025986 | Bacteria | 1831 |
| 671 | Ga0207658_10198554 | 3300025986 | Bacteria | 1673 |
| 672 | Ga0207658_10199397 | 3300025986 | Bacteria | 1670 |
| 673 | Ga0207658_10264992 | 3300025986 | Unclassified | 1466 |
| 674 | Ga0207677_10001128 | 3300026023 | Bacteria | 14558 |
| 675 | Ga0207677_10007816 | 3300026023 | Bacteria | 5937 |
| 676 | Ga0207677_10010583 | 3300026023 | Bacteria | 5226 |
| 677 | Ga0207677_10023852 | 3300026023 | Bacteria | 3787 |
| 678 | Ga0207677_10038954 | 3300026023 | Unclassified | 3121 |
| 679 | Ga0207677_10097786 | 3300026023 | Bacteria | 2151 |
| 680 | Ga0207677_10125325 | 3300026023 | Bacteria | 1940 |
| 681 | Ga0207703_10001897 | 3300026035 | Bacteria | 18529 |
| 682 | Ga0207703_10013153 | 3300026035 | Bacteria | 6448 |
| 683 | Ga0207703_10100930 | 3300026035 | Bacteria | 2446 |
| 684 | Ga0207703_10305589 | 3300026035 | Unclassified | 1452 |
| 685 | Ga0207639_10006748 | 3300026041 | Bacteria | 7812 |
| 686 | Ga0207639_10017197 | 3300026041 | Bacteria | 5126 |
| 687 | Ga0207639_10020984 | 3300026041 | Bacteria | 4685 |
| 688 | Ga0207639_10031409 | 3300026041 | Bacteria | 3903 |
| 689 | Ga0207639_10031413 | 3300026041 | Bacteria | 3903 |
| 690 | Ga0207639_10068232 | 3300026041 | Bacteria | 2770 |
| 691 | Ga0207639_10230510 | 3300026041 | Bacteria | 1605 |
| 692 | Ga0207639_10300518 | 3300026041 | Unclassified | 1419 |
| 693 | Ga0207678_10020230 | 3300026067 | Bacteria | 5844 |
| 694 | Ga0207708_10030217 | 3300026075 | Bacteria | 4109 |
| 695 | Ga0207702_10052731 | 3300026078 | Bacteria | 3443 |
| 696 | Ga0207702_10055832 | 3300026078 | Bacteria | 3350 |
| 697 | Ga0207702_10164291 | 3300026078 | Bacteria | 2030 |
| 698 | Ga0207641_10000167 | 3300026088 | Bacteria | 92790 |
| 699 | Ga0207641_10004744 | 3300026088 | Bacteria | 11719 |
| 700 | Ga0207641_10040147 | 3300026088 | Bacteria | 3916 |
| 701 | Ga0207641_10091214 | 3300026088 | Bacteria | 2666 |
| 702 | Ga0207641_10136343 | 3300026088 | Bacteria | 2209 |
| 703 | Ga0207641_10259736 | 3300026088 | Unclassified | 1626 |
| 704 | Ga0207648_10002320 | 3300026089 | Bacteria | 20536 |
| 705 | Ga0207648_10007356 | 3300026089 | Bacteria | 10841 |
| 706 | Ga0207648_10105071 | 3300026089 | Bacteria | 2477 |
| 707 | Ga0207648_10156979 | 3300026089 | Bacteria | 2008 |
| 708 | Ga0207648_10170140 | 3300026089 | Bacteria | 1926 |
| 709 | Ga0207648_10218022 | 3300026089 | Bacteria | 1695 |
| 710 | Ga0207676_10004203 | 3300026095 | Bacteria | 10171 |
| 711 | Ga0207676_10004336 | 3300026095 | Bacteria | 10037 |
| 712 | Ga0207676_10047269 | 3300026095 | Bacteria | 3334 |
| 713 | Ga0207676_10080028 | 3300026095 | Bacteria | 2651 |
| 714 | Ga0207676_10132549 | 3300026095 | Unclassified | 2121 |
| 715 | Ga0207676_10285905 | 3300026095 | Bacteria | 1499 |
| 716 | Ga0207676_10336095 | 3300026095 | Bacteria | 1392 |
| 717 | Ga0207674_10000487 | 3300026116 | Bacteria | 52391 |
| 718 | Ga0207674_10005497 | 3300026116 | Bacteria | 15045 |
| 719 | Ga0207674_10030010 | 3300026116 | Bacteria | 5720 |
| 720 | Ga0207674_10032755 | 3300026116 | Bacteria | 5448 |
| 721 | Ga0207674_10081556 | 3300026116 | Bacteria | 3236 |
| 722 | Ga0207674_10085277 | 3300026116 | Unclassified | 3154 |
| 723 | Ga0207674_10111878 | 3300026116 | Bacteria | 2704 |
| 724 | Ga0207674_10320599 | 3300026116 | Bacteria | 1499 |
| 725 | Ga0207675_100000422 | 3300026118 | Bacteria | 40963 |
| 726 | Ga0207675_100009495 | 3300026118 | Bacteria | 9105 |
| 727 | Ga0207675_100135846 | 3300026118 | Unclassified | 2333 |
| 728 | Ga0207675_100160098 | 3300026118 | Bacteria | 2147 |
| 729 | Ga0207675_100344119 | 3300026118 | Bacteria | 1460 |
| 730 | Ga0207683_10009154 | 3300026121 | Bacteria | 8436 |
| 731 | Ga0207683_10012331 | 3300026121 | Bacteria | 7295 |
| 732 | Ga0207683_10048639 | 3300026121 | Bacteria | 3713 |
| 733 | Ga0207683_10117230 | 3300026121 | Unclassified | 2388 |
| 734 | Ga0207698_10007226 | 3300026142 | Bacteria | 6958 |
| 735 | Ga0207698_10016730 | 3300026142 | Bacteria | 4955 |
| 736 | Ga0207698_10017808 | 3300026142 | Bacteria | 4828 |
| 737 | Ga0207698_10020870 | 3300026142 | Bacteria | 4519 |
| 738 | Ga0207698_10066284 | 3300026142 | Bacteria | 2841 |
| 739 | Ga0207698_10081989 | 3300026142 | Unclassified | 2606 |
| 740 | Ga0207698_10169232 | 3300026142 | Bacteria | 1922 |
| 741 | Ga0207698_10177058 | 3300026142 | Bacteria | 1885 |
| 742 | Ga0207698_10262201 | 3300026142 | Unclassified | 1588 |
| 743 | Ga0207428_10085705 | 3300027907 | Bacteria | 2453 |
| 744 | Ga0268266_10000088 | 3300028379 | Bacteria | 199029 |
| 745 | Ga0268266_10110528 | 3300028379 | Bacteria | 2435 |
| 746 | Ga0268266_10231728 | 3300028379 | Bacteria | 1701 |
| 747 | Ga0268265_10002951 | 3300028380 | Bacteria | 12466 |
| 748 | Ga0268265_10014053 | 3300028380 | Bacteria | 5455 |
| 749 | Ga0268265_10329279 | 3300028380 | Bacteria | 1387 |
| 750 | Ga0268264_10000201 | 3300028381 | Bacteria | 122060 |
| 751 | Ga0268264_10009165 | 3300028381 | Bacteria | 8200 |
| 752 | Ga0268264_10012038 | 3300028381 | Bacteria | 7122 |
| 753 | Ga0268264_10017595 | 3300028381 | Bacteria | 5853 |
| 754 | Ga0268264_10081109 | 3300028381 | Bacteria | 2772 |
| 755 | Ga0268264_10225213 | 3300028381 | Bacteria | 1728 |
| 756 | Ga0268264_10324735 | 3300028381 | Unclassified | 1456 |
| 757 | Ga0268264_10351299 | 3300028381 | Bacteria | 1403 |
| 758 | Ga0307517_10000959 | 3300028786 | Bacteria | 48920 |
| 759 | Ga0307517_10113614 | 3300028786 | Unclassified | 2043 |
| 760 | Ga0307515_10051447 | 3300028794 | Bacteria | 6140 |
| 761 | Ga0307511_10000498 | 3300030521 | Bacteria | 42446 |
| 762 | Ga0307513_10312833 | 3300031456 | Bacteria | 1332 |
| 763 | Ga0307509_10075920 | 3300031507 | Bacteria | 3489 |
| 764 | Ga0307508_10003711 | 3300031616 | Bacteria | 15293 |
| 765 | Ga0307508_10120330 | 3300031616 | Bacteria | 2228 |
| 766 | Ga0307516_10001623 | 3300031730 | Bacteria | 30968 |
| 767 | Ga0307516_10024738 | 3300031730 | Bacteria | 6130 |
| 768 | Ga0307410_10028683 | 3300031852 | Bacteria | 3535 |
| 769 | Ga0307407_10138439 | 3300031903 | Bacteria | 1567 |
| 770 | Ga0307412_10089746 | 3300031911 | Bacteria | 2147 |
| 771 | Ga0307510_10007184 | 3300033180 | Bacteria | 13262 |
| 772 | Ga0373934_0092050 | 3300035086 | Unclassified | 1223 |
| 773 | Ga0373927_0044596 | 3300035695 | Bacteria | 2869 |
| 774 | Ga0395899_0016065 | 3300037312 | Bacteria | 5707 |
| 775 | Ga0395899_0060285 | 3300037312 | Bacteria | 2795 |
| 776 | Ga0395900_0027549 | 3300037418 | Bacteria | 5821 |
| 777 | Ga0395900_0036820 | 3300037418 | Bacteria | 5044 |
| 778 | Ga0395900_0072390 | 3300037418 | Bacteria | 3543 |
| 779 | Ga0395898_0006045 | 3300037466 | Bacteria | 12994 |
| 780 | Ga0395898_0551266 | 3300037466 | Bacteria | 1095 |
| 781 | Ga0395905_0119024 | 3300037471 | Unclassified | 2482 |
| 782 | Ga0395901_0006717 | 3300038443 | Bacteria | 11625 |
| 783 | Ga0436365_1688093 | 3300039437 | Bacteria | 4184 |
| 784 | Ga0436365_1869494 | 3300039437 | Unclassified | 2830 |
| 785 | Ga0439436_0010124 | 3300041404 | Bacteria | 2880 |
| 786 | Ga0451793_0073312 | 3300041452 | Bacteria | 1012 |
| 787 | Ga0451843_0497346 | 3300041509 | Bacteria | 2627 |
| 788 | Ga0439431_0001387 | 3300041997 | Bacteria | 5341 |
| 789 | Ga0439431_0019678 | 3300041997 | Bacteria | 1606 |
| 790 | Ga0439433_0025225 | 3300041999 | Bacteria | 1342 |
| 791 | Ga0439449_0013894 | 3300042007 | Bacteria | 3028 |
| 792 | Ga0439457_002833 | 3300042014 | Bacteria | 4842 |
| 793 | Ga0439462_0019273 | 3300042015 | Bacteria | 1775 |
| 794 | Ga0439434_0013486 | 3300042435 | Bacteria | 2427 |
| 795 | Ga0439444_0003799 | 3300042437 | Bacteria | 2158 |
| 796 | Ga0439460_0070379 | 3300042461 | Bacteria | 1083 |
| 797 | Ga0466969_0000033 | 3300044656 | Bacteria | 82227 |
| 798 | Ga0466972_0000020 | 3300044658 | Bacteria | 197336 |
| 799 | Ga0466972_0001881 | 3300044658 | Bacteria | 10296 |
| 800 | Ga0466972_0002168 | 3300044658 | Bacteria | 9640 |
| 801 | Ga0466972_0199011 | 3300044658 | Bacteria | 938 |
| 802 | Ga0466966_0000543 | 3300044684 | Bacteria | 24041 |
| 803 | Ga0453684_0182266 | 3300044712 | Bacteria | 2464 |
| 804 | Ga0466970_0000117 | 3300044765 | Bacteria | 35460 |
| 805 | Ga0466957_0228244 | 3300044842 | Bacteria | 1232 |
| 806 | Ga0466957_0300318 | 3300044842 | Bacteria | 1079 |
| 807 | Ga0466959_0000048 | 3300045049 | Bacteria | 83528 |
| 808 | Ga0466959_0010689 | 3300045049 | Bacteria | 6572 |
| 809 | Ga0466959_0011580 | 3300045049 | Bacteria | 6338 |
| 810 | Ga0495627_021164 | 3300046453 | Bacteria | 2159 |
| 811 | Ga0495592_0039961 | 3300046454 | Bacteria | 3522 |
| 812 | Ga0495629_0090712 | 3300046459 | Unclassified | 2132 |
| 813 | Ga0495638_0071348 | 3300046460 | Bacteria | 2125 |
| 814 | Ga0495638_0112872 | 3300046460 | Bacteria | 1613 |
| 815 | Ga0495582_0007431 | 3300046473 | Bacteria | 6067 |
| 816 | Ga0495585_0196408 | 3300046492 | Bacteria | 1030 |
| 817 | Ga0495618_0031904 | 3300046514 | Bacteria | 3299 |
| 818 | Ga0495630_0003396 | 3300046517 | Bacteria | 11092 |
| 819 | Ga0495643_0034710 | 3300046522 | Bacteria | 2781 |
| 820 | Ga0495586_0139732 | 3300046535 | Unclassified | 1359 |
| 821 | Ga0495633_0000059 | 3300046558 | Bacteria | 147552 |
| 822 | Ga0495668_0000834 | 3300046616 | Bacteria | 35036 |
| 823 | Ga0495668_0014219 | 3300046616 | Bacteria | 4674 |
| 824 | Ga0495634_0042278 | 3300046642 | Bacteria | 3092 |
| 825 | Ga0495611_0000213 | 3300046648 | Bacteria | 40899 |
| 826 | Ga0495658_0028141 | 3300046683 | Unclassified | 3031 |
| 827 | Ga0495600_0114504 | 3300046809 | Bacteria | 1756 |
| 828 | Ga0495672_0011354 | 3300047320 | Bacteria | 6292 |
| 829 | Ga0495672_0049750 | 3300047320 | Bacteria | 2479 |
| 830 | Ga0495676_0204244 | 3300047321 | Unclassified | 1371 |
| 831 | Ga0495687_000010 | 3300047443 | Bacteria | 413735 |
| 832 | Ga0495684_0012571 | 3300047471 | Bacteria | 6527 |
| 833 | Ga0495686_0000436 | 3300047472 | Bacteria | 64423 |
| 834 | Ga0495686_0007468 | 3300047472 | Bacteria | 8190 |
| 835 | Ga0496109_0062734 | 3300048912 | Bacteria | 3399 |
| 836 | Ga0496109_0214149 | 3300048912 | Bacteria | 1812 |
| 837 | Ga0496110_0164754 | 3300048913 | Bacteria | 2010 |
| 838 | Ga0496115_0265809 | 3300048918 | Bacteria | 1410 |
| 839 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 840 | Ga0501299_003540 | 3300049522 | Bacteria | 2270 |
| 841 | Ga0501031_0152373 | 3300049568 | Unclassified | 1511 |
| 842 | Ga0501032_0006601 | 3300049569 | Bacteria | 8521 |
| 843 | Ga0501032_0008334 | 3300049569 | Bacteria | 7554 |
| 844 | Ga0501032_0101588 | 3300049569 | Bacteria | 1905 |
| 845 | Ga0501034_0000114 | 3300049571 | Bacteria | 148505 |
| 846 | Ga0501034_0006325 | 3300049571 | Bacteria | 12750 |
| 847 | Ga0501034_0009097 | 3300049571 | Bacteria | 10433 |
| 848 | Ga0501036_0003899 | 3300049572 | Bacteria | 11968 |
| 849 | Ga0501036_0016822 | 3300049572 | Bacteria | 6109 |
| 850 | Ga0501037_0218195 | 3300049573 | Unclassified | 1343 |
| 851 | Ga0501038_0028657 | 3300049574 | Unclassified | 4946 |
| 852 | Ga0501038_0037372 | 3300049574 | Bacteria | 4257 |
| 853 | Ga0501038_0253724 | 3300049574 | Unclassified | 1392 |
| 854 | Ga0501039_0027227 | 3300049575 | Unclassified | 4396 |
| 855 | Ga0501039_0038486 | 3300049575 | Bacteria | 3693 |
| 856 | Ga0501039_0094835 | 3300049575 | Unclassified | 2326 |
| 857 | Ga0501042_0233568 | 3300049578 | Unclassified | 1327 |
| 858 | Ga0501043_0007872 | 3300049579 | Bacteria | 8428 |
| 859 | Ga0501043_0030942 | 3300049579 | Bacteria | 4209 |
| 860 | Ga0501043_0063552 | 3300049579 | Bacteria | 2899 |
| 861 | Ga0501043_0087812 | 3300049579 | Unclassified | 2443 |
| 862 | Ga0501046_0005622 | 3300049580 | Bacteria | 11191 |
| 863 | Ga0501046_0065271 | 3300049580 | Bacteria | 2840 |
| 864 | Ga0501046_0123382 | 3300049580 | Unclassified | 1970 |
| 865 | Ga0501047_0014491 | 3300049581 | Bacteria | 7498 |
| 866 | Ga0501047_0034996 | 3300049581 | Bacteria | 4851 |
| 867 | Ga0501047_0058133 | 3300049581 | Bacteria | 3736 |
| 868 | Ga0501047_0578825 | 3300049581 | Unclassified | 946 |
| 869 | Ga0501048_0010212 | 3300049582 | Bacteria | 7021 |
| 870 | Ga0501067_0077400 | 3300049583 | Unclassified | 1843 |
| 871 | Ga0501070_0013912 | 3300049586 | Bacteria | 6775 |
| 872 | Ga0501072_0215672 | 3300049588 | Bacteria | 1530 |
| 873 | Ga0501073_0052833 | 3300049589 | Unclassified | 2844 |
| 874 | Ga0501074_0000510 | 3300049590 | Bacteria | 23805 |
| 875 | Ga0501207_000852 | 3300049654 | Bacteria | 3634 |
| 876 | Ga0501217_000867 | 3300049661 | Bacteria | 5367 |
| 877 | Ga0501225_0002427 | 3300049705 | Bacteria | 5759 |
| 878 | Ga0501080_0119892 | 3300049742 | Unclassified | 2438 |
| 879 | Ga0501083_0007826 | 3300049744 | Bacteria | 7572 |
| 880 | Ga0501266_003387 | 3300049763 | Bacteria | 1983 |
| 881 | Ga0501269_001971 | 3300049766 | Unclassified | 2594 |
| 882 | Ga0501035_0006493 | 3300049822 | Bacteria | 10987 |
| 883 | Ga0501035_0018176 | 3300049822 | Bacteria | 6475 |
| 884 | Ga0501044_0006290 | 3300049823 | Bacteria | 13124 |
| 885 | Ga0501044_0008085 | 3300049823 | Bacteria | 11545 |
| 886 | Ga0501044_0009879 | 3300049823 | Bacteria | 10370 |
| 887 | Ga0501044_0117025 | 3300049823 | Bacteria | 2670 |
| 888 | Ga0501044_0156023 | 3300049823 | Bacteria | 2262 |
| 889 | Ga0501044_0216236 | 3300049823 | Bacteria | 1869 |
| 890 | Ga0501044_0255008 | 3300049823 | Bacteria | 1694 |
| 891 | Ga0501212_001301 | 3300049851 | Bacteria | 2783 |
| 892 | Ga0501284_00080 | 3300050005 | Bacteria | 24773 |
| 893 | nmdc:mga0k408_22910_c1 | 3300050493 | Bacteria | 2744 |
| 894 | nmdc:mga07m45_221643_c1 | 3300050496 | Bacteria | 1100 |
| 895 | nmdc:mga05p37_124069_c1 | 3300050507 | Bacteria | 3172 |
| 896 | nmdc:mga05p37_503219_c1 | 3300050507 | Bacteria | 1390 |
| 897 | nmdc:mga09592_92338_c1 | 3300050508 | Unclassified | 2588 |
| 898 | nmdc:mga0qj67_21616_c1 | 3300050509 | Bacteria | 4936 |
| 899 | nmdc:mga08y16_9852_c1 | 3300050511 | Bacteria | 10032 |
| 900 | nmdc:mga0n895_403083_c1 | 3300050512 | Bacteria | 1383 |
| 901 | Ga0495619_0017768 | 3300053085 | Bacteria | 4506 |
| 902 | Ga0495619_0018313 | 3300053085 | Unclassified | 4444 |
| 903 | Ga0500644_0000040 | 3300053088 | Bacteria | 77696 |
| 904 | Ga0500646_0007548 | 3300053090 | Bacteria | 2782 |
| 905 | Ga0500646_0024527 | 3300053090 | Bacteria | 1624 |
| 906 | Ga0500583_0000031 | 3300053092 | Bacteria | 104319 |
| 907 | Ga0500583_0064229 | 3300053092 | Bacteria | 1740 |
| 908 | Ga0500651_0112249 | 3300053093 | Bacteria | 1662 |
| 909 | Ga0500641_0011168 | 3300053096 | Bacteria | 3258 |
| 910 | Ga0500556_0020243 | 3300053104 | Bacteria | 2127 |
| 911 | Ga0500556_0063308 | 3300053104 | Bacteria | 1367 |
| 912 | Ga0500569_000346 | 3300053109 | Bacteria | 7465 |
| 913 | Ga0500652_051860 | 3300053131 | Bacteria | 1676 |
| 914 | Ga0500658_0004538 | 3300053134 | Bacteria | 5177 |
| 915 | Ga0500559_0031530 | 3300053136 | Bacteria | 2274 |
| 916 | Ga0500568_0000990 | 3300053139 | Bacteria | 19487 |
| 917 | Ga0500568_0046411 | 3300053139 | Bacteria | 1724 |
| 918 | Ga0500577_0001512 | 3300053142 | Bacteria | 5925 |
| 919 | Ga0500589_005564 | 3300053147 | Bacteria | 4927 |
| 920 | Ga0500616_0002295 | 3300053153 | Bacteria | 16178 |
| 921 | Ga0500622_0000110 | 3300053156 | Bacteria | 83911 |
| 922 | Ga0500622_0000736 | 3300053156 | Bacteria | 28546 |
| 923 | Ga0500627_0007790 | 3300053158 | Bacteria | 3760 |
| 924 | Ga0500636_0073784 | 3300053177 | Bacteria | 1976 |
| 925 | Ga0500637_0076557 | 3300053178 | Bacteria | 1930 |
| 926 | Ga0500611_000043 | 3300053727 | Bacteria | 58183 |
| 927 | Ga0500645_034758 | 3300053730 | Bacteria | 1505 |
| 928 | Ga0501082_0128407 | 3300060353 | Bacteria | 2199 |
| 929 | Ga0501082_0133240 | 3300060353 | Unclassified | 2156 |
| 930 | 2738730495 | 2738541278 | Bacteria | 9755573 |
| 931 | 2819678345 | 2818991460 | Bacteria | 7595395 |
| 932 | 2821138200 | 2821136567 | Bacteria | 8080116 |
| 933 | 2881957303 | 2881955468 | Bacteria | 3545609 |
| 934 | 2883068592 | 2883068021 | Bacteria | 6192739 |
| 935 | 2884793205 | 2884791551 | Bacteria | 8511252 |
| 936 | 2896089660 | 2896085136 | Bacteria | 6129793 |
| 937 | 2896110919 | 2896109856 | Bacteria | 7140722 |
| 938 | 2904468995 | 2904467357 | Bacteria | 8057758 |
| 939 | 2929180941 | 2929177148 | Bacteria | 7883697 |
| 940 | 2929242878 | 2929239360 | Bacteria | 7745570 |
| 941 | 2929925142 | 2929921140 | Bacteria | 8649150 |
| 942 | 2945983340 | 2945977869 | Bacteria | 7777518 |
| 943 | 2946017270 | 2946013367 | Bacteria | 7766675 |
| 944 | 8003155161 | 8003151029 | Bacteria | 8187759 |
| 945 | Ga0501219_000570 | |||
| 946 | MRS1b_contig_305419 | |||
| 947 | JGI24740J21852_10015209 | |||
| 948 | JGI24739J22299_10016692 | |||
| 949 | JGI24744J21845_10020387 | |||
| 950 | JGI25154J39366_1000202 | |||
| 951 | JGI25158J39367_1007218 | |||
| 952 | JGI25153J46596_10004261 | |||
| 953 | rootH1_10028377 | |||
| 954 | rootH2_10041831 | |||
| 955 | rootH2_10088952 | |||
| 956 | rootH2_10097470 | |||
| 957 | rootH2_10170421 | |||
| 958 | rootH2_10175738 | |||
| 959 | rootH2_10188889 | |||
| 960 | rootL2_10046167 | |||
| 961 | rootL2_10073329 | |||
| 962 | rootL2_10105999 | |||
| 963 | rootL2_10124366 | |||
| 964 | rootL2_10124367 | |||
| 965 | rootL2_10235807 | |||
| 966 | rootH1_10009908 | |||
| 967 | rootH1_10011504 | |||
| 968 | rootH1_10011519 | |||
| 969 | rootH1_10055264 | |||
| 970 | rootH1_10081773 | |||
| 971 | rootH1_10115930 | |||
| 972 | JGI25160J50197_1001825 | |||
| 973 | JGI25160J50197_1007286 | |||
| 974 | Ga0055526_1017058 | |||
| 975 | Ga0055528_1001774 | |||
| 976 | Ga0065165_1000536 | |||
| 977 | Ga0065165_1055388 | |||
| 978 | Ga0065714_10022651 | |||
| 979 | Ga0065704_10106193 | |||
| 980 | Ga0065704_10126587 | |||
| 981 | Ga0065712_10004890 | |||
| 982 | Ga0065715_10148252 | |||
| 983 | Ga0070658_10051423 | |||
| 984 | Ga0070676_10001984 | |||
| 985 | Ga0070676_10009689 | |||
| 986 | Ga0070676_10034700 | |||
| 987 | Ga0070683_100003213 | |||
| 988 | Ga0070683_100011584 | |||
| 989 | Ga0070683_100022517 | |||
| 990 | Ga0070683_100045166 | |||
| 991 | Ga0070690_100003637 | |||
| 992 | Ga0070690_100060756 | |||
| 993 | Ga0070670_100053915 | |||
| 994 | Ga0070670_100055378 | |||
| 995 | Ga0070670_100119394 | |||
| 996 | Ga0070670_100175826 | |||
| 997 | Ga0070670_100182610 | |||
| 998 | Ga0070670_100215010 | |||
| 999 | Ga0070670_100219576 | |||
| 1000 | Ga0070670_100359944 | |||
| 1001 | Ga0070670_100451206 | |||
| 1002 | Ga0070677_10014695 | |||
| 1003 | Ga0068869_100002528 | |||
| 1004 | Ga0068869_100008103 | |||
| 1005 | Ga0068869_100016690 | |||
| 1006 | Ga0068869_100022932 | |||
| 1007 | Ga0068869_100024531 | |||
| 1008 | Ga0068869_100040114 | |||
| 1009 | Ga0068869_100042374 | |||
| 1010 | Ga0068869_100053984 | |||
| 1011 | Ga0068869_100067094 | |||
| 1012 | Ga0068869_100083154 | |||
| 1013 | Ga0068869_100108366 | |||
| 1014 | Ga0068869_100127106 | |||
| 1015 | Ga0068869_100188517 | |||
| 1016 | Ga0070666_10000024 | |||
| 1017 | Ga0070666_10000782 | |||
| 1018 | Ga0070666_10017711 | |||
| 1019 | Ga0070666_10024808 | |||
| 1020 | Ga0070666_10069861 | |||
| 1021 | Ga0070666_10115292 | |||
| 1022 | Ga0070680_100000594 | |||
| 1023 | Ga0070680_100044954 | |||
| 1024 | Ga0070682_100000306 | |||
| 1025 | Ga0070682_100005351 | |||
| 1026 | Ga0070682_100006804 | |||
| 1027 | Ga0068868_100002309 | |||
| 1028 | Ga0068868_100006673 | |||
| 1029 | Ga0068868_100014084 | |||
| 1030 | Ga0068868_100018557 | |||
| 1031 | Ga0068868_100043871 | |||
| 1032 | Ga0068868_100045564 | |||
| 1033 | Ga0068868_100061234 | |||
| 1034 | Ga0068868_100062227 | |||
| 1035 | Ga0068868_100079155 | |||
| 1036 | Ga0068868_100101143 | |||
| 1037 | Ga0068868_100139929 | |||
| 1038 | Ga0070660_100007954 | |||
| 1039 | Ga0070660_100054699 | |||
| 1040 | Ga0070660_100093222 | |||
| 1041 | Ga0070660_100104875 | |||
| 1042 | Ga0070660_100156732 | |||
| 1043 | Ga0070660_100177165 | |||
| 1044 | Ga0070689_100003067 | |||
| 1045 | Ga0070689_100062416 | |||
| 1046 | Ga0070689_100095130 | |||
| 1047 | Ga0070689_100098657 | |||
| 1048 | Ga0070691_10005329 | |||
| 1049 | Ga0070687_100020390 | |||
| 1050 | Ga0070661_100004768 | |||
| 1051 | Ga0070661_100051883 | |||
| 1052 | Ga0070661_100095329 | |||
| 1053 | Ga0070661_100184397 | |||
| 1054 | Ga0070668_100000077 | |||
| 1055 | Ga0070668_100007250 | |||
| 1056 | Ga0070668_100084166 | |||
| 1057 | Ga0070668_100245623 | |||
| 1058 | Ga0070669_100007472 | |||
| 1059 | Ga0070669_100032967 | |||
| 1060 | Ga0070669_100033440 | |||
| 1061 | Ga0070669_100085527 | |||
| 1062 | Ga0070669_100127110 | |||
| 1063 | Ga0070675_100003118 | |||
| 1064 | Ga0070675_100019256 | |||
| 1065 | Ga0070675_100048228 | |||
| 1066 | Ga0070675_100081723 | |||
| 1067 | Ga0070675_100162110 | |||
| 1068 | Ga0070671_100019485 | |||
| 1069 | Ga0070671_100023754 | |||
| 1070 | Ga0070671_100050432 | |||
| 1071 | Ga0070671_100056674 | |||
| 1072 | Ga0070674_100052548 | |||
| 1073 | Ga0070673_100000458 | |||
| 1074 | Ga0070673_100005255 | |||
| 1075 | Ga0070673_100010574 | |||
| 1076 | Ga0070673_100013705 | |||
| 1077 | Ga0070673_100039228 | |||
| 1078 | Ga0070673_100070133 | |||
| 1079 | Ga0070673_100081086 | |||
| 1080 | Ga0070673_100153815 | |||
| 1081 | Ga0070688_100001769 | |||
| 1082 | Ga0070688_100014670 | |||
| 1083 | Ga0070688_100017681 | |||
| 1084 | Ga0070688_100108990 | |||
| 1085 | Ga0070659_100002170 | |||
| 1086 | Ga0070659_100005743 | |||
| 1087 | Ga0070659_100007759 | |||
| 1088 | Ga0070659_100016883 | |||
| 1089 | Ga0070659_100029344 | |||
| 1090 | Ga0070659_100072052 | |||
| 1091 | Ga0070659_100090709 | |||
| 1092 | Ga0070667_100000382 | |||
| 1093 | Ga0070667_100034349 | |||
| 1094 | Ga0070667_100077684 | |||
| 1095 | Ga0070667_100133846 | |||
| 1096 | Ga0070701_10100030 | |||
| 1097 | Ga0070663_100059620 | |||
| 1098 | Ga0070678_100038502 | |||
| 1099 | Ga0070678_100065559 | |||
| 1100 | Ga0070678_100105679 | |||
| 1101 | Ga0070678_100278779 | |||
| 1102 | Ga0070662_100021354 | |||
| 1103 | Ga0070662_100023594 | |||
| 1104 | Ga0070662_100028482 | |||
| 1105 | Ga0070662_100080643 | |||
| 1106 | Ga0070662_100134038 | |||
| 1107 | Ga0070681_10012525 | |||
| 1108 | Ga0070681_10024895 | |||
| 1109 | Ga0070681_10057753 | |||
| 1110 | Ga0070681_10058013 | |||
| 1111 | Ga0070681_10163426 | |||
| 1112 | Ga0068867_100029117 | |||
| 1113 | Ga0068867_100029264 | |||
| 1114 | Ga0068867_100054027 | |||
| 1115 | Ga0068867_100081605 | |||
| 1116 | Ga0068867_100124422 | |||
| 1117 | Ga0070685_10008317 | |||
| 1118 | Ga0070698_100004775 | |||
| 1119 | Ga0070698_100016643 | |||
| 1120 | Ga0070698_100040360 | |||
| 1121 | Ga0070698_100123380 | |||
| 1122 | Ga0070679_100027054 | |||
| 1123 | Ga0070679_100087084 | |||
| 1124 | Ga0070679_100173703 | |||
| 1125 | Ga0070684_100005358 | |||
| 1126 | Ga0070684_100054132 | |||
| 1127 | Ga0070684_100055125 | |||
| 1128 | Ga0068853_100002018 | |||
| 1129 | Ga0068853_100011817 | |||
| 1130 | Ga0068853_100011848 | |||
| 1131 | Ga0068853_100017276 | |||
| 1132 | Ga0068853_100042528 | |||
| 1133 | Ga0068853_100111113 | |||
| 1134 | Ga0068853_100161914 | |||
| 1135 | Ga0068853_100436742 | |||
| 1136 | Ga0070672_100000010 | |||
| 1137 | Ga0070672_100020432 | |||
| 1138 | Ga0070672_100027534 | |||
| 1139 | Ga0070672_100039837 | |||
| 1140 | Ga0070672_100060129 | |||
| 1141 | Ga0070672_100080786 | |||
| 1142 | Ga0070672_100129898 | |||
| 1143 | Ga0070686_100005054 | |||
| 1144 | Ga0070665_100000031 | |||
| 1145 | Ga0070665_100002045 | |||
| 1146 | Ga0068855_100000108 | |||
| 1147 | Ga0068855_100000732 | |||
| 1148 | Ga0068855_100012864 | |||
| 1149 | Ga0068855_100014994 | |||
| 1150 | Ga0068855_100019957 | |||
| 1151 | Ga0068855_100022269 | |||
| 1152 | Ga0068855_100042012 | |||
| 1153 | Ga0068855_100261154 | |||
| 1154 | Ga0070664_100013453 | |||
| 1155 | Ga0070664_100030559 | |||
| 1156 | Ga0070664_100045280 | |||
| 1157 | Ga0070664_100055778 | |||
| 1158 | Ga0070664_100080039 | |||
| 1159 | Ga0070664_100204228 | |||
| 1160 | Ga0068857_100001355 | |||
| 1161 | Ga0068857_100005870 | |||
| 1162 | Ga0068857_100026627 | |||
| 1163 | Ga0068857_100054793 | |||
| 1164 | Ga0068857_100115816 | |||
| 1165 | Ga0068857_100151221 | |||
| 1166 | Ga0068857_100434064 | |||
| 1167 | Ga0068854_100010810 | |||
| 1168 | Ga0068854_100094355 | |||
| 1169 | Ga0068854_100102519 | |||
| 1170 | Ga0068854_100152739 | |||
| 1171 | Ga0068856_100024579 | |||
| 1172 | Ga0068856_100177228 | |||
| 1173 | Ga0068856_100615091 | |||
| 1174 | Ga0070702_100020838 | |||
| 1175 | Ga0068852_100008954 | |||
| 1176 | Ga0068852_100011843 | |||
| 1177 | Ga0068852_100026755 | |||
| 1178 | Ga0068852_100032181 | |||
| 1179 | Ga0068852_100066504 | |||
| 1180 | Ga0068852_100071994 | |||
| 1181 | Ga0068852_100216697 | |||
| 1182 | Ga0068859_100000018 | |||
| 1183 | Ga0068859_100012863 | |||
| 1184 | Ga0068859_100027796 | |||
| 1185 | Ga0068859_100034823 | |||
| 1186 | Ga0068859_100046643 | |||
| 1187 | Ga0068859_100049098 | |||
| 1188 | Ga0068859_100052662 | |||
| 1189 | Ga0068864_100000389 | |||
| 1190 | Ga0068864_100004617 | |||
| 1191 | Ga0068864_100087906 | |||
| 1192 | Ga0068864_100133607 | |||
| 1193 | Ga0068864_100159238 | |||
| 1194 | Ga0068864_100198647 | |||
| 1195 | Ga0068864_100320961 | |||
| 1196 | Ga0068861_100001157 | |||
| 1197 | Ga0068861_100053405 | |||
| 1198 | Ga0068861_100057170 | |||
| 1199 | Ga0068861_100086839 | |||
| 1200 | Ga0068861_100143850 | |||
| 1201 | Ga0068861_100179902 | |||
| 1202 | Ga0068851_10000503 | |||
| 1203 | Ga0068851_10049868 | |||
| 1204 | Ga0068870_10006403 | |||
| 1205 | Ga0068863_100001416 | |||
| 1206 | Ga0068863_100012262 | |||
| 1207 | Ga0068863_100061353 | |||
| 1208 | Ga0068863_100069014 | |||
| 1209 | Ga0068863_100244281 | |||
| 1210 | Ga0068858_100002897 | |||
| 1211 | Ga0068858_100015268 | |||
| 1212 | Ga0068858_100060556 | |||
| 1213 | Ga0068858_100090976 | |||
| 1214 | Ga0068858_100198625 | |||
| 1215 | Ga0068860_100000072 | |||
| 1216 | Ga0068860_100006531 | |||
| 1217 | Ga0068860_100010513 | |||
| 1218 | Ga0068860_100013037 | |||
| 1219 | Ga0068860_100023829 | |||
| 1220 | Ga0068860_100023830 | |||
| 1221 | Ga0068860_100061726 | |||
| 1222 | Ga0068860_100069377 | |||
| 1223 | Ga0068860_100096179 | |||
| 1224 | Ga0068860_100159690 | |||
| 1225 | Ga0068860_100224908 | |||
| 1226 | Ga0068860_100463113 | |||
| 1227 | Ga0068862_100017201 | |||
| 1228 | Ga0068862_100031657 | |||
| 1229 | Ga0068862_100066075 | |||
| 1230 | Ga0068862_100187044 | |||
| 1231 | Ga0081539_10000899 | |||
| 1232 | Ga0075366_10030100 | |||
| 1233 | Ga0097621_100000122 | |||
| 1234 | Ga0097621_100002697 | |||
| 1235 | Ga0097621_100003855 | |||
| 1236 | Ga0097621_100028270 | |||
| 1237 | Ga0097621_100070050 | |||
| 1238 | Ga0097621_100213454 | |||
| 1239 | Ga0068871_100000412 | |||
| 1240 | Ga0068871_100001186 | |||
| 1241 | Ga0068871_100008450 | |||
| 1242 | Ga0068871_100010459 | |||
| 1243 | Ga0068871_100033468 | |||
| 1244 | Ga0068871_100057524 | |||
| 1245 | Ga0068871_100071524 | |||
| 1246 | Ga0068871_100220008 | |||
| 1247 | Ga0075428_100006899 | |||
| 1248 | Ga0075428_100008539 | |||
| 1249 | Ga0075430_100020469 | |||
| 1250 | Ga0075430_100081376 | |||
| 1251 | Ga0075431_100011318 | |||
| 1252 | Ga0075429_100012224 | |||
| 1253 | Ga0075429_100151805 | |||
| 1254 | Ga0068865_100004773 | |||
| 1255 | Ga0068865_100047126 | |||
| 1256 | Ga0068865_100049844 | |||
| 1257 | Ga0068865_100178757 | |||
| 1258 | Ga0097620_100000018 | |||
| 1259 | Ga0097620_100012863 | |||
| 1260 | Ga0097620_100027796 | |||
| 1261 | Ga0097620_100034824 | |||
| 1262 | Ga0097620_100046639 | |||
| 1263 | Ga0097620_100049103 | |||
| 1264 | Ga0097620_100052661 | |||
| 1265 | Ga0105251_10039608 | |||
| 1266 | Ga0105240_10000152 | |||
| 1267 | Ga0105240_10001109 | |||
| 1268 | Ga0105240_10002195 | |||
| 1269 | Ga0105240_10015841 | |||
| 1270 | Ga0105240_10023875 | |||
| 1271 | Ga0105240_10038968 | |||
| 1272 | Ga0105240_10045267 | |||
| 1273 | Ga0105240_10057451 | |||
| 1274 | Ga0105240_10081585 | |||
| 1275 | Ga0105240_10272185 | |||
| 1276 | Ga0105240_10302117 | |||
| 1277 | Ga0105240_10328061 | |||
| 1278 | Ga0105240_10497778 | |||
| 1279 | Ga0111539_10006032 | |||
| 1280 | Ga0111539_10015984 | |||
| 1281 | Ga0105247_10034255 | |||
| 1282 | Ga0105247_10277396 | |||
| 1283 | Ga0114129_10090762 | |||
| 1284 | Ga0114129_10144051 | |||
| 1285 | Ga0114129_10150623 | |||
| 1286 | Ga0105241_10000813 | |||
| 1287 | Ga0105241_10000893 | |||
| 1288 | Ga0105241_10001132 | |||
| 1289 | Ga0105241_10013390 | |||
| 1290 | Ga0105241_10213285 | |||
| 1291 | Ga0105241_10232474 | |||
| 1292 | Ga0105242_10043806 | |||
| 1293 | Ga0105242_10110984 | |||
| 1294 | Ga0105242_10161945 | |||
| 1295 | Ga0105242_10244724 | |||
| 1296 | Ga0105248_10189402 | |||
| 1297 | Ga0105237_10001480 | |||
| 1298 | Ga0105237_10004983 | |||
| 1299 | Ga0105237_10013064 | |||
| 1300 | Ga0105237_10016323 | |||
| 1301 | Ga0105237_10179837 | |||
| 1302 | Ga0105237_10243373 | |||
| 1303 | Ga0105237_10293737 | |||
| 1304 | Ga0105238_10003001 | |||
| 1305 | Ga0105238_10003918 | |||
| 1306 | Ga0105249_10001879 | |||
| 1307 | Ga0105249_10003364 | |||
| 1308 | Ga0105249_10003657 | |||
| 1309 | Ga0105249_10010234 | |||
| 1310 | Ga0105249_10020220 | |||
| 1311 | Ga0105249_10033600 | |||
| 1312 | Ga0105249_10122316 | |||
| 1313 | Ga0105249_10241071 | |||
| 1314 | Ga0105249_10294460 | |||
| 1315 | Ga0105239_10000596 | |||
| 1316 | Ga0105239_10020350 | |||
| 1317 | Ga0105239_10088598 | |||
| 1318 | Ga0105239_10141382 | |||
| 1319 | Ga0105239_10264157 | |||
| 1320 | Ga0105239_10357919 | |||
| 1321 | Ga0105246_10178567 | |||
| 1322 | Ga0105246_10304429 | |||
| 1323 | Ga0157373_10016489 | |||
| 1324 | Ga0157373_10036339 | |||
| 1325 | Ga0157373_10058483 | |||
| 1326 | Ga0157373_10065185 | |||
| 1327 | Ga0157373_10079985 | |||
| 1328 | Ga0157371_10000642 | |||
| 1329 | Ga0157371_10002222 | |||
| 1330 | Ga0157371_10003513 | |||
| 1331 | Ga0157371_10040430 | |||
| 1332 | Ga0157371_10045602 | |||
| 1333 | Ga0157371_10052236 | |||
| 1334 | Ga0157371_10052931 | |||
| 1335 | Ga0157371_10066274 | |||
| 1336 | Ga0157370_10002063 | |||
| 1337 | Ga0157370_10006351 | |||
| 1338 | Ga0157370_10022658 | |||
| 1339 | Ga0157370_10022981 | |||
| 1340 | Ga0157370_10035467 | |||
| 1341 | Ga0157370_10038922 | |||
| 1342 | Ga0157370_10132764 | |||
| 1343 | Ga0157370_10224545 | |||
| 1344 | Ga0157370_10407449 | |||
| 1345 | Ga0157370_10418920 | |||
| 1346 | Ga0157369_10008609 | |||
| 1347 | Ga0157369_10026680 | |||
| 1348 | Ga0157369_10029377 | |||
| 1349 | Ga0157369_10035700 | |||
| 1350 | Ga0157369_10129758 | |||
| 1351 | Ga0157369_10165532 | |||
| 1352 | Ga0157369_10279892 | |||
| 1353 | Ga0157374_10000440 | |||
| 1354 | Ga0157374_10003152 | |||
| 1355 | Ga0157374_10014074 | |||
| 1356 | Ga0157374_10015844 | |||
| 1357 | Ga0157374_10023036 | |||
| 1358 | Ga0157374_10033267 | |||
| 1359 | Ga0157374_10050029 | |||
| 1360 | Ga0157374_10119431 | |||
| 1361 | Ga0157374_10151088 | |||
| 1362 | Ga0157378_10002826 | |||
| 1363 | Ga0157378_10054560 | |||
| 1364 | Ga0157378_10055935 | |||
| 1365 | Ga0157378_10073674 | |||
| 1366 | Ga0157378_10110351 | |||
| 1367 | Ga0157378_10142972 | |||
| 1368 | Ga0157378_10157602 | |||
| 1369 | Ga0157378_10456506 | |||
| 1370 | Ga0163162_10001022 | |||
| 1371 | Ga0163162_10001731 | |||
| 1372 | Ga0163162_10003497 | |||
| 1373 | Ga0163162_10003748 | |||
| 1374 | Ga0163162_10003960 | |||
| 1375 | Ga0163162_10004143 | |||
| 1376 | Ga0163162_10005187 | |||
| 1377 | Ga0163162_10005457 | |||
| 1378 | Ga0163162_10114034 | |||
| 1379 | Ga0163162_10159301 | |||
| 1380 | Ga0163162_10253463 | |||
| 1381 | Ga0163162_10376241 | |||
| 1382 | Ga0157372_10007217 | |||
| 1383 | Ga0157372_10008579 | |||
| 1384 | Ga0157372_10010299 | |||
| 1385 | Ga0157372_10029448 | |||
| 1386 | Ga0157372_10041683 | |||
| 1387 | Ga0157372_10051606 | |||
| 1388 | Ga0157372_10054553 | |||
| 1389 | Ga0157372_10069856 | |||
| 1390 | Ga0157372_10081900 | |||
| 1391 | Ga0157372_10104725 | |||
| 1392 | Ga0157372_10107147 | |||
| 1393 | Ga0157372_10114364 | |||
| 1394 | Ga0157372_10129989 | |||
| 1395 | Ga0157372_10185237 | |||
| 1396 | Ga0157372_10204036 | |||
| 1397 | Ga0157372_10244481 | |||
| 1398 | Ga0157372_10391786 | |||
| 1399 | Ga0157375_10000219 | |||
| 1400 | Ga0157375_10001037 | |||
| 1401 | Ga0157375_10033496 | |||
| 1402 | Ga0157375_10047606 | |||
| 1403 | Ga0157375_10083582 | |||
| 1404 | Ga0157375_10088836 | |||
| 1405 | Ga0157375_10124081 | |||
| 1406 | Ga0157375_10129469 | |||
| 1407 | Ga0157375_10190895 | |||
| 1408 | Ga0157375_10233021 | |||
| 1409 | Ga0157375_10256455 | |||
| 1410 | Ga0157375_10373881 | |||
| 1411 | Ga0157375_10640006 | |||
| 1412 | Ga0163163_10000803 | |||
| 1413 | Ga0163163_10000936 | |||
| 1414 | Ga0163163_10002011 | |||
| 1415 | Ga0163163_10013408 | |||
| 1416 | Ga0163163_10110318 | |||
| 1417 | Ga0163163_10357610 | |||
| 1418 | Ga0163163_10389172 | |||
| 1419 | Ga0157380_10011402 | |||
| 1420 | Ga0157380_10084098 | |||
| 1421 | Ga0157380_10101399 | |||
| 1422 | Ga0157380_10448069 | |||
| 1423 | Ga0157377_10000734 | |||
| 1424 | Ga0157377_10010123 | |||
| 1425 | Ga0157377_10023786 | |||
| 1426 | Ga0157377_10031424 | |||
| 1427 | Ga0157379_10000078 | |||
| 1428 | Ga0157379_10019816 | |||
| 1429 | Ga0157379_10030868 | |||
| 1430 | Ga0157379_10118285 | |||
| 1431 | Ga0157376_10000219 | |||
| 1432 | Ga0157376_10000554 | |||
| 1433 | Ga0157376_10010474 | |||
| 1434 | Ga0157376_10056150 | |||
| 1435 | Ga0157376_10188407 | |||
| 1436 | Ga0157376_10207468 | |||
| 1437 | Ga0157376_10221657 | |||
| 1438 | Ga0182005_1000126 | |||
| 1439 | Ga0163161_10001931 | |||
| 1440 | Ga0163161_10005543 | |||
| 1441 | Ga0163161_10022094 | |||
| 1442 | Ga0163161_10022100 | |||
| 1443 | Ga0163161_10023331 | |||
| 1444 | Ga0213876_10011837 | |||
| 1445 | Ga0209436_101280 | |||
| 1446 | Ga0209258_100098 | |||
| 1447 | Ga0209646_1000006 | |||
| 1448 | Ga0209148_1000682 | |||
| 1449 | Ga0209673_1000299 | |||
| 1450 | Ga0209130_1001255 | |||
| 1451 | Ga0209564_1024014 | |||
| 1452 | Ga0209564_1043407 | |||
| 1453 | Ga0209758_1000497 | |||
| 1454 | Ga0209758_1007875 | |||
| 1455 | Ga0209758_1011427 | |||
| 1456 | Ga0209050_1000771 | |||
| 1457 | Ga0207426_1000019 | |||
| 1458 | Ga0207426_1000137 | |||
| 1459 | Ga0207426_1000562 | |||
| 1460 | Ga0207426_1001710 | |||
| 1461 | Ga0207426_1004272 | |||
| 1462 | Ga0209257_1000013 | |||
| 1463 | Ga0209257_1006112 | |||
| 1464 | Ga0207697_10015466 | |||
| 1465 | Ga0207697_10016329 | |||
| 1466 | Ga0207682_10032721 | |||
| 1467 | Ga0207682_10037618 | |||
| 1468 | Ga0207710_10046686 | |||
| 1469 | Ga0207688_10012491 | |||
| 1470 | Ga0207680_10000026 | |||
| 1471 | Ga0207680_10012305 | |||
| 1472 | Ga0207680_10027008 | |||
| 1473 | Ga0207680_10052847 | |||
| 1474 | Ga0207680_10127099 | |||
| 1475 | Ga0207680_10188834 | |||
| 1476 | Ga0207647_10095497 | |||
| 1477 | Ga0207645_10002365 | |||
| 1478 | Ga0207645_10015737 | |||
| 1479 | Ga0207645_10041085 | |||
| 1480 | Ga0207643_10048056 | |||
| 1481 | Ga0207643_10072292 | |||
| 1482 | Ga0207705_10002848 | |||
| 1483 | Ga0207705_10031133 | |||
| 1484 | Ga0207705_10044128 | |||
| 1485 | Ga0207705_10087541 | |||
| 1486 | Ga0207654_10033997 | |||
| 1487 | Ga0207654_10044405 | |||
| 1488 | Ga0207654_10096438 | |||
| 1489 | Ga0207707_10012158 | |||
| 1490 | Ga0207707_10083205 | |||
| 1491 | Ga0207707_10144588 | |||
| 1492 | Ga0207695_10000060 | |||
| 1493 | Ga0207695_10000185 | |||
| 1494 | Ga0207695_10000666 | |||
| 1495 | Ga0207695_10002019 | |||
| 1496 | Ga0207695_10020493 | |||
| 1497 | Ga0207695_10024469 | |||
| 1498 | Ga0207695_10029572 | |||
| 1499 | Ga0207695_10058683 | |||
| 1500 | Ga0207695_10091007 | |||
| 1501 | Ga0207695_10145924 | |||
| 1502 | Ga0207695_10266310 | |||
| 1503 | Ga0207671_10001263 | |||
| 1504 | Ga0207671_10001265 | |||
| 1505 | Ga0207671_10001378 | |||
| 1506 | Ga0207671_10006612 | |||
| 1507 | Ga0207671_10014115 | |||
| 1508 | Ga0207660_10006788 | |||
| 1509 | Ga0207660_10053868 | |||
| 1510 | Ga0207660_10102611 | |||
| 1511 | Ga0207662_10048369 | |||
| 1512 | Ga0207662_10072413 | |||
| 1513 | Ga0207657_10032389 | |||
| 1514 | Ga0207657_10040514 | |||
| 1515 | Ga0207657_10063023 | |||
| 1516 | Ga0207657_10110558 | |||
| 1517 | Ga0207657_10233716 | |||
| 1518 | Ga0207657_10239665 | |||
| 1519 | Ga0207652_10001065 | |||
| 1520 | Ga0207652_10038245 | |||
| 1521 | Ga0207652_10083509 | |||
| 1522 | Ga0207681_10002862 | |||
| 1523 | Ga0207681_10055724 | |||
| 1524 | Ga0207681_10083863 | |||
| 1525 | Ga0207694_10006677 | |||
| 1526 | Ga0207650_10018608 | |||
| 1527 | Ga0207650_10049594 | |||
| 1528 | Ga0207650_10053698 | |||
| 1529 | Ga0207650_10088656 | |||
| 1530 | Ga0207650_10100680 | |||
| 1531 | Ga0207650_10229509 | |||
| 1532 | Ga0207650_10247637 | |||
| 1533 | Ga0207659_10025913 | |||
| 1534 | Ga0207659_10028295 | |||
| 1535 | Ga0207659_10028428 | |||
| 1536 | Ga0207659_10059965 | |||
| 1537 | Ga0207659_10122479 | |||
| 1538 | Ga0207659_10200649 | |||
| 1539 | Ga0207644_10046471 | |||
| 1540 | Ga0207644_10065845 | |||
| 1541 | Ga0207644_10102007 | |||
| 1542 | Ga0207644_10144300 | |||
| 1543 | Ga0207644_10149983 | |||
| 1544 | Ga0207644_10160775 | |||
| 1545 | Ga0207690_10030536 | |||
| 1546 | Ga0207690_10049221 | |||
| 1547 | Ga0207690_10068265 | |||
| 1548 | Ga0207690_10152511 | |||
| 1549 | Ga0207706_10006315 | |||
| 1550 | Ga0207706_10007207 | |||
| 1551 | Ga0207706_10010930 | |||
| 1552 | Ga0207706_10015400 | |||
| 1553 | Ga0207706_10045085 | |||
| 1554 | Ga0207706_10083471 | |||
| 1555 | Ga0207686_10000909 | |||
| 1556 | Ga0207670_10012581 | |||
| 1557 | Ga0207670_10036851 | |||
| 1558 | Ga0207670_10154655 | |||
| 1559 | Ga0207704_10014245 | |||
| 1560 | Ga0207704_10020109 | |||
| 1561 | Ga0207704_10043471 | |||
| 1562 | Ga0207704_10103824 | |||
| 1563 | Ga0207704_10234801 | |||
| 1564 | Ga0207691_10000014 | |||
| 1565 | Ga0207691_10008260 | |||
| 1566 | Ga0207691_10030869 | |||
| 1567 | Ga0207691_10055796 | |||
| 1568 | Ga0207691_10142619 | |||
| 1569 | Ga0207689_10001523 | |||
| 1570 | Ga0207689_10003713 | |||
| 1571 | Ga0207689_10006429 | |||
| 1572 | Ga0207689_10012708 | |||
| 1573 | Ga0207689_10012737 | |||
| 1574 | Ga0207689_10012764 | |||
| 1575 | Ga0207689_10015373 | |||
| 1576 | Ga0207689_10025133 | |||
| 1577 | Ga0207689_10067011 | |||
| 1578 | Ga0207689_10166791 | |||
| 1579 | Ga0207661_10083764 | |||
| 1580 | Ga0207661_10092617 | |||
| 1581 | Ga0207679_10003675 | |||
| 1582 | Ga0207679_10006982 | |||
| 1583 | Ga0207679_10017302 | |||
| 1584 | Ga0207679_10052759 | |||
| 1585 | Ga0207667_10000084 | |||
| 1586 | Ga0207667_10018078 | |||
| 1587 | Ga0207667_10018411 | |||
| 1588 | Ga0207667_10032284 | |||
| 1589 | Ga0207667_10050187 | |||
| 1590 | Ga0207667_10056603 | |||
| 1591 | Ga0207651_10000262 | |||
| 1592 | Ga0207651_10045863 | |||
| 1593 | Ga0207651_10074988 | |||
| 1594 | Ga0207651_10079716 | |||
| 1595 | Ga0207651_10080914 | |||
| 1596 | Ga0207651_10420173 | |||
| 1597 | Ga0207712_10005936 | |||
| 1598 | Ga0207712_10008329 | |||
| 1599 | Ga0207712_10019440 | |||
| 1600 | Ga0207712_10020327 | |||
| 1601 | Ga0207712_10025376 | |||
| 1602 | Ga0207712_10070709 | |||
| 1603 | Ga0207668_10000544 | |||
| 1604 | Ga0207668_10091391 | |||
| 1605 | Ga0207668_10145279 | |||
| 1606 | Ga0207668_10255037 | |||
| 1607 | Ga0207640_10042857 | |||
| 1608 | Ga0207640_10054981 | |||
| 1609 | Ga0207640_10162811 | |||
| 1610 | Ga0207658_10001505 | |||
| 1611 | Ga0207658_10022600 | |||
| 1612 | Ga0207658_10068965 | |||
| 1613 | Ga0207658_10162623 | |||
| 1614 | Ga0207658_10198554 | |||
| 1615 | Ga0207658_10199397 | |||
| 1616 | Ga0207658_10264992 | |||
| 1617 | Ga0207677_10001128 | |||
| 1618 | Ga0207677_10007816 | |||
| 1619 | Ga0207677_10010583 | |||
| 1620 | Ga0207677_10023852 | |||
| 1621 | Ga0207677_10038954 | |||
| 1622 | Ga0207677_10097786 | |||
| 1623 | Ga0207677_10125325 | |||
| 1624 | Ga0207703_10001897 | |||
| 1625 | Ga0207703_10013153 | |||
| 1626 | Ga0207703_10100930 | |||
| 1627 | Ga0207703_10305589 | |||
| 1628 | Ga0207639_10006748 | |||
| 1629 | Ga0207639_10017197 | |||
| 1630 | Ga0207639_10020984 | |||
| 1631 | Ga0207639_10031409 | |||
| 1632 | Ga0207639_10031413 | |||
| 1633 | Ga0207639_10068232 | |||
| 1634 | Ga0207639_10230510 | |||
| 1635 | Ga0207639_10300518 | |||
| 1636 | Ga0207678_10020230 | |||
| 1637 | Ga0207708_10030217 | |||
| 1638 | Ga0207702_10052731 | |||
| 1639 | Ga0207702_10055832 | |||
| 1640 | Ga0207702_10164291 | |||
| 1641 | Ga0207641_10000167 | |||
| 1642 | Ga0207641_10004744 | |||
| 1643 | Ga0207641_10040147 | |||
| 1644 | Ga0207641_10091214 | |||
| 1645 | Ga0207641_10136343 | |||
| 1646 | Ga0207641_10259736 | |||
| 1647 | Ga0207648_10002320 | |||
| 1648 | Ga0207648_10007356 | |||
| 1649 | Ga0207648_10105071 | |||
| 1650 | Ga0207648_10156979 | |||
| 1651 | Ga0207648_10170140 | |||
| 1652 | Ga0207648_10218022 | |||
| 1653 | Ga0207676_10004203 | |||
| 1654 | Ga0207676_10004336 | |||
| 1655 | Ga0207676_10047269 | |||
| 1656 | Ga0207676_10080028 | |||
| 1657 | Ga0207676_10132549 | |||
| 1658 | Ga0207676_10285905 | |||
| 1659 | Ga0207676_10336095 | |||
| 1660 | Ga0207674_10000487 | |||
| 1661 | Ga0207674_10005497 | |||
| 1662 | Ga0207674_10030010 | |||
| 1663 | Ga0207674_10032755 | |||
| 1664 | Ga0207674_10081556 | |||
| 1665 | Ga0207674_10085277 | |||
| 1666 | Ga0207674_10111878 | |||
| 1667 | Ga0207674_10320599 | |||
| 1668 | Ga0207675_100000422 | |||
| 1669 | Ga0207675_100009495 | |||
| 1670 | Ga0207675_100135846 | |||
| 1671 | Ga0207675_100160098 | |||
| 1672 | Ga0207675_100344119 | |||
| 1673 | Ga0207683_10009154 | |||
| 1674 | Ga0207683_10012331 | |||
| 1675 | Ga0207683_10048639 | |||
| 1676 | Ga0207683_10117230 | |||
| 1677 | Ga0207698_10007226 | |||
| 1678 | Ga0207698_10016730 | |||
| 1679 | Ga0207698_10017808 | |||
| 1680 | Ga0207698_10020870 | |||
| 1681 | Ga0207698_10066284 | |||
| 1682 | Ga0207698_10081989 | |||
| 1683 | Ga0207698_10169232 | |||
| 1684 | Ga0207698_10177058 | |||
| 1685 | Ga0207698_10262201 | |||
| 1686 | Ga0207428_10085705 | |||
| 1687 | Ga0268266_10000088 | |||
| 1688 | Ga0268266_10110528 | |||
| 1689 | Ga0268266_10231728 | |||
| 1690 | Ga0268265_10002951 | |||
| 1691 | Ga0268265_10014053 | |||
| 1692 | Ga0268265_10329279 | |||
| 1693 | Ga0268264_10000201 | |||
| 1694 | Ga0268264_10009165 | |||
| 1695 | Ga0268264_10012038 | |||
| 1696 | Ga0268264_10017595 | |||
| 1697 | Ga0268264_10081109 | |||
| 1698 | Ga0268264_10225213 | |||
| 1699 | Ga0268264_10324735 | |||
| 1700 | Ga0268264_10351299 | |||
| 1701 | Ga0307517_10000959 | |||
| 1702 | Ga0307517_10113614 | |||
| 1703 | Ga0307515_10051447 | |||
| 1704 | Ga0307511_10000498 | |||
| 1705 | Ga0307513_10312833 | |||
| 1706 | Ga0307509_10075920 | |||
| 1707 | Ga0307508_10003711 | |||
| 1708 | Ga0307508_10120330 | |||
| 1709 | Ga0307516_10001623 | |||
| 1710 | Ga0307516_10024738 | |||
| 1711 | Ga0307410_10028683 | |||
| 1712 | Ga0307407_10138439 | |||
| 1713 | Ga0307412_10089746 | |||
| 1714 | Ga0307510_10007184 | |||
| 1715 | Ga0373934_0092050 | |||
| 1716 | Ga0373927_0044596 | |||
| 1717 | Ga0395899_0016065 | |||
| 1718 | Ga0395899_0060285 | |||
| 1719 | Ga0395900_0027549 | |||
| 1720 | Ga0395900_0036820 | |||
| 1721 | Ga0395900_0072390 | |||
| 1722 | Ga0395898_0006045 | |||
| 1723 | Ga0395898_0551266 | |||
| 1724 | Ga0395905_0119024 | |||
| 1725 | Ga0395901_0006717 | |||
| 1726 | Ga0436365_1688093 | |||
| 1727 | Ga0436365_1869494 | |||
| 1728 | Ga0439436_0010124 | |||
| 1729 | Ga0451793_0073312 | |||
| 1730 | Ga0451843_0497346 | |||
| 1731 | Ga0439431_0001387 | |||
| 1732 | Ga0439431_0019678 | |||
| 1733 | Ga0439433_0025225 | |||
| 1734 | Ga0439449_0013894 | |||
| 1735 | Ga0439457_002833 | |||
| 1736 | Ga0439462_0019273 | |||
| 1737 | Ga0439434_0013486 | |||
| 1738 | Ga0439444_0003799 | |||
| 1739 | Ga0439460_0070379 | |||
| 1740 | Ga0466969_0000033 | |||
| 1741 | Ga0466972_0000020 | |||
| 1742 | Ga0466972_0001881 | |||
| 1743 | Ga0466972_0002168 | |||
| 1744 | Ga0466972_0199011 | |||
| 1745 | Ga0466966_0000543 | |||
| 1746 | Ga0453684_0182266 | |||
| 1747 | Ga0466970_0000117 | |||
| 1748 | Ga0466957_0228244 | |||
| 1749 | Ga0466957_0300318 | |||
| 1750 | Ga0466959_0000048 | |||
| 1751 | Ga0466959_0010689 | |||
| 1752 | Ga0466959_0011580 | |||
| 1753 | Ga0495627_021164 | |||
| 1754 | Ga0495592_0039961 | |||
| 1755 | Ga0495629_0090712 | |||
| 1756 | Ga0495638_0071348 | |||
| 1757 | Ga0495638_0112872 | |||
| 1758 | Ga0495582_0007431 | |||
| 1759 | Ga0495585_0196408 | |||
| 1760 | Ga0495618_0031904 | |||
| 1761 | Ga0495630_0003396 | |||
| 1762 | Ga0495643_0034710 | |||
| 1763 | Ga0495586_0139732 | |||
| 1764 | Ga0495633_0000059 | |||
| 1765 | Ga0495668_0000834 | |||
| 1766 | Ga0495668_0014219 | |||
| 1767 | Ga0495634_0042278 | |||
| 1768 | Ga0495611_0000213 | |||
| 1769 | Ga0495658_0028141 | |||
| 1770 | Ga0495600_0114504 | |||
| 1771 | Ga0495672_0011354 | |||
| 1772 | Ga0495672_0049750 | |||
| 1773 | Ga0495676_0204244 | |||
| 1774 | Ga0495687_000010 | |||
| 1775 | Ga0495684_0012571 | |||
| 1776 | Ga0495686_0000436 | |||
| 1777 | Ga0495686_0007468 | |||
| 1778 | Ga0496109_0062734 | |||
| 1779 | Ga0496109_0214149 | |||
| 1780 | Ga0496110_0164754 | |||
| 1781 | Ga0496115_0265809 | |||
| 1782 | Ga0496121_0000007 | |||
| 1783 | Ga0501299_003540 | |||
| 1784 | Ga0501031_0152373 | |||
| 1785 | Ga0501032_0006601 | |||
| 1786 | Ga0501032_0008334 | |||
| 1787 | Ga0501032_0101588 | |||
| 1788 | Ga0501034_0000114 | |||
| 1789 | Ga0501034_0006325 | |||
| 1790 | Ga0501034_0009097 | |||
| 1791 | Ga0501036_0003899 | |||
| 1792 | Ga0501036_0016822 | |||
| 1793 | Ga0501037_0218195 | |||
| 1794 | Ga0501038_0028657 | |||
| 1795 | Ga0501038_0037372 | |||
| 1796 | Ga0501038_0253724 | |||
| 1797 | Ga0501039_0027227 | |||
| 1798 | Ga0501039_0038486 | |||
| 1799 | Ga0501039_0094835 | |||
| 1800 | Ga0501042_0233568 | |||
| 1801 | Ga0501043_0007872 | |||
| 1802 | Ga0501043_0030942 | |||
| 1803 | Ga0501043_0063552 | |||
| 1804 | Ga0501043_0087812 | |||
| 1805 | Ga0501046_0005622 | |||
| 1806 | Ga0501046_0065271 | |||
| 1807 | Ga0501046_0123382 | |||
| 1808 | Ga0501047_0014491 | |||
| 1809 | Ga0501047_0034996 | |||
| 1810 | Ga0501047_0058133 | |||
| 1811 | Ga0501047_0578825 | |||
| 1812 | Ga0501048_0010212 | |||
| 1813 | Ga0501067_0077400 | |||
| 1814 | Ga0501070_0013912 | |||
| 1815 | Ga0501072_0215672 | |||
| 1816 | Ga0501073_0052833 | |||
| 1817 | Ga0501074_0000510 | |||
| 1818 | Ga0501207_000852 | |||
| 1819 | Ga0501217_000867 | |||
| 1820 | Ga0501225_0002427 | |||
| 1821 | Ga0501080_0119892 | |||
| 1822 | Ga0501083_0007826 | |||
| 1823 | Ga0501266_003387 | |||
| 1824 | Ga0501269_001971 | |||
| 1825 | Ga0501035_0006493 | |||
| 1826 | Ga0501035_0018176 | |||
| 1827 | Ga0501044_0006290 | |||
| 1828 | Ga0501044_0008085 | |||
| 1829 | Ga0501044_0009879 | |||
| 1830 | Ga0501044_0117025 | |||
| 1831 | Ga0501044_0156023 | |||
| 1832 | Ga0501044_0216236 | |||
| 1833 | Ga0501044_0255008 | |||
| 1834 | Ga0501212_001301 | |||
| 1835 | Ga0501284_00080 | |||
| 1836 | nmdc:mga0k408_22910_c1 | |||
| 1837 | nmdc:mga07m45_221643_c1 | |||
| 1838 | nmdc:mga05p37_124069_c1 | |||
| 1839 | nmdc:mga05p37_503219_c1 | |||
| 1840 | nmdc:mga09592_92338_c1 | |||
| 1841 | nmdc:mga0qj67_21616_c1 | |||
| 1842 | nmdc:mga08y16_9852_c1 | |||
| 1843 | nmdc:mga0n895_403083_c1 | |||
| 1844 | Ga0495619_0017768 | |||
| 1845 | Ga0495619_0018313 | |||
| 1846 | Ga0500644_0000040 | |||
| 1847 | Ga0500646_0007548 | |||
| 1848 | Ga0500646_0024527 | |||
| 1849 | Ga0500583_0000031 | |||
| 1850 | Ga0500583_0064229 | |||
| 1851 | Ga0500651_0112249 | |||
| 1852 | Ga0500641_0011168 | |||
| 1853 | Ga0500556_0020243 | |||
| 1854 | Ga0500556_0063308 | |||
| 1855 | Ga0500569_000346 | |||
| 1856 | Ga0500652_051860 | |||
| 1857 | Ga0500658_0004538 | |||
| 1858 | Ga0500559_0031530 | |||
| 1859 | Ga0500568_0000990 | |||
| 1860 | Ga0500568_0046411 | |||
| 1861 | Ga0500577_0001512 | |||
| 1862 | Ga0500589_005564 | |||
| 1863 | Ga0500616_0002295 | |||
| 1864 | Ga0500622_0000110 | |||
| 1865 | Ga0500622_0000736 | |||
| 1866 | Ga0500627_0007790 | |||
| 1867 | Ga0500636_0073784 | |||
| 1868 | Ga0500637_0076557 | |||
| 1869 | Ga0500611_000043 | |||
| 1870 | Ga0500645_034758 | |||
| 1871 | Ga0501082_0128407 | |||
| 1872 | Ga0501082_0133240 | |||
| 1873 | 2738730495 | |||
| 1874 | 2819678345 | |||
| 1875 | 2821138200 | |||
| 1876 | 2881957303 | |||
| 1877 | 2883068592 | |||
| 1878 | 2884793205 | |||
| 1879 | 2896089660 | |||
| 1880 | 2896110919 | |||
| 1881 | 2904468995 | |||
| 1882 | 2929180941 | |||
| 1883 | 2929242878 | |||
| 1884 | 2929925142 | |||
| 1885 | 2945983340 | |||
| 1886 | 2946017270 | |||
| 1887 | 8003155161 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4py9-assembly1.cif.gz_A | crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 | 0.9069 | 5 | 334 |
| 5jju-assembly1.cif.gz_B | crystal structure of rv2837c complexed with 5'-papa and 5'-amp | 0.903 | 3 | 327 |
| 4py9-assembly1.cif.gz_A | crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 | 0.8892 | 5 | 334 |
| 5o25-assembly1.cif.gz_A | structure of wildtype t.maritima pde (tm1595) in ligand-free state | 0.8763 | 3 | 329 |
| 5jju-assembly1.cif.gz_B | crystal structure of rv2837c complexed with 5'-papa and 5'-amp | 0.8713 | 3 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4py9A02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.9755 | 210 | 334 | 3.10.310.30 |
| 4py9A02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.9521 | 210 | 334 | 3.10.310.30 |
| 4py9A01 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) | 0.9423 | 5 | 209 | 3.90.1640.10 |
| 4py9A01 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) | 0.8984 | 5 | 209 | 3.90.1640.10 |
| af_Q2FXM3_201_313_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8899 | 216 | 335 | 3.10.310.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5WMP5-F1-model_v4 | Phosphoesterase RecJ domain-containing | 0.9959 | 21 | 172 |
|
| AF-A0A522E7W8-F1-model_v4 | DHH family phosphoesterase | 0.9911 | 1 | 103 |
|
| AF-A0A359AV32-F1-model_v4 | DHH family phosphoesterase | 0.9888 | 25 | 132 |
|
| AF-A0A3D4C8E0-F1-model_v4 | deleted | 0.9861 | 262 | 335 |
|
| AF-A0A4Q3RL94-F1-model_v4 | Bifunctional oligoribonuclease/PAP phosphatase NrnA | 0.9815 | 1 | 197 |
|