F486409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 944 | 484 | 1888 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0043414|Ga0466971_0043414_455_1318 |
| Length | 274 |
| Sequence | MTTETPDGIAPAAHQPETRRPRPTRHRGPIMLRGGEPDPQTQGTTTDQRLLDRRGPTDWVHTDPWRVLRIQSEFVEGFGLLAELPRAVSVFGSARTAREHPYYAAGVELGAALAGAGYAVITGGGPGAMEAGGLSVGLGIELPFEQELNEWVDVGISFRYFFVRKTMFVKYAQAFVILPGGFGTLDELFEALTLVQTRKVTRFPVLLYGTEYWSGLVDWIRSTMVDGGTISPADLDLFTVTDDVEEVVAVIKAEEGDNGGGMRSLPRDTGPVDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 235 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 241 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 244 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 245 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 379 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 381 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 383 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 384 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 385 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 386 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 387 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 390 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 395 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 396 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 397 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 398 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 399 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 400 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 401 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 402 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 403 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 404 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 405 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 406 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 407 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 408 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 409 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 410 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 411 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 412 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 413 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 414 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 415 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 416 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 417 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 418 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 419 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 420 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 421 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 422 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 423 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 424 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 425 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 426 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 427 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 428 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 429 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 430 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 431 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 432 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 433 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 434 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 435 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 436 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 437 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 438 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 439 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 440 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 441 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 442 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 443 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 444 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 445 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 446 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 447 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 448 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 449 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 450 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 451 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 452 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 453 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 454 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 455 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 456 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 457 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 458 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 459 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 460 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 461 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 462 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 463 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 464 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 465 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 466 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 467 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 468 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 469 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 470 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 471 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 472 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 473 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 474 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 475 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 476 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 477 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 478 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 479 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 480 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 481 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 482 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 483 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 484 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.15 |
| Metatranscriptomes | 0.21 |
| Isolates | 9.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.07 |
| Nodule | 0.42 |
| Rhizoplane | 7.73 |
| Rhizosphere | 77.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466971_0043414 | 3300044719 | Bacteria | 2020 |
| 2 | JGI24737J22298_10060831 | 3300001990 | Bacteria | 1137 |
| 3 | JGI25406J46586_10019790 | 3300003203 | Bacteria | 2734 |
| 4 | rootH1_10006175 | 3300003323 | Bacteria | 5674 |
| 5 | JGI25405J52794_10038489 | 3300003911 | Bacteria | 1007 |
| 6 | Ga0070658_10001015 | 3300005327 | Bacteria | 24084 |
| 7 | Ga0070658_10252342 | 3300005327 | Bacteria | 1497 |
| 8 | Ga0070658_10492190 | 3300005327 | Bacteria | 1059 |
| 9 | Ga0070676_10045712 | 3300005328 | Bacteria | 2551 |
| 10 | Ga0070683_100079895 | 3300005329 | Bacteria | 3061 |
| 11 | Ga0070683_100286674 | 3300005329 | Bacteria | 1566 |
| 12 | Ga0070683_100339828 | 3300005329 | Bacteria | 1429 |
| 13 | Ga0070670_100276699 | 3300005331 | Bacteria | 1465 |
| 14 | Ga0068869_100116031 | 3300005334 | Bacteria | 2042 |
| 15 | Ga0070666_10008623 | 3300005335 | Bacteria | 6337 |
| 16 | Ga0070666_10161872 | 3300005335 | Bacteria | 1564 |
| 17 | Ga0070666_10422881 | 3300005335 | Bacteria | 960 |
| 18 | Ga0070680_100028244 | 3300005336 | Bacteria | 4498 |
| 19 | Ga0070682_100061158 | 3300005337 | Bacteria | 2383 |
| 20 | Ga0070682_100548989 | 3300005337 | Bacteria | 904 |
| 21 | Ga0068868_100036941 | 3300005338 | Bacteria | 3784 |
| 22 | Ga0068868_100133992 | 3300005338 | Bacteria | 2029 |
| 23 | Ga0068868_100444425 | 3300005338 | Bacteria | 1127 |
| 24 | Ga0070660_100128076 | 3300005339 | Bacteria | 2030 |
| 25 | Ga0070660_100227953 | 3300005339 | Bacteria | 1515 |
| 26 | Ga0070687_100052515 | 3300005343 | Bacteria | 2116 |
| 27 | Ga0070687_100361637 | 3300005343 | Bacteria | 940 |
| 28 | Ga0070661_100102507 | 3300005344 | Bacteria | 2130 |
| 29 | Ga0070661_100115090 | 3300005344 | Bacteria | 2011 |
| 30 | Ga0070692_10023965 | 3300005345 | Bacteria | 2995 |
| 31 | Ga0070692_10056976 | 3300005345 | Bacteria | 2047 |
| 32 | Ga0070668_100016248 | 3300005347 | Bacteria | 5567 |
| 33 | Ga0070668_100025772 | 3300005347 | Bacteria | 4460 |
| 34 | Ga0070668_100434606 | 3300005347 | Bacteria | 1126 |
| 35 | Ga0070675_100008437 | 3300005354 | Bacteria | 7997 |
| 36 | Ga0070671_100003983 | 3300005355 | Bacteria | 11636 |
| 37 | Ga0070671_100027438 | 3300005355 | Bacteria | 4688 |
| 38 | Ga0070671_100162474 | 3300005355 | Bacteria | 1888 |
| 39 | Ga0070671_100346759 | 3300005355 | Bacteria | 1267 |
| 40 | Ga0070674_100057240 | 3300005356 | Bacteria | 2706 |
| 41 | Ga0070673_100232589 | 3300005364 | Bacteria | 1599 |
| 42 | Ga0070673_100446265 | 3300005364 | Bacteria | 1163 |
| 43 | Ga0070688_100064615 | 3300005365 | Bacteria | 2323 |
| 44 | Ga0070688_100279342 | 3300005365 | Bacteria | 1199 |
| 45 | Ga0070688_100381755 | 3300005365 | Bacteria | 1039 |
| 46 | Ga0070659_100070520 | 3300005366 | Bacteria | 2776 |
| 47 | Ga0070667_100001309 | 3300005367 | Bacteria | 22415 |
| 48 | Ga0070667_100091665 | 3300005367 | Bacteria | 2613 |
| 49 | Ga0070709_10068498 | 3300005434 | Bacteria | 2282 |
| 50 | Ga0070714_100000100 | 3300005435 | Bacteria | 73241 |
| 51 | Ga0070714_100017702 | 3300005435 | Bacteria | 5778 |
| 52 | Ga0070714_100061727 | 3300005435 | Bacteria | 3220 |
| 53 | Ga0070714_100311233 | 3300005435 | Bacteria | 1470 |
| 54 | Ga0070714_100543260 | 3300005435 | Bacteria | 1112 |
| 55 | Ga0070714_100743673 | 3300005435 | Bacteria | 948 |
| 56 | Ga0070713_100005229 | 3300005436 | Bacteria | 8844 |
| 57 | Ga0070710_10034403 | 3300005437 | Bacteria | 2757 |
| 58 | Ga0070701_10033291 | 3300005438 | Bacteria | 2574 |
| 59 | Ga0070705_100050318 | 3300005440 | Bacteria | 2423 |
| 60 | Ga0070700_100000031 | 3300005441 | Bacteria | 117217 |
| 61 | Ga0070700_100147240 | 3300005441 | Bacteria | 1606 |
| 62 | Ga0070700_100166530 | 3300005441 | Bacteria | 1522 |
| 63 | Ga0070708_100002967 | 3300005445 | Bacteria | 13181 |
| 64 | Ga0070663_100016604 | 3300005455 | Bacteria | 4787 |
| 65 | Ga0070663_100129984 | 3300005455 | Bacteria | 1911 |
| 66 | Ga0070663_100216988 | 3300005455 | Bacteria | 1500 |
| 67 | Ga0070662_100142835 | 3300005457 | Bacteria | 1857 |
| 68 | Ga0070681_10412195 | 3300005458 | Bacteria | 1263 |
| 69 | Ga0070685_10023086 | 3300005466 | Bacteria | 3402 |
| 70 | Ga0070685_10055386 | 3300005466 | Bacteria | 2304 |
| 71 | Ga0070685_10192324 | 3300005466 | Bacteria | 1321 |
| 72 | Ga0070707_100141840 | 3300005468 | Bacteria | 2338 |
| 73 | Ga0070698_100006387 | 3300005471 | Bacteria | 12799 |
| 74 | Ga0070699_100001284 | 3300005518 | Bacteria | 23140 |
| 75 | Ga0070679_100059205 | 3300005530 | Bacteria | 3818 |
| 76 | Ga0070684_100114415 | 3300005535 | Bacteria | 2422 |
| 77 | Ga0070697_100000091 | 3300005536 | Bacteria | 75795 |
| 78 | Ga0070697_100129375 | 3300005536 | Bacteria | 2116 |
| 79 | Ga0068853_100030282 | 3300005539 | Bacteria | 4571 |
| 80 | Ga0068853_100206439 | 3300005539 | Bacteria | 1789 |
| 81 | Ga0068853_100231490 | 3300005539 | Bacteria | 1691 |
| 82 | Ga0070672_100183879 | 3300005543 | Bacteria | 1742 |
| 83 | Ga0070686_100088401 | 3300005544 | Bacteria | 2068 |
| 84 | Ga0070695_100057148 | 3300005545 | Bacteria | 2520 |
| 85 | Ga0070696_100136059 | 3300005546 | Bacteria | 1791 |
| 86 | Ga0070693_100139007 | 3300005547 | Bacteria | 1527 |
| 87 | Ga0070693_100303832 | 3300005547 | Bacteria | 1076 |
| 88 | Ga0070665_100001318 | 3300005548 | Bacteria | 29616 |
| 89 | Ga0070665_100001778 | 3300005548 | Bacteria | 24546 |
| 90 | Ga0070665_100059933 | 3300005548 | Bacteria | 3815 |
| 91 | Ga0070704_100015882 | 3300005549 | Bacteria | 4742 |
| 92 | Ga0068855_100072469 | 3300005563 | Bacteria | 4004 |
| 93 | Ga0068855_100284929 | 3300005563 | Bacteria | 1833 |
| 94 | Ga0070664_100051540 | 3300005564 | Bacteria | 3485 |
| 95 | Ga0068857_100194794 | 3300005577 | Bacteria | 1846 |
| 96 | Ga0068857_100587409 | 3300005577 | Bacteria | 1052 |
| 97 | Ga0068857_100785111 | 3300005577 | Bacteria | 909 |
| 98 | Ga0068854_100047859 | 3300005578 | Bacteria | 3048 |
| 99 | Ga0068854_100183874 | 3300005578 | Bacteria | 1634 |
| 100 | Ga0068856_100087034 | 3300005614 | Bacteria | 3105 |
| 101 | Ga0068856_100153862 | 3300005614 | Bacteria | 2310 |
| 102 | Ga0068856_100231753 | 3300005614 | Bacteria | 1862 |
| 103 | Ga0070702_100001774 | 3300005615 | Bacteria | 8968 |
| 104 | Ga0070702_100015779 | 3300005615 | Bacteria | 3863 |
| 105 | Ga0068852_100145156 | 3300005616 | Bacteria | 2200 |
| 106 | Ga0068859_100000301 | 3300005617 | Bacteria | 49173 |
| 107 | Ga0068859_100020832 | 3300005617 | Bacteria | 6581 |
| 108 | Ga0068859_100217642 | 3300005617 | Bacteria | 1997 |
| 109 | Ga0068864_100018929 | 3300005618 | Bacteria | 5757 |
| 110 | Ga0068864_100066037 | 3300005618 | Bacteria | 3139 |
| 111 | Ga0068866_10033019 | 3300005718 | Bacteria | 2507 |
| 112 | Ga0068861_100046303 | 3300005719 | Bacteria | 3278 |
| 113 | Ga0068861_100047337 | 3300005719 | Bacteria | 3246 |
| 114 | Ga0068851_10010306 | 3300005834 | Bacteria | 4359 |
| 115 | Ga0068870_10003104 | 3300005840 | Bacteria | 7008 |
| 116 | Ga0068863_100009162 | 3300005841 | Bacteria | 9659 |
| 117 | Ga0068863_100018933 | 3300005841 | Bacteria | 6589 |
| 118 | Ga0068863_100043788 | 3300005841 | Bacteria | 4249 |
| 119 | Ga0068863_100069549 | 3300005841 | Bacteria | 3328 |
| 120 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 121 | Ga0068858_100005725 | 3300005842 | Bacteria | 12147 |
| 122 | Ga0068858_100071489 | 3300005842 | Bacteria | 3218 |
| 123 | Ga0068860_100000345 | 3300005843 | Bacteria | 62383 |
| 124 | Ga0068860_100053734 | 3300005843 | Bacteria | 3829 |
| 125 | Ga0068862_100000049 | 3300005844 | Bacteria | 149792 |
| 126 | Ga0081455_10000288 | 3300005937 | Bacteria | 66686 |
| 127 | Ga0081455_10064419 | 3300005937 | Bacteria | 3069 |
| 128 | Ga0081455_10146576 | 3300005937 | Bacteria | 1825 |
| 129 | Ga0081540_1053513 | 3300005983 | Bacteria | 1979 |
| 130 | Ga0081540_1063423 | 3300005983 | Bacteria | 1749 |
| 131 | Ga0081539_10000264 | 3300005985 | Bacteria | 120533 |
| 132 | Ga0070717_10067839 | 3300006028 | Bacteria | 2969 |
| 133 | Ga0070717_10111451 | 3300006028 | Bacteria | 2335 |
| 134 | Ga0070717_10336328 | 3300006028 | Bacteria | 1347 |
| 135 | Ga0075365_10008217 | 3300006038 | Bacteria | 5905 |
| 136 | Ga0075363_100002322 | 3300006048 | Bacteria | 7730 |
| 137 | Ga0075363_100006033 | 3300006048 | Bacteria | 5460 |
| 138 | Ga0070716_100032422 | 3300006173 | Bacteria | 2849 |
| 139 | Ga0070712_100042524 | 3300006175 | Bacteria | 3125 |
| 140 | Ga0070712_100066508 | 3300006175 | Bacteria | 2562 |
| 141 | Ga0070712_100085027 | 3300006175 | Bacteria | 2302 |
| 142 | Ga0075367_10000660 | 3300006178 | Bacteria | 13191 |
| 143 | Ga0075370_10035099 | 3300006353 | Bacteria | 2814 |
| 144 | Ga0075370_10273424 | 3300006353 | Bacteria | 1003 |
| 145 | Ga0068871_100021131 | 3300006358 | Bacteria | 4997 |
| 146 | Ga0068871_100322577 | 3300006358 | Bacteria | 1360 |
| 147 | Ga0075428_100052509 | 3300006844 | Bacteria | 4467 |
| 148 | Ga0075428_100452187 | 3300006844 | Bacteria | 1376 |
| 149 | Ga0075433_10019058 | 3300006852 | Bacteria | 5708 |
| 150 | Ga0075433_10263218 | 3300006852 | Bacteria | 1529 |
| 151 | Ga0075434_100023900 | 3300006871 | Bacteria | 5965 |
| 152 | Ga0075434_100361505 | 3300006871 | Bacteria | 1472 |
| 153 | Ga0068865_100223713 | 3300006881 | Bacteria | 1472 |
| 154 | Ga0075436_100007073 | 3300006914 | Bacteria | 7681 |
| 155 | Ga0075436_100119180 | 3300006914 | Bacteria | 1845 |
| 156 | Ga0097620_100000301 | 3300006931 | Bacteria | 49173 |
| 157 | Ga0097620_100020832 | 3300006931 | Bacteria | 6581 |
| 158 | Ga0097620_100217640 | 3300006931 | Bacteria | 1997 |
| 159 | Ga0099826_10020443 | 3300006948 | Bacteria | 4966 |
| 160 | Ga0075435_100022015 | 3300007076 | Bacteria | 4913 |
| 161 | Ga0075435_100213934 | 3300007076 | Bacteria | 1636 |
| 162 | Ga0075435_100252376 | 3300007076 | Bacteria | 1502 |
| 163 | Ga0105251_10065767 | 3300009011 | Bacteria | 1696 |
| 164 | Ga0105250_10029863 | 3300009092 | Bacteria | 2192 |
| 165 | Ga0105240_10803250 | 3300009093 | Bacteria | 1019 |
| 166 | Ga0111539_10053625 | 3300009094 | Bacteria | 4800 |
| 167 | Ga0111539_10114393 | 3300009094 | Bacteria | 3164 |
| 168 | Ga0105245_10576320 | 3300009098 | Bacteria | 1149 |
| 169 | Ga0105247_10007071 | 3300009101 | Bacteria | 6898 |
| 170 | Ga0105247_10038610 | 3300009101 | Bacteria | 2916 |
| 171 | Ga0105247_10306477 | 3300009101 | Bacteria | 1103 |
| 172 | Ga0114129_10100201 | 3300009147 | Bacteria | 4008 |
| 173 | Ga0114129_10116178 | 3300009147 | Bacteria | 3687 |
| 174 | Ga0105243_10000243 | 3300009148 | Bacteria | 62451 |
| 175 | Ga0105243_10045452 | 3300009148 | Bacteria | 3451 |
| 176 | Ga0105241_10026313 | 3300009174 | Bacteria | 4327 |
| 177 | Ga0105242_10094485 | 3300009176 | Bacteria | 2522 |
| 178 | Ga0105248_10153591 | 3300009177 | Bacteria | 2597 |
| 179 | Ga0105237_10038461 | 3300009545 | Bacteria | 4831 |
| 180 | Ga0105237_10132325 | 3300009545 | Bacteria | 2488 |
| 181 | Ga0105237_10156852 | 3300009545 | Bacteria | 2273 |
| 182 | Ga0105237_10270548 | 3300009545 | Bacteria | 1702 |
| 183 | Ga0105238_10129979 | 3300009551 | Bacteria | 2496 |
| 184 | Ga0105238_10288052 | 3300009551 | Bacteria | 1624 |
| 185 | Ga0105238_10550258 | 3300009551 | Bacteria | 1158 |
| 186 | Ga0105249_10478596 | 3300009553 | Bacteria | 1288 |
| 187 | Ga0105239_10388408 | 3300010375 | Bacteria | 1579 |
| 188 | Ga0105239_10417463 | 3300010375 | Bacteria | 1520 |
| 189 | Ga0105239_10587519 | 3300010375 | Bacteria | 1270 |
| 190 | Ga0105246_10001918 | 3300011119 | Bacteria | 12529 |
| 191 | Ga0105246_10008217 | 3300011119 | Bacteria | 6410 |
| 192 | Ga0105246_10041194 | 3300011119 | Bacteria | 3120 |
| 193 | Ga0157371_10125415 | 3300013102 | Bacteria | 1826 |
| 194 | Ga0157370_10060912 | 3300013104 | Bacteria | 3582 |
| 195 | Ga0157370_10194996 | 3300013104 | Bacteria | 1880 |
| 196 | Ga0157369_10115850 | 3300013105 | Bacteria | 2846 |
| 197 | Ga0157369_10173857 | 3300013105 | Bacteria | 2268 |
| 198 | Ga0157369_10233373 | 3300013105 | Bacteria | 1923 |
| 199 | Ga0157369_10255873 | 3300013105 | Bacteria | 1827 |
| 200 | Ga0157374_10029965 | 3300013296 | Bacteria | 4936 |
| 201 | Ga0157374_10032344 | 3300013296 | Bacteria | 4762 |
| 202 | Ga0163162_10132038 | 3300013306 | Bacteria | 2606 |
| 203 | Ga0163162_10184222 | 3300013306 | Bacteria | 2214 |
| 204 | Ga0157372_10068459 | 3300013307 | Bacteria | 3991 |
| 205 | Ga0157372_10302497 | 3300013307 | Bacteria | 1860 |
| 206 | Ga0157372_10617201 | 3300013307 | Bacteria | 1264 |
| 207 | Ga0157375_10092365 | 3300013308 | Bacteria | 3090 |
| 208 | Ga0157375_10125964 | 3300013308 | Bacteria | 2676 |
| 209 | Ga0163163_10139294 | 3300014325 | Bacteria | 2468 |
| 210 | Ga0163163_10672806 | 3300014325 | Bacteria | 1099 |
| 211 | Ga0157380_10115247 | 3300014326 | Bacteria | 2266 |
| 212 | Ga0182008_10002554 | 3300014497 | Bacteria | 11332 |
| 213 | Ga0157377_10035563 | 3300014745 | Bacteria | 2733 |
| 214 | Ga0157377_10053373 | 3300014745 | Bacteria | 2285 |
| 215 | Ga0157377_10053669 | 3300014745 | Bacteria | 2280 |
| 216 | Ga0157379_10000149 | 3300014968 | Bacteria | 51280 |
| 217 | Ga0157379_10120173 | 3300014968 | Bacteria | 2363 |
| 218 | Ga0157376_10147187 | 3300014969 | Bacteria | 2120 |
| 219 | Ga0157376_10202868 | 3300014969 | Bacteria | 1826 |
| 220 | Ga0182007_10000334 | 3300015262 | Bacteria | 29904 |
| 221 | Ga0163161_10041940 | 3300017792 | Bacteria | 3289 |
| 222 | Ga0206356_10503846 | 3300020070 | Bacteria | 3860 |
| 223 | Ga0213876_10007115 | 3300021384 | Bacteria | 6099 |
| 224 | Ga0224712_10106061 | 3300022467 | Bacteria | 1199 |
| 225 | Ga0209758_1003976 | 3300025297 | Bacteria | 12811 |
| 226 | Ga0207426_1017545 | 3300025302 | Bacteria | 2541 |
| 227 | Ga0207656_10013812 | 3300025321 | Bacteria | 3097 |
| 228 | Ga0207656_10089094 | 3300025321 | Bacteria | 1398 |
| 229 | Ga0207696_1038022 | 3300025711 | Bacteria | 1422 |
| 230 | Ga0207692_10025015 | 3300025898 | Bacteria | 2784 |
| 231 | Ga0207692_10043686 | 3300025898 | Bacteria | 2231 |
| 232 | Ga0207692_10139781 | 3300025898 | Bacteria | 1377 |
| 233 | Ga0207710_10000144 | 3300025900 | Bacteria | 82093 |
| 234 | Ga0207710_10143217 | 3300025900 | Bacteria | 1155 |
| 235 | Ga0207688_10001356 | 3300025901 | Bacteria | 12725 |
| 236 | Ga0207688_10003164 | 3300025901 | Bacteria | 8979 |
| 237 | Ga0207688_10266247 | 3300025901 | Bacteria | 1041 |
| 238 | Ga0207680_10039159 | 3300025903 | Bacteria | 2748 |
| 239 | Ga0207680_10082225 | 3300025903 | Bacteria | 2026 |
| 240 | Ga0207647_10037810 | 3300025904 | Bacteria | 3057 |
| 241 | Ga0207647_10187038 | 3300025904 | Bacteria | 1201 |
| 242 | Ga0207647_10190259 | 3300025904 | Bacteria | 1189 |
| 243 | Ga0207685_10025122 | 3300025905 | Bacteria | 2052 |
| 244 | Ga0207643_10000252 | 3300025908 | Bacteria | 37454 |
| 245 | Ga0207705_10002366 | 3300025909 | Bacteria | 14581 |
| 246 | Ga0207654_10006100 | 3300025911 | Bacteria | 6059 |
| 247 | Ga0207707_10200932 | 3300025912 | Bacteria | 1738 |
| 248 | Ga0207695_10073573 | 3300025913 | Bacteria | 3481 |
| 249 | Ga0207695_10080382 | 3300025913 | Bacteria | 3301 |
| 250 | Ga0207671_10058806 | 3300025914 | Bacteria | 2850 |
| 251 | Ga0207671_10222164 | 3300025914 | Bacteria | 1480 |
| 252 | Ga0207693_10009301 | 3300025915 | Bacteria | 8019 |
| 253 | Ga0207693_10049796 | 3300025915 | Bacteria | 3290 |
| 254 | Ga0207663_10095356 | 3300025916 | Bacteria | 1984 |
| 255 | Ga0207660_10031910 | 3300025917 | Bacteria | 3633 |
| 256 | Ga0207662_10018036 | 3300025918 | Bacteria | 3998 |
| 257 | Ga0207662_10164150 | 3300025918 | Bacteria | 1421 |
| 258 | Ga0207662_10343143 | 3300025918 | Bacteria | 1001 |
| 259 | Ga0207657_10010073 | 3300025919 | Bacteria | 9451 |
| 260 | Ga0207657_10012261 | 3300025919 | Bacteria | 8468 |
| 261 | Ga0207657_10200018 | 3300025919 | Bacteria | 1608 |
| 262 | Ga0207649_10002137 | 3300025920 | Bacteria | 11192 |
| 263 | Ga0207649_10058183 | 3300025920 | Bacteria | 2419 |
| 264 | Ga0207652_10025670 | 3300025921 | Bacteria | 4900 |
| 265 | Ga0207652_10122491 | 3300025921 | Bacteria | 2314 |
| 266 | Ga0207652_10175872 | 3300025921 | Bacteria | 1922 |
| 267 | Ga0207652_10187850 | 3300025921 | Bacteria | 1858 |
| 268 | Ga0207646_10028568 | 3300025922 | Bacteria | 5074 |
| 269 | Ga0207681_10218004 | 3300025923 | Bacteria | 1475 |
| 270 | Ga0207681_10277224 | 3300025923 | Bacteria | 1319 |
| 271 | Ga0207694_10233955 | 3300025924 | Bacteria | 1501 |
| 272 | Ga0207650_10009635 | 3300025925 | Bacteria | 6604 |
| 273 | Ga0207687_10092593 | 3300025927 | Bacteria | 2208 |
| 274 | Ga0207687_10343834 | 3300025927 | Bacteria | 1213 |
| 275 | Ga0207700_10033600 | 3300025928 | Bacteria | 3672 |
| 276 | Ga0207700_10061946 | 3300025928 | Bacteria | 2839 |
| 277 | Ga0207700_10250365 | 3300025928 | Bacteria | 1513 |
| 278 | Ga0207664_10000002 | 3300025929 | Bacteria | 657053 |
| 279 | Ga0207664_10006938 | 3300025929 | Bacteria | 7835 |
| 280 | Ga0207664_10008947 | 3300025929 | Bacteria | 7012 |
| 281 | Ga0207664_10260722 | 3300025929 | Bacteria | 1516 |
| 282 | Ga0207644_10002584 | 3300025931 | Bacteria | 11651 |
| 283 | Ga0207644_10048594 | 3300025931 | Bacteria | 3034 |
| 284 | Ga0207644_10072727 | 3300025931 | Bacteria | 2519 |
| 285 | Ga0207644_10119981 | 3300025931 | Bacteria | 2001 |
| 286 | Ga0207690_10041704 | 3300025932 | Bacteria | 3010 |
| 287 | Ga0207690_10064973 | 3300025932 | Bacteria | 2493 |
| 288 | Ga0207706_10009589 | 3300025933 | Bacteria | 8885 |
| 289 | Ga0207706_10035354 | 3300025933 | Bacteria | 4443 |
| 290 | Ga0207709_10002717 | 3300025935 | Bacteria | 10935 |
| 291 | Ga0207709_10092851 | 3300025935 | Bacteria | 1977 |
| 292 | Ga0207709_10121916 | 3300025935 | Bacteria | 1762 |
| 293 | Ga0207709_10339800 | 3300025935 | Bacteria | 1130 |
| 294 | Ga0207670_10138640 | 3300025936 | Bacteria | 1791 |
| 295 | Ga0207665_10002753 | 3300025939 | Bacteria | 11792 |
| 296 | Ga0207691_10022185 | 3300025940 | Bacteria | 5988 |
| 297 | Ga0207711_10046215 | 3300025941 | Bacteria | 3720 |
| 298 | Ga0207689_10005533 | 3300025942 | Bacteria | 11280 |
| 299 | Ga0207689_10232061 | 3300025942 | Bacteria | 1525 |
| 300 | Ga0207661_10071196 | 3300025944 | Bacteria | 2841 |
| 301 | Ga0207679_10012227 | 3300025945 | Bacteria | 5592 |
| 302 | Ga0207679_10239670 | 3300025945 | Bacteria | 1536 |
| 303 | Ga0207667_10115963 | 3300025949 | Bacteria | 2760 |
| 304 | Ga0207651_10359734 | 3300025960 | Bacteria | 1228 |
| 305 | Ga0207712_10009452 | 3300025961 | Bacteria | 6168 |
| 306 | Ga0207668_10025359 | 3300025972 | Bacteria | 3836 |
| 307 | Ga0207668_10116325 | 3300025972 | Bacteria | 2016 |
| 308 | Ga0207640_10019589 | 3300025981 | Bacteria | 4001 |
| 309 | Ga0207640_10220535 | 3300025981 | Bacteria | 1452 |
| 310 | Ga0207658_10012115 | 3300025986 | Bacteria | 5881 |
| 311 | Ga0207658_10183119 | 3300025986 | Bacteria | 1735 |
| 312 | Ga0207677_10020671 | 3300026023 | Bacteria | 4002 |
| 313 | Ga0207677_10260531 | 3300026023 | Bacteria | 1413 |
| 314 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 315 | Ga0207703_10012943 | 3300026035 | Bacteria | 6502 |
| 316 | Ga0207639_10021736 | 3300026041 | Bacteria | 4611 |
| 317 | Ga0207639_10069225 | 3300026041 | Bacteria | 2753 |
| 318 | Ga0207639_10289699 | 3300026041 | Bacteria | 1443 |
| 319 | Ga0207639_10421915 | 3300026041 | Bacteria | 1206 |
| 320 | Ga0207678_10001004 | 3300026067 | Bacteria | 25696 |
| 321 | Ga0207678_10001822 | 3300026067 | Bacteria | 19525 |
| 322 | Ga0207678_10018860 | 3300026067 | Bacteria | 6060 |
| 323 | Ga0207678_10048568 | 3300026067 | Bacteria | 3668 |
| 324 | Ga0207678_10060503 | 3300026067 | Bacteria | 3258 |
| 325 | Ga0207678_10154687 | 3300026067 | Bacteria | 1958 |
| 326 | Ga0207708_10000046 | 3300026075 | Bacteria | 116515 |
| 327 | Ga0207708_10152453 | 3300026075 | Bacteria | 1820 |
| 328 | Ga0207708_10185609 | 3300026075 | Bacteria | 1652 |
| 329 | Ga0207702_10198124 | 3300026078 | Bacteria | 1860 |
| 330 | Ga0207702_10204785 | 3300026078 | Bacteria | 1831 |
| 331 | Ga0207702_10243320 | 3300026078 | Bacteria | 1686 |
| 332 | Ga0207641_10000562 | 3300026088 | Bacteria | 41565 |
| 333 | Ga0207641_10013676 | 3300026088 | Bacteria | 6659 |
| 334 | Ga0207641_10032803 | 3300026088 | Bacteria | 4313 |
| 335 | Ga0207648_10147379 | 3300026089 | Bacteria | 2076 |
| 336 | Ga0207676_10006835 | 3300026095 | Bacteria | 8078 |
| 337 | Ga0207676_10063826 | 3300026095 | Bacteria | 2926 |
| 338 | Ga0207674_10112320 | 3300026116 | Bacteria | 2698 |
| 339 | Ga0207674_10212373 | 3300026116 | Bacteria | 1884 |
| 340 | Ga0207674_10458356 | 3300026116 | Bacteria | 1232 |
| 341 | Ga0207675_100042012 | 3300026118 | Bacteria | 4268 |
| 342 | Ga0207675_100066284 | 3300026118 | Bacteria | 3375 |
| 343 | Ga0207675_100098113 | 3300026118 | Bacteria | 2759 |
| 344 | Ga0207683_10000558 | 3300026121 | Bacteria | 34428 |
| 345 | Ga0207683_10015426 | 3300026121 | Bacteria | 6507 |
| 346 | Ga0207683_10127920 | 3300026121 | Bacteria | 2284 |
| 347 | Ga0207683_10352822 | 3300026121 | Bacteria | 1350 |
| 348 | Ga0207683_10611900 | 3300026121 | Bacteria | 1009 |
| 349 | Ga0207698_10004323 | 3300026142 | Bacteria | 8645 |
| 350 | Ga0207698_10782199 | 3300026142 | Bacteria | 955 |
| 351 | Ga0209813_10048246 | 3300027866 | Bacteria | 1321 |
| 352 | Ga0207428_10022350 | 3300027907 | Bacteria | 5339 |
| 353 | Ga0268266_10001153 | 3300028379 | Bacteria | 32787 |
| 354 | Ga0268266_10002138 | 3300028379 | Bacteria | 21775 |
| 355 | Ga0268266_10015037 | 3300028379 | Bacteria | 6643 |
| 356 | Ga0268266_10059472 | 3300028379 | Bacteria | 3293 |
| 357 | Ga0268266_10343148 | 3300028379 | Bacteria | 1402 |
| 358 | Ga0268266_10343862 | 3300028379 | Bacteria | 1401 |
| 359 | Ga0268265_10000017 | 3300028380 | Bacteria | 293875 |
| 360 | Ga0268264_10000257 | 3300028381 | Bacteria | 96251 |
| 361 | Ga0268264_10050028 | 3300028381 | Bacteria | 3479 |
| 362 | Ga0268264_10236062 | 3300028381 | Bacteria | 1691 |
| 363 | Ga0307517_10001322 | 3300028786 | Bacteria | 41623 |
| 364 | Ga0307515_10001617 | 3300028794 | Bacteria | 50228 |
| 365 | Ga0307515_10018584 | 3300028794 | Bacteria | 12560 |
| 366 | Ga0307511_10014203 | 3300030521 | Bacteria | 7751 |
| 367 | Ga0307511_10015988 | 3300030521 | Bacteria | 7247 |
| 368 | Ga0307511_10103887 | 3300030521 | Bacteria | 1848 |
| 369 | Ga0307512_10088477 | 3300030522 | Bacteria | 2173 |
| 370 | Ga0307512_10096313 | 3300030522 | Bacteria | 2030 |
| 371 | Ga0307512_10233202 | 3300030522 | Bacteria | 942 |
| 372 | Ga0307513_10018434 | 3300031456 | Bacteria | 8338 |
| 373 | Ga0307513_10097245 | 3300031456 | Bacteria | 2979 |
| 374 | Ga0307513_10133134 | 3300031456 | Bacteria | 2427 |
| 375 | Ga0307408_100232614 | 3300031548 | Bacteria | 1510 |
| 376 | Ga0307508_10004580 | 3300031616 | Bacteria | 13457 |
| 377 | Ga0307508_10008424 | 3300031616 | Bacteria | 9520 |
| 378 | Ga0307508_10058061 | 3300031616 | Bacteria | 3424 |
| 379 | Ga0307508_10132343 | 3300031616 | Bacteria | 2097 |
| 380 | Ga0307514_10033526 | 3300031649 | Bacteria | 4097 |
| 381 | Ga0307514_10070706 | 3300031649 | Bacteria | 2620 |
| 382 | Ga0316575_10000188 | 3300031665 | Bacteria | 16260 |
| 383 | Ga0316579_10000152 | 3300031691 | Bacteria | 19471 |
| 384 | Ga0307516_10006178 | 3300031730 | Bacteria | 14097 |
| 385 | Ga0307516_10012725 | 3300031730 | Bacteria | 9043 |
| 386 | Ga0307516_10097243 | 3300031730 | Bacteria | 2764 |
| 387 | Ga0307405_10030057 | 3300031731 | Bacteria | 3182 |
| 388 | Ga0307405_10498208 | 3300031731 | Bacteria | 976 |
| 389 | Ga0307413_10000397 | 3300031824 | Bacteria | 13922 |
| 390 | Ga0307518_10021528 | 3300031838 | Bacteria | 4639 |
| 391 | Ga0307518_10056846 | 3300031838 | Bacteria | 2842 |
| 392 | Ga0307518_10116595 | 3300031838 | Bacteria | 1896 |
| 393 | Ga0307410_10097722 | 3300031852 | Bacteria | 2098 |
| 394 | Ga0307410_10121215 | 3300031852 | Bacteria | 1907 |
| 395 | Ga0307410_10141318 | 3300031852 | Bacteria | 1781 |
| 396 | Ga0307406_10396017 | 3300031901 | Bacteria | 1093 |
| 397 | Ga0307407_10048623 | 3300031903 | Bacteria | 2415 |
| 398 | Ga0307412_10140787 | 3300031911 | Bacteria | 1766 |
| 399 | Ga0307409_100082227 | 3300031995 | Bacteria | 2606 |
| 400 | Ga0307409_100196908 | 3300031995 | Bacteria | 1799 |
| 401 | Ga0307409_100226173 | 3300031995 | Bacteria | 1692 |
| 402 | Ga0307409_100412309 | 3300031995 | Bacteria | 1293 |
| 403 | Ga0307416_100066850 | 3300032002 | Bacteria | 2962 |
| 404 | Ga0307416_100156355 | 3300032002 | Bacteria | 2100 |
| 405 | Ga0307416_100175660 | 3300032002 | Bacteria | 2000 |
| 406 | Ga0307414_10041944 | 3300032004 | Bacteria | 3105 |
| 407 | Ga0307414_10198057 | 3300032004 | Bacteria | 1631 |
| 408 | Ga0307414_10307901 | 3300032004 | Bacteria | 1343 |
| 409 | Ga0307411_10000834 | 3300032005 | Bacteria | 11536 |
| 410 | Ga0307415_100029462 | 3300032126 | Bacteria | 3508 |
| 411 | Ga0307415_100044494 | 3300032126 | Bacteria | 2969 |
| 412 | Ga0307415_100089823 | 3300032126 | Bacteria | 2220 |
| 413 | Ga0307415_100123812 | 3300032126 | Bacteria | 1944 |
| 414 | Ga0307507_10012000 | 3300033179 | Bacteria | 10805 |
| 415 | Ga0307507_10035253 | 3300033179 | Bacteria | 5144 |
| 416 | Ga0307507_10093060 | 3300033179 | Bacteria | 2569 |
| 417 | Ga0307510_10021098 | 3300033180 | Bacteria | 7599 |
| 418 | Ga0373938_0007234 | 3300034957 | Bacteria | 1947 |
| 419 | Ga0373940_0012856 | 3300035088 | Bacteria | 2013 |
| 420 | Ga0373952_0017842 | 3300035092 | Bacteria | 1462 |
| 421 | Ga0373962_0029601 | 3300035242 | Bacteria | 1493 |
| 422 | Ga0373935_0081945 | 3300035692 | Bacteria | 2098 |
| 423 | Ga0395899_0125501 | 3300037312 | Bacteria | 1836 |
| 424 | Ga0395900_0007073 | 3300037418 | Bacteria | 11622 |
| 425 | Ga0395900_0024205 | 3300037418 | Bacteria | 6217 |
| 426 | Ga0395898_0023756 | 3300037466 | Bacteria | 6190 |
| 427 | Ga0395898_0098937 | 3300037466 | Bacteria | 2801 |
| 428 | Ga0395898_0156194 | 3300037466 | Bacteria | 2182 |
| 429 | Ga0395898_0213649 | 3300037466 | Bacteria | 1840 |
| 430 | Ga0395905_0207323 | 3300037471 | Bacteria | 1837 |
| 431 | Ga0395905_0269320 | 3300037471 | Bacteria | 1589 |
| 432 | Ga0436364_0258245 | 3300037853 | Bacteria | 1846 |
| 433 | Ga0395901_0028766 | 3300038443 | Bacteria | 5717 |
| 434 | Ga0395901_0134713 | 3300038443 | Bacteria | 2596 |
| 435 | Ga0395901_0220969 | 3300038443 | Bacteria | 1980 |
| 436 | Ga0395901_0443076 | 3300038443 | Bacteria | 1329 |
| 437 | Ga0395901_0545732 | 3300038443 | Bacteria | 1175 |
| 438 | Ga0400488_61512 | 3300038741 | Bacteria | 10327 |
| 439 | Ga0436365_1887167 | 3300039437 | Bacteria | 40011 |
| 440 | Ga0439436_0001917 | 3300041404 | Bacteria | 6157 |
| 441 | Ga0451789_0233241 | 3300041443 | Bacteria | 2420 |
| 442 | Ga0451791_1666820 | 3300041451 | Bacteria | 7239 |
| 443 | Ga0451793_0152285 | 3300041452 | Bacteria | 10161 |
| 444 | Ga0451793_0933570 | 3300041452 | Bacteria | 4515 |
| 445 | Ga0451797_0077001 | 3300041453 | Bacteria | 1277 |
| 446 | Ga0451795_0115662 | 3300041456 | Bacteria | 2357 |
| 447 | Ga0451807_0323001 | 3300041486 | Bacteria | 882 |
| 448 | Ga0451833_0187408 | 3300041491 | Bacteria | 12907 |
| 449 | Ga0451839_0525567 | 3300041496 | Bacteria | 10453 |
| 450 | Ga0451843_0137783 | 3300041509 | Bacteria | 1347 |
| 451 | Ga0451853_1285162 | 3300041512 | Bacteria | 3573 |
| 452 | Ga0451853_1868916 | 3300041512 | Bacteria | 2665 |
| 453 | Ga0439448_0013296 | 3300042005 | Bacteria | 2472 |
| 454 | Ga0439448_0099900 | 3300042005 | Bacteria | 985 |
| 455 | Ga0439432_032338 | 3300042006 | Bacteria | 1687 |
| 456 | Ga0439449_0020532 | 3300042007 | Bacteria | 2474 |
| 457 | Ga0439449_0023382 | 3300042007 | Bacteria | 2311 |
| 458 | Ga0439450_004963 | 3300042008 | Bacteria | 2309 |
| 459 | Ga0439450_010526 | 3300042008 | Bacteria | 1787 |
| 460 | Ga0439455_0000667 | 3300042012 | Bacteria | 5045 |
| 461 | Ga0439455_0004610 | 3300042012 | Bacteria | 2745 |
| 462 | Ga0439462_0003587 | 3300042015 | Bacteria | 3735 |
| 463 | Ga0450900_005059 | 3300042136 | Bacteria | 1544 |
| 464 | Ga0450903_001837 | 3300042138 | Bacteria | 3870 |
| 465 | Ga0439458_0004762 | 3300042157 | Bacteria | 3085 |
| 466 | Ga0439458_0011123 | 3300042157 | Bacteria | 2010 |
| 467 | Ga0466969_0011684 | 3300044656 | Bacteria | 4645 |
| 468 | Ga0466969_0044624 | 3300044656 | Bacteria | 2204 |
| 469 | Ga0466969_0062577 | 3300044656 | Bacteria | 1805 |
| 470 | Ga0466969_0095635 | 3300044656 | Bacteria | 1403 |
| 471 | Ga0466972_0002655 | 3300044658 | Bacteria | 8854 |
| 472 | Ga0466972_0005010 | 3300044658 | Bacteria | 6638 |
| 473 | Ga0466972_0025454 | 3300044658 | Bacteria | 2934 |
| 474 | Ga0466972_0079018 | 3300044658 | Bacteria | 1567 |
| 475 | Ga0466965_0002418 | 3300044683 | Bacteria | 7928 |
| 476 | Ga0466965_0004870 | 3300044683 | Bacteria | 5995 |
| 477 | Ga0466965_0031342 | 3300044683 | Bacteria | 2593 |
| 478 | Ga0466965_0327546 | 3300044683 | Bacteria | 835 |
| 479 | Ga0466966_0001756 | 3300044684 | Bacteria | 14038 |
| 480 | Ga0466966_0008783 | 3300044684 | Bacteria | 6689 |
| 481 | Ga0466966_0013564 | 3300044684 | Bacteria | 5393 |
| 482 | Ga0466966_0020421 | 3300044684 | Bacteria | 4354 |
| 483 | Ga0466966_0068773 | 3300044684 | Bacteria | 2223 |
| 484 | Ga0466966_0076252 | 3300044684 | Bacteria | 2094 |
| 485 | Ga0466966_0158130 | 3300044684 | Bacteria | 1380 |
| 486 | Ga0466966_0173161 | 3300044684 | Bacteria | 1311 |
| 487 | Ga0466966_0429360 | 3300044684 | Bacteria | 794 |
| 488 | Ga0466961_0008517 | 3300044693 | Bacteria | 6533 |
| 489 | Ga0466961_0010592 | 3300044693 | Bacteria | 5884 |
| 490 | Ga0466961_0013345 | 3300044693 | Bacteria | 5259 |
| 491 | Ga0466961_0039615 | 3300044693 | Bacteria | 3021 |
| 492 | Ga0466961_0047153 | 3300044693 | Bacteria | 2755 |
| 493 | Ga0466961_0047314 | 3300044693 | Bacteria | 2750 |
| 494 | Ga0466961_0093420 | 3300044693 | Bacteria | 1898 |
| 495 | Ga0466963_0009248 | 3300044694 | Bacteria | 5933 |
| 496 | Ga0466963_0033174 | 3300044694 | Bacteria | 3349 |
| 497 | Ga0466963_0039416 | 3300044694 | Bacteria | 3093 |
| 498 | Ga0466963_0075213 | 3300044694 | Bacteria | 2279 |
| 499 | Ga0466963_0098206 | 3300044694 | Bacteria | 2001 |
| 500 | Ga0466963_0111050 | 3300044694 | Bacteria | 1882 |
| 501 | Ga0466963_0182849 | 3300044694 | Bacteria | 1464 |
| 502 | Ga0466964_0073909 | 3300044706 | Bacteria | 1448 |
| 503 | Ga0466971_0006460 | 3300044719 | Bacteria | 5093 |
| 504 | Ga0466971_0008220 | 3300044719 | Bacteria | 4552 |
| 505 | Ga0466971_0095635 | 3300044719 | Bacteria | 1362 |
| 506 | Ga0466971_0113621 | 3300044719 | Bacteria | 1251 |
| 507 | Ga0466968_0000884 | 3300044735 | Bacteria | 10548 |
| 508 | Ga0466970_0001549 | 3300044765 | Bacteria | 11072 |
| 509 | Ga0466970_0007752 | 3300044765 | Bacteria | 5386 |
| 510 | Ga0466970_0011340 | 3300044765 | Bacteria | 4543 |
| 511 | Ga0466970_0019253 | 3300044765 | Bacteria | 3538 |
| 512 | Ga0466970_0039231 | 3300044765 | Bacteria | 2513 |
| 513 | Ga0466970_0126864 | 3300044765 | Bacteria | 1400 |
| 514 | Ga0466970_0134343 | 3300044765 | Bacteria | 1360 |
| 515 | Ga0466957_0011648 | 3300044842 | Bacteria | 5081 |
| 516 | Ga0466957_0046347 | 3300044842 | Bacteria | 2639 |
| 517 | Ga0466957_0052018 | 3300044842 | Bacteria | 2493 |
| 518 | Ga0466957_0071896 | 3300044842 | Bacteria | 2140 |
| 519 | Ga0466957_0080966 | 3300044842 | Bacteria | 2022 |
| 520 | Ga0466957_0129261 | 3300044842 | Bacteria | 1617 |
| 521 | Ga0466957_0188681 | 3300044842 | Bacteria | 1349 |
| 522 | Ga0466957_0226808 | 3300044842 | Bacteria | 1235 |
| 523 | Ga0466957_0233827 | 3300044842 | Bacteria | 1217 |
| 524 | Ga0466957_0315027 | 3300044842 | Bacteria | 1054 |
| 525 | Ga0466957_0436844 | 3300044842 | Bacteria | 900 |
| 526 | Ga0466960_0016299 | 3300044901 | Bacteria | 3220 |
| 527 | Ga0466960_0023319 | 3300044901 | Bacteria | 2778 |
| 528 | Ga0466960_0061159 | 3300044901 | Bacteria | 1848 |
| 529 | Ga0466960_0065233 | 3300044901 | Bacteria | 1798 |
| 530 | Ga0466960_0115723 | 3300044901 | Bacteria | 1398 |
| 531 | Ga0466960_0137163 | 3300044901 | Bacteria | 1296 |
| 532 | Ga0466960_0268112 | 3300044901 | Bacteria | 953 |
| 533 | Ga0466959_0018880 | 3300045049 | Bacteria | 5066 |
| 534 | Ga0466959_0031761 | 3300045049 | Bacteria | 3907 |
| 535 | Ga0466959_0033724 | 3300045049 | Bacteria | 3786 |
| 536 | Ga0466959_0114609 | 3300045049 | Bacteria | 1921 |
| 537 | Ga0466959_0174163 | 3300045049 | Bacteria | 1508 |
| 538 | Ga0466959_0183643 | 3300045049 | Bacteria | 1462 |
| 539 | Ga0466959_0218696 | 3300045049 | Bacteria | 1322 |
| 540 | Ga0466959_0334710 | 3300045049 | Bacteria | 1033 |
| 541 | Ga0466958_0001720 | 3300045836 | Bacteria | 10578 |
| 542 | Ga0466958_0023859 | 3300045836 | Bacteria | 3596 |
| 543 | Ga0466958_0033524 | 3300045836 | Bacteria | 3060 |
| 544 | Ga0466958_0045697 | 3300045836 | Bacteria | 2642 |
| 545 | Ga0466958_0063722 | 3300045836 | Bacteria | 2248 |
| 546 | Ga0466958_0083979 | 3300045836 | Bacteria | 1963 |
| 547 | Ga0466958_0198550 | 3300045836 | Bacteria | 1276 |
| 548 | Ga0466958_0268228 | 3300045836 | Bacteria | 1093 |
| 549 | Ga0466967_0002943 | 3300045976 | Bacteria | 10873 |
| 550 | Ga0466967_0004674 | 3300045976 | Bacteria | 9294 |
| 551 | Ga0466967_0005415 | 3300045976 | Bacteria | 8842 |
| 552 | Ga0466967_0009957 | 3300045976 | Bacteria | 7095 |
| 553 | Ga0466967_0029087 | 3300045976 | Bacteria | 4621 |
| 554 | Ga0466967_0029383 | 3300045976 | Bacteria | 4600 |
| 555 | Ga0466967_0053312 | 3300045976 | Bacteria | 3554 |
| 556 | Ga0466967_0076000 | 3300045976 | Bacteria | 3020 |
| 557 | Ga0466967_0148301 | 3300045976 | Bacteria | 2190 |
| 558 | Ga0466967_0252137 | 3300045976 | Bacteria | 1686 |
| 559 | Ga0466967_0296708 | 3300045976 | Bacteria | 1554 |
| 560 | Ga0466967_0580205 | 3300045976 | Bacteria | 1105 |
| 561 | Ga0466967_0639985 | 3300045976 | Bacteria | 1051 |
| 562 | Ga0466967_0644369 | 3300045976 | Bacteria | 1047 |
| 563 | Ga0495617_096210 | 3300046452 | Bacteria | 964 |
| 564 | Ga0495603_0000105 | 3300046455 | Bacteria | 39641 |
| 565 | Ga0495603_0018224 | 3300046455 | Bacteria | 4247 |
| 566 | Ga0495603_0073381 | 3300046455 | Bacteria | 2010 |
| 567 | Ga0495590_0022922 | 3300046457 | Bacteria | 2207 |
| 568 | Ga0495629_0004087 | 3300046459 | Bacteria | 10948 |
| 569 | Ga0495629_0018577 | 3300046459 | Bacteria | 4972 |
| 570 | Ga0495629_0051936 | 3300046459 | Bacteria | 2868 |
| 571 | Ga0495629_0427702 | 3300046459 | Bacteria | 898 |
| 572 | Ga0495638_0150393 | 3300046460 | Bacteria | 1350 |
| 573 | Ga0495651_0089685 | 3300046462 | Bacteria | 2307 |
| 574 | Ga0495650_0124444 | 3300046471 | Bacteria | 946 |
| 575 | Ga0495580_0234360 | 3300046472 | Bacteria | 1260 |
| 576 | Ga0495580_0483717 | 3300046472 | Bacteria | 828 |
| 577 | Ga0495582_0085304 | 3300046473 | Bacteria | 1757 |
| 578 | Ga0495605_0036219 | 3300046474 | Bacteria | 2489 |
| 579 | Ga0495639_0016322 | 3300046475 | Bacteria | 3223 |
| 580 | Ga0495662_0005123 | 3300046476 | Bacteria | 6565 |
| 581 | Ga0495662_0010595 | 3300046476 | Bacteria | 4508 |
| 582 | Ga0495662_0165304 | 3300046476 | Bacteria | 1090 |
| 583 | Ga0495664_0011486 | 3300046477 | Bacteria | 4995 |
| 584 | Ga0495594_0012685 | 3300046499 | Bacteria | 4395 |
| 585 | Ga0495594_0024388 | 3300046499 | Bacteria | 3248 |
| 586 | Ga0495594_0036254 | 3300046499 | Bacteria | 2689 |
| 587 | Ga0495583_0062446 | 3300046506 | Bacteria | 1659 |
| 588 | Ga0495620_0053608 | 3300046515 | Bacteria | 1707 |
| 589 | Ga0495628_0027887 | 3300046516 | Bacteria | 4591 |
| 590 | Ga0495630_0650083 | 3300046517 | Bacteria | 807 |
| 591 | Ga0495631_0047991 | 3300046518 | Bacteria | 1873 |
| 592 | Ga0495643_0002389 | 3300046522 | Bacteria | 14989 |
| 593 | Ga0495652_0022853 | 3300046529 | Bacteria | 5548 |
| 594 | Ga0495587_0020410 | 3300046536 | Bacteria | 4091 |
| 595 | Ga0495609_0061075 | 3300046538 | Bacteria | 1665 |
| 596 | Ga0495645_0262584 | 3300046543 | Bacteria | 1142 |
| 597 | Ga0495656_0048656 | 3300046615 | Bacteria | 1803 |
| 598 | Ga0495668_0002057 | 3300046616 | Bacteria | 17478 |
| 599 | Ga0495634_0001776 | 3300046642 | Bacteria | 18660 |
| 600 | Ga0495611_0014547 | 3300046648 | Bacteria | 3363 |
| 601 | Ga0495611_0107675 | 3300046648 | Bacteria | 1296 |
| 602 | Ga0495611_0205781 | 3300046648 | Bacteria | 917 |
| 603 | Ga0495625_0078233 | 3300046660 | Bacteria | 2309 |
| 604 | Ga0495635_0000701 | 3300046663 | Bacteria | 21595 |
| 605 | Ga0495635_0179770 | 3300046663 | Bacteria | 1438 |
| 606 | Ga0495588_0027033 | 3300046674 | Bacteria | 2866 |
| 607 | Ga0495588_0060985 | 3300046674 | Bacteria | 1953 |
| 608 | Ga0495588_0088685 | 3300046674 | Bacteria | 1619 |
| 609 | Ga0495657_0002809 | 3300046675 | Bacteria | 14470 |
| 610 | Ga0495657_0016267 | 3300046675 | Bacteria | 5421 |
| 611 | Ga0495657_0275134 | 3300046675 | Bacteria | 1009 |
| 612 | Ga0495646_0011050 | 3300046680 | Bacteria | 5735 |
| 613 | Ga0495658_0105433 | 3300046683 | Bacteria | 1688 |
| 614 | Ga0495613_0003082 | 3300046689 | Bacteria | 12452 |
| 615 | Ga0495613_0003113 | 3300046689 | Bacteria | 12415 |
| 616 | Ga0495613_0009204 | 3300046689 | Bacteria | 7324 |
| 617 | Ga0495624_0098796 | 3300046690 | Bacteria | 1798 |
| 618 | Ga0495624_0270094 | 3300046690 | Bacteria | 1027 |
| 619 | Ga0495649_0028152 | 3300046694 | Bacteria | 3115 |
| 620 | Ga0495589_0022462 | 3300046794 | Bacteria | 3219 |
| 621 | Ga0495589_0054026 | 3300046794 | Bacteria | 1981 |
| 622 | Ga0495589_0058017 | 3300046794 | Bacteria | 1903 |
| 623 | Ga0495589_0070339 | 3300046794 | Bacteria | 1711 |
| 624 | Ga0495600_0065116 | 3300046809 | Bacteria | 2382 |
| 625 | Ga0495600_0126003 | 3300046809 | Bacteria | 1666 |
| 626 | Ga0495660_0055252 | 3300046810 | Bacteria | 2150 |
| 627 | Ga0495581_0249367 | 3300047315 | Bacteria | 1038 |
| 628 | Ga0495604_0002054 | 3300047317 | Bacteria | 16246 |
| 629 | Ga0495604_0009117 | 3300047317 | Bacteria | 7853 |
| 630 | Ga0495636_0008299 | 3300047318 | Bacteria | 4100 |
| 631 | Ga0495636_0024186 | 3300047318 | Bacteria | 2462 |
| 632 | Ga0495636_0066753 | 3300047318 | Bacteria | 1530 |
| 633 | Ga0495636_0165992 | 3300047318 | Bacteria | 996 |
| 634 | Ga0495674_0062791 | 3300047319 | Bacteria | 3233 |
| 635 | Ga0495674_0125374 | 3300047319 | Bacteria | 2167 |
| 636 | Ga0495672_0130887 | 3300047320 | Bacteria | 1320 |
| 637 | Ga0495676_0001188 | 3300047321 | Bacteria | 22211 |
| 638 | Ga0495676_0008085 | 3300047321 | Bacteria | 9651 |
| 639 | Ga0495676_0119870 | 3300047321 | Bacteria | 1915 |
| 640 | Ga0495676_0129874 | 3300047321 | Bacteria | 1820 |
| 641 | Ga0495683_0000800 | 3300047323 | Bacteria | 22388 |
| 642 | Ga0495683_0022666 | 3300047323 | Bacteria | 3229 |
| 643 | Ga0495683_0045175 | 3300047323 | Bacteria | 2214 |
| 644 | Ga0495683_0073020 | 3300047323 | Bacteria | 1683 |
| 645 | Ga0495687_011722 | 3300047443 | Bacteria | 4690 |
| 646 | Ga0495675_0047466 | 3300047444 | Bacteria | 2732 |
| 647 | Ga0495675_0065664 | 3300047444 | Bacteria | 2294 |
| 648 | Ga0495675_0095617 | 3300047444 | Bacteria | 1862 |
| 649 | Ga0495685_002576 | 3300047447 | Bacteria | 5704 |
| 650 | Ga0495685_006867 | 3300047447 | Bacteria | 3744 |
| 651 | Ga0495685_012006 | 3300047447 | Bacteria | 2930 |
| 652 | Ga0495685_053960 | 3300047447 | Bacteria | 1360 |
| 653 | Ga0495685_057283 | 3300047447 | Bacteria | 1316 |
| 654 | Ga0495685_108469 | 3300047447 | Bacteria | 914 |
| 655 | Ga0495681_0008621 | 3300047470 | Bacteria | 6366 |
| 656 | Ga0495681_0069632 | 3300047470 | Bacteria | 1597 |
| 657 | Ga0495684_0397496 | 3300047471 | Bacteria | 968 |
| 658 | Ga0495686_0089775 | 3300047472 | Bacteria | 1867 |
| 659 | Ga0495593_0011515 | 3300047673 | Bacteria | 5077 |
| 660 | Ga0495602_0014301 | 3300048088 | Bacteria | 8061 |
| 661 | Ga0495614_0000088 | 3300048089 | Bacteria | 30664 |
| 662 | Ga0495614_0081542 | 3300048089 | Bacteria | 1401 |
| 663 | Ga0496100_0002834 | 3300048903 | Bacteria | 8885 |
| 664 | Ga0496100_0072838 | 3300048903 | Bacteria | 2297 |
| 665 | Ga0496100_0136382 | 3300048903 | Bacteria | 1734 |
| 666 | Ga0496101_0037899 | 3300048904 | Bacteria | 3422 |
| 667 | Ga0496101_0124580 | 3300048904 | Bacteria | 1952 |
| 668 | Ga0496102_0000015 | 3300048905 | Bacteria | 304524 |
| 669 | Ga0496102_0000059 | 3300048905 | Bacteria | 168633 |
| 670 | Ga0496102_0002026 | 3300048905 | Bacteria | 17510 |
| 671 | Ga0496102_0010950 | 3300048905 | Bacteria | 7813 |
| 672 | Ga0496102_0198219 | 3300048905 | Bacteria | 1892 |
| 673 | Ga0496102_0248798 | 3300048905 | Bacteria | 1676 |
| 674 | Ga0496102_0368244 | 3300048905 | Bacteria | 1352 |
| 675 | Ga0496103_0000096 | 3300048906 | Bacteria | 97798 |
| 676 | Ga0496103_0000160 | 3300048906 | Bacteria | 71063 |
| 677 | Ga0496103_0020268 | 3300048906 | Bacteria | 3995 |
| 678 | Ga0496103_0110596 | 3300048906 | Bacteria | 1745 |
| 679 | Ga0496103_0229652 | 3300048906 | Bacteria | 1194 |
| 680 | Ga0496104_0005657 | 3300048907 | Bacteria | 10946 |
| 681 | Ga0496104_0006958 | 3300048907 | Bacteria | 9974 |
| 682 | Ga0496104_0068476 | 3300048907 | Bacteria | 3373 |
| 683 | Ga0496104_0068954 | 3300048907 | Bacteria | 3360 |
| 684 | Ga0496104_0467167 | 3300048907 | Bacteria | 1173 |
| 685 | Ga0496105_0000965 | 3300048908 | Bacteria | 19757 |
| 686 | Ga0496105_0015166 | 3300048908 | Bacteria | 6134 |
| 687 | Ga0496105_0029201 | 3300048908 | Bacteria | 4513 |
| 688 | Ga0496105_0079384 | 3300048908 | Bacteria | 2710 |
| 689 | Ga0496105_0562712 | 3300048908 | Bacteria | 889 |
| 690 | Ga0496106_0005516 | 3300048909 | Bacteria | 9360 |
| 691 | Ga0496106_0013882 | 3300048909 | Bacteria | 5953 |
| 692 | Ga0496107_0009898 | 3300048910 | Bacteria | 6615 |
| 693 | Ga0496107_0028295 | 3300048910 | Bacteria | 3982 |
| 694 | Ga0496107_0037500 | 3300048910 | Bacteria | 3478 |
| 695 | Ga0496108_0000928 | 3300048911 | Bacteria | 22854 |
| 696 | Ga0496108_0025341 | 3300048911 | Bacteria | 4886 |
| 697 | Ga0496108_0036497 | 3300048911 | Bacteria | 4089 |
| 698 | Ga0496108_0037925 | 3300048911 | Bacteria | 4015 |
| 699 | Ga0496108_0187439 | 3300048911 | Bacteria | 1792 |
| 700 | Ga0496108_0237581 | 3300048911 | Bacteria | 1585 |
| 701 | Ga0496108_0440105 | 3300048911 | Bacteria | 1139 |
| 702 | Ga0496109_0009281 | 3300048912 | Bacteria | 8380 |
| 703 | Ga0496109_0014832 | 3300048912 | Bacteria | 6780 |
| 704 | Ga0496109_0030590 | 3300048912 | Bacteria | 4826 |
| 705 | Ga0496109_0146941 | 3300048912 | Bacteria | 2206 |
| 706 | Ga0496110_0002066 | 3300048913 | Bacteria | 14967 |
| 707 | Ga0496110_0146470 | 3300048913 | Bacteria | 2136 |
| 708 | Ga0496110_0265067 | 3300048913 | Bacteria | 1564 |
| 709 | Ga0496110_0587422 | 3300048913 | Bacteria | 1011 |
| 710 | Ga0496111_0000386 | 3300048914 | Bacteria | 22027 |
| 711 | Ga0496111_0095415 | 3300048914 | Bacteria | 2182 |
| 712 | Ga0496112_0168021 | 3300048915 | Bacteria | 2159 |
| 713 | Ga0496112_0197002 | 3300048915 | Bacteria | 1975 |
| 714 | Ga0496113_0001375 | 3300048916 | Bacteria | 13486 |
| 715 | Ga0496113_0007465 | 3300048916 | Bacteria | 7039 |
| 716 | Ga0496113_0011663 | 3300048916 | Bacteria | 5877 |
| 717 | Ga0496113_0042145 | 3300048916 | Bacteria | 3371 |
| 718 | Ga0496114_0000657 | 3300048917 | Bacteria | 25588 |
| 719 | Ga0496114_0001776 | 3300048917 | Bacteria | 16356 |
| 720 | Ga0496114_0052279 | 3300048917 | Bacteria | 3403 |
| 721 | Ga0496114_0074857 | 3300048917 | Bacteria | 2851 |
| 722 | Ga0496114_0098689 | 3300048917 | Bacteria | 2491 |
| 723 | Ga0496114_0193655 | 3300048917 | Bacteria | 1779 |
| 724 | Ga0496114_0315910 | 3300048917 | Bacteria | 1380 |
| 725 | Ga0496115_0012989 | 3300048918 | Bacteria | 6283 |
| 726 | Ga0496115_0065632 | 3300048918 | Bacteria | 2932 |
| 727 | Ga0496115_0176656 | 3300048918 | Bacteria | 1766 |
| 728 | Ga0496116_0000178 | 3300048919 | Bacteria | 128023 |
| 729 | Ga0496117_0000047 | 3300048920 | Bacteria | 299632 |
| 730 | Ga0496117_0168470 | 3300048920 | Bacteria | 1274 |
| 731 | Ga0496118_0000050 | 3300048921 | Bacteria | 244124 |
| 732 | Ga0496118_0008356 | 3300048921 | Bacteria | 10713 |
| 733 | Ga0496118_0011438 | 3300048921 | Bacteria | 8663 |
| 734 | Ga0496119_0000282 | 3300048922 | Bacteria | 71403 |
| 735 | Ga0496119_0002385 | 3300048922 | Bacteria | 20639 |
| 736 | Ga0496119_0034976 | 3300048922 | Bacteria | 3298 |
| 737 | Ga0496119_0067751 | 3300048922 | Bacteria | 2104 |
| 738 | Ga0496120_0005229 | 3300048923 | Bacteria | 10437 |
| 739 | Ga0496120_0015037 | 3300048923 | Bacteria | 5122 |
| 740 | Ga0496121_0012441 | 3300048924 | Bacteria | 9276 |
| 741 | Ga0496121_0021347 | 3300048924 | Bacteria | 6346 |
| 742 | Ga0496121_0063525 | 3300048924 | Bacteria | 3016 |
| 743 | Ga0496121_0127132 | 3300048924 | Bacteria | 1914 |
| 744 | Ga0496124_0002610 | 3300048927 | Bacteria | 23269 |
| 745 | Ga0496125_0014400 | 3300048928 | Bacteria | 7704 |
| 746 | Ga0496125_0153318 | 3300048928 | Bacteria | 1578 |
| 747 | Ga0496126_0000035 | 3300048929 | Bacteria | 361590 |
| 748 | Ga0496126_0000049 | 3300048929 | Bacteria | 317568 |
| 749 | Ga0496126_0261585 | 3300048929 | Bacteria | 1439 |
| 750 | Ga0496126_0435814 | 3300048929 | Bacteria | 1057 |
| 751 | Ga0501031_0005989 | 3300049568 | Bacteria | 7936 |
| 752 | Ga0501031_0007602 | 3300049568 | Bacteria | 7055 |
| 753 | Ga0501031_0098997 | 3300049568 | Bacteria | 1903 |
| 754 | Ga0501031_0167089 | 3300049568 | Bacteria | 1438 |
| 755 | Ga0501032_0006469 | 3300049569 | Bacteria | 8613 |
| 756 | Ga0501032_0008926 | 3300049569 | Bacteria | 7291 |
| 757 | Ga0501032_0035355 | 3300049569 | Bacteria | 3416 |
| 758 | Ga0501033_0016066 | 3300049570 | Bacteria | 5669 |
| 759 | Ga0501034_0021106 | 3300049571 | Bacteria | 6645 |
| 760 | Ga0501034_0106394 | 3300049571 | Bacteria | 2798 |
| 761 | Ga0501034_0210079 | 3300049571 | Bacteria | 1902 |
| 762 | Ga0501036_0008213 | 3300049572 | Bacteria | 8559 |
| 763 | Ga0501036_0039300 | 3300049572 | Bacteria | 4004 |
| 764 | Ga0501036_0193946 | 3300049572 | Bacteria | 1709 |
| 765 | Ga0501037_0001694 | 3300049573 | Bacteria | 15996 |
| 766 | Ga0501037_0005598 | 3300049573 | Bacteria | 9156 |
| 767 | Ga0501037_0025874 | 3300049573 | Bacteria | 4334 |
| 768 | Ga0501038_0002018 | 3300049574 | Bacteria | 18735 |
| 769 | Ga0501038_0003778 | 3300049574 | Bacteria | 14089 |
| 770 | Ga0501038_0007747 | 3300049574 | Bacteria | 9899 |
| 771 | Ga0501038_0029765 | 3300049574 | Bacteria | 4835 |
| 772 | Ga0501038_0249692 | 3300049574 | Bacteria | 1406 |
| 773 | Ga0501039_0000657 | 3300049575 | Bacteria | 24951 |
| 774 | Ga0501039_0022492 | 3300049575 | Bacteria | 4839 |
| 775 | Ga0501039_0231914 | 3300049575 | Bacteria | 1451 |
| 776 | Ga0501043_0000892 | 3300049579 | Bacteria | 26475 |
| 777 | Ga0501043_0013080 | 3300049579 | Bacteria | 6485 |
| 778 | Ga0501043_0019115 | 3300049579 | Bacteria | 5378 |
| 779 | Ga0501043_0040479 | 3300049579 | Bacteria | 3663 |
| 780 | Ga0501046_0000654 | 3300049580 | Bacteria | 33712 |
| 781 | Ga0501046_0270638 | 3300049580 | Bacteria | 1246 |
| 782 | Ga0501047_0003422 | 3300049581 | Bacteria | 15003 |
| 783 | Ga0501047_0014792 | 3300049581 | Bacteria | 7427 |
| 784 | Ga0501048_0000381 | 3300049582 | Bacteria | 30814 |
| 785 | Ga0501048_0008071 | 3300049582 | Bacteria | 7969 |
| 786 | Ga0501067_0097653 | 3300049583 | Bacteria | 1631 |
| 787 | Ga0501069_0003392 | 3300049585 | Bacteria | 8179 |
| 788 | Ga0501069_0145499 | 3300049585 | Bacteria | 1360 |
| 789 | Ga0501070_0000501 | 3300049586 | Bacteria | 35639 |
| 790 | Ga0501070_0002238 | 3300049586 | Bacteria | 17001 |
| 791 | Ga0501070_0013330 | 3300049586 | Bacteria | 6933 |
| 792 | Ga0501070_0069041 | 3300049586 | Bacteria | 2926 |
| 793 | Ga0501070_0129855 | 3300049586 | Bacteria | 2082 |
| 794 | Ga0501070_0204323 | 3300049586 | Bacteria | 1622 |
| 795 | Ga0501073_0035859 | 3300049589 | Bacteria | 3524 |
| 796 | Ga0501074_0009352 | 3300049590 | Bacteria | 7119 |
| 797 | Ga0501077_0093511 | 3300049593 | Bacteria | 1906 |
| 798 | Ga0501080_0017196 | 3300049742 | Bacteria | 6681 |
| 799 | Ga0501080_0048838 | 3300049742 | Bacteria | 3937 |
| 800 | Ga0501080_0057948 | 3300049742 | Bacteria | 3606 |
| 801 | Ga0501083_0053977 | 3300049744 | Bacteria | 2697 |
| 802 | Ga0501035_0002060 | 3300049822 | Bacteria | 20007 |
| 803 | Ga0501035_0017415 | 3300049822 | Bacteria | 6626 |
| 804 | Ga0501035_0078120 | 3300049822 | Bacteria | 2925 |
| 805 | Ga0501035_0117217 | 3300049822 | Bacteria | 2330 |
| 806 | Ga0501044_0008159 | 3300049823 | Bacteria | 11491 |
| 807 | Ga0501044_0009614 | 3300049823 | Bacteria | 10522 |
| 808 | Ga0501044_0014121 | 3300049823 | Bacteria | 8622 |
| 809 | Ga0501044_0038244 | 3300049823 | Bacteria | 5011 |
| 810 | Ga0501044_0057269 | 3300049823 | Bacteria | 4000 |
| 811 | Ga0501044_0161978 | 3300049823 | Bacteria | 2213 |
| 812 | nmdc:mga03n38_203607_c1 | 3300050490 | Bacteria | 1025 |
| 813 | nmdc:mga03n38_28184_c1 | 3300050490 | Bacteria | 2338 |
| 814 | nmdc:mga00v17_108480_c1 | 3300050491 | Bacteria | 1759 |
| 815 | nmdc:mga06z11_3893_c1 | 3300050494 | Bacteria | 5820 |
| 816 | nmdc:mga04h51_56671_c1 | 3300050495 | Bacteria | 1331 |
| 817 | nmdc:mga05p37_490574_c1 | 3300050507 | Bacteria | 1412 |
| 818 | nmdc:mga08y16_150082_c1 | 3300050511 | Bacteria | 2423 |
| 819 | nmdc:mga08y16_5861_c1 | 3300050511 | Bacteria | 12873 |
| 820 | nmdc:mga0n895_14278_c1 | 3300050512 | Bacteria | 7207 |
| 821 | nmdc:mga0n895_98989_c1 | 3300050512 | Bacteria | 2924 |
| 822 | nmdc:mga0rr50_12687_c1 | 3300050513 | Bacteria | 5457 |
| 823 | nmdc:mga0rr50_58119_c1 | 3300050513 | Bacteria | 2897 |
| 824 | nmdc:mga0rr50_8525_c1 | 3300050513 | Bacteria | 6385 |
| 825 | nmdc:mga08x19_266283_c2 | 3300050514 | Bacteria | 861 |
| 826 | nmdc:mga08x19_70063_c1 | 3300050514 | Bacteria | 2284 |
| 827 | nmdc:mga0a205_27627_c1 | 3300050515 | Bacteria | 5419 |
| 828 | nmdc:mga0a205_9224_c1 | 3300050515 | Bacteria | 9008 |
| 829 | Ga0495601_0011742 | 3300053077 | Bacteria | 5251 |
| 830 | Ga0495612_0067601 | 3300053078 | Bacteria | 1486 |
| 831 | Ga0495655_0017871 | 3300053083 | Bacteria | 1551 |
| 832 | Ga0495619_0007926 | 3300053085 | Bacteria | 6721 |
| 833 | Ga0500644_0026394 | 3300053088 | Bacteria | 1797 |
| 834 | Ga0500640_015826 | 3300053095 | Bacteria | 3169 |
| 835 | Ga0500650_0094620 | 3300053098 | Bacteria | 1399 |
| 836 | Ga0500553_114257 | 3300053101 | Bacteria | 1128 |
| 837 | Ga0500560_052613 | 3300053107 | Bacteria | 1310 |
| 838 | Ga0500569_000878 | 3300053109 | Bacteria | 5360 |
| 839 | Ga0500614_043272 | 3300053123 | Bacteria | 1154 |
| 840 | Ga0500628_001434 | 3300053129 | Bacteria | 4082 |
| 841 | Ga0500652_001624 | 3300053131 | Bacteria | 6840 |
| 842 | Ga0500577_0019326 | 3300053142 | Bacteria | 2207 |
| 843 | Ga0500579_089215 | 3300053143 | Bacteria | 1676 |
| 844 | Ga0500616_0075318 | 3300053153 | Bacteria | 1708 |
| 845 | Ga0500624_016633 | 3300053157 | Bacteria | 1138 |
| 846 | Ga0500634_0047354 | 3300053161 | Bacteria | 2321 |
| 847 | Ga0500656_011440 | 3300053732 | Bacteria | 987 |
| 848 | Ga0501084_0017976 | 3300054114 | Bacteria | 5887 |
| 849 | Ga0466962_0015906 | 3300061719 | Bacteria | 3631 |
| 850 | Ga0466962_0025539 | 3300061719 | Bacteria | 2836 |
| 851 | Ga0466962_0029088 | 3300061719 | Bacteria | 2644 |
| 852 | Ga0466962_0039728 | 3300061719 | Bacteria | 2253 |
| 853 | Ga0466962_0071139 | 3300061719 | Bacteria | 1662 |
| 854 | 2508672339 | 2508501039 | Bacteria | 9978592 |
| 855 | 2547408617 | 2547132111 | Bacteria | 8013147 |
| 856 | 2548698702 | 2547132424 | Bacteria | 8348532 |
| 857 | 2552110360 | 2551306166 | Bacteria | 9731570 |
| 858 | 2559426995 | 2558860280 | Bacteria | 11429938 |
| 859 | 2566997347 | 2565956761 | Bacteria | 6601618 |
| 860 | 2583152310 | 2582580736 | Bacteria | 5325865 |
| 861 | 2585296361 | 2582581312 | Bacteria | 7308206 |
| 862 | 2585320526 | 2582581314 | Bacteria | 11452267 |
| 863 | 2616900149 | 2616644941 | Bacteria | 8510691 |
| 864 | 2623500553 | 2622736605 | Bacteria | 4992138 |
| 865 | 2643902504 | 2643221578 | Bacteria | 9213798 |
| 866 | 2643941565 | 2643221587 | Bacteria | 7586415 |
| 867 | 2644017489 | 2643221601 | Bacteria | 7493239 |
| 868 | 2644173549 | 2643221631 | Bacteria | 8168043 |
| 869 | 2644263672 | 2643221647 | Bacteria | 10741251 |
| 870 | 2644386666 | 2643221670 | Bacteria | 6497041 |
| 871 | 2644404075 | 2643221673 | Bacteria | 9196637 |
| 872 | 2644428649 | 2643221677 | Bacteria | 7584031 |
| 873 | 2644513696 | 2643221692 | Bacteria | 7282860 |
| 874 | 2644632880 | 2643221714 | Bacteria | 9015452 |
| 875 | 2689961122 | 2687453737 | Bacteria | 11203906 |
| 876 | 2738888094 | 2738541308 | Bacteria | 7020677 |
| 877 | 2739238576 | 2738543011 | Bacteria | 5731169 |
| 878 | 2776369542 | 2775506925 | Bacteria | 7237746 |
| 879 | 2784590182 | 2784132148 | Bacteria | 8627943 |
| 880 | 2785371235 | 2784746768 | Bacteria | 10036182 |
| 881 | 2786672420 | 2786546132 | Bacteria | 10419719 |
| 882 | 2791913962 | 2791354901 | Bacteria | 8322202 |
| 883 | 2793984559 | 2791355406 | Bacteria | 11364898 |
| 884 | 2808843799 | 2808606359 | Bacteria | 9866990 |
| 885 | 2809233854 | 2808606448 | Bacteria | 8656184 |
| 886 | 2812478991 | 2811994917 | Bacteria | 7761064 |
| 887 | 2819694849 | 2818991463 | Bacteria | 7948711 |
| 888 | 2819740835 | 2818991472 | Bacteria | 10089953 |
| 889 | 2852642032 | 2852635781 | Bacteria | 8251373 |
| 890 | 2856748408 | 2856741275 | Bacteria | 8096094 |
| 891 | 2862179213 | 2862178590 | Bacteria | 8583590 |
| 892 | 2862577763 | 2862574272 | Bacteria | 10567477 |
| 893 | 2863068925 | 2863067949 | Bacteria | 8541735 |
| 894 | 2866553055 | 2866552031 | Bacteria | 5824618 |
| 895 | 2867428680 | 2867428634 | Bacteria | 9590268 |
| 896 | 2873154285 | 2873151551 | Bacteria | 8625867 |
| 897 | 2873316901 | 2873314349 | Bacteria | 8512634 |
| 898 | 2875396451 | 2875391855 | Bacteria | 7600475 |
| 899 | 2877679364 | 2877676314 | Bacteria | 9512378 |
| 900 | 2889303010 | 2889300758 | Bacteria | 5690814 |
| 901 | 2891399478 | 2891395885 | Bacteria | 9251614 |
| 902 | 2891560739 | 2891554331 | Bacteria | 8812224 |
| 903 | 2891564250 | 2891562705 | Bacteria | 8039471 |
| 904 | 2899360206 | 2899359706 | Bacteria | 10940472 |
| 905 | 2904538276 | 2904535858 | Bacteria | 6308016 |
| 906 | 2912762521 | 2912757875 | Bacteria | 7940295 |
| 907 | 2918506247 | 2918501144 | Bacteria | 8668083 |
| 908 | 2919719378 | 2919713450 | Bacteria | 7431245 |
| 909 | 2922557468 | 2922554459 | Bacteria | 6683962 |
| 910 | 2928145654 | 2928142448 | Bacteria | 5288925 |
| 911 | 2935391585 | 2935390628 | Bacteria | 7043367 |
| 912 | 2939746112 | 2939743619 | Bacteria | 5762299 |
| 913 | 2946048106 | 2946045630 | Bacteria | 8527308 |
| 914 | 2946077511 | 2946072368 | Bacteria | 8999607 |
| 915 | 2947227199 | 2947224130 | Bacteria | 9938529 |
| 916 | 2954384253 | 2954380949 | Bacteria | 10050426 |
| 917 | 2954678693 | 2954673503 | Bacteria | 9685905 |
| 918 | 2954685463 | 2954682443 | Bacteria | 9862841 |
| 919 | 2954695075 | 2954691527 | Bacteria | 10720516 |
| 920 | 2954710249 | 2954701450 | Bacteria | 10834262 |
| 921 | 2954714566 | 2954711539 | Bacteria | 10867210 |
| 922 | 2954724511 | 2954721474 | Bacteria | 10456478 |
| 923 | 2954737308 | 2954731030 | Bacteria | 10243860 |
| 924 | 2954743432 | 2954740390 | Bacteria | 10229294 |
| 925 | 2954756158 | 2954749733 | Bacteria | 10366972 |
| 926 | 2954762389 | 2954759201 | Bacteria | 9358192 |
| 927 | 2956941309 | 2956939328 | Bacteria | 3474458 |
| 928 | 2966601085 | 2966598605 | Bacteria | 7676064 |
| 929 | 2990065309 | 2990059506 | Bacteria | 9321252 |
| 930 | 2997603106 | 2997600082 | Bacteria | 9896405 |
| 931 | 3006398177 | 3006393351 | Bacteria | 6615579 |
| 932 | 3006487761 | 3006486233 | Bacteria | 8157040 |
| 933 | 8003320431 | 8003314358 | Bacteria | 10575343 |
| 934 | 8023624817 | 8023623736 | Bacteria | 8593882 |
| 935 | 8025537508 | 8025530807 | Bacteria | 8495698 |
| 936 | 8047715123 | 8047710418 | Bacteria | 11023148 |
| 937 | 8047896375 | 8047893842 | Bacteria | 11723082 |
| 938 | 8048133785 | 8048127548 | Bacteria | 11053136 |
| 939 | 8048362561 | 8048356638 | Bacteria | 11044339 |
| 940 | 8048373384 | 8048369669 | Bacteria | 11666822 |
| 941 | 8048384858 | 8048379754 | Bacteria | 11877923 |
| 942 | 8055177356 | 8055172936 | Bacteria | 9305943 |
| 943 | 8056215346 | 8056207758 | Bacteria | 8639239 |
| 944 | 8056831906 | 8056829672 | Bacteria | 9045328 |
| 945 | Ga0466971_0043414 | |||
| 946 | JGI24737J22298_10060831 | |||
| 947 | JGI25406J46586_10019790 | |||
| 948 | rootH1_10006175 | |||
| 949 | JGI25405J52794_10038489 | |||
| 950 | Ga0070658_10001015 | |||
| 951 | Ga0070658_10252342 | |||
| 952 | Ga0070658_10492190 | |||
| 953 | Ga0070676_10045712 | |||
| 954 | Ga0070683_100079895 | |||
| 955 | Ga0070683_100286674 | |||
| 956 | Ga0070683_100339828 | |||
| 957 | Ga0070670_100276699 | |||
| 958 | Ga0068869_100116031 | |||
| 959 | Ga0070666_10008623 | |||
| 960 | Ga0070666_10161872 | |||
| 961 | Ga0070666_10422881 | |||
| 962 | Ga0070680_100028244 | |||
| 963 | Ga0070682_100061158 | |||
| 964 | Ga0070682_100548989 | |||
| 965 | Ga0068868_100036941 | |||
| 966 | Ga0068868_100133992 | |||
| 967 | Ga0068868_100444425 | |||
| 968 | Ga0070660_100128076 | |||
| 969 | Ga0070660_100227953 | |||
| 970 | Ga0070687_100052515 | |||
| 971 | Ga0070687_100361637 | |||
| 972 | Ga0070661_100102507 | |||
| 973 | Ga0070661_100115090 | |||
| 974 | Ga0070692_10023965 | |||
| 975 | Ga0070692_10056976 | |||
| 976 | Ga0070668_100016248 | |||
| 977 | Ga0070668_100025772 | |||
| 978 | Ga0070668_100434606 | |||
| 979 | Ga0070675_100008437 | |||
| 980 | Ga0070671_100003983 | |||
| 981 | Ga0070671_100027438 | |||
| 982 | Ga0070671_100162474 | |||
| 983 | Ga0070671_100346759 | |||
| 984 | Ga0070674_100057240 | |||
| 985 | Ga0070673_100232589 | |||
| 986 | Ga0070673_100446265 | |||
| 987 | Ga0070688_100064615 | |||
| 988 | Ga0070688_100279342 | |||
| 989 | Ga0070688_100381755 | |||
| 990 | Ga0070659_100070520 | |||
| 991 | Ga0070667_100001309 | |||
| 992 | Ga0070667_100091665 | |||
| 993 | Ga0070709_10068498 | |||
| 994 | Ga0070714_100000100 | |||
| 995 | Ga0070714_100017702 | |||
| 996 | Ga0070714_100061727 | |||
| 997 | Ga0070714_100311233 | |||
| 998 | Ga0070714_100543260 | |||
| 999 | Ga0070714_100743673 | |||
| 1000 | Ga0070713_100005229 | |||
| 1001 | Ga0070710_10034403 | |||
| 1002 | Ga0070701_10033291 | |||
| 1003 | Ga0070705_100050318 | |||
| 1004 | Ga0070700_100000031 | |||
| 1005 | Ga0070700_100147240 | |||
| 1006 | Ga0070700_100166530 | |||
| 1007 | Ga0070708_100002967 | |||
| 1008 | Ga0070663_100016604 | |||
| 1009 | Ga0070663_100129984 | |||
| 1010 | Ga0070663_100216988 | |||
| 1011 | Ga0070662_100142835 | |||
| 1012 | Ga0070681_10412195 | |||
| 1013 | Ga0070685_10023086 | |||
| 1014 | Ga0070685_10055386 | |||
| 1015 | Ga0070685_10192324 | |||
| 1016 | Ga0070707_100141840 | |||
| 1017 | Ga0070698_100006387 | |||
| 1018 | Ga0070699_100001284 | |||
| 1019 | Ga0070679_100059205 | |||
| 1020 | Ga0070684_100114415 | |||
| 1021 | Ga0070697_100000091 | |||
| 1022 | Ga0070697_100129375 | |||
| 1023 | Ga0068853_100030282 | |||
| 1024 | Ga0068853_100206439 | |||
| 1025 | Ga0068853_100231490 | |||
| 1026 | Ga0070672_100183879 | |||
| 1027 | Ga0070686_100088401 | |||
| 1028 | Ga0070695_100057148 | |||
| 1029 | Ga0070696_100136059 | |||
| 1030 | Ga0070693_100139007 | |||
| 1031 | Ga0070693_100303832 | |||
| 1032 | Ga0070665_100001318 | |||
| 1033 | Ga0070665_100001778 | |||
| 1034 | Ga0070665_100059933 | |||
| 1035 | Ga0070704_100015882 | |||
| 1036 | Ga0068855_100072469 | |||
| 1037 | Ga0068855_100284929 | |||
| 1038 | Ga0070664_100051540 | |||
| 1039 | Ga0068857_100194794 | |||
| 1040 | Ga0068857_100587409 | |||
| 1041 | Ga0068857_100785111 | |||
| 1042 | Ga0068854_100047859 | |||
| 1043 | Ga0068854_100183874 | |||
| 1044 | Ga0068856_100087034 | |||
| 1045 | Ga0068856_100153862 | |||
| 1046 | Ga0068856_100231753 | |||
| 1047 | Ga0070702_100001774 | |||
| 1048 | Ga0070702_100015779 | |||
| 1049 | Ga0068852_100145156 | |||
| 1050 | Ga0068859_100000301 | |||
| 1051 | Ga0068859_100020832 | |||
| 1052 | Ga0068859_100217642 | |||
| 1053 | Ga0068864_100018929 | |||
| 1054 | Ga0068864_100066037 | |||
| 1055 | Ga0068866_10033019 | |||
| 1056 | Ga0068861_100046303 | |||
| 1057 | Ga0068861_100047337 | |||
| 1058 | Ga0068851_10010306 | |||
| 1059 | Ga0068870_10003104 | |||
| 1060 | Ga0068863_100009162 | |||
| 1061 | Ga0068863_100018933 | |||
| 1062 | Ga0068863_100043788 | |||
| 1063 | Ga0068863_100069549 | |||
| 1064 | Ga0068858_100000010 | |||
| 1065 | Ga0068858_100005725 | |||
| 1066 | Ga0068858_100071489 | |||
| 1067 | Ga0068860_100000345 | |||
| 1068 | Ga0068860_100053734 | |||
| 1069 | Ga0068862_100000049 | |||
| 1070 | Ga0081455_10000288 | |||
| 1071 | Ga0081455_10064419 | |||
| 1072 | Ga0081455_10146576 | |||
| 1073 | Ga0081540_1053513 | |||
| 1074 | Ga0081540_1063423 | |||
| 1075 | Ga0081539_10000264 | |||
| 1076 | Ga0070717_10067839 | |||
| 1077 | Ga0070717_10111451 | |||
| 1078 | Ga0070717_10336328 | |||
| 1079 | Ga0075365_10008217 | |||
| 1080 | Ga0075363_100002322 | |||
| 1081 | Ga0075363_100006033 | |||
| 1082 | Ga0070716_100032422 | |||
| 1083 | Ga0070712_100042524 | |||
| 1084 | Ga0070712_100066508 | |||
| 1085 | Ga0070712_100085027 | |||
| 1086 | Ga0075367_10000660 | |||
| 1087 | Ga0075370_10035099 | |||
| 1088 | Ga0075370_10273424 | |||
| 1089 | Ga0068871_100021131 | |||
| 1090 | Ga0068871_100322577 | |||
| 1091 | Ga0075428_100052509 | |||
| 1092 | Ga0075428_100452187 | |||
| 1093 | Ga0075433_10019058 | |||
| 1094 | Ga0075433_10263218 | |||
| 1095 | Ga0075434_100023900 | |||
| 1096 | Ga0075434_100361505 | |||
| 1097 | Ga0068865_100223713 | |||
| 1098 | Ga0075436_100007073 | |||
| 1099 | Ga0075436_100119180 | |||
| 1100 | Ga0097620_100000301 | |||
| 1101 | Ga0097620_100020832 | |||
| 1102 | Ga0097620_100217640 | |||
| 1103 | Ga0099826_10020443 | |||
| 1104 | Ga0075435_100022015 | |||
| 1105 | Ga0075435_100213934 | |||
| 1106 | Ga0075435_100252376 | |||
| 1107 | Ga0105251_10065767 | |||
| 1108 | Ga0105250_10029863 | |||
| 1109 | Ga0105240_10803250 | |||
| 1110 | Ga0111539_10053625 | |||
| 1111 | Ga0111539_10114393 | |||
| 1112 | Ga0105245_10576320 | |||
| 1113 | Ga0105247_10007071 | |||
| 1114 | Ga0105247_10038610 | |||
| 1115 | Ga0105247_10306477 | |||
| 1116 | Ga0114129_10100201 | |||
| 1117 | Ga0114129_10116178 | |||
| 1118 | Ga0105243_10000243 | |||
| 1119 | Ga0105243_10045452 | |||
| 1120 | Ga0105241_10026313 | |||
| 1121 | Ga0105242_10094485 | |||
| 1122 | Ga0105248_10153591 | |||
| 1123 | Ga0105237_10038461 | |||
| 1124 | Ga0105237_10132325 | |||
| 1125 | Ga0105237_10156852 | |||
| 1126 | Ga0105237_10270548 | |||
| 1127 | Ga0105238_10129979 | |||
| 1128 | Ga0105238_10288052 | |||
| 1129 | Ga0105238_10550258 | |||
| 1130 | Ga0105249_10478596 | |||
| 1131 | Ga0105239_10388408 | |||
| 1132 | Ga0105239_10417463 | |||
| 1133 | Ga0105239_10587519 | |||
| 1134 | Ga0105246_10001918 | |||
| 1135 | Ga0105246_10008217 | |||
| 1136 | Ga0105246_10041194 | |||
| 1137 | Ga0157371_10125415 | |||
| 1138 | Ga0157370_10060912 | |||
| 1139 | Ga0157370_10194996 | |||
| 1140 | Ga0157369_10115850 | |||
| 1141 | Ga0157369_10173857 | |||
| 1142 | Ga0157369_10233373 | |||
| 1143 | Ga0157369_10255873 | |||
| 1144 | Ga0157374_10029965 | |||
| 1145 | Ga0157374_10032344 | |||
| 1146 | Ga0163162_10132038 | |||
| 1147 | Ga0163162_10184222 | |||
| 1148 | Ga0157372_10068459 | |||
| 1149 | Ga0157372_10302497 | |||
| 1150 | Ga0157372_10617201 | |||
| 1151 | Ga0157375_10092365 | |||
| 1152 | Ga0157375_10125964 | |||
| 1153 | Ga0163163_10139294 | |||
| 1154 | Ga0163163_10672806 | |||
| 1155 | Ga0157380_10115247 | |||
| 1156 | Ga0182008_10002554 | |||
| 1157 | Ga0157377_10035563 | |||
| 1158 | Ga0157377_10053373 | |||
| 1159 | Ga0157377_10053669 | |||
| 1160 | Ga0157379_10000149 | |||
| 1161 | Ga0157379_10120173 | |||
| 1162 | Ga0157376_10147187 | |||
| 1163 | Ga0157376_10202868 | |||
| 1164 | Ga0182007_10000334 | |||
| 1165 | Ga0163161_10041940 | |||
| 1166 | Ga0206356_10503846 | |||
| 1167 | Ga0213876_10007115 | |||
| 1168 | Ga0224712_10106061 | |||
| 1169 | Ga0209758_1003976 | |||
| 1170 | Ga0207426_1017545 | |||
| 1171 | Ga0207656_10013812 | |||
| 1172 | Ga0207656_10089094 | |||
| 1173 | Ga0207696_1038022 | |||
| 1174 | Ga0207692_10025015 | |||
| 1175 | Ga0207692_10043686 | |||
| 1176 | Ga0207692_10139781 | |||
| 1177 | Ga0207710_10000144 | |||
| 1178 | Ga0207710_10143217 | |||
| 1179 | Ga0207688_10001356 | |||
| 1180 | Ga0207688_10003164 | |||
| 1181 | Ga0207688_10266247 | |||
| 1182 | Ga0207680_10039159 | |||
| 1183 | Ga0207680_10082225 | |||
| 1184 | Ga0207647_10037810 | |||
| 1185 | Ga0207647_10187038 | |||
| 1186 | Ga0207647_10190259 | |||
| 1187 | Ga0207685_10025122 | |||
| 1188 | Ga0207643_10000252 | |||
| 1189 | Ga0207705_10002366 | |||
| 1190 | Ga0207654_10006100 | |||
| 1191 | Ga0207707_10200932 | |||
| 1192 | Ga0207695_10073573 | |||
| 1193 | Ga0207695_10080382 | |||
| 1194 | Ga0207671_10058806 | |||
| 1195 | Ga0207671_10222164 | |||
| 1196 | Ga0207693_10009301 | |||
| 1197 | Ga0207693_10049796 | |||
| 1198 | Ga0207663_10095356 | |||
| 1199 | Ga0207660_10031910 | |||
| 1200 | Ga0207662_10018036 | |||
| 1201 | Ga0207662_10164150 | |||
| 1202 | Ga0207662_10343143 | |||
| 1203 | Ga0207657_10010073 | |||
| 1204 | Ga0207657_10012261 | |||
| 1205 | Ga0207657_10200018 | |||
| 1206 | Ga0207649_10002137 | |||
| 1207 | Ga0207649_10058183 | |||
| 1208 | Ga0207652_10025670 | |||
| 1209 | Ga0207652_10122491 | |||
| 1210 | Ga0207652_10175872 | |||
| 1211 | Ga0207652_10187850 | |||
| 1212 | Ga0207646_10028568 | |||
| 1213 | Ga0207681_10218004 | |||
| 1214 | Ga0207681_10277224 | |||
| 1215 | Ga0207694_10233955 | |||
| 1216 | Ga0207650_10009635 | |||
| 1217 | Ga0207687_10092593 | |||
| 1218 | Ga0207687_10343834 | |||
| 1219 | Ga0207700_10033600 | |||
| 1220 | Ga0207700_10061946 | |||
| 1221 | Ga0207700_10250365 | |||
| 1222 | Ga0207664_10000002 | |||
| 1223 | Ga0207664_10006938 | |||
| 1224 | Ga0207664_10008947 | |||
| 1225 | Ga0207664_10260722 | |||
| 1226 | Ga0207644_10002584 | |||
| 1227 | Ga0207644_10048594 | |||
| 1228 | Ga0207644_10072727 | |||
| 1229 | Ga0207644_10119981 | |||
| 1230 | Ga0207690_10041704 | |||
| 1231 | Ga0207690_10064973 | |||
| 1232 | Ga0207706_10009589 | |||
| 1233 | Ga0207706_10035354 | |||
| 1234 | Ga0207709_10002717 | |||
| 1235 | Ga0207709_10092851 | |||
| 1236 | Ga0207709_10121916 | |||
| 1237 | Ga0207709_10339800 | |||
| 1238 | Ga0207670_10138640 | |||
| 1239 | Ga0207665_10002753 | |||
| 1240 | Ga0207691_10022185 | |||
| 1241 | Ga0207711_10046215 | |||
| 1242 | Ga0207689_10005533 | |||
| 1243 | Ga0207689_10232061 | |||
| 1244 | Ga0207661_10071196 | |||
| 1245 | Ga0207679_10012227 | |||
| 1246 | Ga0207679_10239670 | |||
| 1247 | Ga0207667_10115963 | |||
| 1248 | Ga0207651_10359734 | |||
| 1249 | Ga0207712_10009452 | |||
| 1250 | Ga0207668_10025359 | |||
| 1251 | Ga0207668_10116325 | |||
| 1252 | Ga0207640_10019589 | |||
| 1253 | Ga0207640_10220535 | |||
| 1254 | Ga0207658_10012115 | |||
| 1255 | Ga0207658_10183119 | |||
| 1256 | Ga0207677_10020671 | |||
| 1257 | Ga0207677_10260531 | |||
| 1258 | Ga0207703_10000002 | |||
| 1259 | Ga0207703_10012943 | |||
| 1260 | Ga0207639_10021736 | |||
| 1261 | Ga0207639_10069225 | |||
| 1262 | Ga0207639_10289699 | |||
| 1263 | Ga0207639_10421915 | |||
| 1264 | Ga0207678_10001004 | |||
| 1265 | Ga0207678_10001822 | |||
| 1266 | Ga0207678_10018860 | |||
| 1267 | Ga0207678_10048568 | |||
| 1268 | Ga0207678_10060503 | |||
| 1269 | Ga0207678_10154687 | |||
| 1270 | Ga0207708_10000046 | |||
| 1271 | Ga0207708_10152453 | |||
| 1272 | Ga0207708_10185609 | |||
| 1273 | Ga0207702_10198124 | |||
| 1274 | Ga0207702_10204785 | |||
| 1275 | Ga0207702_10243320 | |||
| 1276 | Ga0207641_10000562 | |||
| 1277 | Ga0207641_10013676 | |||
| 1278 | Ga0207641_10032803 | |||
| 1279 | Ga0207648_10147379 | |||
| 1280 | Ga0207676_10006835 | |||
| 1281 | Ga0207676_10063826 | |||
| 1282 | Ga0207674_10112320 | |||
| 1283 | Ga0207674_10212373 | |||
| 1284 | Ga0207674_10458356 | |||
| 1285 | Ga0207675_100042012 | |||
| 1286 | Ga0207675_100066284 | |||
| 1287 | Ga0207675_100098113 | |||
| 1288 | Ga0207683_10000558 | |||
| 1289 | Ga0207683_10015426 | |||
| 1290 | Ga0207683_10127920 | |||
| 1291 | Ga0207683_10352822 | |||
| 1292 | Ga0207683_10611900 | |||
| 1293 | Ga0207698_10004323 | |||
| 1294 | Ga0207698_10782199 | |||
| 1295 | Ga0209813_10048246 | |||
| 1296 | Ga0207428_10022350 | |||
| 1297 | Ga0268266_10001153 | |||
| 1298 | Ga0268266_10002138 | |||
| 1299 | Ga0268266_10015037 | |||
| 1300 | Ga0268266_10059472 | |||
| 1301 | Ga0268266_10343148 | |||
| 1302 | Ga0268266_10343862 | |||
| 1303 | Ga0268265_10000017 | |||
| 1304 | Ga0268264_10000257 | |||
| 1305 | Ga0268264_10050028 | |||
| 1306 | Ga0268264_10236062 | |||
| 1307 | Ga0307517_10001322 | |||
| 1308 | Ga0307515_10001617 | |||
| 1309 | Ga0307515_10018584 | |||
| 1310 | Ga0307511_10014203 | |||
| 1311 | Ga0307511_10015988 | |||
| 1312 | Ga0307511_10103887 | |||
| 1313 | Ga0307512_10088477 | |||
| 1314 | Ga0307512_10096313 | |||
| 1315 | Ga0307512_10233202 | |||
| 1316 | Ga0307513_10018434 | |||
| 1317 | Ga0307513_10097245 | |||
| 1318 | Ga0307513_10133134 | |||
| 1319 | Ga0307408_100232614 | |||
| 1320 | Ga0307508_10004580 | |||
| 1321 | Ga0307508_10008424 | |||
| 1322 | Ga0307508_10058061 | |||
| 1323 | Ga0307508_10132343 | |||
| 1324 | Ga0307514_10033526 | |||
| 1325 | Ga0307514_10070706 | |||
| 1326 | Ga0316575_10000188 | |||
| 1327 | Ga0316579_10000152 | |||
| 1328 | Ga0307516_10006178 | |||
| 1329 | Ga0307516_10012725 | |||
| 1330 | Ga0307516_10097243 | |||
| 1331 | Ga0307405_10030057 | |||
| 1332 | Ga0307405_10498208 | |||
| 1333 | Ga0307413_10000397 | |||
| 1334 | Ga0307518_10021528 | |||
| 1335 | Ga0307518_10056846 | |||
| 1336 | Ga0307518_10116595 | |||
| 1337 | Ga0307410_10097722 | |||
| 1338 | Ga0307410_10121215 | |||
| 1339 | Ga0307410_10141318 | |||
| 1340 | Ga0307406_10396017 | |||
| 1341 | Ga0307407_10048623 | |||
| 1342 | Ga0307412_10140787 | |||
| 1343 | Ga0307409_100082227 | |||
| 1344 | Ga0307409_100196908 | |||
| 1345 | Ga0307409_100226173 | |||
| 1346 | Ga0307409_100412309 | |||
| 1347 | Ga0307416_100066850 | |||
| 1348 | Ga0307416_100156355 | |||
| 1349 | Ga0307416_100175660 | |||
| 1350 | Ga0307414_10041944 | |||
| 1351 | Ga0307414_10198057 | |||
| 1352 | Ga0307414_10307901 | |||
| 1353 | Ga0307411_10000834 | |||
| 1354 | Ga0307415_100029462 | |||
| 1355 | Ga0307415_100044494 | |||
| 1356 | Ga0307415_100089823 | |||
| 1357 | Ga0307415_100123812 | |||
| 1358 | Ga0307507_10012000 | |||
| 1359 | Ga0307507_10035253 | |||
| 1360 | Ga0307507_10093060 | |||
| 1361 | Ga0307510_10021098 | |||
| 1362 | Ga0373938_0007234 | |||
| 1363 | Ga0373940_0012856 | |||
| 1364 | Ga0373952_0017842 | |||
| 1365 | Ga0373962_0029601 | |||
| 1366 | Ga0373935_0081945 | |||
| 1367 | Ga0395899_0125501 | |||
| 1368 | Ga0395900_0007073 | |||
| 1369 | Ga0395900_0024205 | |||
| 1370 | Ga0395898_0023756 | |||
| 1371 | Ga0395898_0098937 | |||
| 1372 | Ga0395898_0156194 | |||
| 1373 | Ga0395898_0213649 | |||
| 1374 | Ga0395905_0207323 | |||
| 1375 | Ga0395905_0269320 | |||
| 1376 | Ga0436364_0258245 | |||
| 1377 | Ga0395901_0028766 | |||
| 1378 | Ga0395901_0134713 | |||
| 1379 | Ga0395901_0220969 | |||
| 1380 | Ga0395901_0443076 | |||
| 1381 | Ga0395901_0545732 | |||
| 1382 | Ga0400488_61512 | |||
| 1383 | Ga0436365_1887167 | |||
| 1384 | Ga0439436_0001917 | |||
| 1385 | Ga0451789_0233241 | |||
| 1386 | Ga0451791_1666820 | |||
| 1387 | Ga0451793_0152285 | |||
| 1388 | Ga0451793_0933570 | |||
| 1389 | Ga0451797_0077001 | |||
| 1390 | Ga0451795_0115662 | |||
| 1391 | Ga0451807_0323001 | |||
| 1392 | Ga0451833_0187408 | |||
| 1393 | Ga0451839_0525567 | |||
| 1394 | Ga0451843_0137783 | |||
| 1395 | Ga0451853_1285162 | |||
| 1396 | Ga0451853_1868916 | |||
| 1397 | Ga0439448_0013296 | |||
| 1398 | Ga0439448_0099900 | |||
| 1399 | Ga0439432_032338 | |||
| 1400 | Ga0439449_0020532 | |||
| 1401 | Ga0439449_0023382 | |||
| 1402 | Ga0439450_004963 | |||
| 1403 | Ga0439450_010526 | |||
| 1404 | Ga0439455_0000667 | |||
| 1405 | Ga0439455_0004610 | |||
| 1406 | Ga0439462_0003587 | |||
| 1407 | Ga0450900_005059 | |||
| 1408 | Ga0450903_001837 | |||
| 1409 | Ga0439458_0004762 | |||
| 1410 | Ga0439458_0011123 | |||
| 1411 | Ga0466969_0011684 | |||
| 1412 | Ga0466969_0044624 | |||
| 1413 | Ga0466969_0062577 | |||
| 1414 | Ga0466969_0095635 | |||
| 1415 | Ga0466972_0002655 | |||
| 1416 | Ga0466972_0005010 | |||
| 1417 | Ga0466972_0025454 | |||
| 1418 | Ga0466972_0079018 | |||
| 1419 | Ga0466965_0002418 | |||
| 1420 | Ga0466965_0004870 | |||
| 1421 | Ga0466965_0031342 | |||
| 1422 | Ga0466965_0327546 | |||
| 1423 | Ga0466966_0001756 | |||
| 1424 | Ga0466966_0008783 | |||
| 1425 | Ga0466966_0013564 | |||
| 1426 | Ga0466966_0020421 | |||
| 1427 | Ga0466966_0068773 | |||
| 1428 | Ga0466966_0076252 | |||
| 1429 | Ga0466966_0158130 | |||
| 1430 | Ga0466966_0173161 | |||
| 1431 | Ga0466966_0429360 | |||
| 1432 | Ga0466961_0008517 | |||
| 1433 | Ga0466961_0010592 | |||
| 1434 | Ga0466961_0013345 | |||
| 1435 | Ga0466961_0039615 | |||
| 1436 | Ga0466961_0047153 | |||
| 1437 | Ga0466961_0047314 | |||
| 1438 | Ga0466961_0093420 | |||
| 1439 | Ga0466963_0009248 | |||
| 1440 | Ga0466963_0033174 | |||
| 1441 | Ga0466963_0039416 | |||
| 1442 | Ga0466963_0075213 | |||
| 1443 | Ga0466963_0098206 | |||
| 1444 | Ga0466963_0111050 | |||
| 1445 | Ga0466963_0182849 | |||
| 1446 | Ga0466964_0073909 | |||
| 1447 | Ga0466971_0006460 | |||
| 1448 | Ga0466971_0008220 | |||
| 1449 | Ga0466971_0095635 | |||
| 1450 | Ga0466971_0113621 | |||
| 1451 | Ga0466968_0000884 | |||
| 1452 | Ga0466970_0001549 | |||
| 1453 | Ga0466970_0007752 | |||
| 1454 | Ga0466970_0011340 | |||
| 1455 | Ga0466970_0019253 | |||
| 1456 | Ga0466970_0039231 | |||
| 1457 | Ga0466970_0126864 | |||
| 1458 | Ga0466970_0134343 | |||
| 1459 | Ga0466957_0011648 | |||
| 1460 | Ga0466957_0046347 | |||
| 1461 | Ga0466957_0052018 | |||
| 1462 | Ga0466957_0071896 | |||
| 1463 | Ga0466957_0080966 | |||
| 1464 | Ga0466957_0129261 | |||
| 1465 | Ga0466957_0188681 | |||
| 1466 | Ga0466957_0226808 | |||
| 1467 | Ga0466957_0233827 | |||
| 1468 | Ga0466957_0315027 | |||
| 1469 | Ga0466957_0436844 | |||
| 1470 | Ga0466960_0016299 | |||
| 1471 | Ga0466960_0023319 | |||
| 1472 | Ga0466960_0061159 | |||
| 1473 | Ga0466960_0065233 | |||
| 1474 | Ga0466960_0115723 | |||
| 1475 | Ga0466960_0137163 | |||
| 1476 | Ga0466960_0268112 | |||
| 1477 | Ga0466959_0018880 | |||
| 1478 | Ga0466959_0031761 | |||
| 1479 | Ga0466959_0033724 | |||
| 1480 | Ga0466959_0114609 | |||
| 1481 | Ga0466959_0174163 | |||
| 1482 | Ga0466959_0183643 | |||
| 1483 | Ga0466959_0218696 | |||
| 1484 | Ga0466959_0334710 | |||
| 1485 | Ga0466958_0001720 | |||
| 1486 | Ga0466958_0023859 | |||
| 1487 | Ga0466958_0033524 | |||
| 1488 | Ga0466958_0045697 | |||
| 1489 | Ga0466958_0063722 | |||
| 1490 | Ga0466958_0083979 | |||
| 1491 | Ga0466958_0198550 | |||
| 1492 | Ga0466958_0268228 | |||
| 1493 | Ga0466967_0002943 | |||
| 1494 | Ga0466967_0004674 | |||
| 1495 | Ga0466967_0005415 | |||
| 1496 | Ga0466967_0009957 | |||
| 1497 | Ga0466967_0029087 | |||
| 1498 | Ga0466967_0029383 | |||
| 1499 | Ga0466967_0053312 | |||
| 1500 | Ga0466967_0076000 | |||
| 1501 | Ga0466967_0148301 | |||
| 1502 | Ga0466967_0252137 | |||
| 1503 | Ga0466967_0296708 | |||
| 1504 | Ga0466967_0580205 | |||
| 1505 | Ga0466967_0639985 | |||
| 1506 | Ga0466967_0644369 | |||
| 1507 | Ga0495617_096210 | |||
| 1508 | Ga0495603_0000105 | |||
| 1509 | Ga0495603_0018224 | |||
| 1510 | Ga0495603_0073381 | |||
| 1511 | Ga0495590_0022922 | |||
| 1512 | Ga0495629_0004087 | |||
| 1513 | Ga0495629_0018577 | |||
| 1514 | Ga0495629_0051936 | |||
| 1515 | Ga0495629_0427702 | |||
| 1516 | Ga0495638_0150393 | |||
| 1517 | Ga0495651_0089685 | |||
| 1518 | Ga0495650_0124444 | |||
| 1519 | Ga0495580_0234360 | |||
| 1520 | Ga0495580_0483717 | |||
| 1521 | Ga0495582_0085304 | |||
| 1522 | Ga0495605_0036219 | |||
| 1523 | Ga0495639_0016322 | |||
| 1524 | Ga0495662_0005123 | |||
| 1525 | Ga0495662_0010595 | |||
| 1526 | Ga0495662_0165304 | |||
| 1527 | Ga0495664_0011486 | |||
| 1528 | Ga0495594_0012685 | |||
| 1529 | Ga0495594_0024388 | |||
| 1530 | Ga0495594_0036254 | |||
| 1531 | Ga0495583_0062446 | |||
| 1532 | Ga0495620_0053608 | |||
| 1533 | Ga0495628_0027887 | |||
| 1534 | Ga0495630_0650083 | |||
| 1535 | Ga0495631_0047991 | |||
| 1536 | Ga0495643_0002389 | |||
| 1537 | Ga0495652_0022853 | |||
| 1538 | Ga0495587_0020410 | |||
| 1539 | Ga0495609_0061075 | |||
| 1540 | Ga0495645_0262584 | |||
| 1541 | Ga0495656_0048656 | |||
| 1542 | Ga0495668_0002057 | |||
| 1543 | Ga0495634_0001776 | |||
| 1544 | Ga0495611_0014547 | |||
| 1545 | Ga0495611_0107675 | |||
| 1546 | Ga0495611_0205781 | |||
| 1547 | Ga0495625_0078233 | |||
| 1548 | Ga0495635_0000701 | |||
| 1549 | Ga0495635_0179770 | |||
| 1550 | Ga0495588_0027033 | |||
| 1551 | Ga0495588_0060985 | |||
| 1552 | Ga0495588_0088685 | |||
| 1553 | Ga0495657_0002809 | |||
| 1554 | Ga0495657_0016267 | |||
| 1555 | Ga0495657_0275134 | |||
| 1556 | Ga0495646_0011050 | |||
| 1557 | Ga0495658_0105433 | |||
| 1558 | Ga0495613_0003082 | |||
| 1559 | Ga0495613_0003113 | |||
| 1560 | Ga0495613_0009204 | |||
| 1561 | Ga0495624_0098796 | |||
| 1562 | Ga0495624_0270094 | |||
| 1563 | Ga0495649_0028152 | |||
| 1564 | Ga0495589_0022462 | |||
| 1565 | Ga0495589_0054026 | |||
| 1566 | Ga0495589_0058017 | |||
| 1567 | Ga0495589_0070339 | |||
| 1568 | Ga0495600_0065116 | |||
| 1569 | Ga0495600_0126003 | |||
| 1570 | Ga0495660_0055252 | |||
| 1571 | Ga0495581_0249367 | |||
| 1572 | Ga0495604_0002054 | |||
| 1573 | Ga0495604_0009117 | |||
| 1574 | Ga0495636_0008299 | |||
| 1575 | Ga0495636_0024186 | |||
| 1576 | Ga0495636_0066753 | |||
| 1577 | Ga0495636_0165992 | |||
| 1578 | Ga0495674_0062791 | |||
| 1579 | Ga0495674_0125374 | |||
| 1580 | Ga0495672_0130887 | |||
| 1581 | Ga0495676_0001188 | |||
| 1582 | Ga0495676_0008085 | |||
| 1583 | Ga0495676_0119870 | |||
| 1584 | Ga0495676_0129874 | |||
| 1585 | Ga0495683_0000800 | |||
| 1586 | Ga0495683_0022666 | |||
| 1587 | Ga0495683_0045175 | |||
| 1588 | Ga0495683_0073020 | |||
| 1589 | Ga0495687_011722 | |||
| 1590 | Ga0495675_0047466 | |||
| 1591 | Ga0495675_0065664 | |||
| 1592 | Ga0495675_0095617 | |||
| 1593 | Ga0495685_002576 | |||
| 1594 | Ga0495685_006867 | |||
| 1595 | Ga0495685_012006 | |||
| 1596 | Ga0495685_053960 | |||
| 1597 | Ga0495685_057283 | |||
| 1598 | Ga0495685_108469 | |||
| 1599 | Ga0495681_0008621 | |||
| 1600 | Ga0495681_0069632 | |||
| 1601 | Ga0495684_0397496 | |||
| 1602 | Ga0495686_0089775 | |||
| 1603 | Ga0495593_0011515 | |||
| 1604 | Ga0495602_0014301 | |||
| 1605 | Ga0495614_0000088 | |||
| 1606 | Ga0495614_0081542 | |||
| 1607 | Ga0496100_0002834 | |||
| 1608 | Ga0496100_0072838 | |||
| 1609 | Ga0496100_0136382 | |||
| 1610 | Ga0496101_0037899 | |||
| 1611 | Ga0496101_0124580 | |||
| 1612 | Ga0496102_0000015 | |||
| 1613 | Ga0496102_0000059 | |||
| 1614 | Ga0496102_0002026 | |||
| 1615 | Ga0496102_0010950 | |||
| 1616 | Ga0496102_0198219 | |||
| 1617 | Ga0496102_0248798 | |||
| 1618 | Ga0496102_0368244 | |||
| 1619 | Ga0496103_0000096 | |||
| 1620 | Ga0496103_0000160 | |||
| 1621 | Ga0496103_0020268 | |||
| 1622 | Ga0496103_0110596 | |||
| 1623 | Ga0496103_0229652 | |||
| 1624 | Ga0496104_0005657 | |||
| 1625 | Ga0496104_0006958 | |||
| 1626 | Ga0496104_0068476 | |||
| 1627 | Ga0496104_0068954 | |||
| 1628 | Ga0496104_0467167 | |||
| 1629 | Ga0496105_0000965 | |||
| 1630 | Ga0496105_0015166 | |||
| 1631 | Ga0496105_0029201 | |||
| 1632 | Ga0496105_0079384 | |||
| 1633 | Ga0496105_0562712 | |||
| 1634 | Ga0496106_0005516 | |||
| 1635 | Ga0496106_0013882 | |||
| 1636 | Ga0496107_0009898 | |||
| 1637 | Ga0496107_0028295 | |||
| 1638 | Ga0496107_0037500 | |||
| 1639 | Ga0496108_0000928 | |||
| 1640 | Ga0496108_0025341 | |||
| 1641 | Ga0496108_0036497 | |||
| 1642 | Ga0496108_0037925 | |||
| 1643 | Ga0496108_0187439 | |||
| 1644 | Ga0496108_0237581 | |||
| 1645 | Ga0496108_0440105 | |||
| 1646 | Ga0496109_0009281 | |||
| 1647 | Ga0496109_0014832 | |||
| 1648 | Ga0496109_0030590 | |||
| 1649 | Ga0496109_0146941 | |||
| 1650 | Ga0496110_0002066 | |||
| 1651 | Ga0496110_0146470 | |||
| 1652 | Ga0496110_0265067 | |||
| 1653 | Ga0496110_0587422 | |||
| 1654 | Ga0496111_0000386 | |||
| 1655 | Ga0496111_0095415 | |||
| 1656 | Ga0496112_0168021 | |||
| 1657 | Ga0496112_0197002 | |||
| 1658 | Ga0496113_0001375 | |||
| 1659 | Ga0496113_0007465 | |||
| 1660 | Ga0496113_0011663 | |||
| 1661 | Ga0496113_0042145 | |||
| 1662 | Ga0496114_0000657 | |||
| 1663 | Ga0496114_0001776 | |||
| 1664 | Ga0496114_0052279 | |||
| 1665 | Ga0496114_0074857 | |||
| 1666 | Ga0496114_0098689 | |||
| 1667 | Ga0496114_0193655 | |||
| 1668 | Ga0496114_0315910 | |||
| 1669 | Ga0496115_0012989 | |||
| 1670 | Ga0496115_0065632 | |||
| 1671 | Ga0496115_0176656 | |||
| 1672 | Ga0496116_0000178 | |||
| 1673 | Ga0496117_0000047 | |||
| 1674 | Ga0496117_0168470 | |||
| 1675 | Ga0496118_0000050 | |||
| 1676 | Ga0496118_0008356 | |||
| 1677 | Ga0496118_0011438 | |||
| 1678 | Ga0496119_0000282 | |||
| 1679 | Ga0496119_0002385 | |||
| 1680 | Ga0496119_0034976 | |||
| 1681 | Ga0496119_0067751 | |||
| 1682 | Ga0496120_0005229 | |||
| 1683 | Ga0496120_0015037 | |||
| 1684 | Ga0496121_0012441 | |||
| 1685 | Ga0496121_0021347 | |||
| 1686 | Ga0496121_0063525 | |||
| 1687 | Ga0496121_0127132 | |||
| 1688 | Ga0496124_0002610 | |||
| 1689 | Ga0496125_0014400 | |||
| 1690 | Ga0496125_0153318 | |||
| 1691 | Ga0496126_0000035 | |||
| 1692 | Ga0496126_0000049 | |||
| 1693 | Ga0496126_0261585 | |||
| 1694 | Ga0496126_0435814 | |||
| 1695 | Ga0501031_0005989 | |||
| 1696 | Ga0501031_0007602 | |||
| 1697 | Ga0501031_0098997 | |||
| 1698 | Ga0501031_0167089 | |||
| 1699 | Ga0501032_0006469 | |||
| 1700 | Ga0501032_0008926 | |||
| 1701 | Ga0501032_0035355 | |||
| 1702 | Ga0501033_0016066 | |||
| 1703 | Ga0501034_0021106 | |||
| 1704 | Ga0501034_0106394 | |||
| 1705 | Ga0501034_0210079 | |||
| 1706 | Ga0501036_0008213 | |||
| 1707 | Ga0501036_0039300 | |||
| 1708 | Ga0501036_0193946 | |||
| 1709 | Ga0501037_0001694 | |||
| 1710 | Ga0501037_0005598 | |||
| 1711 | Ga0501037_0025874 | |||
| 1712 | Ga0501038_0002018 | |||
| 1713 | Ga0501038_0003778 | |||
| 1714 | Ga0501038_0007747 | |||
| 1715 | Ga0501038_0029765 | |||
| 1716 | Ga0501038_0249692 | |||
| 1717 | Ga0501039_0000657 | |||
| 1718 | Ga0501039_0022492 | |||
| 1719 | Ga0501039_0231914 | |||
| 1720 | Ga0501043_0000892 | |||
| 1721 | Ga0501043_0013080 | |||
| 1722 | Ga0501043_0019115 | |||
| 1723 | Ga0501043_0040479 | |||
| 1724 | Ga0501046_0000654 | |||
| 1725 | Ga0501046_0270638 | |||
| 1726 | Ga0501047_0003422 | |||
| 1727 | Ga0501047_0014792 | |||
| 1728 | Ga0501048_0000381 | |||
| 1729 | Ga0501048_0008071 | |||
| 1730 | Ga0501067_0097653 | |||
| 1731 | Ga0501069_0003392 | |||
| 1732 | Ga0501069_0145499 | |||
| 1733 | Ga0501070_0000501 | |||
| 1734 | Ga0501070_0002238 | |||
| 1735 | Ga0501070_0013330 | |||
| 1736 | Ga0501070_0069041 | |||
| 1737 | Ga0501070_0129855 | |||
| 1738 | Ga0501070_0204323 | |||
| 1739 | Ga0501073_0035859 | |||
| 1740 | Ga0501074_0009352 | |||
| 1741 | Ga0501077_0093511 | |||
| 1742 | Ga0501080_0017196 | |||
| 1743 | Ga0501080_0048838 | |||
| 1744 | Ga0501080_0057948 | |||
| 1745 | Ga0501083_0053977 | |||
| 1746 | Ga0501035_0002060 | |||
| 1747 | Ga0501035_0017415 | |||
| 1748 | Ga0501035_0078120 | |||
| 1749 | Ga0501035_0117217 | |||
| 1750 | Ga0501044_0008159 | |||
| 1751 | Ga0501044_0009614 | |||
| 1752 | Ga0501044_0014121 | |||
| 1753 | Ga0501044_0038244 | |||
| 1754 | Ga0501044_0057269 | |||
| 1755 | Ga0501044_0161978 | |||
| 1756 | nmdc:mga03n38_203607_c1 | |||
| 1757 | nmdc:mga03n38_28184_c1 | |||
| 1758 | nmdc:mga00v17_108480_c1 | |||
| 1759 | nmdc:mga06z11_3893_c1 | |||
| 1760 | nmdc:mga04h51_56671_c1 | |||
| 1761 | nmdc:mga05p37_490574_c1 | |||
| 1762 | nmdc:mga08y16_150082_c1 | |||
| 1763 | nmdc:mga08y16_5861_c1 | |||
| 1764 | nmdc:mga0n895_14278_c1 | |||
| 1765 | nmdc:mga0n895_98989_c1 | |||
| 1766 | nmdc:mga0rr50_12687_c1 | |||
| 1767 | nmdc:mga0rr50_58119_c1 | |||
| 1768 | nmdc:mga0rr50_8525_c1 | |||
| 1769 | nmdc:mga08x19_266283_c2 | |||
| 1770 | nmdc:mga08x19_70063_c1 | |||
| 1771 | nmdc:mga0a205_27627_c1 | |||
| 1772 | nmdc:mga0a205_9224_c1 | |||
| 1773 | Ga0495601_0011742 | |||
| 1774 | Ga0495612_0067601 | |||
| 1775 | Ga0495655_0017871 | |||
| 1776 | Ga0495619_0007926 | |||
| 1777 | Ga0500644_0026394 | |||
| 1778 | Ga0500640_015826 | |||
| 1779 | Ga0500650_0094620 | |||
| 1780 | Ga0500553_114257 | |||
| 1781 | Ga0500560_052613 | |||
| 1782 | Ga0500569_000878 | |||
| 1783 | Ga0500614_043272 | |||
| 1784 | Ga0500628_001434 | |||
| 1785 | Ga0500652_001624 | |||
| 1786 | Ga0500577_0019326 | |||
| 1787 | Ga0500579_089215 | |||
| 1788 | Ga0500616_0075318 | |||
| 1789 | Ga0500624_016633 | |||
| 1790 | Ga0500634_0047354 | |||
| 1791 | Ga0500656_011440 | |||
| 1792 | Ga0501084_0017976 | |||
| 1793 | Ga0466962_0015906 | |||
| 1794 | Ga0466962_0025539 | |||
| 1795 | Ga0466962_0029088 | |||
| 1796 | Ga0466962_0039728 | |||
| 1797 | Ga0466962_0071139 | |||
| 1798 | 2508672339 | |||
| 1799 | 2547408617 | |||
| 1800 | 2548698702 | |||
| 1801 | 2552110360 | |||
| 1802 | 2559426995 | |||
| 1803 | 2566997347 | |||
| 1804 | 2583152310 | |||
| 1805 | 2585296361 | |||
| 1806 | 2585320526 | |||
| 1807 | 2616900149 | |||
| 1808 | 2623500553 | |||
| 1809 | 2643902504 | |||
| 1810 | 2643941565 | |||
| 1811 | 2644017489 | |||
| 1812 | 2644173549 | |||
| 1813 | 2644263672 | |||
| 1814 | 2644386666 | |||
| 1815 | 2644404075 | |||
| 1816 | 2644428649 | |||
| 1817 | 2644513696 | |||
| 1818 | 2644632880 | |||
| 1819 | 2689961122 | |||
| 1820 | 2738888094 | |||
| 1821 | 2739238576 | |||
| 1822 | 2776369542 | |||
| 1823 | 2784590182 | |||
| 1824 | 2785371235 | |||
| 1825 | 2786672420 | |||
| 1826 | 2791913962 | |||
| 1827 | 2793984559 | |||
| 1828 | 2808843799 | |||
| 1829 | 2809233854 | |||
| 1830 | 2812478991 | |||
| 1831 | 2819694849 | |||
| 1832 | 2819740835 | |||
| 1833 | 2852642032 | |||
| 1834 | 2856748408 | |||
| 1835 | 2862179213 | |||
| 1836 | 2862577763 | |||
| 1837 | 2863068925 | |||
| 1838 | 2866553055 | |||
| 1839 | 2867428680 | |||
| 1840 | 2873154285 | |||
| 1841 | 2873316901 | |||
| 1842 | 2875396451 | |||
| 1843 | 2877679364 | |||
| 1844 | 2889303010 | |||
| 1845 | 2891399478 | |||
| 1846 | 2891560739 | |||
| 1847 | 2891564250 | |||
| 1848 | 2899360206 | |||
| 1849 | 2904538276 | |||
| 1850 | 2912762521 | |||
| 1851 | 2918506247 | |||
| 1852 | 2919719378 | |||
| 1853 | 2922557468 | |||
| 1854 | 2928145654 | |||
| 1855 | 2935391585 | |||
| 1856 | 2939746112 | |||
| 1857 | 2946048106 | |||
| 1858 | 2946077511 | |||
| 1859 | 2947227199 | |||
| 1860 | 2954384253 | |||
| 1861 | 2954678693 | |||
| 1862 | 2954685463 | |||
| 1863 | 2954695075 | |||
| 1864 | 2954710249 | |||
| 1865 | 2954714566 | |||
| 1866 | 2954724511 | |||
| 1867 | 2954737308 | |||
| 1868 | 2954743432 | |||
| 1869 | 2954756158 | |||
| 1870 | 2954762389 | |||
| 1871 | 2956941309 | |||
| 1872 | 2966601085 | |||
| 1873 | 2990065309 | |||
| 1874 | 2997603106 | |||
| 1875 | 3006398177 | |||
| 1876 | 3006487761 | |||
| 1877 | 8003320431 | |||
| 1878 | 8023624817 | |||
| 1879 | 8025537508 | |||
| 1880 | 8047715123 | |||
| 1881 | 8047896375 | |||
| 1882 | 8048133785 | |||
| 1883 | 8048362561 | |||
| 1884 | 8048373384 | |||
| 1885 | 8048384858 | |||
| 1886 | 8055177356 | |||
| 1887 | 8056215346 | |||
| 1888 | 8056831906 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zi9-assembly1.cif.gz_A | crystal structure of type-ii log from streptomyces coelicolor a3 | 0.9632 | 55 | 259 |
| 5wq3-assembly1.cif.gz_C-3 | crystal structure of type-ii log from corynebacterium glutamicum | 0.96 | 56 | 261 |
| 5wq3-assembly1.cif.gz_B-2 | crystal structure of type-ii log from corynebacterium glutamicum | 0.9588 | 56 | 262 |
| 1wek-assembly1.cif.gz_E | crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 | 0.9564 | 58 | 259 |
| 1wek-assembly1.cif.gz_F | crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 | 0.9491 | 58 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5wq3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9747 | 61 | 262 | 3.40.50.450 |
| 5wq3B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9652 | 61 | 262 | 3.40.50.450 |
| 1wekF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9497 | 62 | 258 | 3.40.50.450 |
| af_Q8I1V0_170_336_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9376 | 116 | 258 | 3.40.50.450 |
| 1wekF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9351 | 62 | 258 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A371LRB8-F1-model_v4 | TIGR00730 family Rossman fold protein | 0.9894 | 96 | 254 |
GO:0005829
GO:0009691 GO:0016787 |
| AF-A0A4V1U1L1-F1-model_v4 | deleted | 0.9857 | 88 | 254 |
|
| AF-A0A7V1SKG0-F1-model_v4 | TIGR00730 family Rossman fold protein | 0.9851 | 174 | 259 |
GO:0005829
|
| AF-A0A7C4HNH5-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9844 | 87 | 258 |
GO:0005829
GO:0008714 GO:0009691 |
| AF-A0A382YWA3-F1-model_v4 | TIGR00730 family Rossman fold protein | 0.9834 | 88 | 163 |
GO:0005829
|