F486444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 945 | 643 | 1890 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300053134|Ga0500658_0005036|Ga0500658_0005036_3304_4428 |
| Length | 374 |
| Sequence | MLIYFCIADAFISSISFIPFWGHDPLIRSKEMIVMSSIMKTTALILGATGGIGGAVARKLLARGWRIRALNRDAAKASRNEPAFEWVQGDAMNAGDVLRAAEGVGLIVHAVNPPGYRDWETLVLPMLDNTIAAARAVGVRVVLPGNVYNFGPDALPAPTEESPQNPVTKKGAIRVEMEKRLKAASQSGAGAIIVRGGDFFGPGTTANSWFSSGLVTPGKPVGTIRNPARRGIGHQWAYLPDMAETIAQLVERADRLAPFAVYHMEGFWDADGLQMAEAIKRVVGGKAKIGNFPWWIVPLTAPFVPVMREIKEMRYLWKVPVRMRNTKLVAELGKEPQTPIDEAVRASLVALGCLPEPHRQAAAALIGHPSQNAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 77 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 156 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 178 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 179 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 180 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 283 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 284 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 285 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 290 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 294 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 298 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 299 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 300 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 301 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 302 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 303 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 304 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 305 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 306 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 307 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 308 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 309 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 310 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 311 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 312 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 313 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 314 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 315 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 316 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 317 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 318 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 319 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 320 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 321 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 322 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 323 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 324 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 325 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 326 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 327 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 328 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 329 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 330 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 331 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 332 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 333 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 334 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 335 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 336 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 337 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 338 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 339 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 340 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 341 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 342 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 343 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 344 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 345 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 346 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 347 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 348 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 349 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 350 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 351 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 352 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 353 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 354 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 355 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 356 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 357 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 358 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 359 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 360 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 361 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 362 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 363 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 364 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 365 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 366 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 367 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 368 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 369 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 370 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 371 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 372 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 373 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 374 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 375 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 376 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 377 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 378 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 379 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 380 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 381 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 382 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 383 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 384 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 385 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 386 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 387 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 388 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 389 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 390 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 391 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 392 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 393 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 394 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 395 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 396 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 397 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 398 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 399 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 400 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 401 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 402 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 403 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 404 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 405 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 406 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 407 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 408 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 409 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 410 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 411 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 412 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 413 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 414 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 415 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 416 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 417 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 418 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 419 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 420 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 421 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 422 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 423 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 424 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 425 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 426 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 427 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 428 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 429 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 430 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 431 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 432 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 433 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 434 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 435 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 436 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 437 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 438 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 439 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 440 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 441 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 442 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 443 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 444 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 445 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 446 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 447 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 448 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 449 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 450 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 451 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 452 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 453 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 454 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 455 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 456 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 457 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 458 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 459 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 460 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 461 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 462 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 463 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 464 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 465 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 466 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 467 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 468 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 469 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 470 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 471 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 472 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 473 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 474 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 475 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 476 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 477 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 478 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 479 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 480 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 481 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 482 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 483 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 484 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 485 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 486 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 487 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 488 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 489 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 490 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 491 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 492 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 493 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 494 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 495 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 496 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 497 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 498 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 499 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 500 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 501 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 502 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 503 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 504 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 505 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 506 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 507 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 508 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 509 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 510 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 511 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 512 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 513 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 514 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 515 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 516 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 517 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 518 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 519 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 520 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 521 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 522 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 523 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 524 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 525 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 526 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 527 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 528 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 529 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 530 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 531 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 532 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 533 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 534 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 535 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 536 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 537 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 538 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 539 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 540 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 541 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 542 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 543 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 544 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 545 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 546 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 547 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 548 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 549 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 550 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 551 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 552 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 553 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 554 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 555 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 556 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 557 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 558 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 559 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 560 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 561 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 562 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 563 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 564 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 565 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 566 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 567 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 568 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 569 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 570 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 571 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 572 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 573 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 574 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 575 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 576 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 577 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 578 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 579 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 580 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 581 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 582 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 583 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 584 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 585 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 586 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 587 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 588 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 589 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 590 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 591 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 592 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 593 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 594 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 595 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 596 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 597 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 598 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 599 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 600 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 601 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 602 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 603 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 604 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 605 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 606 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 607 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 608 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 609 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 610 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 611 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 612 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 613 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 614 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 615 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 616 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 617 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 618 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 619 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 620 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 621 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 622 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 623 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 624 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 625 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 626 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 627 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 628 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 629 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 630 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 631 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 632 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 633 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 634 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 635 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 636 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 637 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 638 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 639 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 640 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 641 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
| 642 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 643 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.39 |
| Metatranscriptomes | 0 |
| Isolates | 36.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 18.62 |
| Nodule | 28.47 |
| Rhizoplane | 3.7 |
| Rhizosphere | 33.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500658_0005036 | 3300053134 | Bacteria | 4917 |
| 2 | JGI24740J21852_10000491 | 3300001979 | Bacteria | 16940 |
| 3 | JGI24737J22298_10006149 | 3300001990 | Bacteria | 4114 |
| 4 | JGI25155J39150_1000044 | 3300002704 | Bacteria | 86149 |
| 5 | JGI25156J39149_1000058 | 3300002705 | Bacteria | 86233 |
| 6 | JGI25162J39368_1001111 | 3300002737 | Bacteria | 16290 |
| 7 | JGI25154J39366_1000236 | 3300002738 | Bacteria | 36377 |
| 8 | JGI25158J39367_1000019 | 3300002739 | Bacteria | 41617 |
| 9 | JGI25157J39369_1000078 | 3300002741 | Bacteria | 86233 |
| 10 | JGI25152J39213_1008101 | 3300002773 | Bacteria | 2642 |
| 11 | JGI25152J39213_1009714 | 3300002773 | Bacteria | 2262 |
| 12 | JGI25159J45721_1000393 | 3300002987 | Bacteria | 20327 |
| 13 | JGI25159J45721_1001256 | 3300002987 | Bacteria | 10697 |
| 14 | JGI25151J46595_10001000 | 3300003187 | Bacteria | 21370 |
| 15 | JGI25151J46595_10003303 | 3300003187 | Bacteria | 8955 |
| 16 | JGI25151J46595_10027236 | 3300003187 | Bacteria | 2295 |
| 17 | JGI25165J46597_1002105 | 3300003214 | Bacteria | 7259 |
| 18 | JGI25165J46597_1006815 | 3300003214 | Bacteria | 1978 |
| 19 | JGI25153J46596_10001757 | 3300003215 | Bacteria | 12850 |
| 20 | JGI25153J46596_10005805 | 3300003215 | Bacteria | 6416 |
| 21 | rootH1_10002490 | 3300003316 | Bacteria | 42026 |
| 22 | rootH1_10154918 | 3300003316 | Bacteria | 2742 |
| 23 | rootH2_10104606 | 3300003320 | Bacteria | 4147 |
| 24 | rootL2_10000902 | 3300003322 | Bacteria | 25253 |
| 25 | rootH1_10073995 | 3300003323 | Bacteria | 3565 |
| 26 | rootH1_10091604 | 3300003323 | Bacteria | 6396 |
| 27 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 28 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 29 | JGI25161J50226_1000068 | 3300003374 | Bacteria | 90522 |
| 30 | Ga0055532_1000337 | 3300003758 | Bacteria | 25555 |
| 31 | Ga0055532_1000821 | 3300003758 | Bacteria | 10645 |
| 32 | Ga0055532_1000922 | 3300003758 | Bacteria | 9520 |
| 33 | Ga0055525_1000119 | 3300003759 | Bacteria | 120272 |
| 34 | Ga0055527_1000104 | 3300003760 | Bacteria | 60485 |
| 35 | Ga0055527_1000154 | 3300003760 | Bacteria | 48442 |
| 36 | Ga0055535_1000218 | 3300003761 | Bacteria | 60485 |
| 37 | Ga0055535_1000320 | 3300003761 | Bacteria | 48442 |
| 38 | Ga0055542_1000076 | 3300003762 | Bacteria | 139662 |
| 39 | Ga0055542_1000153 | 3300003762 | Bacteria | 87342 |
| 40 | Ga0055542_1003042 | 3300003762 | Bacteria | 4847 |
| 41 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 42 | Ga0055529_1000176 | 3300003763 | Bacteria | 87107 |
| 43 | Ga0055526_1000244 | 3300003771 | Bacteria | 45976 |
| 44 | Ga0055526_1001546 | 3300003771 | Bacteria | 16285 |
| 45 | Ga0055526_1007492 | 3300003771 | Bacteria | 5654 |
| 46 | Ga0055526_1008391 | 3300003771 | Bacteria | 5166 |
| 47 | Ga0055526_1033769 | 3300003771 | Bacteria | 1413 |
| 48 | Ga0055537_1000178 | 3300003773 | Bacteria | 47461 |
| 49 | Ga0055524_1000113 | 3300003775 | Bacteria | 95090 |
| 50 | Ga0055524_1002336 | 3300003775 | Bacteria | 9864 |
| 51 | Ga0055524_1004246 | 3300003775 | Bacteria | 6666 |
| 52 | Ga0055524_1013289 | 3300003775 | Bacteria | 3111 |
| 53 | Ga0055528_1000256 | 3300003790 | Bacteria | 45159 |
| 54 | Ga0055528_1000261 | 3300003790 | Bacteria | 44757 |
| 55 | Ga0055528_1001003 | 3300003790 | Bacteria | 18727 |
| 56 | Ga0055528_1001848 | 3300003790 | Bacteria | 12070 |
| 57 | Ga0055528_1015200 | 3300003790 | Bacteria | 2794 |
| 58 | Ga0055528_1020168 | 3300003790 | Bacteria | 2174 |
| 59 | Ga0055530_10002177 | 3300003791 | Bacteria | 12983 |
| 60 | Ga0055540_1000268 | 3300003792 | Bacteria | 47109 |
| 61 | Ga0055540_1004141 | 3300003792 | Bacteria | 6702 |
| 62 | Ga0055540_1010129 | 3300003792 | Bacteria | 3165 |
| 63 | Ga0055540_1016808 | 3300003792 | Bacteria | 2063 |
| 64 | Ga0055540_1020546 | 3300003792 | Bacteria | 1742 |
| 65 | Ga0055531_10000494 | 3300003794 | Bacteria | 36120 |
| 66 | Ga0055531_10015091 | 3300003794 | Bacteria | 3429 |
| 67 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 68 | Ga0055543_1000470 | 3300004625 | Bacteria | 23657 |
| 69 | Ga0065165_1000335 | 3300005262 | Bacteria | 77037 |
| 70 | Ga0065165_1006900 | 3300005262 | Bacteria | 5770 |
| 71 | Ga0065714_10069269 | 3300005288 | Bacteria | 4300 |
| 72 | Ga0070658_10002454 | 3300005327 | Bacteria | 15511 |
| 73 | Ga0070658_10023533 | 3300005327 | Bacteria | 4943 |
| 74 | Ga0070666_10000023 | 3300005335 | Bacteria | 161603 |
| 75 | Ga0070660_100000808 | 3300005339 | Bacteria | 20758 |
| 76 | Ga0070660_100002392 | 3300005339 | Bacteria | 12893 |
| 77 | Ga0070661_100020019 | 3300005344 | Bacteria | 4770 |
| 78 | Ga0070661_100072065 | 3300005344 | Bacteria | 2542 |
| 79 | Ga0070668_100063326 | 3300005347 | Bacteria | 2866 |
| 80 | Ga0070669_100100499 | 3300005353 | Bacteria | 2181 |
| 81 | Ga0070674_100016877 | 3300005356 | Bacteria | 4581 |
| 82 | Ga0070659_100000012 | 3300005366 | Bacteria | 180004 |
| 83 | Ga0070667_100007705 | 3300005367 | Bacteria | 8929 |
| 84 | Ga0070667_100021962 | 3300005367 | Bacteria | 5296 |
| 85 | Ga0070667_100328962 | 3300005367 | Bacteria | 1380 |
| 86 | Ga0070663_100000530 | 3300005455 | Bacteria | 20177 |
| 87 | Ga0070678_100000786 | 3300005456 | Bacteria | 15935 |
| 88 | Ga0068867_100056815 | 3300005459 | Bacteria | 2896 |
| 89 | Ga0070672_100010194 | 3300005543 | Bacteria | 6509 |
| 90 | Ga0070672_100053334 | 3300005543 | Bacteria | 3161 |
| 91 | Ga0070665_100010169 | 3300005548 | Bacteria | 9515 |
| 92 | Ga0070665_100174378 | 3300005548 | Bacteria | 2151 |
| 93 | Ga0068855_100068316 | 3300005563 | Bacteria | 4137 |
| 94 | Ga0070664_100060423 | 3300005564 | Bacteria | 3227 |
| 95 | Ga0068857_100107544 | 3300005577 | Bacteria | 2505 |
| 96 | Ga0068857_100132824 | 3300005577 | Bacteria | 2246 |
| 97 | Ga0068854_100028189 | 3300005578 | Bacteria | 3878 |
| 98 | Ga0068854_100055631 | 3300005578 | Bacteria | 2849 |
| 99 | Ga0068852_100064479 | 3300005616 | Bacteria | 3193 |
| 100 | Ga0068851_10113937 | 3300005834 | Bacteria | 1446 |
| 101 | Ga0068858_100130717 | 3300005842 | Bacteria | 2354 |
| 102 | Ga0068860_100017387 | 3300005843 | Bacteria | 7006 |
| 103 | Ga0068862_100133515 | 3300005844 | Bacteria | 2198 |
| 104 | Ga0075365_10008493 | 3300006038 | Bacteria | 5840 |
| 105 | Ga0075363_100018898 | 3300006048 | Bacteria | 3439 |
| 106 | Ga0070712_100180099 | 3300006175 | Bacteria | 1646 |
| 107 | Ga0075362_10007517 | 3300006177 | Bacteria | 4130 |
| 108 | Ga0075369_10005897 | 3300006186 | Bacteria | 4604 |
| 109 | Ga0075369_10017667 | 3300006186 | Bacteria | 2896 |
| 110 | Ga0075369_10112159 | 3300006186 | Bacteria | 1229 |
| 111 | Ga0075366_10003422 | 3300006195 | Bacteria | 8362 |
| 112 | Ga0075370_10004016 | 3300006353 | Bacteria | 7072 |
| 113 | Ga0075370_10048128 | 3300006353 | Bacteria | 2415 |
| 114 | Ga0075370_10084033 | 3300006353 | Bacteria | 1832 |
| 115 | Ga0075370_10104724 | 3300006353 | Bacteria | 1640 |
| 116 | Ga0068865_100023745 | 3300006881 | Bacteria | 4019 |
| 117 | Ga0079104_1000056 | 3300006946 | Bacteria | 166276 |
| 118 | Ga0105244_10033305 | 3300009036 | Bacteria | 2717 |
| 119 | Ga0105240_10001781 | 3300009093 | Bacteria | 36346 |
| 120 | Ga0105240_10143890 | 3300009093 | Bacteria | 2847 |
| 121 | Ga0111539_10076168 | 3300009094 | Bacteria | 3950 |
| 122 | Ga0105243_10000812 | 3300009148 | Bacteria | 29753 |
| 123 | Ga0105241_10003240 | 3300009174 | Bacteria | 12103 |
| 124 | Ga0105237_10001251 | 3300009545 | Bacteria | 33932 |
| 125 | Ga0105237_10030427 | 3300009545 | Bacteria | 5483 |
| 126 | Ga0105237_10081269 | 3300009545 | Bacteria | 3231 |
| 127 | Ga0105237_10128351 | 3300009545 | Bacteria | 2530 |
| 128 | Ga0105237_10804532 | 3300009545 | Bacteria | 947 |
| 129 | Ga0105238_10000331 | 3300009551 | Bacteria | 51630 |
| 130 | Ga0105238_10035972 | 3300009551 | Bacteria | 5034 |
| 131 | Ga0105238_10048861 | 3300009551 | Bacteria | 4262 |
| 132 | Ga0123341_1000028 | 3300009765 | Bacteria | 69145 |
| 133 | Ga0123342_1028435 | 3300009766 | Bacteria | 3017 |
| 134 | Ga0105239_10035459 | 3300010375 | Bacteria | 5478 |
| 135 | Ga0105239_10060729 | 3300010375 | Bacteria | 4149 |
| 136 | Ga0105239_10179572 | 3300010375 | Bacteria | 2368 |
| 137 | Ga0157371_10000197 | 3300013102 | Bacteria | 88423 |
| 138 | Ga0157371_10016751 | 3300013102 | Bacteria | 5459 |
| 139 | Ga0157370_10000248 | 3300013104 | Bacteria | 68580 |
| 140 | Ga0157370_10001042 | 3300013104 | Bacteria | 34875 |
| 141 | Ga0157370_10236176 | 3300013104 | Bacteria | 1692 |
| 142 | Ga0157369_10111065 | 3300013105 | Bacteria | 2914 |
| 143 | Ga0163162_10001650 | 3300013306 | Bacteria | 20913 |
| 144 | Ga0157372_10068297 | 3300013307 | Bacteria | 3996 |
| 145 | Ga0157375_10202886 | 3300013308 | Bacteria | 2139 |
| 146 | Ga0182007_10003611 | 3300015262 | Bacteria | 7256 |
| 147 | Ga0182007_10004059 | 3300015262 | Bacteria | 6741 |
| 148 | Ga0182007_10004378 | 3300015262 | Bacteria | 6410 |
| 149 | Ga0182005_1000173 | 3300015265 | Bacteria | 44701 |
| 150 | Ga0163161_10043529 | 3300017792 | Bacteria | 3233 |
| 151 | Ga0214543_1009579 | 3300021327 | Bacteria | 14952 |
| 152 | Ga0213876_10035238 | 3300021384 | Bacteria | 2640 |
| 153 | Ga0209435_100054 | 3300025206 | Bacteria | 86285 |
| 154 | Ga0209436_100070 | 3300025208 | Bacteria | 51558 |
| 155 | Ga0209566_100442 | 3300025225 | Bacteria | 30640 |
| 156 | Ga0209674_105923 | 3300025226 | Bacteria | 1733 |
| 157 | Ga0209672_100032 | 3300025228 | Bacteria | 324684 |
| 158 | Ga0209672_100042 | 3300025228 | Bacteria | 272005 |
| 159 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 160 | Ga0209147_100046 | 3300025229 | Bacteria | 295158 |
| 161 | Ga0209147_100052 | 3300025229 | Bacteria | 272005 |
| 162 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 163 | Ga0209563_101162 | 3300025230 | Bacteria | 7390 |
| 164 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 165 | Ga0209258_100030 | 3300025242 | Bacteria | 470208 |
| 166 | Ga0209258_100073 | 3300025242 | Bacteria | 272005 |
| 167 | Ga0207425_1001479 | 3300025245 | Bacteria | 9779 |
| 168 | Ga0207425_1012055 | 3300025245 | Bacteria | 2041 |
| 169 | Ga0209646_1000170 | 3300025246 | Bacteria | 86285 |
| 170 | Ga0209026_1000193 | 3300025250 | Bacteria | 86285 |
| 171 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 172 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 173 | Ga0209148_1000821 | 3300025254 | Bacteria | 22414 |
| 174 | Ga0209759_1000222 | 3300025256 | Bacteria | 86285 |
| 175 | Ga0209129_1000252 | 3300025258 | Bacteria | 55710 |
| 176 | Ga0209129_1002985 | 3300025258 | Bacteria | 7710 |
| 177 | Ga0209129_1018814 | 3300025258 | Bacteria | 1319 |
| 178 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 179 | Ga0209233_1000148 | 3300025261 | Bacteria | 185135 |
| 180 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 181 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 182 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 183 | Ga0209455_1000324 | 3300025272 | Bacteria | 47295 |
| 184 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 185 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 186 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 187 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 188 | Ga0209673_1001232 | 3300025273 | Bacteria | 26878 |
| 189 | Ga0209673_1004332 | 3300025273 | Bacteria | 7651 |
| 190 | Ga0209673_1007335 | 3300025273 | Bacteria | 5109 |
| 191 | Ga0209673_1024673 | 3300025273 | Bacteria | 2015 |
| 192 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 193 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 194 | Ga0209675_1000119 | 3300025291 | Bacteria | 110218 |
| 195 | Ga0209675_1028059 | 3300025291 | Bacteria | 1373 |
| 196 | Ga0209676_1025937 | 3300025292 | Bacteria | 1871 |
| 197 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 198 | Ga0209025_1002551 | 3300025294 | Bacteria | 19004 |
| 199 | Ga0209025_1004772 | 3300025294 | Bacteria | 11509 |
| 200 | Ga0209025_1016097 | 3300025294 | Bacteria | 4449 |
| 201 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 202 | Ga0209564_1000588 | 3300025295 | Bacteria | 57321 |
| 203 | Ga0209564_1000644 | 3300025295 | Bacteria | 52727 |
| 204 | Ga0209564_1000883 | 3300025295 | Bacteria | 39645 |
| 205 | Ga0209564_1007448 | 3300025295 | Bacteria | 5651 |
| 206 | Ga0209564_1012085 | 3300025295 | Bacteria | 3798 |
| 207 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 208 | Ga0209758_1001217 | 3300025297 | Bacteria | 32348 |
| 209 | Ga0209758_1001343 | 3300025297 | Bacteria | 29681 |
| 210 | Ga0209758_1001396 | 3300025297 | Bacteria | 28704 |
| 211 | Ga0209758_1018413 | 3300025297 | Bacteria | 3423 |
| 212 | Ga0209758_1018414 | 3300025297 | Bacteria | 3423 |
| 213 | Ga0209050_1001510 | 3300025298 | Bacteria | 24578 |
| 214 | Ga0209050_1002600 | 3300025298 | Bacteria | 14957 |
| 215 | Ga0209050_1019579 | 3300025298 | Bacteria | 2563 |
| 216 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 217 | Ga0209256_1000210 | 3300025299 | Bacteria | 110217 |
| 218 | Ga0209256_1000924 | 3300025299 | Bacteria | 35882 |
| 219 | Ga0209256_1002389 | 3300025299 | Bacteria | 15470 |
| 220 | Ga0209256_1011242 | 3300025299 | Bacteria | 3609 |
| 221 | Ga0209256_1023488 | 3300025299 | Bacteria | 1837 |
| 222 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 223 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 224 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 225 | Ga0209051_1000196 | 3300025303 | Bacteria | 107028 |
| 226 | Ga0209051_1000400 | 3300025303 | Bacteria | 60342 |
| 227 | Ga0209051_1004736 | 3300025303 | Bacteria | 8241 |
| 228 | Ga0209051_1006706 | 3300025303 | Bacteria | 6434 |
| 229 | Ga0209051_1035357 | 3300025303 | Bacteria | 1860 |
| 230 | Ga0209257_1000168 | 3300025304 | Bacteria | 171312 |
| 231 | Ga0209257_1000305 | 3300025304 | Bacteria | 107001 |
| 232 | Ga0209257_1001180 | 3300025304 | Bacteria | 33048 |
| 233 | Ga0207655_1070987 | 3300025728 | Bacteria | 1294 |
| 234 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 235 | Ga0207647_10184401 | 3300025904 | Bacteria | 1211 |
| 236 | Ga0207705_10000489 | 3300025909 | Bacteria | 33785 |
| 237 | Ga0207705_10002172 | 3300025909 | Bacteria | 15174 |
| 238 | Ga0207705_10009527 | 3300025909 | Bacteria | 7068 |
| 239 | Ga0207654_10000273 | 3300025911 | Bacteria | 31494 |
| 240 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 241 | Ga0207695_10001076 | 3300025913 | Bacteria | 47744 |
| 242 | Ga0207695_10029433 | 3300025913 | Bacteria | 6068 |
| 243 | Ga0207671_10004383 | 3300025914 | Bacteria | 13528 |
| 244 | Ga0207671_10008263 | 3300025914 | Bacteria | 8855 |
| 245 | Ga0207671_10018796 | 3300025914 | Bacteria | 5295 |
| 246 | Ga0207693_10146142 | 3300025915 | Bacteria | 1859 |
| 247 | Ga0207657_10000013 | 3300025919 | Bacteria | 180080 |
| 248 | Ga0207657_10005166 | 3300025919 | Bacteria | 13693 |
| 249 | Ga0207657_10027577 | 3300025919 | Bacteria | 5200 |
| 250 | Ga0207649_10000443 | 3300025920 | Bacteria | 29944 |
| 251 | Ga0207649_10011842 | 3300025920 | Bacteria | 4825 |
| 252 | Ga0207694_10000253 | 3300025924 | Bacteria | 50728 |
| 253 | Ga0207694_10028372 | 3300025924 | Bacteria | 4267 |
| 254 | Ga0207694_10065008 | 3300025924 | Bacteria | 2844 |
| 255 | Ga0207694_10148721 | 3300025924 | Bacteria | 1886 |
| 256 | Ga0207690_10000048 | 3300025932 | Bacteria | 114048 |
| 257 | Ga0207690_10014663 | 3300025932 | Bacteria | 4738 |
| 258 | Ga0207706_10069437 | 3300025933 | Bacteria | 3099 |
| 259 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 260 | Ga0207669_10000251 | 3300025937 | Bacteria | 24482 |
| 261 | Ga0207691_10026111 | 3300025940 | Bacteria | 5481 |
| 262 | Ga0207691_10065584 | 3300025940 | Bacteria | 3286 |
| 263 | Ga0207679_10044049 | 3300025945 | Bacteria | 3217 |
| 264 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 265 | Ga0207667_10007355 | 3300025949 | Bacteria | 13250 |
| 266 | Ga0207667_10038463 | 3300025949 | Bacteria | 5110 |
| 267 | Ga0207667_10074482 | 3300025949 | Bacteria | 3527 |
| 268 | Ga0207668_10049653 | 3300025972 | Bacteria | 2886 |
| 269 | Ga0207668_10238403 | 3300025972 | Bacteria | 1470 |
| 270 | Ga0207640_10001706 | 3300025981 | Bacteria | 11781 |
| 271 | Ga0207640_10026274 | 3300025981 | Bacteria | 3533 |
| 272 | Ga0207658_10003699 | 3300025986 | Bacteria | 10780 |
| 273 | Ga0207658_10327777 | 3300025986 | Bacteria | 1327 |
| 274 | Ga0207639_10025615 | 3300026041 | Bacteria | 4278 |
| 275 | Ga0207639_10205790 | 3300026041 | Bacteria | 1691 |
| 276 | Ga0207678_10001175 | 3300026067 | Bacteria | 23968 |
| 277 | Ga0207702_10156415 | 3300026078 | Bacteria | 2078 |
| 278 | Ga0207648_10031438 | 3300026089 | Bacteria | 4694 |
| 279 | Ga0207674_10171368 | 3300026116 | Bacteria | 2124 |
| 280 | Ga0207674_10382261 | 3300026116 | Bacteria | 1361 |
| 281 | Ga0207683_10008013 | 3300026121 | Bacteria | 9032 |
| 282 | Ga0207698_10008335 | 3300026142 | Bacteria | 6547 |
| 283 | Ga0209281_1000125 | 3300027111 | Bacteria | 200371 |
| 284 | Ga0209281_1001633 | 3300027111 | Bacteria | 12012 |
| 285 | Ga0209371_1000767 | 3300027312 | Bacteria | 26697 |
| 286 | Ga0209371_1007474 | 3300027312 | Bacteria | 3801 |
| 287 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 288 | Ga0268266_10071099 | 3300028379 | Bacteria | 3016 |
| 289 | Ga0268264_10026646 | 3300028381 | Bacteria | 4724 |
| 290 | Ga0307515_10021842 | 3300028794 | Bacteria | 11320 |
| 291 | Ga0307515_10044147 | 3300028794 | Bacteria | 6898 |
| 292 | Ga0265338_10017549 | 3300028800 | Bacteria | 7708 |
| 293 | Ga0268256_1000381 | 3300030500 | Bacteria | 41938 |
| 294 | Ga0268256_1034045 | 3300030500 | Bacteria | 1198 |
| 295 | Ga0316177_1132731 | 3300030731 | Bacteria | 1553 |
| 296 | Ga0265328_10016351 | 3300031239 | Bacteria | 2889 |
| 297 | Ga0265327_10007500 | 3300031251 | Bacteria | 8406 |
| 298 | Ga0307509_10203133 | 3300031507 | Bacteria | 1816 |
| 299 | Ga0307405_10286904 | 3300031731 | Bacteria | 1242 |
| 300 | Ga0307412_10000279 | 3300031911 | Bacteria | 32639 |
| 301 | Ga0307510_10001025 | 3300033180 | Bacteria | 29562 |
| 302 | Ga0307510_10030018 | 3300033180 | Bacteria | 6172 |
| 303 | Ga0307510_10156361 | 3300033180 | Bacteria | 1886 |
| 304 | Ga0373959_0021938 | 3300034820 | Bacteria | 1230 |
| 305 | Ga0373939_0001752 | 3300035114 | Bacteria | 5229 |
| 306 | Ga0373960_0039436 | 3300035121 | Bacteria | 1358 |
| 307 | Ga0373931_0009437 | 3300035691 | Bacteria | 4667 |
| 308 | Ga0395900_0009732 | 3300037418 | Bacteria | 9846 |
| 309 | Ga0395900_0124638 | 3300037418 | Bacteria | 2642 |
| 310 | Ga0395900_0593518 | 3300037418 | Bacteria | 1049 |
| 311 | Ga0395898_0002817 | 3300037466 | Bacteria | 19944 |
| 312 | Ga0395905_0000836 | 3300037471 | Bacteria | 40186 |
| 313 | Ga0395905_0001684 | 3300037471 | Bacteria | 26069 |
| 314 | Ga0395905_0003242 | 3300037471 | Bacteria | 17500 |
| 315 | Ga0436364_0266159 | 3300037853 | Bacteria | 1155 |
| 316 | Ga0436364_1191496 | 3300037853 | Bacteria | 2219 |
| 317 | Ga0395901_0000053 | 3300038443 | Bacteria | 163807 |
| 318 | Ga0395901_0000771 | 3300038443 | Bacteria | 35916 |
| 319 | Ga0395901_0051719 | 3300038443 | Bacteria | 4271 |
| 320 | Ga0436365_1903073 | 3300039437 | Bacteria | 5474 |
| 321 | Ga0436363_0094623 | 3300039450 | Bacteria | 3474 |
| 322 | Ga0451797_1009375 | 3300041453 | Bacteria | 4861 |
| 323 | Ga0451802_0590003 | 3300041460 | Bacteria | 3572 |
| 324 | Ga0451802_0864319 | 3300041460 | Bacteria | 3925 |
| 325 | Ga0451806_273572 | 3300041462 | Bacteria | 2348 |
| 326 | Ga0451807_0250052 | 3300041486 | Bacteria | 3812 |
| 327 | Ga0451807_0394883 | 3300041486 | Bacteria | 1838 |
| 328 | Ga0451833_0097459 | 3300041491 | Bacteria | 3501 |
| 329 | Ga0451837_0500608 | 3300041494 | Bacteria | 1238 |
| 330 | Ga0451837_1125556 | 3300041494 | Bacteria | 1399 |
| 331 | Ga0451849_1051639 | 3300041505 | Bacteria | 1866 |
| 332 | Ga0451843_0511692 | 3300041509 | Bacteria | 2904 |
| 333 | Ga0451853_1537113 | 3300041512 | Bacteria | 6622 |
| 334 | Ga0439448_0046940 | 3300042005 | Bacteria | 1408 |
| 335 | Ga0439449_0019623 | 3300042007 | Bacteria | 2534 |
| 336 | Ga0466969_0048147 | 3300044656 | Bacteria | 2108 |
| 337 | Ga0466972_0031098 | 3300044658 | Bacteria | 2627 |
| 338 | Ga0466973_0073639 | 3300044659 | Bacteria | 3025 |
| 339 | Ga0466965_0002833 | 3300044683 | Bacteria | 7472 |
| 340 | Ga0466965_0074376 | 3300044683 | Bacteria | 1712 |
| 341 | Ga0466966_0024442 | 3300044684 | Bacteria | 3951 |
| 342 | Ga0466966_0030275 | 3300044684 | Bacteria | 3514 |
| 343 | Ga0466961_0068600 | 3300044693 | Bacteria | 2251 |
| 344 | Ga0466963_0000775 | 3300044694 | Bacteria | 15854 |
| 345 | Ga0466971_0027711 | 3300044719 | Bacteria | 2537 |
| 346 | Ga0466968_0001146 | 3300044735 | Bacteria | 9394 |
| 347 | Ga0466968_0054845 | 3300044735 | Bacteria | 1709 |
| 348 | Ga0466970_0004290 | 3300044765 | Bacteria | 7016 |
| 349 | Ga0466957_0007192 | 3300044842 | Bacteria | 6295 |
| 350 | Ga0466957_0014397 | 3300044842 | Bacteria | 4605 |
| 351 | Ga0466957_0103143 | 3300044842 | Bacteria | 1800 |
| 352 | Ga0466959_0038026 | 3300045049 | Bacteria | 3557 |
| 353 | Ga0451576_0046970 | 3300045051 | Bacteria | 4542 |
| 354 | Ga0466958_0112472 | 3300045836 | Bacteria | 1700 |
| 355 | Ga0495591_000038 | 3300046458 | Bacteria | 157347 |
| 356 | Ga0495591_002043 | 3300046458 | Bacteria | 11725 |
| 357 | Ga0495629_0011780 | 3300046459 | Bacteria | 6347 |
| 358 | Ga0495629_0099923 | 3300046459 | Bacteria | 2025 |
| 359 | Ga0495650_0000074 | 3300046471 | Bacteria | 251346 |
| 360 | Ga0495650_0000085 | 3300046471 | Bacteria | 235655 |
| 361 | Ga0495650_0000792 | 3300046471 | Bacteria | 38739 |
| 362 | Ga0495605_0013342 | 3300046474 | Bacteria | 4531 |
| 363 | Ga0495605_0019640 | 3300046474 | Bacteria | 3606 |
| 364 | Ga0495584_0000234 | 3300046491 | Bacteria | 39911 |
| 365 | Ga0495584_0004488 | 3300046491 | Bacteria | 7500 |
| 366 | Ga0495584_0017295 | 3300046491 | Bacteria | 3674 |
| 367 | Ga0495585_0000503 | 3300046492 | Bacteria | 37043 |
| 368 | Ga0495585_0027601 | 3300046492 | Bacteria | 3240 |
| 369 | Ga0495585_0044443 | 3300046492 | Bacteria | 2481 |
| 370 | Ga0495596_0000353 | 3300046500 | Bacteria | 29811 |
| 371 | Ga0495607_0002423 | 3300046501 | Bacteria | 15227 |
| 372 | Ga0495607_0010757 | 3300046501 | Bacteria | 6127 |
| 373 | Ga0495607_0012593 | 3300046501 | Bacteria | 5574 |
| 374 | Ga0495607_0016048 | 3300046501 | Bacteria | 4839 |
| 375 | Ga0495583_0003563 | 3300046506 | Bacteria | 11728 |
| 376 | Ga0495583_0004282 | 3300046506 | Bacteria | 10329 |
| 377 | Ga0495583_0007004 | 3300046506 | Bacteria | 7218 |
| 378 | Ga0495583_0034415 | 3300046506 | Bacteria | 2426 |
| 379 | Ga0495583_0037583 | 3300046506 | Bacteria | 2294 |
| 380 | Ga0495583_0049900 | 3300046506 | Bacteria | 1914 |
| 381 | Ga0495606_0003262 | 3300046507 | Bacteria | 17404 |
| 382 | Ga0495606_0004275 | 3300046507 | Bacteria | 14413 |
| 383 | Ga0495606_0023312 | 3300046507 | Bacteria | 4489 |
| 384 | Ga0495606_0053380 | 3300046507 | Bacteria | 2623 |
| 385 | Ga0495610_0035819 | 3300046512 | Bacteria | 2542 |
| 386 | Ga0495610_0063514 | 3300046512 | Bacteria | 1748 |
| 387 | Ga0495616_0005239 | 3300046513 | Bacteria | 8009 |
| 388 | Ga0495616_0054958 | 3300046513 | Bacteria | 1973 |
| 389 | Ga0495616_0057988 | 3300046513 | Bacteria | 1908 |
| 390 | Ga0495620_0021011 | 3300046515 | Bacteria | 3177 |
| 391 | Ga0495630_0320565 | 3300046517 | Bacteria | 1185 |
| 392 | Ga0495631_0014736 | 3300046518 | Bacteria | 3766 |
| 393 | Ga0495631_0024247 | 3300046518 | Bacteria | 2802 |
| 394 | Ga0495631_0034272 | 3300046518 | Bacteria | 2277 |
| 395 | Ga0495632_0051326 | 3300046519 | Bacteria | 2030 |
| 396 | Ga0495643_0003546 | 3300046522 | Bacteria | 11343 |
| 397 | Ga0495643_0023729 | 3300046522 | Bacteria | 3484 |
| 398 | Ga0495643_0155728 | 3300046522 | Bacteria | 1128 |
| 399 | Ga0495644_0020986 | 3300046523 | Bacteria | 2492 |
| 400 | Ga0495648_0000123 | 3300046524 | Bacteria | 92159 |
| 401 | Ga0495648_0001570 | 3300046524 | Bacteria | 22297 |
| 402 | Ga0495648_0033596 | 3300046524 | Bacteria | 3348 |
| 403 | Ga0495663_0003381 | 3300046525 | Bacteria | 4610 |
| 404 | Ga0495654_0030922 | 3300046530 | Bacteria | 2720 |
| 405 | Ga0495609_0000072 | 3300046538 | Bacteria | 125273 |
| 406 | Ga0495609_0001961 | 3300046538 | Bacteria | 13059 |
| 407 | Ga0495609_0015067 | 3300046538 | Bacteria | 3623 |
| 408 | Ga0495609_0047265 | 3300046538 | Bacteria | 1926 |
| 409 | Ga0495597_0010430 | 3300046542 | Bacteria | 4544 |
| 410 | Ga0495656_0000081 | 3300046615 | Bacteria | 42254 |
| 411 | Ga0495668_0047650 | 3300046616 | Bacteria | 2379 |
| 412 | Ga0495668_0177093 | 3300046616 | Bacteria | 1168 |
| 413 | Ga0495611_0001502 | 3300046648 | Bacteria | 11538 |
| 414 | Ga0495611_0018534 | 3300046648 | Bacteria | 2985 |
| 415 | Ga0495611_0046262 | 3300046648 | Bacteria | 1951 |
| 416 | Ga0495625_0016188 | 3300046660 | Bacteria | 5873 |
| 417 | Ga0495625_0017507 | 3300046660 | Bacteria | 5609 |
| 418 | Ga0495625_0028250 | 3300046660 | Bacteria | 4209 |
| 419 | Ga0495625_0059750 | 3300046660 | Bacteria | 2703 |
| 420 | Ga0495625_0083670 | 3300046660 | Bacteria | 2217 |
| 421 | Ga0495661_0000040 | 3300046665 | Bacteria | 151437 |
| 422 | Ga0495661_0000632 | 3300046665 | Bacteria | 35731 |
| 423 | Ga0495661_0035787 | 3300046665 | Bacteria | 3113 |
| 424 | Ga0495661_0039944 | 3300046665 | Bacteria | 2913 |
| 425 | Ga0495661_0131180 | 3300046665 | Bacteria | 1373 |
| 426 | Ga0495669_0000951 | 3300046684 | Bacteria | 12114 |
| 427 | Ga0495669_0002830 | 3300046684 | Bacteria | 7121 |
| 428 | Ga0495669_0016202 | 3300046684 | Bacteria | 3192 |
| 429 | Ga0495670_0036221 | 3300046691 | Bacteria | 2459 |
| 430 | Ga0495671_0067962 | 3300046692 | Bacteria | 1752 |
| 431 | Ga0495649_0008479 | 3300046694 | Bacteria | 6182 |
| 432 | Ga0495649_0104606 | 3300046694 | Bacteria | 1503 |
| 433 | Ga0495589_0012514 | 3300046794 | Bacteria | 4392 |
| 434 | Ga0495589_0016431 | 3300046794 | Bacteria | 3804 |
| 435 | Ga0495600_0029243 | 3300046809 | Bacteria | 3567 |
| 436 | Ga0495660_0042271 | 3300046810 | Bacteria | 2519 |
| 437 | Ga0495674_0043083 | 3300047319 | Bacteria | 4020 |
| 438 | Ga0495672_0001502 | 3300047320 | Bacteria | 22882 |
| 439 | Ga0495672_0023150 | 3300047320 | Bacteria | 4027 |
| 440 | Ga0495672_0070862 | 3300047320 | Bacteria | 1974 |
| 441 | Ga0495676_0110221 | 3300047321 | Bacteria | 2021 |
| 442 | Ga0495683_0000751 | 3300047323 | Bacteria | 23402 |
| 443 | Ga0495683_0006182 | 3300047323 | Bacteria | 6560 |
| 444 | Ga0495683_0102248 | 3300047323 | Bacteria | 1377 |
| 445 | Ga0495687_000181 | 3300047443 | Bacteria | 91455 |
| 446 | Ga0495687_053514 | 3300047443 | Bacteria | 1699 |
| 447 | Ga0495681_0002457 | 3300047470 | Bacteria | 13222 |
| 448 | Ga0495681_0027576 | 3300047470 | Bacteria | 2935 |
| 449 | Ga0495686_0000051 | 3300047472 | Bacteria | 263489 |
| 450 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 451 | Ga0495686_0001880 | 3300047472 | Bacteria | 20984 |
| 452 | Ga0495686_0016214 | 3300047472 | Bacteria | 5058 |
| 453 | Ga0495686_0145844 | 3300047472 | Bacteria | 1393 |
| 454 | Ga0495686_0157979 | 3300047472 | Bacteria | 1327 |
| 455 | Ga0495686_0187695 | 3300047472 | Bacteria | 1193 |
| 456 | Ga0495626_0022835 | 3300048091 | Bacteria | 3088 |
| 457 | Ga0495626_0037916 | 3300048091 | Bacteria | 2288 |
| 458 | Ga0496100_0094115 | 3300048903 | Bacteria | 2051 |
| 459 | Ga0496101_0004154 | 3300048904 | Bacteria | 9071 |
| 460 | Ga0496101_0014663 | 3300048904 | Bacteria | 5272 |
| 461 | Ga0496102_0004598 | 3300048905 | Bacteria | 11673 |
| 462 | Ga0496102_0021862 | 3300048905 | Bacteria | 5662 |
| 463 | Ga0496103_0000784 | 3300048906 | Bacteria | 23390 |
| 464 | Ga0496103_0032993 | 3300048906 | Bacteria | 3162 |
| 465 | Ga0496104_0034197 | 3300048907 | Bacteria | 4737 |
| 466 | Ga0496104_0210622 | 3300048907 | Bacteria | 1855 |
| 467 | Ga0496105_0176741 | 3300048908 | Bacteria | 1748 |
| 468 | Ga0496106_0006670 | 3300048909 | Bacteria | 8547 |
| 469 | Ga0496106_0087170 | 3300048909 | Bacteria | 2405 |
| 470 | Ga0496107_0235483 | 3300048910 | Bacteria | 1362 |
| 471 | Ga0496109_0013161 | 3300048912 | Bacteria | 7160 |
| 472 | Ga0496111_0097400 | 3300048914 | Bacteria | 2159 |
| 473 | Ga0496112_0159356 | 3300048915 | Bacteria | 2223 |
| 474 | Ga0496113_0000633 | 3300048916 | Bacteria | 17688 |
| 475 | Ga0496113_0016669 | 3300048916 | Bacteria | 5080 |
| 476 | Ga0496113_0130020 | 3300048916 | Bacteria | 1975 |
| 477 | Ga0496113_0221706 | 3300048916 | Bacteria | 1507 |
| 478 | Ga0496114_0003146 | 3300048917 | Bacteria | 12674 |
| 479 | Ga0496114_0025174 | 3300048917 | Bacteria | 4862 |
| 480 | Ga0496115_0000783 | 3300048918 | Bacteria | 23323 |
| 481 | Ga0496116_0044240 | 3300048919 | Bacteria | 3026 |
| 482 | Ga0496116_0082733 | 3300048919 | Bacteria | 1984 |
| 483 | Ga0496116_0112599 | 3300048919 | Bacteria | 1594 |
| 484 | Ga0496117_0001166 | 3300048920 | Bacteria | 39515 |
| 485 | Ga0496117_0008212 | 3300048920 | Bacteria | 9956 |
| 486 | Ga0496117_0023913 | 3300048920 | Bacteria | 4851 |
| 487 | Ga0496117_0032207 | 3300048920 | Bacteria | 3987 |
| 488 | Ga0496117_0055217 | 3300048920 | Bacteria | 2777 |
| 489 | Ga0496117_0065309 | 3300048920 | Bacteria | 2475 |
| 490 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 491 | Ga0496118_0002904 | 3300048921 | Bacteria | 22291 |
| 492 | Ga0496118_0010634 | 3300048921 | Bacteria | 9085 |
| 493 | Ga0496118_0013144 | 3300048921 | Bacteria | 7857 |
| 494 | Ga0496118_0029235 | 3300048921 | Bacteria | 4626 |
| 495 | Ga0496118_0041646 | 3300048921 | Bacteria | 3633 |
| 496 | Ga0496118_0071453 | 3300048921 | Bacteria | 2498 |
| 497 | Ga0496119_0000678 | 3300048922 | Bacteria | 45442 |
| 498 | Ga0496119_0014493 | 3300048922 | Bacteria | 6161 |
| 499 | Ga0496119_0034908 | 3300048922 | Bacteria | 3302 |
| 500 | Ga0496119_0135895 | 3300048922 | Bacteria | 1333 |
| 501 | Ga0496120_0007629 | 3300048923 | Bacteria | 8017 |
| 502 | Ga0496121_0001367 | 3300048924 | Bacteria | 41529 |
| 503 | Ga0496121_0011982 | 3300048924 | Bacteria | 9533 |
| 504 | Ga0496121_0017363 | 3300048924 | Bacteria | 7357 |
| 505 | Ga0496121_0043649 | 3300048924 | Bacteria | 3879 |
| 506 | Ga0496121_0056235 | 3300048924 | Bacteria | 3269 |
| 507 | Ga0496121_0081336 | 3300048924 | Bacteria | 2564 |
| 508 | Ga0496121_0094326 | 3300048924 | Bacteria | 2328 |
| 509 | Ga0496121_0117822 | 3300048924 | Bacteria | 2011 |
| 510 | Ga0496122_0000279 | 3300048925 | Bacteria | 114185 |
| 511 | Ga0496122_0000287 | 3300048925 | Bacteria | 112404 |
| 512 | Ga0496122_0003383 | 3300048925 | Bacteria | 20997 |
| 513 | Ga0496122_0005139 | 3300048925 | Bacteria | 15785 |
| 514 | Ga0496122_0012084 | 3300048925 | Bacteria | 8654 |
| 515 | Ga0496122_0017366 | 3300048925 | Bacteria | 6733 |
| 516 | Ga0496122_0033588 | 3300048925 | Bacteria | 4216 |
| 517 | Ga0496122_0039175 | 3300048925 | Bacteria | 3782 |
| 518 | Ga0496122_0040356 | 3300048925 | Bacteria | 3710 |
| 519 | Ga0496122_0075124 | 3300048925 | Bacteria | 2386 |
| 520 | Ga0496122_0130055 | 3300048925 | Bacteria | 1602 |
| 521 | Ga0496123_0000146 | 3300048926 | Bacteria | 143990 |
| 522 | Ga0496123_0001342 | 3300048926 | Bacteria | 34737 |
| 523 | Ga0496123_0005602 | 3300048926 | Bacteria | 12555 |
| 524 | Ga0496123_0005726 | 3300048926 | Bacteria | 12379 |
| 525 | Ga0496123_0010773 | 3300048926 | Bacteria | 8023 |
| 526 | Ga0496123_0016107 | 3300048926 | Bacteria | 6091 |
| 527 | Ga0496123_0021444 | 3300048926 | Bacteria | 5021 |
| 528 | Ga0496123_0049229 | 3300048926 | Bacteria | 2827 |
| 529 | Ga0496123_0053468 | 3300048926 | Bacteria | 2668 |
| 530 | Ga0496123_0082517 | 3300048926 | Bacteria | 1948 |
| 531 | Ga0496123_0084908 | 3300048926 | Bacteria | 1907 |
| 532 | Ga0496124_0000043 | 3300048927 | Bacteria | 300907 |
| 533 | Ga0496124_0000232 | 3300048927 | Bacteria | 108986 |
| 534 | Ga0496124_0000343 | 3300048927 | Bacteria | 85220 |
| 535 | Ga0496124_0002777 | 3300048927 | Bacteria | 22248 |
| 536 | Ga0496124_0002928 | 3300048927 | Bacteria | 21499 |
| 537 | Ga0496124_0028074 | 3300048927 | Bacteria | 5037 |
| 538 | Ga0496124_0032533 | 3300048927 | Bacteria | 4603 |
| 539 | Ga0496124_0038378 | 3300048927 | Bacteria | 4160 |
| 540 | Ga0496124_0055799 | 3300048927 | Bacteria | 3336 |
| 541 | Ga0496124_0114468 | 3300048927 | Bacteria | 2166 |
| 542 | Ga0496124_0123284 | 3300048927 | Bacteria | 2068 |
| 543 | Ga0496124_0173271 | 3300048927 | Bacteria | 1668 |
| 544 | Ga0496125_0000525 | 3300048928 | Bacteria | 66539 |
| 545 | Ga0496125_0009938 | 3300048928 | Bacteria | 9672 |
| 546 | Ga0496125_0010075 | 3300048928 | Bacteria | 9588 |
| 547 | Ga0496125_0030997 | 3300048928 | Bacteria | 4774 |
| 548 | Ga0496125_0034181 | 3300048928 | Bacteria | 4485 |
| 549 | Ga0496125_0037628 | 3300048928 | Bacteria | 4204 |
| 550 | Ga0496125_0104313 | 3300048928 | Bacteria | 2077 |
| 551 | Ga0496125_0179631 | 3300048928 | Bacteria | 1412 |
| 552 | Ga0496126_0000890 | 3300048929 | Bacteria | 52336 |
| 553 | Ga0496126_0001437 | 3300048929 | Bacteria | 37376 |
| 554 | Ga0496126_0016491 | 3300048929 | Bacteria | 7383 |
| 555 | Ga0496126_0206978 | 3300048929 | Bacteria | 1653 |
| 556 | Ga0501034_0056018 | 3300049571 | Bacteria | 3968 |
| 557 | Ga0501034_0537780 | 3300049571 | Bacteria | 1079 |
| 558 | Ga0501036_0333037 | 3300049572 | Bacteria | 1268 |
| 559 | Ga0501047_0004596 | 3300049581 | Bacteria | 12981 |
| 560 | Ga0501044_0014603 | 3300049823 | Bacteria | 8469 |
| 561 | Ga0501044_0102610 | 3300049823 | Bacteria | 2876 |
| 562 | Ga0501044_0615272 | 3300049823 | Bacteria | 978 |
| 563 | nmdc:mga03683_2591_c1 | 3300050489 | Bacteria | 5645 |
| 564 | nmdc:mga0yw44_4173_c1 | 3300050492 | Bacteria | 6571 |
| 565 | nmdc:mga06z11_67015_c1 | 3300050494 | Bacteria | 1889 |
| 566 | nmdc:mga07m45_10860_c1 | 3300050496 | Bacteria | 4769 |
| 567 | nmdc:mga07m45_3201_c1 | 3300050496 | Bacteria | 7851 |
| 568 | nmdc:mga07m45_42767_c1 | 3300050496 | Bacteria | 2540 |
| 569 | nmdc:mga08y16_185363_c1 | 3300050511 | Bacteria | 2160 |
| 570 | nmdc:mga0sz30_12277_c1 | 3300050516 | Bacteria | 1975 |
| 571 | nmdc:mga0sz30_12293_c1 | 3300050516 | Bacteria | 3328 |
| 572 | nmdc:mga0sz30_90334_c1 | 3300050516 | Bacteria | 1332 |
| 573 | Ga0495601_0046002 | 3300053077 | Bacteria | 2746 |
| 574 | Ga0495612_0081970 | 3300053078 | Bacteria | 1356 |
| 575 | Ga0500610_0002998 | 3300053079 | Bacteria | 6368 |
| 576 | Ga0495619_0011875 | 3300053085 | Bacteria | 5484 |
| 577 | Ga0500643_060660 | 3300053087 | Bacteria | 1063 |
| 578 | Ga0500556_0000052 | 3300053104 | Bacteria | 117825 |
| 579 | Ga0500569_001663 | 3300053109 | Bacteria | 4238 |
| 580 | Ga0500592_011458 | 3300053116 | Bacteria | 1419 |
| 581 | Ga0500595_004353 | 3300053119 | Bacteria | 6371 |
| 582 | Ga0500618_002324 | 3300053125 | Bacteria | 7295 |
| 583 | Ga0500642_0048629 | 3300053130 | Bacteria | 1863 |
| 584 | Ga0500655_024233 | 3300053133 | Bacteria | 1148 |
| 585 | Ga0500658_0006626 | 3300053134 | Bacteria | 4292 |
| 586 | Ga0500568_0003502 | 3300053139 | Bacteria | 8713 |
| 587 | Ga0500568_0056921 | 3300053139 | Bacteria | 1522 |
| 588 | Ga0500590_075518 | 3300053148 | Bacteria | 1667 |
| 589 | Ga0500619_006419 | 3300053154 | Bacteria | 2710 |
| 590 | Ga0500622_0003787 | 3300053156 | Bacteria | 9863 |
| 591 | Ga0500622_0014724 | 3300053156 | Bacteria | 4194 |
| 592 | Ga0500627_0036194 | 3300053158 | Bacteria | 2101 |
| 593 | Ga0500633_0000648 | 3300053160 | Bacteria | 5809 |
| 594 | Ga0500636_0034674 | 3300053177 | Bacteria | 2987 |
| 595 | Ga0500645_000083 | 3300053730 | Bacteria | 76285 |
| 596 | Ga0500645_027123 | 3300053730 | Bacteria | 1738 |
| 597 | Ga0500596_003000 | 3300053735 | Bacteria | 3256 |
| 598 | Ga0466962_0140248 | 3300061719 | Bacteria | 1171 |
| 599 | Ga0466962_0165628 | 3300061719 | Bacteria | 1075 |
| 600 | 2509391897 | 2509276021 | Bacteria | 7634384 |
| 601 | 2509447247 | 2509276033 | Bacteria | 7180565 |
| 602 | 2510308190 | 2510065057 | Bacteria | 6649661 |
| 603 | 2510895511 | 2510461076 | Bacteria | 8618824 |
| 604 | 2511136751 | 2510917022 | Bacteria | 6504556 |
| 605 | 2511199160 | 2510917030 | Bacteria | 7460662 |
| 606 | 2511500185 | 2511231052 | Bacteria | 6974333 |
| 607 | 2512532903 | 2512047086 | Bacteria | 6850303 |
| 608 | 2513567842 | 2513237084 | Bacteria | 7231967 |
| 609 | 2513577084 | 2513237085 | Bacteria | 7695351 |
| 610 | 2513590897 | 2513237087 | Bacteria | 5817514 |
| 611 | 2513619865 | 2513237091 | Bacteria | 6900273 |
| 612 | 2513633249 | 2513237093 | Bacteria | 7545552 |
| 613 | 2513707745 | 2513237103 | Bacteria | 7647401 |
| 614 | 2513886208 | 2513237140 | Bacteria | 7076289 |
| 615 | 2513905845 | 2513237143 | Bacteria | 6664116 |
| 616 | 2514018175 | 2513237162 | Bacteria | 7468464 |
| 617 | 2515113188 | 2515075009 | Bacteria | 7288508 |
| 618 | 2515611381 | 2515154107 | Bacteria | 6795637 |
| 619 | 2515638036 | 2515154113 | Bacteria | 7807172 |
| 620 | 2515645795 | 2515154114 | Bacteria | 7848616 |
| 621 | 2515655217 | 2515154116 | Bacteria | 7552979 |
| 622 | 2515739618 | 2515154134 | Bacteria | 7220242 |
| 623 | 2516897712 | 2516653046 | Bacteria | 6989037 |
| 624 | 2517036850 | 2516653077 | Bacteria | 7555578 |
| 625 | 2517077214 | 2516653085 | Bacteria | 7346596 |
| 626 | 2517095962 | 2517093000 | Bacteria | 7412387 |
| 627 | 2517407585 | 2517287029 | Bacteria | 6905599 |
| 628 | 2519462200 | 2519103095 | Bacteria | 6629912 |
| 629 | 2524453632 | 2524023207 | Bacteria | 6813453 |
| 630 | 2524611548 | 2524023250 | Bacteria | 5457705 |
| 631 | 2545675074 | 2545555834 | Bacteria | 8130841 |
| 632 | 2551711956 | 2551306089 | Bacteria | 7162724 |
| 633 | 2551725300 | 2551306091 | Bacteria | 7086830 |
| 634 | 2585222990 | 2582581298 | Bacteria | 7315509 |
| 635 | 2585271259 | 2582581307 | Bacteria | 6597605 |
| 636 | 2585279197 | 2582581308 | Bacteria | 7413247 |
| 637 | 2585294816 | 2582581311 | Bacteria | 6763856 |
| 638 | 2585323200 | 2582581315 | Bacteria | 7318924 |
| 639 | 2585331305 | 2582581316 | Bacteria | 7774528 |
| 640 | 2585524641 | 2585427526 | Bacteria | 7258840 |
| 641 | 2585531318 | 2585427527 | Bacteria | 7273426 |
| 642 | 2585538329 | 2585427528 | Bacteria | 6842387 |
| 643 | 2585545573 | 2585427529 | Bacteria | 7395659 |
| 644 | 2585552759 | 2585427530 | Bacteria | 7383882 |
| 645 | 2585559004 | 2585427531 | Bacteria | 6992870 |
| 646 | 2585836282 | 2585427593 | Bacteria | 7141551 |
| 647 | 2585904049 | 2585427609 | Bacteria | 6667127 |
| 648 | 2587980833 | 2585428125 | Bacteria | 6662905 |
| 649 | 2599734389 | 2599185239 | Bacteria | 8686614 |
| 650 | 2599747478 | 2599185240 | Bacteria | 7968121 |
| 651 | 2600203907 | 2599185354 | Bacteria | 4398675 |
| 652 | 2600209362 | 2599185355 | Bacteria | 7968906 |
| 653 | 2616311364 | 2615840626 | Bacteria | 7921970 |
| 654 | 2616554378 | 2615840698 | Bacteria | 7319877 |
| 655 | 2617383681 | 2617270742 | Bacteria | 6808054 |
| 656 | 2643856664 | 2643221568 | Bacteria | 5187270 |
| 657 | 2671111300 | 2667528174 | Bacteria | 6435400 |
| 658 | 2676746090 | 2675903129 | Bacteria | 7964495 |
| 659 | 2719181928 | 2718217882 | Bacteria | 6556348 |
| 660 | 2719386540 | 2718217927 | Bacteria | 6972593 |
| 661 | 2719732645 | 2718218009 | Bacteria | 6478651 |
| 662 | 2720614177 | 2718218232 | Bacteria | 6720332 |
| 663 | 2720620945 | 2718218233 | Bacteria | 6662049 |
| 664 | 2720632269 | 2718218235 | Bacteria | 6630699 |
| 665 | 2720775997 | 2718218269 | Bacteria | 6906114 |
| 666 | 2721148019 | 2718218363 | Bacteria | 6524337 |
| 667 | 2721159470 | 2718218365 | Bacteria | 6274507 |
| 668 | 2721164855 | 2718218366 | Bacteria | 6425255 |
| 669 | 2721400244 | 2718218423 | Bacteria | 6438183 |
| 670 | 2722841025 | 2721755514 | Bacteria | 6424414 |
| 671 | 2723027595 | 2721755556 | Bacteria | 6745503 |
| 672 | 2723561224 | 2721755684 | Bacteria | 6859907 |
| 673 | 2723567847 | 2721755685 | Bacteria | 6704835 |
| 674 | 2724039057 | 2721755809 | Bacteria | 6438790 |
| 675 | 2724045401 | 2721755810 | Bacteria | 6479005 |
| 676 | 2724090604 | 2721755819 | Bacteria | 6906405 |
| 677 | 2724105112 | 2721755822 | Bacteria | 6726041 |
| 678 | 2724110939 | 2721755823 | Bacteria | 6752556 |
| 679 | 2725951471 | 2724679232 | Bacteria | 7646494 |
| 680 | 2730108531 | 2728369352 | Bacteria | 6745171 |
| 681 | 2730165163 | 2728369365 | Bacteria | 6555560 |
| 682 | 2730299102 | 2728369397 | Bacteria | 6274511 |
| 683 | 2739032969 | 2738541333 | Bacteria | 7106503 |
| 684 | 2739054544 | 2738541337 | Bacteria | 6183410 |
| 685 | 2793280181 | 2791355253 | Bacteria | 5171699 |
| 686 | 2793315959 | 2791355259 | Bacteria | 7254731 |
| 687 | 2793319308 | 2791355260 | Bacteria | 6598818 |
| 688 | 2793328393 | 2791355261 | Bacteria | 6661293 |
| 689 | 2793335349 | 2791355262 | Bacteria | 6774204 |
| 690 | 2793339404 | 2791355263 | Bacteria | 6872478 |
| 691 | 2793347118 | 2791355264 | Bacteria | 6429314 |
| 692 | 2793351712 | 2791355265 | Bacteria | 6539969 |
| 693 | 2793362009 | 2791355266 | Bacteria | 7116587 |
| 694 | 2793367763 | 2791355267 | Bacteria | 7222458 |
| 695 | 2805932855 | 2802429606 | Bacteria | 6346811 |
| 696 | 2806045108 | 2802429633 | Bacteria | 7341974 |
| 697 | 2806056936 | 2802429635 | Bacteria | 7650140 |
| 698 | 2806064317 | 2802429636 | Bacteria | 7597525 |
| 699 | 2806071584 | 2802429637 | Bacteria | 7067217 |
| 700 | 2809143736 | 2808606418 | Bacteria | 6724496 |
| 701 | 2817258121 | 2816332253 | Bacteria | 6764532 |
| 702 | 2817281464 | 2816332256 | Bacteria | 6891714 |
| 703 | 2817454171 | 2816332286 | Bacteria | 6853759 |
| 704 | 2819637449 | 2818991452 | Bacteria | 8442785 |
| 705 | 2819641423 | 2818991453 | Bacteria | 7181617 |
| 706 | 2819685061 | 2818991461 | Bacteria | 7026071 |
| 707 | 2819718745 | 2818991467 | Bacteria | 5893227 |
| 708 | 2838021585 | 2838016132 | Bacteria | 6577831 |
| 709 | 2838023723 | 2838022645 | Bacteria | 6494267 |
| 710 | 2838033679 | 2838029111 | Bacteria | 6603031 |
| 711 | 2838045097 | 2838042994 | Bacteria | 6046894 |
| 712 | 2838053420 | 2838048938 | Bacteria | 6044578 |
| 713 | 2838065542 | 2838061910 | Bacteria | 6794874 |
| 714 | 2838070019 | 2838068647 | Bacteria | 6208656 |
| 715 | 2838683326 | 2838680041 | Bacteria | 6545511 |
| 716 | 2838686913 | 2838686498 | Bacteria | 7807632 |
| 717 | 2838697730 | 2838694306 | Bacteria | 6853137 |
| 718 | 2838710846 | 2838707686 | Bacteria | 6619912 |
| 719 | 2838730129 | 2838729681 | Bacteria | 7400765 |
| 720 | 2838742856 | 2838742623 | Bacteria | 7396178 |
| 721 | 2841852359 | 2841851746 | Bacteria | 7532261 |
| 722 | 2841867085 | 2841864319 | Bacteria | 6742987 |
| 723 | 2842079019 | 2842077413 | Bacteria | 6508645 |
| 724 | 2842113133 | 2842110456 | Bacteria | 7656360 |
| 725 | 2842118471 | 2842118031 | Bacteria | 7033875 |
| 726 | 2842158183 | 2842156927 | Bacteria | 6894975 |
| 727 | 2842168658 | 2842163707 | Bacteria | 6916235 |
| 728 | 2842181803 | 2842180545 | Bacteria | 6888678 |
| 729 | 2842199237 | 2842198810 | Bacteria | 6608673 |
| 730 | 2842218074 | 2842217011 | Bacteria | 7497767 |
| 731 | 2842230147 | 2842229732 | Bacteria | 7475766 |
| 732 | 2842240382 | 2842237096 | Bacteria | 6620661 |
| 733 | 2842244035 | 2842243621 | Bacteria | 7421798 |
| 734 | 2842257880 | 2842257432 | Bacteria | 7401195 |
| 735 | 2842270830 | 2842264693 | Bacteria | 6472963 |
| 736 | 2842271549 | 2842271015 | Bacteria | 7807131 |
| 737 | 2842292681 | 2842291075 | Bacteria | 7076806 |
| 738 | 2842305180 | 2842304105 | Bacteria | 7023636 |
| 739 | 2842317060 | 2842311132 | Bacteria | 6616990 |
| 740 | 2842347389 | 2842341865 | Bacteria | 7003929 |
| 741 | 2842370197 | 2842363717 | Bacteria | 6844742 |
| 742 | 2842373957 | 2842370503 | Bacteria | 7038661 |
| 743 | 2842379079 | 2842377471 | Bacteria | 7140707 |
| 744 | 2842384981 | 2842384541 | Bacteria | 7057858 |
| 745 | 2842400217 | 2842395702 | Bacteria | 6780583 |
| 746 | 2842423633 | 2842422224 | Bacteria | 6239196 |
| 747 | 2842434713 | 2842428310 | Bacteria | 6767288 |
| 748 | 2842441091 | 2842434925 | Bacteria | 6502746 |
| 749 | 2842447709 | 2842441272 | Bacteria | 6769273 |
| 750 | 2842449422 | 2842447887 | Bacteria | 6754142 |
| 751 | 2842469074 | 2842462802 | Bacteria | 6588055 |
| 752 | 2842475638 | 2842469257 | Bacteria | 6752936 |
| 753 | 2842480426 | 2842475841 | Bacteria | 6603183 |
| 754 | 2842483942 | 2842482326 | Bacteria | 7212537 |
| 755 | 2842496621 | 2842495871 | Bacteria | 6820686 |
| 756 | 2842505353 | 2842502639 | Bacteria | 6604161 |
| 757 | 2842510972 | 2842509118 | Bacteria | 6850950 |
| 758 | 2842917992 | 2842914999 | Bacteria | 4419378 |
| 759 | 2844458210 | 2844454524 | Bacteria | 7952546 |
| 760 | 2852390386 | 2852387548 | Bacteria | 8025568 |
| 761 | 2855830368 | 2855825444 | Bacteria | 6785811 |
| 762 | 2855845853 | 2855839649 | Bacteria | 7135830 |
| 763 | 2857517295 | 2857516855 | Bacteria | 7787325 |
| 764 | 2858805253 | 2858800743 | Bacteria | 6603254 |
| 765 | 2863424083 | 2863421361 | Bacteria | 7300805 |
| 766 | 2896390652 | 2896384573 | Bacteria | 7700774 |
| 767 | 2904567237 | 2904564687 | Bacteria | 7609577 |
| 768 | 2904574282 | 2904571731 | Bacteria | 7608790 |
| 769 | 2915989298 | 2915986958 | Bacteria | 6739310 |
| 770 | 2915995483 | 2915993759 | Bacteria | 7016183 |
| 771 | 2916012565 | 2916007675 | Bacteria | 6898660 |
| 772 | 2916019219 | 2916014648 | Bacteria | 6946486 |
| 773 | 2916026127 | 2916021584 | Bacteria | 6854472 |
| 774 | 2916037241 | 2916035215 | Bacteria | 6755766 |
| 775 | 2916047821 | 2916041962 | Bacteria | 6820487 |
| 776 | 2916053865 | 2916048683 | Bacteria | 6543552 |
| 777 | 2919087675 | 2919085039 | Bacteria | 4532964 |
| 778 | 2919106326 | 2919100787 | Bacteria | 7710546 |
| 779 | 2919410131 | 2919408235 | Bacteria | 6149349 |
| 780 | 2920765944 | 2920760137 | Bacteria | 7427611 |
| 781 | 2921202557 | 2921201388 | Bacteria | 6926299 |
| 782 | 2921214074 | 2921208531 | Bacteria | 6745326 |
| 783 | 2921241701 | 2921237296 | Bacteria | 6876710 |
| 784 | 2921249683 | 2921244191 | Bacteria | 6568419 |
| 785 | 2921284971 | 2921282425 | Bacteria | 6826397 |
| 786 | 2921297483 | 2921296804 | Bacteria | 7176999 |
| 787 | 2924144300 | 2924144063 | Bacteria | 6883928 |
| 788 | 2924151515 | 2924150972 | Bacteria | 7169444 |
| 789 | 2924159393 | 2924158325 | Bacteria | 7188855 |
| 790 | 2924196694 | 2924193448 | Bacteria | 6955718 |
| 791 | 2924201248 | 2924200457 | Bacteria | 6757188 |
| 792 | 2924212446 | 2924207177 | Bacteria | 6917007 |
| 793 | 2924233623 | 2924228884 | Bacteria | 6633132 |
| 794 | 2928029280 | 2928027323 | Bacteria | 4382488 |
| 795 | 2928158697 | 2928157003 | Bacteria | 7522202 |
| 796 | 2928167660 | 2928163908 | Bacteria | 7561269 |
| 797 | 2928174532 | 2928170801 | Bacteria | 8785406 |
| 798 | 2928540596 | 2928536128 | Bacteria | 7657547 |
| 799 | 2928969942 | 2928968154 | Bacteria | 4633371 |
| 800 | 2933570987 | 2933570622 | Bacteria | 7023390 |
| 801 | 2933588810 | 2933586486 | Bacteria | 7667493 |
| 802 | 2933600825 | 2933599457 | Bacteria | 5858799 |
| 803 | 2935896884 | 2935894831 | Bacteria | 6620579 |
| 804 | 2935901820 | 2935901341 | Bacteria | 7341747 |
| 805 | 2936371905 | 2936367885 | Bacteria | 7324495 |
| 806 | 2936379740 | 2936375103 | Bacteria | 6652732 |
| 807 | 2936387486 | 2936381700 | Bacteria | 7006523 |
| 808 | 2936997986 | 2936996657 | Bacteria | 6298727 |
| 809 | 2937007811 | 2937002841 | Bacteria | 6934057 |
| 810 | 2937014663 | 2937009748 | Bacteria | 6746052 |
| 811 | 2937020142 | 2937016420 | Bacteria | 6782579 |
| 812 | 2937051608 | 2937049772 | Bacteria | 6757901 |
| 813 | 2937059488 | 2937056579 | Bacteria | 7107896 |
| 814 | 2937067397 | 2937063883 | Bacteria | 7199456 |
| 815 | 2937096347 | 2937091812 | Bacteria | 6979387 |
| 816 | 2937105794 | 2937098957 | Bacteria | 7249374 |
| 817 | 2937108978 | 2937106411 | Bacteria | 6947143 |
| 818 | 2937116897 | 2937113482 | Bacteria | 6505872 |
| 819 | 2937124883 | 2937119839 | Bacteria | 6597547 |
| 820 | 2946008272 | 2946006987 | Bacteria | 6705746 |
| 821 | 2946788709 | 2946787523 | Bacteria | 4366789 |
| 822 | 2957385460 | 2957382221 | Bacteria | 6737050 |
| 823 | 2957405972 | 2957402308 | Bacteria | 6741770 |
| 824 | 2957409497 | 2957408893 | Bacteria | 6558585 |
| 825 | 2957418720 | 2957415311 | Bacteria | 6991633 |
| 826 | 2957424407 | 2957422303 | Bacteria | 7172205 |
| 827 | 2957430207 | 2957430029 | Bacteria | 7022557 |
| 828 | 2957455142 | 2957450854 | Bacteria | 6765715 |
| 829 | 2957460089 | 2957457609 | Bacteria | 6967680 |
| 830 | 2957464917 | 2957464669 | Bacteria | 6568877 |
| 831 | 2957475318 | 2957471148 | Bacteria | 6797643 |
| 832 | 2957490399 | 2957484790 | Bacteria | 6703082 |
| 833 | 2957492289 | 2957491536 | Bacteria | 6695180 |
| 834 | 2960590701 | 2960584000 | Bacteria | 6864594 |
| 835 | 2960601345 | 2960597568 | Bacteria | 6550735 |
| 836 | 2960606284 | 2960603979 | Bacteria | 6898737 |
| 837 | 2960616011 | 2960610863 | Bacteria | 6691244 |
| 838 | 2960623675 | 2960617483 | Bacteria | 6727748 |
| 839 | 2960643994 | 2960637947 | Bacteria | 7296468 |
| 840 | 2960658468 | 2960652885 | Bacteria | 7083688 |
| 841 | 2960672485 | 2960667422 | Bacteria | 6763020 |
| 842 | 2960678882 | 2960674078 | Bacteria | 6609048 |
| 843 | 2960691683 | 2960687367 | Bacteria | 6535474 |
| 844 | 2964610346 | 2964607997 | Bacteria | 7101408 |
| 845 | 2964624508 | 2964621998 | Bacteria | 6834995 |
| 846 | 2964642184 | 2964636051 | Bacteria | 7091832 |
| 847 | 2964649666 | 2964643177 | Bacteria | 6820887 |
| 848 | 2964655723 | 2964649959 | Bacteria | 6675118 |
| 849 | 2964661199 | 2964656573 | Bacteria | 7100150 |
| 850 | 2964669554 | 2964663802 | Bacteria | 7019362 |
| 851 | 2964670887 | 2964670856 | Bacteria | 6851364 |
| 852 | 2964681941 | 2964678106 | Bacteria | 6792020 |
| 853 | 2964690302 | 2964685014 | Bacteria | 6839111 |
| 854 | 2964695019 | 2964691889 | Bacteria | 6802758 |
| 855 | 2964704260 | 2964698721 | Bacteria | 6765331 |
| 856 | 2964711795 | 2964705432 | Bacteria | 7114648 |
| 857 | 2964713741 | 2964712639 | Bacteria | 6695970 |
| 858 | 2964725340 | 2964719344 | Bacteria | 7286602 |
| 859 | 2967666066 | 2967664464 | Bacteria | 6948836 |
| 860 | 2967675113 | 2967671571 | Bacteria | 7021409 |
| 861 | 2967685414 | 2967678726 | Bacteria | 7264382 |
| 862 | 2967694218 | 2967693043 | Bacteria | 6804451 |
| 863 | 2967700402 | 2967699805 | Bacteria | 6854538 |
| 864 | 2967716017 | 2967714385 | Bacteria | 7000047 |
| 865 | 2967727048 | 2967721400 | Bacteria | 7073753 |
| 866 | 2967739763 | 2967735183 | Bacteria | 6827012 |
| 867 | 2967745345 | 2967742019 | Bacteria | 6794534 |
| 868 | 2967750324 | 2967748971 | Bacteria | 6733771 |
| 869 | 2967767458 | 2967762386 | Bacteria | 6923502 |
| 870 | 2967770144 | 2967769361 | Bacteria | 6587838 |
| 871 | 2970019893 | 2970019648 | Bacteria | 7072033 |
| 872 | 2970037397 | 2970033650 | Bacteria | 7118744 |
| 873 | 2970043143 | 2970040964 | Bacteria | 6731123 |
| 874 | 2970050226 | 2970047711 | Bacteria | 7088379 |
| 875 | 2970060625 | 2970054988 | Bacteria | 6611507 |
| 876 | 2970064365 | 2970061556 | Bacteria | 7099761 |
| 877 | 2970072707 | 2970068827 | Bacteria | 7123112 |
| 878 | 2970076608 | 2970076120 | Bacteria | 6697332 |
| 879 | 2970087439 | 2970082768 | Bacteria | 6183754 |
| 880 | 2970095175 | 2970088815 | Bacteria | 6933825 |
| 881 | 2970114088 | 2970109326 | Bacteria | 6863976 |
| 882 | 2970119947 | 2970116247 | Bacteria | 6501857 |
| 883 | 2970130853 | 2970129317 | Bacteria | 6806560 |
| 884 | 2970154835 | 2970149975 | Bacteria | 6779706 |
| 885 | 2970158203 | 2970156795 | Bacteria | 7168044 |
| 886 | 2970165241 | 2970164137 | Bacteria | 6861252 |
| 887 | 2970175309 | 2970170962 | Bacteria | 6876229 |
| 888 | 2970184815 | 2970184632 | Bacteria | 7054431 |
| 889 | 2977523023 | 2977516862 | Bacteria | 6940108 |
| 890 | 2977524311 | 2977523885 | Bacteria | 6960446 |
| 891 | 2977539241 | 2977537788 | Bacteria | 6929320 |
| 892 | 2977558797 | 2977551784 | Bacteria | 7125765 |
| 893 | 2977564202 | 2977558990 | Bacteria | 6863948 |
| 894 | 2977571163 | 2977565890 | Bacteria | 6901543 |
| 895 | 2977576826 | 2977572785 | Bacteria | 6763888 |
| 896 | 2977580571 | 2977579622 | Bacteria | 6772100 |
| 897 | 2981992183 | 2981990288 | Bacteria | 7590678 |
| 898 | 2984590102 | 2984587000 | Bacteria | 5263363 |
| 899 | 2995395093 | 2995392953 | Bacteria | 4539380 |
| 900 | 2996895013 | 2996893221 | Bacteria | 5823108 |
| 901 | 3003671281 | 3003665799 | Bacteria | 7279786 |
| 902 | 3005448585 | 3005445848 | Bacteria | 6906074 |
| 903 | 639649309 | 639633055 | Bacteria | 7751309 |
| 904 | 641645879 | 641522639 | Bacteria | 7737025 |
| 905 | 642419921 | 641736154 | Bacteria | 7689995 |
| 906 | 648738534 | 648276728 | Bacteria | 6968865 |
| 907 | 8003997652 | 8003992118 | Bacteria | 7266902 |
| 908 | 8005281344 | 8005275841 | Bacteria | 6929066 |
| 909 | 8005284684 | 8005282627 | Bacteria | 6675747 |
| 910 | 8005295650 | 8005289223 | Bacteria | 6634003 |
| 911 | 8005303260 | 8005301065 | Bacteria | 6614431 |
| 912 | 8005309527 | 8005307578 | Bacteria | 7395396 |
| 913 | 8005381061 | 8005376324 | Bacteria | 6590079 |
| 914 | 8005388991 | 8005382845 | Bacteria | 6732062 |
| 915 | 8005437414 | 8005430974 | Bacteria | 6689030 |
| 916 | 8005463871 | 8005460587 | Bacteria | 7157962 |
| 917 | 8005501028 | 8005497431 | Bacteria | 6477605 |
| 918 | 8005556886 | 8005556819 | Bacteria | 6908598 |
| 919 | 8005568130 | 8005563573 | Bacteria | 7153261 |
| 920 | 8005573329 | 8005570704 | Bacteria | 6957481 |
| 921 | 8005622395 | 8005619151 | Bacteria | 7030230 |
| 922 | 8005629895 | 8005626139 | Bacteria | 6534237 |
| 923 | 8005672445 | 8005668836 | Bacteria | 6953162 |
| 924 | 8005682760 | 8005682033 | Bacteria | 6726518 |
| 925 | 8005691967 | 8005688590 | Bacteria | 6610080 |
| 926 | 8005697538 | 8005695170 | Bacteria | 6912330 |
| 927 | 8018164440 | 8018163183 | Bacteria | 7277977 |
| 928 | 8018176920 | 8018176218 | Bacteria | 6896178 |
| 929 | 8018850110 | 8018845410 | Bacteria | 8933938 |
| 930 | 8020813680 | 8020807995 | Bacteria | 6801506 |
| 931 | 8020942721 | 8020938398 | Bacteria | 7472757 |
| 932 | 8020952891 | 8020945358 | Bacteria | 8467355 |
| 933 | 8020957728 | 8020953355 | Bacteria | 7439080 |
| 934 | 8021121453 | 8021120328 | Bacteria | 8782274 |
| 935 | 8023683033 | 8023680758 | Bacteria | 7729763 |
| 936 | 8024482735 | 8024479707 | Bacteria | 6954785 |
| 937 | 8039100099 | 8039098773 | Bacteria | 6602928 |
| 938 | 8040171125 | 8040167225 | Bacteria | 6542727 |
| 939 | 8040179167 | 8040173305 | Bacteria | 6827067 |
| 940 | 8046771812 | 8046767195 | Bacteria | 7547379 |
| 941 | 8056378270 | 8056375014 | Bacteria | 7006639 |
| 942 | 8056384288 | 8056382006 | Bacteria | 6408074 |
| 943 | 8057102384 | 8057101203 | Bacteria | 5034064 |
| 944 | 8057575570 | 8057575449 | Bacteria | 7367519 |
| 945 | 8057878450 | 8057874678 | Bacteria | 7494653 |
| 946 | Ga0500658_0005036 | |||
| 947 | JGI24740J21852_10000491 | |||
| 948 | JGI24737J22298_10006149 | |||
| 949 | JGI25155J39150_1000044 | |||
| 950 | JGI25156J39149_1000058 | |||
| 951 | JGI25162J39368_1001111 | |||
| 952 | JGI25154J39366_1000236 | |||
| 953 | JGI25158J39367_1000019 | |||
| 954 | JGI25157J39369_1000078 | |||
| 955 | JGI25152J39213_1008101 | |||
| 956 | JGI25152J39213_1009714 | |||
| 957 | JGI25159J45721_1000393 | |||
| 958 | JGI25159J45721_1001256 | |||
| 959 | JGI25151J46595_10001000 | |||
| 960 | JGI25151J46595_10003303 | |||
| 961 | JGI25151J46595_10027236 | |||
| 962 | JGI25165J46597_1002105 | |||
| 963 | JGI25165J46597_1006815 | |||
| 964 | JGI25153J46596_10001757 | |||
| 965 | JGI25153J46596_10005805 | |||
| 966 | rootH1_10002490 | |||
| 967 | rootH1_10154918 | |||
| 968 | rootH2_10104606 | |||
| 969 | rootL2_10000902 | |||
| 970 | rootH1_10073995 | |||
| 971 | rootH1_10091604 | |||
| 972 | JGI25160J50197_1000001 | |||
| 973 | JGI25161J50226_1000001 | |||
| 974 | JGI25161J50226_1000068 | |||
| 975 | Ga0055532_1000337 | |||
| 976 | Ga0055532_1000821 | |||
| 977 | Ga0055532_1000922 | |||
| 978 | Ga0055525_1000119 | |||
| 979 | Ga0055527_1000104 | |||
| 980 | Ga0055527_1000154 | |||
| 981 | Ga0055535_1000218 | |||
| 982 | Ga0055535_1000320 | |||
| 983 | Ga0055542_1000076 | |||
| 984 | Ga0055542_1000153 | |||
| 985 | Ga0055542_1003042 | |||
| 986 | Ga0055529_1000004 | |||
| 987 | Ga0055529_1000176 | |||
| 988 | Ga0055526_1000244 | |||
| 989 | Ga0055526_1001546 | |||
| 990 | Ga0055526_1007492 | |||
| 991 | Ga0055526_1008391 | |||
| 992 | Ga0055526_1033769 | |||
| 993 | Ga0055537_1000178 | |||
| 994 | Ga0055524_1000113 | |||
| 995 | Ga0055524_1002336 | |||
| 996 | Ga0055524_1004246 | |||
| 997 | Ga0055524_1013289 | |||
| 998 | Ga0055528_1000256 | |||
| 999 | Ga0055528_1000261 | |||
| 1000 | Ga0055528_1001003 | |||
| 1001 | Ga0055528_1001848 | |||
| 1002 | Ga0055528_1015200 | |||
| 1003 | Ga0055528_1020168 | |||
| 1004 | Ga0055530_10002177 | |||
| 1005 | Ga0055540_1000268 | |||
| 1006 | Ga0055540_1004141 | |||
| 1007 | Ga0055540_1010129 | |||
| 1008 | Ga0055540_1016808 | |||
| 1009 | Ga0055540_1020546 | |||
| 1010 | Ga0055531_10000494 | |||
| 1011 | Ga0055531_10015091 | |||
| 1012 | Ga0055543_1000003 | |||
| 1013 | Ga0055543_1000470 | |||
| 1014 | Ga0065165_1000335 | |||
| 1015 | Ga0065165_1006900 | |||
| 1016 | Ga0065714_10069269 | |||
| 1017 | Ga0070658_10002454 | |||
| 1018 | Ga0070658_10023533 | |||
| 1019 | Ga0070666_10000023 | |||
| 1020 | Ga0070660_100000808 | |||
| 1021 | Ga0070660_100002392 | |||
| 1022 | Ga0070661_100020019 | |||
| 1023 | Ga0070661_100072065 | |||
| 1024 | Ga0070668_100063326 | |||
| 1025 | Ga0070669_100100499 | |||
| 1026 | Ga0070674_100016877 | |||
| 1027 | Ga0070659_100000012 | |||
| 1028 | Ga0070667_100007705 | |||
| 1029 | Ga0070667_100021962 | |||
| 1030 | Ga0070667_100328962 | |||
| 1031 | Ga0070663_100000530 | |||
| 1032 | Ga0070678_100000786 | |||
| 1033 | Ga0068867_100056815 | |||
| 1034 | Ga0070672_100010194 | |||
| 1035 | Ga0070672_100053334 | |||
| 1036 | Ga0070665_100010169 | |||
| 1037 | Ga0070665_100174378 | |||
| 1038 | Ga0068855_100068316 | |||
| 1039 | Ga0070664_100060423 | |||
| 1040 | Ga0068857_100107544 | |||
| 1041 | Ga0068857_100132824 | |||
| 1042 | Ga0068854_100028189 | |||
| 1043 | Ga0068854_100055631 | |||
| 1044 | Ga0068852_100064479 | |||
| 1045 | Ga0068851_10113937 | |||
| 1046 | Ga0068858_100130717 | |||
| 1047 | Ga0068860_100017387 | |||
| 1048 | Ga0068862_100133515 | |||
| 1049 | Ga0075365_10008493 | |||
| 1050 | Ga0075363_100018898 | |||
| 1051 | Ga0070712_100180099 | |||
| 1052 | Ga0075362_10007517 | |||
| 1053 | Ga0075369_10005897 | |||
| 1054 | Ga0075369_10017667 | |||
| 1055 | Ga0075369_10112159 | |||
| 1056 | Ga0075366_10003422 | |||
| 1057 | Ga0075370_10004016 | |||
| 1058 | Ga0075370_10048128 | |||
| 1059 | Ga0075370_10084033 | |||
| 1060 | Ga0075370_10104724 | |||
| 1061 | Ga0068865_100023745 | |||
| 1062 | Ga0079104_1000056 | |||
| 1063 | Ga0105244_10033305 | |||
| 1064 | Ga0105240_10001781 | |||
| 1065 | Ga0105240_10143890 | |||
| 1066 | Ga0111539_10076168 | |||
| 1067 | Ga0105243_10000812 | |||
| 1068 | Ga0105241_10003240 | |||
| 1069 | Ga0105237_10001251 | |||
| 1070 | Ga0105237_10030427 | |||
| 1071 | Ga0105237_10081269 | |||
| 1072 | Ga0105237_10128351 | |||
| 1073 | Ga0105237_10804532 | |||
| 1074 | Ga0105238_10000331 | |||
| 1075 | Ga0105238_10035972 | |||
| 1076 | Ga0105238_10048861 | |||
| 1077 | Ga0123341_1000028 | |||
| 1078 | Ga0123342_1028435 | |||
| 1079 | Ga0105239_10035459 | |||
| 1080 | Ga0105239_10060729 | |||
| 1081 | Ga0105239_10179572 | |||
| 1082 | Ga0157371_10000197 | |||
| 1083 | Ga0157371_10016751 | |||
| 1084 | Ga0157370_10000248 | |||
| 1085 | Ga0157370_10001042 | |||
| 1086 | Ga0157370_10236176 | |||
| 1087 | Ga0157369_10111065 | |||
| 1088 | Ga0163162_10001650 | |||
| 1089 | Ga0157372_10068297 | |||
| 1090 | Ga0157375_10202886 | |||
| 1091 | Ga0182007_10003611 | |||
| 1092 | Ga0182007_10004059 | |||
| 1093 | Ga0182007_10004378 | |||
| 1094 | Ga0182005_1000173 | |||
| 1095 | Ga0163161_10043529 | |||
| 1096 | Ga0214543_1009579 | |||
| 1097 | Ga0213876_10035238 | |||
| 1098 | Ga0209435_100054 | |||
| 1099 | Ga0209436_100070 | |||
| 1100 | Ga0209566_100442 | |||
| 1101 | Ga0209674_105923 | |||
| 1102 | Ga0209672_100032 | |||
| 1103 | Ga0209672_100042 | |||
| 1104 | Ga0209147_100012 | |||
| 1105 | Ga0209147_100046 | |||
| 1106 | Ga0209147_100052 | |||
| 1107 | Ga0209563_100024 | |||
| 1108 | Ga0209563_101162 | |||
| 1109 | Ga0209437_100098 | |||
| 1110 | Ga0209258_100030 | |||
| 1111 | Ga0209258_100073 | |||
| 1112 | Ga0207425_1001479 | |||
| 1113 | Ga0207425_1012055 | |||
| 1114 | Ga0209646_1000170 | |||
| 1115 | Ga0209026_1000193 | |||
| 1116 | Ga0209148_1000008 | |||
| 1117 | Ga0209148_1000022 | |||
| 1118 | Ga0209148_1000821 | |||
| 1119 | Ga0209759_1000222 | |||
| 1120 | Ga0209129_1000252 | |||
| 1121 | Ga0209129_1002985 | |||
| 1122 | Ga0209129_1018814 | |||
| 1123 | Ga0209233_1000095 | |||
| 1124 | Ga0209233_1000148 | |||
| 1125 | Ga0209565_1000003 | |||
| 1126 | Ga0209455_1000002 | |||
| 1127 | Ga0209455_1000024 | |||
| 1128 | Ga0209455_1000324 | |||
| 1129 | Ga0209673_1000010 | |||
| 1130 | Ga0209673_1000017 | |||
| 1131 | Ga0209673_1000021 | |||
| 1132 | Ga0209673_1000025 | |||
| 1133 | Ga0209673_1001232 | |||
| 1134 | Ga0209673_1004332 | |||
| 1135 | Ga0209673_1007335 | |||
| 1136 | Ga0209673_1024673 | |||
| 1137 | Ga0209130_1000003 | |||
| 1138 | Ga0209130_1000020 | |||
| 1139 | Ga0209675_1000119 | |||
| 1140 | Ga0209675_1028059 | |||
| 1141 | Ga0209676_1025937 | |||
| 1142 | Ga0209025_1000091 | |||
| 1143 | Ga0209025_1002551 | |||
| 1144 | Ga0209025_1004772 | |||
| 1145 | Ga0209025_1016097 | |||
| 1146 | Ga0209564_1000016 | |||
| 1147 | Ga0209564_1000588 | |||
| 1148 | Ga0209564_1000644 | |||
| 1149 | Ga0209564_1000883 | |||
| 1150 | Ga0209564_1007448 | |||
| 1151 | Ga0209564_1012085 | |||
| 1152 | Ga0209758_1000007 | |||
| 1153 | Ga0209758_1001217 | |||
| 1154 | Ga0209758_1001343 | |||
| 1155 | Ga0209758_1001396 | |||
| 1156 | Ga0209758_1018413 | |||
| 1157 | Ga0209758_1018414 | |||
| 1158 | Ga0209050_1001510 | |||
| 1159 | Ga0209050_1002600 | |||
| 1160 | Ga0209050_1019579 | |||
| 1161 | Ga0209256_1000049 | |||
| 1162 | Ga0209256_1000210 | |||
| 1163 | Ga0209256_1000924 | |||
| 1164 | Ga0209256_1002389 | |||
| 1165 | Ga0209256_1011242 | |||
| 1166 | Ga0209256_1023488 | |||
| 1167 | Ga0207426_1000008 | |||
| 1168 | Ga0207426_1000011 | |||
| 1169 | Ga0209051_1000029 | |||
| 1170 | Ga0209051_1000196 | |||
| 1171 | Ga0209051_1000400 | |||
| 1172 | Ga0209051_1004736 | |||
| 1173 | Ga0209051_1006706 | |||
| 1174 | Ga0209051_1035357 | |||
| 1175 | Ga0209257_1000168 | |||
| 1176 | Ga0209257_1000305 | |||
| 1177 | Ga0209257_1001180 | |||
| 1178 | Ga0207655_1070987 | |||
| 1179 | Ga0207680_10000002 | |||
| 1180 | Ga0207647_10184401 | |||
| 1181 | Ga0207705_10000489 | |||
| 1182 | Ga0207705_10002172 | |||
| 1183 | Ga0207705_10009527 | |||
| 1184 | Ga0207654_10000273 | |||
| 1185 | Ga0207695_10000037 | |||
| 1186 | Ga0207695_10001076 | |||
| 1187 | Ga0207695_10029433 | |||
| 1188 | Ga0207671_10004383 | |||
| 1189 | Ga0207671_10008263 | |||
| 1190 | Ga0207671_10018796 | |||
| 1191 | Ga0207693_10146142 | |||
| 1192 | Ga0207657_10000013 | |||
| 1193 | Ga0207657_10005166 | |||
| 1194 | Ga0207657_10027577 | |||
| 1195 | Ga0207649_10000443 | |||
| 1196 | Ga0207649_10011842 | |||
| 1197 | Ga0207694_10000253 | |||
| 1198 | Ga0207694_10028372 | |||
| 1199 | Ga0207694_10065008 | |||
| 1200 | Ga0207694_10148721 | |||
| 1201 | Ga0207690_10000048 | |||
| 1202 | Ga0207690_10014663 | |||
| 1203 | Ga0207706_10069437 | |||
| 1204 | Ga0207709_10000005 | |||
| 1205 | Ga0207669_10000251 | |||
| 1206 | Ga0207691_10026111 | |||
| 1207 | Ga0207691_10065584 | |||
| 1208 | Ga0207679_10044049 | |||
| 1209 | Ga0207667_10000001 | |||
| 1210 | Ga0207667_10007355 | |||
| 1211 | Ga0207667_10038463 | |||
| 1212 | Ga0207667_10074482 | |||
| 1213 | Ga0207668_10049653 | |||
| 1214 | Ga0207668_10238403 | |||
| 1215 | Ga0207640_10001706 | |||
| 1216 | Ga0207640_10026274 | |||
| 1217 | Ga0207658_10003699 | |||
| 1218 | Ga0207658_10327777 | |||
| 1219 | Ga0207639_10025615 | |||
| 1220 | Ga0207639_10205790 | |||
| 1221 | Ga0207678_10001175 | |||
| 1222 | Ga0207702_10156415 | |||
| 1223 | Ga0207648_10031438 | |||
| 1224 | Ga0207674_10171368 | |||
| 1225 | Ga0207674_10382261 | |||
| 1226 | Ga0207683_10008013 | |||
| 1227 | Ga0207698_10008335 | |||
| 1228 | Ga0209281_1000125 | |||
| 1229 | Ga0209281_1001633 | |||
| 1230 | Ga0209371_1000767 | |||
| 1231 | Ga0209371_1007474 | |||
| 1232 | Ga0268266_10000004 | |||
| 1233 | Ga0268266_10071099 | |||
| 1234 | Ga0268264_10026646 | |||
| 1235 | Ga0307515_10021842 | |||
| 1236 | Ga0307515_10044147 | |||
| 1237 | Ga0265338_10017549 | |||
| 1238 | Ga0268256_1000381 | |||
| 1239 | Ga0268256_1034045 | |||
| 1240 | Ga0316177_1132731 | |||
| 1241 | Ga0265328_10016351 | |||
| 1242 | Ga0265327_10007500 | |||
| 1243 | Ga0307509_10203133 | |||
| 1244 | Ga0307405_10286904 | |||
| 1245 | Ga0307412_10000279 | |||
| 1246 | Ga0307510_10001025 | |||
| 1247 | Ga0307510_10030018 | |||
| 1248 | Ga0307510_10156361 | |||
| 1249 | Ga0373959_0021938 | |||
| 1250 | Ga0373939_0001752 | |||
| 1251 | Ga0373960_0039436 | |||
| 1252 | Ga0373931_0009437 | |||
| 1253 | Ga0395900_0009732 | |||
| 1254 | Ga0395900_0124638 | |||
| 1255 | Ga0395900_0593518 | |||
| 1256 | Ga0395898_0002817 | |||
| 1257 | Ga0395905_0000836 | |||
| 1258 | Ga0395905_0001684 | |||
| 1259 | Ga0395905_0003242 | |||
| 1260 | Ga0436364_0266159 | |||
| 1261 | Ga0436364_1191496 | |||
| 1262 | Ga0395901_0000053 | |||
| 1263 | Ga0395901_0000771 | |||
| 1264 | Ga0395901_0051719 | |||
| 1265 | Ga0436365_1903073 | |||
| 1266 | Ga0436363_0094623 | |||
| 1267 | Ga0451797_1009375 | |||
| 1268 | Ga0451802_0590003 | |||
| 1269 | Ga0451802_0864319 | |||
| 1270 | Ga0451806_273572 | |||
| 1271 | Ga0451807_0250052 | |||
| 1272 | Ga0451807_0394883 | |||
| 1273 | Ga0451833_0097459 | |||
| 1274 | Ga0451837_0500608 | |||
| 1275 | Ga0451837_1125556 | |||
| 1276 | Ga0451849_1051639 | |||
| 1277 | Ga0451843_0511692 | |||
| 1278 | Ga0451853_1537113 | |||
| 1279 | Ga0439448_0046940 | |||
| 1280 | Ga0439449_0019623 | |||
| 1281 | Ga0466969_0048147 | |||
| 1282 | Ga0466972_0031098 | |||
| 1283 | Ga0466973_0073639 | |||
| 1284 | Ga0466965_0002833 | |||
| 1285 | Ga0466965_0074376 | |||
| 1286 | Ga0466966_0024442 | |||
| 1287 | Ga0466966_0030275 | |||
| 1288 | Ga0466961_0068600 | |||
| 1289 | Ga0466963_0000775 | |||
| 1290 | Ga0466971_0027711 | |||
| 1291 | Ga0466968_0001146 | |||
| 1292 | Ga0466968_0054845 | |||
| 1293 | Ga0466970_0004290 | |||
| 1294 | Ga0466957_0007192 | |||
| 1295 | Ga0466957_0014397 | |||
| 1296 | Ga0466957_0103143 | |||
| 1297 | Ga0466959_0038026 | |||
| 1298 | Ga0451576_0046970 | |||
| 1299 | Ga0466958_0112472 | |||
| 1300 | Ga0495591_000038 | |||
| 1301 | Ga0495591_002043 | |||
| 1302 | Ga0495629_0011780 | |||
| 1303 | Ga0495629_0099923 | |||
| 1304 | Ga0495650_0000074 | |||
| 1305 | Ga0495650_0000085 | |||
| 1306 | Ga0495650_0000792 | |||
| 1307 | Ga0495605_0013342 | |||
| 1308 | Ga0495605_0019640 | |||
| 1309 | Ga0495584_0000234 | |||
| 1310 | Ga0495584_0004488 | |||
| 1311 | Ga0495584_0017295 | |||
| 1312 | Ga0495585_0000503 | |||
| 1313 | Ga0495585_0027601 | |||
| 1314 | Ga0495585_0044443 | |||
| 1315 | Ga0495596_0000353 | |||
| 1316 | Ga0495607_0002423 | |||
| 1317 | Ga0495607_0010757 | |||
| 1318 | Ga0495607_0012593 | |||
| 1319 | Ga0495607_0016048 | |||
| 1320 | Ga0495583_0003563 | |||
| 1321 | Ga0495583_0004282 | |||
| 1322 | Ga0495583_0007004 | |||
| 1323 | Ga0495583_0034415 | |||
| 1324 | Ga0495583_0037583 | |||
| 1325 | Ga0495583_0049900 | |||
| 1326 | Ga0495606_0003262 | |||
| 1327 | Ga0495606_0004275 | |||
| 1328 | Ga0495606_0023312 | |||
| 1329 | Ga0495606_0053380 | |||
| 1330 | Ga0495610_0035819 | |||
| 1331 | Ga0495610_0063514 | |||
| 1332 | Ga0495616_0005239 | |||
| 1333 | Ga0495616_0054958 | |||
| 1334 | Ga0495616_0057988 | |||
| 1335 | Ga0495620_0021011 | |||
| 1336 | Ga0495630_0320565 | |||
| 1337 | Ga0495631_0014736 | |||
| 1338 | Ga0495631_0024247 | |||
| 1339 | Ga0495631_0034272 | |||
| 1340 | Ga0495632_0051326 | |||
| 1341 | Ga0495643_0003546 | |||
| 1342 | Ga0495643_0023729 | |||
| 1343 | Ga0495643_0155728 | |||
| 1344 | Ga0495644_0020986 | |||
| 1345 | Ga0495648_0000123 | |||
| 1346 | Ga0495648_0001570 | |||
| 1347 | Ga0495648_0033596 | |||
| 1348 | Ga0495663_0003381 | |||
| 1349 | Ga0495654_0030922 | |||
| 1350 | Ga0495609_0000072 | |||
| 1351 | Ga0495609_0001961 | |||
| 1352 | Ga0495609_0015067 | |||
| 1353 | Ga0495609_0047265 | |||
| 1354 | Ga0495597_0010430 | |||
| 1355 | Ga0495656_0000081 | |||
| 1356 | Ga0495668_0047650 | |||
| 1357 | Ga0495668_0177093 | |||
| 1358 | Ga0495611_0001502 | |||
| 1359 | Ga0495611_0018534 | |||
| 1360 | Ga0495611_0046262 | |||
| 1361 | Ga0495625_0016188 | |||
| 1362 | Ga0495625_0017507 | |||
| 1363 | Ga0495625_0028250 | |||
| 1364 | Ga0495625_0059750 | |||
| 1365 | Ga0495625_0083670 | |||
| 1366 | Ga0495661_0000040 | |||
| 1367 | Ga0495661_0000632 | |||
| 1368 | Ga0495661_0035787 | |||
| 1369 | Ga0495661_0039944 | |||
| 1370 | Ga0495661_0131180 | |||
| 1371 | Ga0495669_0000951 | |||
| 1372 | Ga0495669_0002830 | |||
| 1373 | Ga0495669_0016202 | |||
| 1374 | Ga0495670_0036221 | |||
| 1375 | Ga0495671_0067962 | |||
| 1376 | Ga0495649_0008479 | |||
| 1377 | Ga0495649_0104606 | |||
| 1378 | Ga0495589_0012514 | |||
| 1379 | Ga0495589_0016431 | |||
| 1380 | Ga0495600_0029243 | |||
| 1381 | Ga0495660_0042271 | |||
| 1382 | Ga0495674_0043083 | |||
| 1383 | Ga0495672_0001502 | |||
| 1384 | Ga0495672_0023150 | |||
| 1385 | Ga0495672_0070862 | |||
| 1386 | Ga0495676_0110221 | |||
| 1387 | Ga0495683_0000751 | |||
| 1388 | Ga0495683_0006182 | |||
| 1389 | Ga0495683_0102248 | |||
| 1390 | Ga0495687_000181 | |||
| 1391 | Ga0495687_053514 | |||
| 1392 | Ga0495681_0002457 | |||
| 1393 | Ga0495681_0027576 | |||
| 1394 | Ga0495686_0000051 | |||
| 1395 | Ga0495686_0000209 | |||
| 1396 | Ga0495686_0001880 | |||
| 1397 | Ga0495686_0016214 | |||
| 1398 | Ga0495686_0145844 | |||
| 1399 | Ga0495686_0157979 | |||
| 1400 | Ga0495686_0187695 | |||
| 1401 | Ga0495626_0022835 | |||
| 1402 | Ga0495626_0037916 | |||
| 1403 | Ga0496100_0094115 | |||
| 1404 | Ga0496101_0004154 | |||
| 1405 | Ga0496101_0014663 | |||
| 1406 | Ga0496102_0004598 | |||
| 1407 | Ga0496102_0021862 | |||
| 1408 | Ga0496103_0000784 | |||
| 1409 | Ga0496103_0032993 | |||
| 1410 | Ga0496104_0034197 | |||
| 1411 | Ga0496104_0210622 | |||
| 1412 | Ga0496105_0176741 | |||
| 1413 | Ga0496106_0006670 | |||
| 1414 | Ga0496106_0087170 | |||
| 1415 | Ga0496107_0235483 | |||
| 1416 | Ga0496109_0013161 | |||
| 1417 | Ga0496111_0097400 | |||
| 1418 | Ga0496112_0159356 | |||
| 1419 | Ga0496113_0000633 | |||
| 1420 | Ga0496113_0016669 | |||
| 1421 | Ga0496113_0130020 | |||
| 1422 | Ga0496113_0221706 | |||
| 1423 | Ga0496114_0003146 | |||
| 1424 | Ga0496114_0025174 | |||
| 1425 | Ga0496115_0000783 | |||
| 1426 | Ga0496116_0044240 | |||
| 1427 | Ga0496116_0082733 | |||
| 1428 | Ga0496116_0112599 | |||
| 1429 | Ga0496117_0001166 | |||
| 1430 | Ga0496117_0008212 | |||
| 1431 | Ga0496117_0023913 | |||
| 1432 | Ga0496117_0032207 | |||
| 1433 | Ga0496117_0055217 | |||
| 1434 | Ga0496117_0065309 | |||
| 1435 | Ga0496118_0000039 | |||
| 1436 | Ga0496118_0002904 | |||
| 1437 | Ga0496118_0010634 | |||
| 1438 | Ga0496118_0013144 | |||
| 1439 | Ga0496118_0029235 | |||
| 1440 | Ga0496118_0041646 | |||
| 1441 | Ga0496118_0071453 | |||
| 1442 | Ga0496119_0000678 | |||
| 1443 | Ga0496119_0014493 | |||
| 1444 | Ga0496119_0034908 | |||
| 1445 | Ga0496119_0135895 | |||
| 1446 | Ga0496120_0007629 | |||
| 1447 | Ga0496121_0001367 | |||
| 1448 | Ga0496121_0011982 | |||
| 1449 | Ga0496121_0017363 | |||
| 1450 | Ga0496121_0043649 | |||
| 1451 | Ga0496121_0056235 | |||
| 1452 | Ga0496121_0081336 | |||
| 1453 | Ga0496121_0094326 | |||
| 1454 | Ga0496121_0117822 | |||
| 1455 | Ga0496122_0000279 | |||
| 1456 | Ga0496122_0000287 | |||
| 1457 | Ga0496122_0003383 | |||
| 1458 | Ga0496122_0005139 | |||
| 1459 | Ga0496122_0012084 | |||
| 1460 | Ga0496122_0017366 | |||
| 1461 | Ga0496122_0033588 | |||
| 1462 | Ga0496122_0039175 | |||
| 1463 | Ga0496122_0040356 | |||
| 1464 | Ga0496122_0075124 | |||
| 1465 | Ga0496122_0130055 | |||
| 1466 | Ga0496123_0000146 | |||
| 1467 | Ga0496123_0001342 | |||
| 1468 | Ga0496123_0005602 | |||
| 1469 | Ga0496123_0005726 | |||
| 1470 | Ga0496123_0010773 | |||
| 1471 | Ga0496123_0016107 | |||
| 1472 | Ga0496123_0021444 | |||
| 1473 | Ga0496123_0049229 | |||
| 1474 | Ga0496123_0053468 | |||
| 1475 | Ga0496123_0082517 | |||
| 1476 | Ga0496123_0084908 | |||
| 1477 | Ga0496124_0000043 | |||
| 1478 | Ga0496124_0000232 | |||
| 1479 | Ga0496124_0000343 | |||
| 1480 | Ga0496124_0002777 | |||
| 1481 | Ga0496124_0002928 | |||
| 1482 | Ga0496124_0028074 | |||
| 1483 | Ga0496124_0032533 | |||
| 1484 | Ga0496124_0038378 | |||
| 1485 | Ga0496124_0055799 | |||
| 1486 | Ga0496124_0114468 | |||
| 1487 | Ga0496124_0123284 | |||
| 1488 | Ga0496124_0173271 | |||
| 1489 | Ga0496125_0000525 | |||
| 1490 | Ga0496125_0009938 | |||
| 1491 | Ga0496125_0010075 | |||
| 1492 | Ga0496125_0030997 | |||
| 1493 | Ga0496125_0034181 | |||
| 1494 | Ga0496125_0037628 | |||
| 1495 | Ga0496125_0104313 | |||
| 1496 | Ga0496125_0179631 | |||
| 1497 | Ga0496126_0000890 | |||
| 1498 | Ga0496126_0001437 | |||
| 1499 | Ga0496126_0016491 | |||
| 1500 | Ga0496126_0206978 | |||
| 1501 | Ga0501034_0056018 | |||
| 1502 | Ga0501034_0537780 | |||
| 1503 | Ga0501036_0333037 | |||
| 1504 | Ga0501047_0004596 | |||
| 1505 | Ga0501044_0014603 | |||
| 1506 | Ga0501044_0102610 | |||
| 1507 | Ga0501044_0615272 | |||
| 1508 | nmdc:mga03683_2591_c1 | |||
| 1509 | nmdc:mga0yw44_4173_c1 | |||
| 1510 | nmdc:mga06z11_67015_c1 | |||
| 1511 | nmdc:mga07m45_10860_c1 | |||
| 1512 | nmdc:mga07m45_3201_c1 | |||
| 1513 | nmdc:mga07m45_42767_c1 | |||
| 1514 | nmdc:mga08y16_185363_c1 | |||
| 1515 | nmdc:mga0sz30_12277_c1 | |||
| 1516 | nmdc:mga0sz30_12293_c1 | |||
| 1517 | nmdc:mga0sz30_90334_c1 | |||
| 1518 | Ga0495601_0046002 | |||
| 1519 | Ga0495612_0081970 | |||
| 1520 | Ga0500610_0002998 | |||
| 1521 | Ga0495619_0011875 | |||
| 1522 | Ga0500643_060660 | |||
| 1523 | Ga0500556_0000052 | |||
| 1524 | Ga0500569_001663 | |||
| 1525 | Ga0500592_011458 | |||
| 1526 | Ga0500595_004353 | |||
| 1527 | Ga0500618_002324 | |||
| 1528 | Ga0500642_0048629 | |||
| 1529 | Ga0500655_024233 | |||
| 1530 | Ga0500658_0006626 | |||
| 1531 | Ga0500568_0003502 | |||
| 1532 | Ga0500568_0056921 | |||
| 1533 | Ga0500590_075518 | |||
| 1534 | Ga0500619_006419 | |||
| 1535 | Ga0500622_0003787 | |||
| 1536 | Ga0500622_0014724 | |||
| 1537 | Ga0500627_0036194 | |||
| 1538 | Ga0500633_0000648 | |||
| 1539 | Ga0500636_0034674 | |||
| 1540 | Ga0500645_000083 | |||
| 1541 | Ga0500645_027123 | |||
| 1542 | Ga0500596_003000 | |||
| 1543 | Ga0466962_0140248 | |||
| 1544 | Ga0466962_0165628 | |||
| 1545 | 2509391897 | |||
| 1546 | 2509447247 | |||
| 1547 | 2510308190 | |||
| 1548 | 2510895511 | |||
| 1549 | 2511136751 | |||
| 1550 | 2511199160 | |||
| 1551 | 2511500185 | |||
| 1552 | 2512532903 | |||
| 1553 | 2513567842 | |||
| 1554 | 2513577084 | |||
| 1555 | 2513590897 | |||
| 1556 | 2513619865 | |||
| 1557 | 2513633249 | |||
| 1558 | 2513707745 | |||
| 1559 | 2513886208 | |||
| 1560 | 2513905845 | |||
| 1561 | 2514018175 | |||
| 1562 | 2515113188 | |||
| 1563 | 2515611381 | |||
| 1564 | 2515638036 | |||
| 1565 | 2515645795 | |||
| 1566 | 2515655217 | |||
| 1567 | 2515739618 | |||
| 1568 | 2516897712 | |||
| 1569 | 2517036850 | |||
| 1570 | 2517077214 | |||
| 1571 | 2517095962 | |||
| 1572 | 2517407585 | |||
| 1573 | 2519462200 | |||
| 1574 | 2524453632 | |||
| 1575 | 2524611548 | |||
| 1576 | 2545675074 | |||
| 1577 | 2551711956 | |||
| 1578 | 2551725300 | |||
| 1579 | 2585222990 | |||
| 1580 | 2585271259 | |||
| 1581 | 2585279197 | |||
| 1582 | 2585294816 | |||
| 1583 | 2585323200 | |||
| 1584 | 2585331305 | |||
| 1585 | 2585524641 | |||
| 1586 | 2585531318 | |||
| 1587 | 2585538329 | |||
| 1588 | 2585545573 | |||
| 1589 | 2585552759 | |||
| 1590 | 2585559004 | |||
| 1591 | 2585836282 | |||
| 1592 | 2585904049 | |||
| 1593 | 2587980833 | |||
| 1594 | 2599734389 | |||
| 1595 | 2599747478 | |||
| 1596 | 2600203907 | |||
| 1597 | 2600209362 | |||
| 1598 | 2616311364 | |||
| 1599 | 2616554378 | |||
| 1600 | 2617383681 | |||
| 1601 | 2643856664 | |||
| 1602 | 2671111300 | |||
| 1603 | 2676746090 | |||
| 1604 | 2719181928 | |||
| 1605 | 2719386540 | |||
| 1606 | 2719732645 | |||
| 1607 | 2720614177 | |||
| 1608 | 2720620945 | |||
| 1609 | 2720632269 | |||
| 1610 | 2720775997 | |||
| 1611 | 2721148019 | |||
| 1612 | 2721159470 | |||
| 1613 | 2721164855 | |||
| 1614 | 2721400244 | |||
| 1615 | 2722841025 | |||
| 1616 | 2723027595 | |||
| 1617 | 2723561224 | |||
| 1618 | 2723567847 | |||
| 1619 | 2724039057 | |||
| 1620 | 2724045401 | |||
| 1621 | 2724090604 | |||
| 1622 | 2724105112 | |||
| 1623 | 2724110939 | |||
| 1624 | 2725951471 | |||
| 1625 | 2730108531 | |||
| 1626 | 2730165163 | |||
| 1627 | 2730299102 | |||
| 1628 | 2739032969 | |||
| 1629 | 2739054544 | |||
| 1630 | 2793280181 | |||
| 1631 | 2793315959 | |||
| 1632 | 2793319308 | |||
| 1633 | 2793328393 | |||
| 1634 | 2793335349 | |||
| 1635 | 2793339404 | |||
| 1636 | 2793347118 | |||
| 1637 | 2793351712 | |||
| 1638 | 2793362009 | |||
| 1639 | 2793367763 | |||
| 1640 | 2805932855 | |||
| 1641 | 2806045108 | |||
| 1642 | 2806056936 | |||
| 1643 | 2806064317 | |||
| 1644 | 2806071584 | |||
| 1645 | 2809143736 | |||
| 1646 | 2817258121 | |||
| 1647 | 2817281464 | |||
| 1648 | 2817454171 | |||
| 1649 | 2819637449 | |||
| 1650 | 2819641423 | |||
| 1651 | 2819685061 | |||
| 1652 | 2819718745 | |||
| 1653 | 2838021585 | |||
| 1654 | 2838023723 | |||
| 1655 | 2838033679 | |||
| 1656 | 2838045097 | |||
| 1657 | 2838053420 | |||
| 1658 | 2838065542 | |||
| 1659 | 2838070019 | |||
| 1660 | 2838683326 | |||
| 1661 | 2838686913 | |||
| 1662 | 2838697730 | |||
| 1663 | 2838710846 | |||
| 1664 | 2838730129 | |||
| 1665 | 2838742856 | |||
| 1666 | 2841852359 | |||
| 1667 | 2841867085 | |||
| 1668 | 2842079019 | |||
| 1669 | 2842113133 | |||
| 1670 | 2842118471 | |||
| 1671 | 2842158183 | |||
| 1672 | 2842168658 | |||
| 1673 | 2842181803 | |||
| 1674 | 2842199237 | |||
| 1675 | 2842218074 | |||
| 1676 | 2842230147 | |||
| 1677 | 2842240382 | |||
| 1678 | 2842244035 | |||
| 1679 | 2842257880 | |||
| 1680 | 2842270830 | |||
| 1681 | 2842271549 | |||
| 1682 | 2842292681 | |||
| 1683 | 2842305180 | |||
| 1684 | 2842317060 | |||
| 1685 | 2842347389 | |||
| 1686 | 2842370197 | |||
| 1687 | 2842373957 | |||
| 1688 | 2842379079 | |||
| 1689 | 2842384981 | |||
| 1690 | 2842400217 | |||
| 1691 | 2842423633 | |||
| 1692 | 2842434713 | |||
| 1693 | 2842441091 | |||
| 1694 | 2842447709 | |||
| 1695 | 2842449422 | |||
| 1696 | 2842469074 | |||
| 1697 | 2842475638 | |||
| 1698 | 2842480426 | |||
| 1699 | 2842483942 | |||
| 1700 | 2842496621 | |||
| 1701 | 2842505353 | |||
| 1702 | 2842510972 | |||
| 1703 | 2842917992 | |||
| 1704 | 2844458210 | |||
| 1705 | 2852390386 | |||
| 1706 | 2855830368 | |||
| 1707 | 2855845853 | |||
| 1708 | 2857517295 | |||
| 1709 | 2858805253 | |||
| 1710 | 2863424083 | |||
| 1711 | 2896390652 | |||
| 1712 | 2904567237 | |||
| 1713 | 2904574282 | |||
| 1714 | 2915989298 | |||
| 1715 | 2915995483 | |||
| 1716 | 2916012565 | |||
| 1717 | 2916019219 | |||
| 1718 | 2916026127 | |||
| 1719 | 2916037241 | |||
| 1720 | 2916047821 | |||
| 1721 | 2916053865 | |||
| 1722 | 2919087675 | |||
| 1723 | 2919106326 | |||
| 1724 | 2919410131 | |||
| 1725 | 2920765944 | |||
| 1726 | 2921202557 | |||
| 1727 | 2921214074 | |||
| 1728 | 2921241701 | |||
| 1729 | 2921249683 | |||
| 1730 | 2921284971 | |||
| 1731 | 2921297483 | |||
| 1732 | 2924144300 | |||
| 1733 | 2924151515 | |||
| 1734 | 2924159393 | |||
| 1735 | 2924196694 | |||
| 1736 | 2924201248 | |||
| 1737 | 2924212446 | |||
| 1738 | 2924233623 | |||
| 1739 | 2928029280 | |||
| 1740 | 2928158697 | |||
| 1741 | 2928167660 | |||
| 1742 | 2928174532 | |||
| 1743 | 2928540596 | |||
| 1744 | 2928969942 | |||
| 1745 | 2933570987 | |||
| 1746 | 2933588810 | |||
| 1747 | 2933600825 | |||
| 1748 | 2935896884 | |||
| 1749 | 2935901820 | |||
| 1750 | 2936371905 | |||
| 1751 | 2936379740 | |||
| 1752 | 2936387486 | |||
| 1753 | 2936997986 | |||
| 1754 | 2937007811 | |||
| 1755 | 2937014663 | |||
| 1756 | 2937020142 | |||
| 1757 | 2937051608 | |||
| 1758 | 2937059488 | |||
| 1759 | 2937067397 | |||
| 1760 | 2937096347 | |||
| 1761 | 2937105794 | |||
| 1762 | 2937108978 | |||
| 1763 | 2937116897 | |||
| 1764 | 2937124883 | |||
| 1765 | 2946008272 | |||
| 1766 | 2946788709 | |||
| 1767 | 2957385460 | |||
| 1768 | 2957405972 | |||
| 1769 | 2957409497 | |||
| 1770 | 2957418720 | |||
| 1771 | 2957424407 | |||
| 1772 | 2957430207 | |||
| 1773 | 2957455142 | |||
| 1774 | 2957460089 | |||
| 1775 | 2957464917 | |||
| 1776 | 2957475318 | |||
| 1777 | 2957490399 | |||
| 1778 | 2957492289 | |||
| 1779 | 2960590701 | |||
| 1780 | 2960601345 | |||
| 1781 | 2960606284 | |||
| 1782 | 2960616011 | |||
| 1783 | 2960623675 | |||
| 1784 | 2960643994 | |||
| 1785 | 2960658468 | |||
| 1786 | 2960672485 | |||
| 1787 | 2960678882 | |||
| 1788 | 2960691683 | |||
| 1789 | 2964610346 | |||
| 1790 | 2964624508 | |||
| 1791 | 2964642184 | |||
| 1792 | 2964649666 | |||
| 1793 | 2964655723 | |||
| 1794 | 2964661199 | |||
| 1795 | 2964669554 | |||
| 1796 | 2964670887 | |||
| 1797 | 2964681941 | |||
| 1798 | 2964690302 | |||
| 1799 | 2964695019 | |||
| 1800 | 2964704260 | |||
| 1801 | 2964711795 | |||
| 1802 | 2964713741 | |||
| 1803 | 2964725340 | |||
| 1804 | 2967666066 | |||
| 1805 | 2967675113 | |||
| 1806 | 2967685414 | |||
| 1807 | 2967694218 | |||
| 1808 | 2967700402 | |||
| 1809 | 2967716017 | |||
| 1810 | 2967727048 | |||
| 1811 | 2967739763 | |||
| 1812 | 2967745345 | |||
| 1813 | 2967750324 | |||
| 1814 | 2967767458 | |||
| 1815 | 2967770144 | |||
| 1816 | 2970019893 | |||
| 1817 | 2970037397 | |||
| 1818 | 2970043143 | |||
| 1819 | 2970050226 | |||
| 1820 | 2970060625 | |||
| 1821 | 2970064365 | |||
| 1822 | 2970072707 | |||
| 1823 | 2970076608 | |||
| 1824 | 2970087439 | |||
| 1825 | 2970095175 | |||
| 1826 | 2970114088 | |||
| 1827 | 2970119947 | |||
| 1828 | 2970130853 | |||
| 1829 | 2970154835 | |||
| 1830 | 2970158203 | |||
| 1831 | 2970165241 | |||
| 1832 | 2970175309 | |||
| 1833 | 2970184815 | |||
| 1834 | 2977523023 | |||
| 1835 | 2977524311 | |||
| 1836 | 2977539241 | |||
| 1837 | 2977558797 | |||
| 1838 | 2977564202 | |||
| 1839 | 2977571163 | |||
| 1840 | 2977576826 | |||
| 1841 | 2977580571 | |||
| 1842 | 2981992183 | |||
| 1843 | 2984590102 | |||
| 1844 | 2995395093 | |||
| 1845 | 2996895013 | |||
| 1846 | 3003671281 | |||
| 1847 | 3005448585 | |||
| 1848 | 639649309 | |||
| 1849 | 641645879 | |||
| 1850 | 642419921 | |||
| 1851 | 648738534 | |||
| 1852 | 8003997652 | |||
| 1853 | 8005281344 | |||
| 1854 | 8005284684 | |||
| 1855 | 8005295650 | |||
| 1856 | 8005303260 | |||
| 1857 | 8005309527 | |||
| 1858 | 8005381061 | |||
| 1859 | 8005388991 | |||
| 1860 | 8005437414 | |||
| 1861 | 8005463871 | |||
| 1862 | 8005501028 | |||
| 1863 | 8005556886 | |||
| 1864 | 8005568130 | |||
| 1865 | 8005573329 | |||
| 1866 | 8005622395 | |||
| 1867 | 8005629895 | |||
| 1868 | 8005672445 | |||
| 1869 | 8005682760 | |||
| 1870 | 8005691967 | |||
| 1871 | 8005697538 | |||
| 1872 | 8018164440 | |||
| 1873 | 8018176920 | |||
| 1874 | 8018850110 | |||
| 1875 | 8020813680 | |||
| 1876 | 8020942721 | |||
| 1877 | 8020952891 | |||
| 1878 | 8020957728 | |||
| 1879 | 8021121453 | |||
| 1880 | 8023683033 | |||
| 1881 | 8024482735 | |||
| 1882 | 8039100099 | |||
| 1883 | 8040171125 | |||
| 1884 | 8040179167 | |||
| 1885 | 8046771812 | |||
| 1886 | 8056378270 | |||
| 1887 | 8056384288 | |||
| 1888 | 8057102384 | |||
| 1889 | 8057575570 | |||
| 1890 | 8057878450 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f5l-assembly1.cif.gz_A | the structure of monooxygenase ksta11 in the biosynthetic pathway of kosinostatin | 0.8353 | 8 | 314 |
| 3m2p-assembly2.cif.gz_C | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.8304 | 8 | 318 |
| 4yra-assembly6.cif.gz_I | mouse tdh in the apo form | 0.8303 | 8 | 317 |
| 3m2p-assembly2.cif.gz_C | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.8222 | 8 | 318 |
| 4yra-assembly6.cif.gz_I | mouse tdh in the apo form | 0.8197 | 8 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6I798_6_113_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9014 | 8 | 82 | 3.40.50.720 |
| af_I1KG15_128_276_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8834 | 7 | 104 | 3.40.50.720 |
| af_I1KVW6_141_273_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8826 | 7 | 104 | 3.40.50.20 |
| af_A0A1D6GVM8_196_300_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8686 | 5 | 105 | 3.40.50.20 |
| af_A0A0P0VRA9_18_110_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8416 | 4 | 82 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A346YN02-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9875 | 8 | 324 |
GO:0004029
GO:0005737 |
| AF-N6UCK9-F1-model_v4 | NAD-dependent epimerase/dehydratase | 0.9771 | 1 | 325 |
GO:0004029
GO:0005737 |
| AF-A3RSK7-F1-model_v4 | deleted | 0.977 | 3 | 322 |
|
| AF-N6UCK9-F1-model_v4 | NAD-dependent epimerase/dehydratase | 0.9741 | 1 | 325 |
GO:0004029
GO:0005737 |
| AF-A0A829MUP5-F1-model_v4 | deleted | 0.9734 | 8 | 325 |
|