F486444

General Info

Members Datasets Scaffolds Average Seq Length
945 643 1890 330

Family's Representative Sequence

Representative Sequence 3300053134|Ga0500658_0005036|Ga0500658_0005036_3304_4428
Length 374
Sequence MLIYFCIADAFISSISFIPFWGHDPLIRSKEMIVMSSIMKTTALILGATGGIGGAVARKLLARGWRIRALNRDAAKASRNEPAFEWVQGDAMNAGDVLRAAEGVGLIVHAVNPPGYRDWETLVLPMLDNTIAAARAVGVRVVLPGNVYNFGPDALPAPTEESPQNPVTKKGAIRVEMEKRLKAASQSGAGAIIVRGGDFFGPGTTANSWFSSGLVTPGKPVGTIRNPARRGIGHQWAYLPDMAETIAQLVERADRLAPFAVYHMEGFWDADGLQMAEAIKRVVGGKAKIGNFPWWIVPLTAPFVPVMREIKEMRYLWKVPVRMRNTKLVAELGKEPQTPIDEAVRASLVALGCLPEPHRQAAAALIGHPSQNAG

Samples

Sample ID Description Type Environment
1 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
77 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
156 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
283 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
299 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
300 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
301 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
302 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
303 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
304 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
305 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
306 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
307 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
308 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
309 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
310 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
311 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
312 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
313 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
314 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
315 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
316 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
317 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
318 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
319 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
320 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
321 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
322 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
323 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
324 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
325 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
326 2519103095 Burkholderia sp. KJ006 Isolate Nodule
327 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
328 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
329 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
330 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
331 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
332 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
333 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
334 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
335 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
336 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
337 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
338 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
339 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
340 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
341 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
342 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
343 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
344 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
345 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
346 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
347 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
348 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
349 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
350 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
351 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
352 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
353 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
354 2643221568 Rhizobium sp. Root564 Isolate Unclassified
355 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
356 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
357 2718217882 Rhizobium sp. N741 Isolate Nodule
358 2718217927 Rhizobium sp. N324 Isolate Nodule
359 2718218009 Rhizobium sp. N561 Isolate Nodule
360 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
361 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
362 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
363 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
364 2718218363 Rhizobium sp. N113 Isolate Nodule
365 2718218365 Rhizobium sp. N731 Isolate Nodule
366 2718218366 Rhizobium sp. N621 Isolate Nodule
367 2718218423 Rhizobium sp. N941 Isolate Nodule
368 2721755514 Rhizobium sp. N6212 Isolate Nodule
369 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
370 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
371 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
372 2721755809 Rhizobium sp. N541 Isolate Nodule
373 2721755810 Rhizobium sp. N871 Isolate Nodule
374 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
375 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
376 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
377 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
378 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
379 2728369365 Rhizobium sp. N1341 Isolate Nodule
380 2728369397 Rhizobium sp. N1314 Isolate Nodule
381 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
382 2738541337 Pelomonas sp. BT06 Isolate Unclassified
383 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
384 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
385 2791355260 Rhizobium sp. L9 Isolate Nodule
386 2791355261 Rhizobium sp. J15 Isolate Nodule
387 2791355262 Rhizobium sp. M1 Isolate Nodule
388 2791355263 Rhizobium chutanense C5 Isolate Nodule
389 2791355264 Rhizobium sp. S9 Isolate Nodule
390 2791355265 Rhizobium sp. H4 Isolate Nodule
391 2791355266 Rhizobium sp. L43 Isolate Nodule
392 2791355267 Rhizobium sp. L18 Isolate Nodule
393 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
394 2802429633 Rhizobium anhuiense J3 Isolate Nodule
395 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
396 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
397 2802429637 Rhizobium anhuiense C15 Isolate Nodule
398 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
399 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
400 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
401 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
402 2818991452 Burkholderia cepacia 561 Isolate Unclassified
403 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
404 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
405 2818991467 Bosea vestrisii 3192 Isolate Unclassified
406 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
407 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
408 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
409 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
410 2838048938 Rhizobium pisi 27/80 Isolate Nodule
411 2838061910 Rhizobium phaseoli L15 Isolate Nodule
412 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
413 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
414 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
415 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
416 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
417 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
418 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
419 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
420 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
421 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
422 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
423 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
424 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
425 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
426 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
427 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
428 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
429 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
430 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
431 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
432 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
433 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
434 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
435 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
436 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
437 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
438 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
439 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
440 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
441 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
442 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
443 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
444 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
445 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
446 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
447 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
448 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
449 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
450 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
451 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
452 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
453 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
454 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
455 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
456 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
457 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
458 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
459 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
460 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
461 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
462 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
463 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
464 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
465 2904564687 Burkholderia sp. 571 Isolate Unclassified
466 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
467 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
468 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
469 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
470 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
471 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
472 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
473 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
474 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
475 2919085039 Luteibacter sp. 1214 Isolate Unclassified
476 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
477 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
478 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
479 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
480 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
481 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
482 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
483 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
484 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
485 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
486 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
487 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
488 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
489 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
490 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
491 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
492 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
493 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
494 2928163908 Burkholderia sp. 567 Isolate Unclassified
495 2928170801 Burkholderia sp. 572 Isolate Unclassified
496 2928536128 Burkholderia sola 565 Isolate Unclassified
497 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
498 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
499 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
500 2933599457 Rhizobium phaseoli M3 Isolate Nodule
501 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
502 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
503 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
504 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
505 2936381700 Rhizobium chutanense C16 Isolate Unclassified
506 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
507 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
508 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
509 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
510 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
511 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
512 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
513 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
514 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
515 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
516 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
517 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
518 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
519 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
520 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
521 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
522 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
523 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
524 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
525 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
526 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
527 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
528 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
529 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
530 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
531 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
532 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
533 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
534 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
535 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
536 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
537 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
538 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
539 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
540 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
541 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
542 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
543 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
544 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
545 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
546 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
547 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
548 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
549 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
550 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
551 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
552 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
553 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
554 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
555 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
556 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
557 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
558 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
559 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
560 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
561 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
562 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
563 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
564 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
565 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
566 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
567 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
568 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
569 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
570 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
571 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
572 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
573 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
574 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
575 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
576 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
577 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
578 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
579 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
580 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
581 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
582 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
583 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
584 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
585 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
586 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
587 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
588 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
589 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
590 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
591 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
592 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
593 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
594 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
595 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
596 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
597 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
598 2996893221 Rhizobium sp. R635 Isolate Nodule
599 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
600 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
601 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
602 641522639 Methylobacterium sp. 4-46 Isolate Nodule
603 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
604 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
605 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
606 8005275841 Rhizobium sp. N4311 Isolate Nodule
607 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
608 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
609 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
610 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
611 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
612 8005382845 Rhizobium sp. R634 Isolate Nodule
613 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
614 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
615 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
616 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
617 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
618 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
619 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
620 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
621 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
622 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
623 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
624 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
625 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
626 8018176218 Rhizobium sp. N122 Isolate Nodule
627 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
628 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
629 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
630 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
631 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
632 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
633 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
634 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
635 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
636 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
637 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
638 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
639 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
640 8056382006 Rhizobium croatiense 13T Isolate Nodule
641 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
642 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
643 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.39
Metatranscriptomes 0
Isolates 36.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 18.62
Nodule 28.47
Rhizoplane 3.7
Rhizosphere 33.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500658_0005036 3300053134 Bacteria 4917
2 JGI24740J21852_10000491 3300001979 Bacteria 16940
3 JGI24737J22298_10006149 3300001990 Bacteria 4114
4 JGI25155J39150_1000044 3300002704 Bacteria 86149
5 JGI25156J39149_1000058 3300002705 Bacteria 86233
6 JGI25162J39368_1001111 3300002737 Bacteria 16290
7 JGI25154J39366_1000236 3300002738 Bacteria 36377
8 JGI25158J39367_1000019 3300002739 Bacteria 41617
9 JGI25157J39369_1000078 3300002741 Bacteria 86233
10 JGI25152J39213_1008101 3300002773 Bacteria 2642
11 JGI25152J39213_1009714 3300002773 Bacteria 2262
12 JGI25159J45721_1000393 3300002987 Bacteria 20327
13 JGI25159J45721_1001256 3300002987 Bacteria 10697
14 JGI25151J46595_10001000 3300003187 Bacteria 21370
15 JGI25151J46595_10003303 3300003187 Bacteria 8955
16 JGI25151J46595_10027236 3300003187 Bacteria 2295
17 JGI25165J46597_1002105 3300003214 Bacteria 7259
18 JGI25165J46597_1006815 3300003214 Bacteria 1978
19 JGI25153J46596_10001757 3300003215 Bacteria 12850
20 JGI25153J46596_10005805 3300003215 Bacteria 6416
21 rootH1_10002490 3300003316 Bacteria 42026
22 rootH1_10154918 3300003316 Bacteria 2742
23 rootH2_10104606 3300003320 Bacteria 4147
24 rootL2_10000902 3300003322 Bacteria 25253
25 rootH1_10073995 3300003323 Bacteria 3565
26 rootH1_10091604 3300003323 Bacteria 6396
27 JGI25160J50197_1000001 3300003354 Bacteria 782301
28 JGI25161J50226_1000001 3300003374 Bacteria 655036
29 JGI25161J50226_1000068 3300003374 Bacteria 90522
30 Ga0055532_1000337 3300003758 Bacteria 25555
31 Ga0055532_1000821 3300003758 Bacteria 10645
32 Ga0055532_1000922 3300003758 Bacteria 9520
33 Ga0055525_1000119 3300003759 Bacteria 120272
34 Ga0055527_1000104 3300003760 Bacteria 60485
35 Ga0055527_1000154 3300003760 Bacteria 48442
36 Ga0055535_1000218 3300003761 Bacteria 60485
37 Ga0055535_1000320 3300003761 Bacteria 48442
38 Ga0055542_1000076 3300003762 Bacteria 139662
39 Ga0055542_1000153 3300003762 Bacteria 87342
40 Ga0055542_1003042 3300003762 Bacteria 4847
41 Ga0055529_1000004 3300003763 Bacteria 433331
42 Ga0055529_1000176 3300003763 Bacteria 87107
43 Ga0055526_1000244 3300003771 Bacteria 45976
44 Ga0055526_1001546 3300003771 Bacteria 16285
45 Ga0055526_1007492 3300003771 Bacteria 5654
46 Ga0055526_1008391 3300003771 Bacteria 5166
47 Ga0055526_1033769 3300003771 Bacteria 1413
48 Ga0055537_1000178 3300003773 Bacteria 47461
49 Ga0055524_1000113 3300003775 Bacteria 95090
50 Ga0055524_1002336 3300003775 Bacteria 9864
51 Ga0055524_1004246 3300003775 Bacteria 6666
52 Ga0055524_1013289 3300003775 Bacteria 3111
53 Ga0055528_1000256 3300003790 Bacteria 45159
54 Ga0055528_1000261 3300003790 Bacteria 44757
55 Ga0055528_1001003 3300003790 Bacteria 18727
56 Ga0055528_1001848 3300003790 Bacteria 12070
57 Ga0055528_1015200 3300003790 Bacteria 2794
58 Ga0055528_1020168 3300003790 Bacteria 2174
59 Ga0055530_10002177 3300003791 Bacteria 12983
60 Ga0055540_1000268 3300003792 Bacteria 47109
61 Ga0055540_1004141 3300003792 Bacteria 6702
62 Ga0055540_1010129 3300003792 Bacteria 3165
63 Ga0055540_1016808 3300003792 Bacteria 2063
64 Ga0055540_1020546 3300003792 Bacteria 1742
65 Ga0055531_10000494 3300003794 Bacteria 36120
66 Ga0055531_10015091 3300003794 Bacteria 3429
67 Ga0055543_1000003 3300004625 Bacteria 358656
68 Ga0055543_1000470 3300004625 Bacteria 23657
69 Ga0065165_1000335 3300005262 Bacteria 77037
70 Ga0065165_1006900 3300005262 Bacteria 5770
71 Ga0065714_10069269 3300005288 Bacteria 4300
72 Ga0070658_10002454 3300005327 Bacteria 15511
73 Ga0070658_10023533 3300005327 Bacteria 4943
74 Ga0070666_10000023 3300005335 Bacteria 161603
75 Ga0070660_100000808 3300005339 Bacteria 20758
76 Ga0070660_100002392 3300005339 Bacteria 12893
77 Ga0070661_100020019 3300005344 Bacteria 4770
78 Ga0070661_100072065 3300005344 Bacteria 2542
79 Ga0070668_100063326 3300005347 Bacteria 2866
80 Ga0070669_100100499 3300005353 Bacteria 2181
81 Ga0070674_100016877 3300005356 Bacteria 4581
82 Ga0070659_100000012 3300005366 Bacteria 180004
83 Ga0070667_100007705 3300005367 Bacteria 8929
84 Ga0070667_100021962 3300005367 Bacteria 5296
85 Ga0070667_100328962 3300005367 Bacteria 1380
86 Ga0070663_100000530 3300005455 Bacteria 20177
87 Ga0070678_100000786 3300005456 Bacteria 15935
88 Ga0068867_100056815 3300005459 Bacteria 2896
89 Ga0070672_100010194 3300005543 Bacteria 6509
90 Ga0070672_100053334 3300005543 Bacteria 3161
91 Ga0070665_100010169 3300005548 Bacteria 9515
92 Ga0070665_100174378 3300005548 Bacteria 2151
93 Ga0068855_100068316 3300005563 Bacteria 4137
94 Ga0070664_100060423 3300005564 Bacteria 3227
95 Ga0068857_100107544 3300005577 Bacteria 2505
96 Ga0068857_100132824 3300005577 Bacteria 2246
97 Ga0068854_100028189 3300005578 Bacteria 3878
98 Ga0068854_100055631 3300005578 Bacteria 2849
99 Ga0068852_100064479 3300005616 Bacteria 3193
100 Ga0068851_10113937 3300005834 Bacteria 1446
101 Ga0068858_100130717 3300005842 Bacteria 2354
102 Ga0068860_100017387 3300005843 Bacteria 7006
103 Ga0068862_100133515 3300005844 Bacteria 2198
104 Ga0075365_10008493 3300006038 Bacteria 5840
105 Ga0075363_100018898 3300006048 Bacteria 3439
106 Ga0070712_100180099 3300006175 Bacteria 1646
107 Ga0075362_10007517 3300006177 Bacteria 4130
108 Ga0075369_10005897 3300006186 Bacteria 4604
109 Ga0075369_10017667 3300006186 Bacteria 2896
110 Ga0075369_10112159 3300006186 Bacteria 1229
111 Ga0075366_10003422 3300006195 Bacteria 8362
112 Ga0075370_10004016 3300006353 Bacteria 7072
113 Ga0075370_10048128 3300006353 Bacteria 2415
114 Ga0075370_10084033 3300006353 Bacteria 1832
115 Ga0075370_10104724 3300006353 Bacteria 1640
116 Ga0068865_100023745 3300006881 Bacteria 4019
117 Ga0079104_1000056 3300006946 Bacteria 166276
118 Ga0105244_10033305 3300009036 Bacteria 2717
119 Ga0105240_10001781 3300009093 Bacteria 36346
120 Ga0105240_10143890 3300009093 Bacteria 2847
121 Ga0111539_10076168 3300009094 Bacteria 3950
122 Ga0105243_10000812 3300009148 Bacteria 29753
123 Ga0105241_10003240 3300009174 Bacteria 12103
124 Ga0105237_10001251 3300009545 Bacteria 33932
125 Ga0105237_10030427 3300009545 Bacteria 5483
126 Ga0105237_10081269 3300009545 Bacteria 3231
127 Ga0105237_10128351 3300009545 Bacteria 2530
128 Ga0105237_10804532 3300009545 Bacteria 947
129 Ga0105238_10000331 3300009551 Bacteria 51630
130 Ga0105238_10035972 3300009551 Bacteria 5034
131 Ga0105238_10048861 3300009551 Bacteria 4262
132 Ga0123341_1000028 3300009765 Bacteria 69145
133 Ga0123342_1028435 3300009766 Bacteria 3017
134 Ga0105239_10035459 3300010375 Bacteria 5478
135 Ga0105239_10060729 3300010375 Bacteria 4149
136 Ga0105239_10179572 3300010375 Bacteria 2368
137 Ga0157371_10000197 3300013102 Bacteria 88423
138 Ga0157371_10016751 3300013102 Bacteria 5459
139 Ga0157370_10000248 3300013104 Bacteria 68580
140 Ga0157370_10001042 3300013104 Bacteria 34875
141 Ga0157370_10236176 3300013104 Bacteria 1692
142 Ga0157369_10111065 3300013105 Bacteria 2914
143 Ga0163162_10001650 3300013306 Bacteria 20913
144 Ga0157372_10068297 3300013307 Bacteria 3996
145 Ga0157375_10202886 3300013308 Bacteria 2139
146 Ga0182007_10003611 3300015262 Bacteria 7256
147 Ga0182007_10004059 3300015262 Bacteria 6741
148 Ga0182007_10004378 3300015262 Bacteria 6410
149 Ga0182005_1000173 3300015265 Bacteria 44701
150 Ga0163161_10043529 3300017792 Bacteria 3233
151 Ga0214543_1009579 3300021327 Bacteria 14952
152 Ga0213876_10035238 3300021384 Bacteria 2640
153 Ga0209435_100054 3300025206 Bacteria 86285
154 Ga0209436_100070 3300025208 Bacteria 51558
155 Ga0209566_100442 3300025225 Bacteria 30640
156 Ga0209674_105923 3300025226 Bacteria 1733
157 Ga0209672_100032 3300025228 Bacteria 324684
158 Ga0209672_100042 3300025228 Bacteria 272005
159 Ga0209147_100012 3300025229 Bacteria 681990
160 Ga0209147_100046 3300025229 Bacteria 295158
161 Ga0209147_100052 3300025229 Bacteria 272005
162 Ga0209563_100024 3300025230 Bacteria 601155
163 Ga0209563_101162 3300025230 Bacteria 7390
164 Ga0209437_100098 3300025233 Bacteria 229766
165 Ga0209258_100030 3300025242 Bacteria 470208
166 Ga0209258_100073 3300025242 Bacteria 272005
167 Ga0207425_1001479 3300025245 Bacteria 9779
168 Ga0207425_1012055 3300025245 Bacteria 2041
169 Ga0209646_1000170 3300025246 Bacteria 86285
170 Ga0209026_1000193 3300025250 Bacteria 86285
171 Ga0209148_1000008 3300025254 Bacteria 1504371
172 Ga0209148_1000022 3300025254 Bacteria 681990
173 Ga0209148_1000821 3300025254 Bacteria 22414
174 Ga0209759_1000222 3300025256 Bacteria 86285
175 Ga0209129_1000252 3300025258 Bacteria 55710
176 Ga0209129_1002985 3300025258 Bacteria 7710
177 Ga0209129_1018814 3300025258 Bacteria 1319
178 Ga0209233_1000095 3300025261 Bacteria 303783
179 Ga0209233_1000148 3300025261 Bacteria 185135
180 Ga0209565_1000003 3300025263 Bacteria 1099648
181 Ga0209455_1000002 3300025272 Bacteria 1505459
182 Ga0209455_1000024 3300025272 Bacteria 676133
183 Ga0209455_1000324 3300025272 Bacteria 47295
184 Ga0209673_1000010 3300025273 Bacteria 596656
185 Ga0209673_1000017 3300025273 Bacteria 492994
186 Ga0209673_1000021 3300025273 Bacteria 422978
187 Ga0209673_1000025 3300025273 Bacteria 404572
188 Ga0209673_1001232 3300025273 Bacteria 26878
189 Ga0209673_1004332 3300025273 Bacteria 7651
190 Ga0209673_1007335 3300025273 Bacteria 5109
191 Ga0209673_1024673 3300025273 Bacteria 2015
192 Ga0209130_1000003 3300025284 Bacteria 677988
193 Ga0209130_1000020 3300025284 Bacteria 379297
194 Ga0209675_1000119 3300025291 Bacteria 110218
195 Ga0209675_1028059 3300025291 Bacteria 1373
196 Ga0209676_1025937 3300025292 Bacteria 1871
197 Ga0209025_1000091 3300025294 Bacteria 250401
198 Ga0209025_1002551 3300025294 Bacteria 19004
199 Ga0209025_1004772 3300025294 Bacteria 11509
200 Ga0209025_1016097 3300025294 Bacteria 4449
201 Ga0209564_1000016 3300025295 Bacteria 613131
202 Ga0209564_1000588 3300025295 Bacteria 57321
203 Ga0209564_1000644 3300025295 Bacteria 52727
204 Ga0209564_1000883 3300025295 Bacteria 39645
205 Ga0209564_1007448 3300025295 Bacteria 5651
206 Ga0209564_1012085 3300025295 Bacteria 3798
207 Ga0209758_1000007 3300025297 Bacteria 1270410
208 Ga0209758_1001217 3300025297 Bacteria 32348
209 Ga0209758_1001343 3300025297 Bacteria 29681
210 Ga0209758_1001396 3300025297 Bacteria 28704
211 Ga0209758_1018413 3300025297 Bacteria 3423
212 Ga0209758_1018414 3300025297 Bacteria 3423
213 Ga0209050_1001510 3300025298 Bacteria 24578
214 Ga0209050_1002600 3300025298 Bacteria 14957
215 Ga0209050_1019579 3300025298 Bacteria 2563
216 Ga0209256_1000049 3300025299 Bacteria 310696
217 Ga0209256_1000210 3300025299 Bacteria 110217
218 Ga0209256_1000924 3300025299 Bacteria 35882
219 Ga0209256_1002389 3300025299 Bacteria 15470
220 Ga0209256_1011242 3300025299 Bacteria 3609
221 Ga0209256_1023488 3300025299 Bacteria 1837
222 Ga0207426_1000008 3300025302 Bacteria 848730
223 Ga0207426_1000011 3300025302 Bacteria 791203
224 Ga0209051_1000029 3300025303 Bacteria 403675
225 Ga0209051_1000196 3300025303 Bacteria 107028
226 Ga0209051_1000400 3300025303 Bacteria 60342
227 Ga0209051_1004736 3300025303 Bacteria 8241
228 Ga0209051_1006706 3300025303 Bacteria 6434
229 Ga0209051_1035357 3300025303 Bacteria 1860
230 Ga0209257_1000168 3300025304 Bacteria 171312
231 Ga0209257_1000305 3300025304 Bacteria 107001
232 Ga0209257_1001180 3300025304 Bacteria 33048
233 Ga0207655_1070987 3300025728 Bacteria 1294
234 Ga0207680_10000002 3300025903 Bacteria 1018646
235 Ga0207647_10184401 3300025904 Bacteria 1211
236 Ga0207705_10000489 3300025909 Bacteria 33785
237 Ga0207705_10002172 3300025909 Bacteria 15174
238 Ga0207705_10009527 3300025909 Bacteria 7068
239 Ga0207654_10000273 3300025911 Bacteria 31494
240 Ga0207695_10000037 3300025913 Bacteria 476303
241 Ga0207695_10001076 3300025913 Bacteria 47744
242 Ga0207695_10029433 3300025913 Bacteria 6068
243 Ga0207671_10004383 3300025914 Bacteria 13528
244 Ga0207671_10008263 3300025914 Bacteria 8855
245 Ga0207671_10018796 3300025914 Bacteria 5295
246 Ga0207693_10146142 3300025915 Bacteria 1859
247 Ga0207657_10000013 3300025919 Bacteria 180080
248 Ga0207657_10005166 3300025919 Bacteria 13693
249 Ga0207657_10027577 3300025919 Bacteria 5200
250 Ga0207649_10000443 3300025920 Bacteria 29944
251 Ga0207649_10011842 3300025920 Bacteria 4825
252 Ga0207694_10000253 3300025924 Bacteria 50728
253 Ga0207694_10028372 3300025924 Bacteria 4267
254 Ga0207694_10065008 3300025924 Bacteria 2844
255 Ga0207694_10148721 3300025924 Bacteria 1886
256 Ga0207690_10000048 3300025932 Bacteria 114048
257 Ga0207690_10014663 3300025932 Bacteria 4738
258 Ga0207706_10069437 3300025933 Bacteria 3099
259 Ga0207709_10000005 3300025935 Bacteria 806813
260 Ga0207669_10000251 3300025937 Bacteria 24482
261 Ga0207691_10026111 3300025940 Bacteria 5481
262 Ga0207691_10065584 3300025940 Bacteria 3286
263 Ga0207679_10044049 3300025945 Bacteria 3217
264 Ga0207667_10000001 3300025949 Bacteria 1178522
265 Ga0207667_10007355 3300025949 Bacteria 13250
266 Ga0207667_10038463 3300025949 Bacteria 5110
267 Ga0207667_10074482 3300025949 Bacteria 3527
268 Ga0207668_10049653 3300025972 Bacteria 2886
269 Ga0207668_10238403 3300025972 Bacteria 1470
270 Ga0207640_10001706 3300025981 Bacteria 11781
271 Ga0207640_10026274 3300025981 Bacteria 3533
272 Ga0207658_10003699 3300025986 Bacteria 10780
273 Ga0207658_10327777 3300025986 Bacteria 1327
274 Ga0207639_10025615 3300026041 Bacteria 4278
275 Ga0207639_10205790 3300026041 Bacteria 1691
276 Ga0207678_10001175 3300026067 Bacteria 23968
277 Ga0207702_10156415 3300026078 Bacteria 2078
278 Ga0207648_10031438 3300026089 Bacteria 4694
279 Ga0207674_10171368 3300026116 Bacteria 2124
280 Ga0207674_10382261 3300026116 Bacteria 1361
281 Ga0207683_10008013 3300026121 Bacteria 9032
282 Ga0207698_10008335 3300026142 Bacteria 6547
283 Ga0209281_1000125 3300027111 Bacteria 200371
284 Ga0209281_1001633 3300027111 Bacteria 12012
285 Ga0209371_1000767 3300027312 Bacteria 26697
286 Ga0209371_1007474 3300027312 Bacteria 3801
287 Ga0268266_10000004 3300028379 Bacteria 1495817
288 Ga0268266_10071099 3300028379 Bacteria 3016
289 Ga0268264_10026646 3300028381 Bacteria 4724
290 Ga0307515_10021842 3300028794 Bacteria 11320
291 Ga0307515_10044147 3300028794 Bacteria 6898
292 Ga0265338_10017549 3300028800 Bacteria 7708
293 Ga0268256_1000381 3300030500 Bacteria 41938
294 Ga0268256_1034045 3300030500 Bacteria 1198
295 Ga0316177_1132731 3300030731 Bacteria 1553
296 Ga0265328_10016351 3300031239 Bacteria 2889
297 Ga0265327_10007500 3300031251 Bacteria 8406
298 Ga0307509_10203133 3300031507 Bacteria 1816
299 Ga0307405_10286904 3300031731 Bacteria 1242
300 Ga0307412_10000279 3300031911 Bacteria 32639
301 Ga0307510_10001025 3300033180 Bacteria 29562
302 Ga0307510_10030018 3300033180 Bacteria 6172
303 Ga0307510_10156361 3300033180 Bacteria 1886
304 Ga0373959_0021938 3300034820 Bacteria 1230
305 Ga0373939_0001752 3300035114 Bacteria 5229
306 Ga0373960_0039436 3300035121 Bacteria 1358
307 Ga0373931_0009437 3300035691 Bacteria 4667
308 Ga0395900_0009732 3300037418 Bacteria 9846
309 Ga0395900_0124638 3300037418 Bacteria 2642
310 Ga0395900_0593518 3300037418 Bacteria 1049
311 Ga0395898_0002817 3300037466 Bacteria 19944
312 Ga0395905_0000836 3300037471 Bacteria 40186
313 Ga0395905_0001684 3300037471 Bacteria 26069
314 Ga0395905_0003242 3300037471 Bacteria 17500
315 Ga0436364_0266159 3300037853 Bacteria 1155
316 Ga0436364_1191496 3300037853 Bacteria 2219
317 Ga0395901_0000053 3300038443 Bacteria 163807
318 Ga0395901_0000771 3300038443 Bacteria 35916
319 Ga0395901_0051719 3300038443 Bacteria 4271
320 Ga0436365_1903073 3300039437 Bacteria 5474
321 Ga0436363_0094623 3300039450 Bacteria 3474
322 Ga0451797_1009375 3300041453 Bacteria 4861
323 Ga0451802_0590003 3300041460 Bacteria 3572
324 Ga0451802_0864319 3300041460 Bacteria 3925
325 Ga0451806_273572 3300041462 Bacteria 2348
326 Ga0451807_0250052 3300041486 Bacteria 3812
327 Ga0451807_0394883 3300041486 Bacteria 1838
328 Ga0451833_0097459 3300041491 Bacteria 3501
329 Ga0451837_0500608 3300041494 Bacteria 1238
330 Ga0451837_1125556 3300041494 Bacteria 1399
331 Ga0451849_1051639 3300041505 Bacteria 1866
332 Ga0451843_0511692 3300041509 Bacteria 2904
333 Ga0451853_1537113 3300041512 Bacteria 6622
334 Ga0439448_0046940 3300042005 Bacteria 1408
335 Ga0439449_0019623 3300042007 Bacteria 2534
336 Ga0466969_0048147 3300044656 Bacteria 2108
337 Ga0466972_0031098 3300044658 Bacteria 2627
338 Ga0466973_0073639 3300044659 Bacteria 3025
339 Ga0466965_0002833 3300044683 Bacteria 7472
340 Ga0466965_0074376 3300044683 Bacteria 1712
341 Ga0466966_0024442 3300044684 Bacteria 3951
342 Ga0466966_0030275 3300044684 Bacteria 3514
343 Ga0466961_0068600 3300044693 Bacteria 2251
344 Ga0466963_0000775 3300044694 Bacteria 15854
345 Ga0466971_0027711 3300044719 Bacteria 2537
346 Ga0466968_0001146 3300044735 Bacteria 9394
347 Ga0466968_0054845 3300044735 Bacteria 1709
348 Ga0466970_0004290 3300044765 Bacteria 7016
349 Ga0466957_0007192 3300044842 Bacteria 6295
350 Ga0466957_0014397 3300044842 Bacteria 4605
351 Ga0466957_0103143 3300044842 Bacteria 1800
352 Ga0466959_0038026 3300045049 Bacteria 3557
353 Ga0451576_0046970 3300045051 Bacteria 4542
354 Ga0466958_0112472 3300045836 Bacteria 1700
355 Ga0495591_000038 3300046458 Bacteria 157347
356 Ga0495591_002043 3300046458 Bacteria 11725
357 Ga0495629_0011780 3300046459 Bacteria 6347
358 Ga0495629_0099923 3300046459 Bacteria 2025
359 Ga0495650_0000074 3300046471 Bacteria 251346
360 Ga0495650_0000085 3300046471 Bacteria 235655
361 Ga0495650_0000792 3300046471 Bacteria 38739
362 Ga0495605_0013342 3300046474 Bacteria 4531
363 Ga0495605_0019640 3300046474 Bacteria 3606
364 Ga0495584_0000234 3300046491 Bacteria 39911
365 Ga0495584_0004488 3300046491 Bacteria 7500
366 Ga0495584_0017295 3300046491 Bacteria 3674
367 Ga0495585_0000503 3300046492 Bacteria 37043
368 Ga0495585_0027601 3300046492 Bacteria 3240
369 Ga0495585_0044443 3300046492 Bacteria 2481
370 Ga0495596_0000353 3300046500 Bacteria 29811
371 Ga0495607_0002423 3300046501 Bacteria 15227
372 Ga0495607_0010757 3300046501 Bacteria 6127
373 Ga0495607_0012593 3300046501 Bacteria 5574
374 Ga0495607_0016048 3300046501 Bacteria 4839
375 Ga0495583_0003563 3300046506 Bacteria 11728
376 Ga0495583_0004282 3300046506 Bacteria 10329
377 Ga0495583_0007004 3300046506 Bacteria 7218
378 Ga0495583_0034415 3300046506 Bacteria 2426
379 Ga0495583_0037583 3300046506 Bacteria 2294
380 Ga0495583_0049900 3300046506 Bacteria 1914
381 Ga0495606_0003262 3300046507 Bacteria 17404
382 Ga0495606_0004275 3300046507 Bacteria 14413
383 Ga0495606_0023312 3300046507 Bacteria 4489
384 Ga0495606_0053380 3300046507 Bacteria 2623
385 Ga0495610_0035819 3300046512 Bacteria 2542
386 Ga0495610_0063514 3300046512 Bacteria 1748
387 Ga0495616_0005239 3300046513 Bacteria 8009
388 Ga0495616_0054958 3300046513 Bacteria 1973
389 Ga0495616_0057988 3300046513 Bacteria 1908
390 Ga0495620_0021011 3300046515 Bacteria 3177
391 Ga0495630_0320565 3300046517 Bacteria 1185
392 Ga0495631_0014736 3300046518 Bacteria 3766
393 Ga0495631_0024247 3300046518 Bacteria 2802
394 Ga0495631_0034272 3300046518 Bacteria 2277
395 Ga0495632_0051326 3300046519 Bacteria 2030
396 Ga0495643_0003546 3300046522 Bacteria 11343
397 Ga0495643_0023729 3300046522 Bacteria 3484
398 Ga0495643_0155728 3300046522 Bacteria 1128
399 Ga0495644_0020986 3300046523 Bacteria 2492
400 Ga0495648_0000123 3300046524 Bacteria 92159
401 Ga0495648_0001570 3300046524 Bacteria 22297
402 Ga0495648_0033596 3300046524 Bacteria 3348
403 Ga0495663_0003381 3300046525 Bacteria 4610
404 Ga0495654_0030922 3300046530 Bacteria 2720
405 Ga0495609_0000072 3300046538 Bacteria 125273
406 Ga0495609_0001961 3300046538 Bacteria 13059
407 Ga0495609_0015067 3300046538 Bacteria 3623
408 Ga0495609_0047265 3300046538 Bacteria 1926
409 Ga0495597_0010430 3300046542 Bacteria 4544
410 Ga0495656_0000081 3300046615 Bacteria 42254
411 Ga0495668_0047650 3300046616 Bacteria 2379
412 Ga0495668_0177093 3300046616 Bacteria 1168
413 Ga0495611_0001502 3300046648 Bacteria 11538
414 Ga0495611_0018534 3300046648 Bacteria 2985
415 Ga0495611_0046262 3300046648 Bacteria 1951
416 Ga0495625_0016188 3300046660 Bacteria 5873
417 Ga0495625_0017507 3300046660 Bacteria 5609
418 Ga0495625_0028250 3300046660 Bacteria 4209
419 Ga0495625_0059750 3300046660 Bacteria 2703
420 Ga0495625_0083670 3300046660 Bacteria 2217
421 Ga0495661_0000040 3300046665 Bacteria 151437
422 Ga0495661_0000632 3300046665 Bacteria 35731
423 Ga0495661_0035787 3300046665 Bacteria 3113
424 Ga0495661_0039944 3300046665 Bacteria 2913
425 Ga0495661_0131180 3300046665 Bacteria 1373
426 Ga0495669_0000951 3300046684 Bacteria 12114
427 Ga0495669_0002830 3300046684 Bacteria 7121
428 Ga0495669_0016202 3300046684 Bacteria 3192
429 Ga0495670_0036221 3300046691 Bacteria 2459
430 Ga0495671_0067962 3300046692 Bacteria 1752
431 Ga0495649_0008479 3300046694 Bacteria 6182
432 Ga0495649_0104606 3300046694 Bacteria 1503
433 Ga0495589_0012514 3300046794 Bacteria 4392
434 Ga0495589_0016431 3300046794 Bacteria 3804
435 Ga0495600_0029243 3300046809 Bacteria 3567
436 Ga0495660_0042271 3300046810 Bacteria 2519
437 Ga0495674_0043083 3300047319 Bacteria 4020
438 Ga0495672_0001502 3300047320 Bacteria 22882
439 Ga0495672_0023150 3300047320 Bacteria 4027
440 Ga0495672_0070862 3300047320 Bacteria 1974
441 Ga0495676_0110221 3300047321 Bacteria 2021
442 Ga0495683_0000751 3300047323 Bacteria 23402
443 Ga0495683_0006182 3300047323 Bacteria 6560
444 Ga0495683_0102248 3300047323 Bacteria 1377
445 Ga0495687_000181 3300047443 Bacteria 91455
446 Ga0495687_053514 3300047443 Bacteria 1699
447 Ga0495681_0002457 3300047470 Bacteria 13222
448 Ga0495681_0027576 3300047470 Bacteria 2935
449 Ga0495686_0000051 3300047472 Bacteria 263489
450 Ga0495686_0000209 3300047472 Bacteria 108972
451 Ga0495686_0001880 3300047472 Bacteria 20984
452 Ga0495686_0016214 3300047472 Bacteria 5058
453 Ga0495686_0145844 3300047472 Bacteria 1393
454 Ga0495686_0157979 3300047472 Bacteria 1327
455 Ga0495686_0187695 3300047472 Bacteria 1193
456 Ga0495626_0022835 3300048091 Bacteria 3088
457 Ga0495626_0037916 3300048091 Bacteria 2288
458 Ga0496100_0094115 3300048903 Bacteria 2051
459 Ga0496101_0004154 3300048904 Bacteria 9071
460 Ga0496101_0014663 3300048904 Bacteria 5272
461 Ga0496102_0004598 3300048905 Bacteria 11673
462 Ga0496102_0021862 3300048905 Bacteria 5662
463 Ga0496103_0000784 3300048906 Bacteria 23390
464 Ga0496103_0032993 3300048906 Bacteria 3162
465 Ga0496104_0034197 3300048907 Bacteria 4737
466 Ga0496104_0210622 3300048907 Bacteria 1855
467 Ga0496105_0176741 3300048908 Bacteria 1748
468 Ga0496106_0006670 3300048909 Bacteria 8547
469 Ga0496106_0087170 3300048909 Bacteria 2405
470 Ga0496107_0235483 3300048910 Bacteria 1362
471 Ga0496109_0013161 3300048912 Bacteria 7160
472 Ga0496111_0097400 3300048914 Bacteria 2159
473 Ga0496112_0159356 3300048915 Bacteria 2223
474 Ga0496113_0000633 3300048916 Bacteria 17688
475 Ga0496113_0016669 3300048916 Bacteria 5080
476 Ga0496113_0130020 3300048916 Bacteria 1975
477 Ga0496113_0221706 3300048916 Bacteria 1507
478 Ga0496114_0003146 3300048917 Bacteria 12674
479 Ga0496114_0025174 3300048917 Bacteria 4862
480 Ga0496115_0000783 3300048918 Bacteria 23323
481 Ga0496116_0044240 3300048919 Bacteria 3026
482 Ga0496116_0082733 3300048919 Bacteria 1984
483 Ga0496116_0112599 3300048919 Bacteria 1594
484 Ga0496117_0001166 3300048920 Bacteria 39515
485 Ga0496117_0008212 3300048920 Bacteria 9956
486 Ga0496117_0023913 3300048920 Bacteria 4851
487 Ga0496117_0032207 3300048920 Bacteria 3987
488 Ga0496117_0055217 3300048920 Bacteria 2777
489 Ga0496117_0065309 3300048920 Bacteria 2475
490 Ga0496118_0000039 3300048921 Bacteria 305458
491 Ga0496118_0002904 3300048921 Bacteria 22291
492 Ga0496118_0010634 3300048921 Bacteria 9085
493 Ga0496118_0013144 3300048921 Bacteria 7857
494 Ga0496118_0029235 3300048921 Bacteria 4626
495 Ga0496118_0041646 3300048921 Bacteria 3633
496 Ga0496118_0071453 3300048921 Bacteria 2498
497 Ga0496119_0000678 3300048922 Bacteria 45442
498 Ga0496119_0014493 3300048922 Bacteria 6161
499 Ga0496119_0034908 3300048922 Bacteria 3302
500 Ga0496119_0135895 3300048922 Bacteria 1333
501 Ga0496120_0007629 3300048923 Bacteria 8017
502 Ga0496121_0001367 3300048924 Bacteria 41529
503 Ga0496121_0011982 3300048924 Bacteria 9533
504 Ga0496121_0017363 3300048924 Bacteria 7357
505 Ga0496121_0043649 3300048924 Bacteria 3879
506 Ga0496121_0056235 3300048924 Bacteria 3269
507 Ga0496121_0081336 3300048924 Bacteria 2564
508 Ga0496121_0094326 3300048924 Bacteria 2328
509 Ga0496121_0117822 3300048924 Bacteria 2011
510 Ga0496122_0000279 3300048925 Bacteria 114185
511 Ga0496122_0000287 3300048925 Bacteria 112404
512 Ga0496122_0003383 3300048925 Bacteria 20997
513 Ga0496122_0005139 3300048925 Bacteria 15785
514 Ga0496122_0012084 3300048925 Bacteria 8654
515 Ga0496122_0017366 3300048925 Bacteria 6733
516 Ga0496122_0033588 3300048925 Bacteria 4216
517 Ga0496122_0039175 3300048925 Bacteria 3782
518 Ga0496122_0040356 3300048925 Bacteria 3710
519 Ga0496122_0075124 3300048925 Bacteria 2386
520 Ga0496122_0130055 3300048925 Bacteria 1602
521 Ga0496123_0000146 3300048926 Bacteria 143990
522 Ga0496123_0001342 3300048926 Bacteria 34737
523 Ga0496123_0005602 3300048926 Bacteria 12555
524 Ga0496123_0005726 3300048926 Bacteria 12379
525 Ga0496123_0010773 3300048926 Bacteria 8023
526 Ga0496123_0016107 3300048926 Bacteria 6091
527 Ga0496123_0021444 3300048926 Bacteria 5021
528 Ga0496123_0049229 3300048926 Bacteria 2827
529 Ga0496123_0053468 3300048926 Bacteria 2668
530 Ga0496123_0082517 3300048926 Bacteria 1948
531 Ga0496123_0084908 3300048926 Bacteria 1907
532 Ga0496124_0000043 3300048927 Bacteria 300907
533 Ga0496124_0000232 3300048927 Bacteria 108986
534 Ga0496124_0000343 3300048927 Bacteria 85220
535 Ga0496124_0002777 3300048927 Bacteria 22248
536 Ga0496124_0002928 3300048927 Bacteria 21499
537 Ga0496124_0028074 3300048927 Bacteria 5037
538 Ga0496124_0032533 3300048927 Bacteria 4603
539 Ga0496124_0038378 3300048927 Bacteria 4160
540 Ga0496124_0055799 3300048927 Bacteria 3336
541 Ga0496124_0114468 3300048927 Bacteria 2166
542 Ga0496124_0123284 3300048927 Bacteria 2068
543 Ga0496124_0173271 3300048927 Bacteria 1668
544 Ga0496125_0000525 3300048928 Bacteria 66539
545 Ga0496125_0009938 3300048928 Bacteria 9672
546 Ga0496125_0010075 3300048928 Bacteria 9588
547 Ga0496125_0030997 3300048928 Bacteria 4774
548 Ga0496125_0034181 3300048928 Bacteria 4485
549 Ga0496125_0037628 3300048928 Bacteria 4204
550 Ga0496125_0104313 3300048928 Bacteria 2077
551 Ga0496125_0179631 3300048928 Bacteria 1412
552 Ga0496126_0000890 3300048929 Bacteria 52336
553 Ga0496126_0001437 3300048929 Bacteria 37376
554 Ga0496126_0016491 3300048929 Bacteria 7383
555 Ga0496126_0206978 3300048929 Bacteria 1653
556 Ga0501034_0056018 3300049571 Bacteria 3968
557 Ga0501034_0537780 3300049571 Bacteria 1079
558 Ga0501036_0333037 3300049572 Bacteria 1268
559 Ga0501047_0004596 3300049581 Bacteria 12981
560 Ga0501044_0014603 3300049823 Bacteria 8469
561 Ga0501044_0102610 3300049823 Bacteria 2876
562 Ga0501044_0615272 3300049823 Bacteria 978
563 nmdc:mga03683_2591_c1 3300050489 Bacteria 5645
564 nmdc:mga0yw44_4173_c1 3300050492 Bacteria 6571
565 nmdc:mga06z11_67015_c1 3300050494 Bacteria 1889
566 nmdc:mga07m45_10860_c1 3300050496 Bacteria 4769
567 nmdc:mga07m45_3201_c1 3300050496 Bacteria 7851
568 nmdc:mga07m45_42767_c1 3300050496 Bacteria 2540
569 nmdc:mga08y16_185363_c1 3300050511 Bacteria 2160
570 nmdc:mga0sz30_12277_c1 3300050516 Bacteria 1975
571 nmdc:mga0sz30_12293_c1 3300050516 Bacteria 3328
572 nmdc:mga0sz30_90334_c1 3300050516 Bacteria 1332
573 Ga0495601_0046002 3300053077 Bacteria 2746
574 Ga0495612_0081970 3300053078 Bacteria 1356
575 Ga0500610_0002998 3300053079 Bacteria 6368
576 Ga0495619_0011875 3300053085 Bacteria 5484
577 Ga0500643_060660 3300053087 Bacteria 1063
578 Ga0500556_0000052 3300053104 Bacteria 117825
579 Ga0500569_001663 3300053109 Bacteria 4238
580 Ga0500592_011458 3300053116 Bacteria 1419
581 Ga0500595_004353 3300053119 Bacteria 6371
582 Ga0500618_002324 3300053125 Bacteria 7295
583 Ga0500642_0048629 3300053130 Bacteria 1863
584 Ga0500655_024233 3300053133 Bacteria 1148
585 Ga0500658_0006626 3300053134 Bacteria 4292
586 Ga0500568_0003502 3300053139 Bacteria 8713
587 Ga0500568_0056921 3300053139 Bacteria 1522
588 Ga0500590_075518 3300053148 Bacteria 1667
589 Ga0500619_006419 3300053154 Bacteria 2710
590 Ga0500622_0003787 3300053156 Bacteria 9863
591 Ga0500622_0014724 3300053156 Bacteria 4194
592 Ga0500627_0036194 3300053158 Bacteria 2101
593 Ga0500633_0000648 3300053160 Bacteria 5809
594 Ga0500636_0034674 3300053177 Bacteria 2987
595 Ga0500645_000083 3300053730 Bacteria 76285
596 Ga0500645_027123 3300053730 Bacteria 1738
597 Ga0500596_003000 3300053735 Bacteria 3256
598 Ga0466962_0140248 3300061719 Bacteria 1171
599 Ga0466962_0165628 3300061719 Bacteria 1075
600 2509391897 2509276021 Bacteria 7634384
601 2509447247 2509276033 Bacteria 7180565
602 2510308190 2510065057 Bacteria 6649661
603 2510895511 2510461076 Bacteria 8618824
604 2511136751 2510917022 Bacteria 6504556
605 2511199160 2510917030 Bacteria 7460662
606 2511500185 2511231052 Bacteria 6974333
607 2512532903 2512047086 Bacteria 6850303
608 2513567842 2513237084 Bacteria 7231967
609 2513577084 2513237085 Bacteria 7695351
610 2513590897 2513237087 Bacteria 5817514
611 2513619865 2513237091 Bacteria 6900273
612 2513633249 2513237093 Bacteria 7545552
613 2513707745 2513237103 Bacteria 7647401
614 2513886208 2513237140 Bacteria 7076289
615 2513905845 2513237143 Bacteria 6664116
616 2514018175 2513237162 Bacteria 7468464
617 2515113188 2515075009 Bacteria 7288508
618 2515611381 2515154107 Bacteria 6795637
619 2515638036 2515154113 Bacteria 7807172
620 2515645795 2515154114 Bacteria 7848616
621 2515655217 2515154116 Bacteria 7552979
622 2515739618 2515154134 Bacteria 7220242
623 2516897712 2516653046 Bacteria 6989037
624 2517036850 2516653077 Bacteria 7555578
625 2517077214 2516653085 Bacteria 7346596
626 2517095962 2517093000 Bacteria 7412387
627 2517407585 2517287029 Bacteria 6905599
628 2519462200 2519103095 Bacteria 6629912
629 2524453632 2524023207 Bacteria 6813453
630 2524611548 2524023250 Bacteria 5457705
631 2545675074 2545555834 Bacteria 8130841
632 2551711956 2551306089 Bacteria 7162724
633 2551725300 2551306091 Bacteria 7086830
634 2585222990 2582581298 Bacteria 7315509
635 2585271259 2582581307 Bacteria 6597605
636 2585279197 2582581308 Bacteria 7413247
637 2585294816 2582581311 Bacteria 6763856
638 2585323200 2582581315 Bacteria 7318924
639 2585331305 2582581316 Bacteria 7774528
640 2585524641 2585427526 Bacteria 7258840
641 2585531318 2585427527 Bacteria 7273426
642 2585538329 2585427528 Bacteria 6842387
643 2585545573 2585427529 Bacteria 7395659
644 2585552759 2585427530 Bacteria 7383882
645 2585559004 2585427531 Bacteria 6992870
646 2585836282 2585427593 Bacteria 7141551
647 2585904049 2585427609 Bacteria 6667127
648 2587980833 2585428125 Bacteria 6662905
649 2599734389 2599185239 Bacteria 8686614
650 2599747478 2599185240 Bacteria 7968121
651 2600203907 2599185354 Bacteria 4398675
652 2600209362 2599185355 Bacteria 7968906
653 2616311364 2615840626 Bacteria 7921970
654 2616554378 2615840698 Bacteria 7319877
655 2617383681 2617270742 Bacteria 6808054
656 2643856664 2643221568 Bacteria 5187270
657 2671111300 2667528174 Bacteria 6435400
658 2676746090 2675903129 Bacteria 7964495
659 2719181928 2718217882 Bacteria 6556348
660 2719386540 2718217927 Bacteria 6972593
661 2719732645 2718218009 Bacteria 6478651
662 2720614177 2718218232 Bacteria 6720332
663 2720620945 2718218233 Bacteria 6662049
664 2720632269 2718218235 Bacteria 6630699
665 2720775997 2718218269 Bacteria 6906114
666 2721148019 2718218363 Bacteria 6524337
667 2721159470 2718218365 Bacteria 6274507
668 2721164855 2718218366 Bacteria 6425255
669 2721400244 2718218423 Bacteria 6438183
670 2722841025 2721755514 Bacteria 6424414
671 2723027595 2721755556 Bacteria 6745503
672 2723561224 2721755684 Bacteria 6859907
673 2723567847 2721755685 Bacteria 6704835
674 2724039057 2721755809 Bacteria 6438790
675 2724045401 2721755810 Bacteria 6479005
676 2724090604 2721755819 Bacteria 6906405
677 2724105112 2721755822 Bacteria 6726041
678 2724110939 2721755823 Bacteria 6752556
679 2725951471 2724679232 Bacteria 7646494
680 2730108531 2728369352 Bacteria 6745171
681 2730165163 2728369365 Bacteria 6555560
682 2730299102 2728369397 Bacteria 6274511
683 2739032969 2738541333 Bacteria 7106503
684 2739054544 2738541337 Bacteria 6183410
685 2793280181 2791355253 Bacteria 5171699
686 2793315959 2791355259 Bacteria 7254731
687 2793319308 2791355260 Bacteria 6598818
688 2793328393 2791355261 Bacteria 6661293
689 2793335349 2791355262 Bacteria 6774204
690 2793339404 2791355263 Bacteria 6872478
691 2793347118 2791355264 Bacteria 6429314
692 2793351712 2791355265 Bacteria 6539969
693 2793362009 2791355266 Bacteria 7116587
694 2793367763 2791355267 Bacteria 7222458
695 2805932855 2802429606 Bacteria 6346811
696 2806045108 2802429633 Bacteria 7341974
697 2806056936 2802429635 Bacteria 7650140
698 2806064317 2802429636 Bacteria 7597525
699 2806071584 2802429637 Bacteria 7067217
700 2809143736 2808606418 Bacteria 6724496
701 2817258121 2816332253 Bacteria 6764532
702 2817281464 2816332256 Bacteria 6891714
703 2817454171 2816332286 Bacteria 6853759
704 2819637449 2818991452 Bacteria 8442785
705 2819641423 2818991453 Bacteria 7181617
706 2819685061 2818991461 Bacteria 7026071
707 2819718745 2818991467 Bacteria 5893227
708 2838021585 2838016132 Bacteria 6577831
709 2838023723 2838022645 Bacteria 6494267
710 2838033679 2838029111 Bacteria 6603031
711 2838045097 2838042994 Bacteria 6046894
712 2838053420 2838048938 Bacteria 6044578
713 2838065542 2838061910 Bacteria 6794874
714 2838070019 2838068647 Bacteria 6208656
715 2838683326 2838680041 Bacteria 6545511
716 2838686913 2838686498 Bacteria 7807632
717 2838697730 2838694306 Bacteria 6853137
718 2838710846 2838707686 Bacteria 6619912
719 2838730129 2838729681 Bacteria 7400765
720 2838742856 2838742623 Bacteria 7396178
721 2841852359 2841851746 Bacteria 7532261
722 2841867085 2841864319 Bacteria 6742987
723 2842079019 2842077413 Bacteria 6508645
724 2842113133 2842110456 Bacteria 7656360
725 2842118471 2842118031 Bacteria 7033875
726 2842158183 2842156927 Bacteria 6894975
727 2842168658 2842163707 Bacteria 6916235
728 2842181803 2842180545 Bacteria 6888678
729 2842199237 2842198810 Bacteria 6608673
730 2842218074 2842217011 Bacteria 7497767
731 2842230147 2842229732 Bacteria 7475766
732 2842240382 2842237096 Bacteria 6620661
733 2842244035 2842243621 Bacteria 7421798
734 2842257880 2842257432 Bacteria 7401195
735 2842270830 2842264693 Bacteria 6472963
736 2842271549 2842271015 Bacteria 7807131
737 2842292681 2842291075 Bacteria 7076806
738 2842305180 2842304105 Bacteria 7023636
739 2842317060 2842311132 Bacteria 6616990
740 2842347389 2842341865 Bacteria 7003929
741 2842370197 2842363717 Bacteria 6844742
742 2842373957 2842370503 Bacteria 7038661
743 2842379079 2842377471 Bacteria 7140707
744 2842384981 2842384541 Bacteria 7057858
745 2842400217 2842395702 Bacteria 6780583
746 2842423633 2842422224 Bacteria 6239196
747 2842434713 2842428310 Bacteria 6767288
748 2842441091 2842434925 Bacteria 6502746
749 2842447709 2842441272 Bacteria 6769273
750 2842449422 2842447887 Bacteria 6754142
751 2842469074 2842462802 Bacteria 6588055
752 2842475638 2842469257 Bacteria 6752936
753 2842480426 2842475841 Bacteria 6603183
754 2842483942 2842482326 Bacteria 7212537
755 2842496621 2842495871 Bacteria 6820686
756 2842505353 2842502639 Bacteria 6604161
757 2842510972 2842509118 Bacteria 6850950
758 2842917992 2842914999 Bacteria 4419378
759 2844458210 2844454524 Bacteria 7952546
760 2852390386 2852387548 Bacteria 8025568
761 2855830368 2855825444 Bacteria 6785811
762 2855845853 2855839649 Bacteria 7135830
763 2857517295 2857516855 Bacteria 7787325
764 2858805253 2858800743 Bacteria 6603254
765 2863424083 2863421361 Bacteria 7300805
766 2896390652 2896384573 Bacteria 7700774
767 2904567237 2904564687 Bacteria 7609577
768 2904574282 2904571731 Bacteria 7608790
769 2915989298 2915986958 Bacteria 6739310
770 2915995483 2915993759 Bacteria 7016183
771 2916012565 2916007675 Bacteria 6898660
772 2916019219 2916014648 Bacteria 6946486
773 2916026127 2916021584 Bacteria 6854472
774 2916037241 2916035215 Bacteria 6755766
775 2916047821 2916041962 Bacteria 6820487
776 2916053865 2916048683 Bacteria 6543552
777 2919087675 2919085039 Bacteria 4532964
778 2919106326 2919100787 Bacteria 7710546
779 2919410131 2919408235 Bacteria 6149349
780 2920765944 2920760137 Bacteria 7427611
781 2921202557 2921201388 Bacteria 6926299
782 2921214074 2921208531 Bacteria 6745326
783 2921241701 2921237296 Bacteria 6876710
784 2921249683 2921244191 Bacteria 6568419
785 2921284971 2921282425 Bacteria 6826397
786 2921297483 2921296804 Bacteria 7176999
787 2924144300 2924144063 Bacteria 6883928
788 2924151515 2924150972 Bacteria 7169444
789 2924159393 2924158325 Bacteria 7188855
790 2924196694 2924193448 Bacteria 6955718
791 2924201248 2924200457 Bacteria 6757188
792 2924212446 2924207177 Bacteria 6917007
793 2924233623 2924228884 Bacteria 6633132
794 2928029280 2928027323 Bacteria 4382488
795 2928158697 2928157003 Bacteria 7522202
796 2928167660 2928163908 Bacteria 7561269
797 2928174532 2928170801 Bacteria 8785406
798 2928540596 2928536128 Bacteria 7657547
799 2928969942 2928968154 Bacteria 4633371
800 2933570987 2933570622 Bacteria 7023390
801 2933588810 2933586486 Bacteria 7667493
802 2933600825 2933599457 Bacteria 5858799
803 2935896884 2935894831 Bacteria 6620579
804 2935901820 2935901341 Bacteria 7341747
805 2936371905 2936367885 Bacteria 7324495
806 2936379740 2936375103 Bacteria 6652732
807 2936387486 2936381700 Bacteria 7006523
808 2936997986 2936996657 Bacteria 6298727
809 2937007811 2937002841 Bacteria 6934057
810 2937014663 2937009748 Bacteria 6746052
811 2937020142 2937016420 Bacteria 6782579
812 2937051608 2937049772 Bacteria 6757901
813 2937059488 2937056579 Bacteria 7107896
814 2937067397 2937063883 Bacteria 7199456
815 2937096347 2937091812 Bacteria 6979387
816 2937105794 2937098957 Bacteria 7249374
817 2937108978 2937106411 Bacteria 6947143
818 2937116897 2937113482 Bacteria 6505872
819 2937124883 2937119839 Bacteria 6597547
820 2946008272 2946006987 Bacteria 6705746
821 2946788709 2946787523 Bacteria 4366789
822 2957385460 2957382221 Bacteria 6737050
823 2957405972 2957402308 Bacteria 6741770
824 2957409497 2957408893 Bacteria 6558585
825 2957418720 2957415311 Bacteria 6991633
826 2957424407 2957422303 Bacteria 7172205
827 2957430207 2957430029 Bacteria 7022557
828 2957455142 2957450854 Bacteria 6765715
829 2957460089 2957457609 Bacteria 6967680
830 2957464917 2957464669 Bacteria 6568877
831 2957475318 2957471148 Bacteria 6797643
832 2957490399 2957484790 Bacteria 6703082
833 2957492289 2957491536 Bacteria 6695180
834 2960590701 2960584000 Bacteria 6864594
835 2960601345 2960597568 Bacteria 6550735
836 2960606284 2960603979 Bacteria 6898737
837 2960616011 2960610863 Bacteria 6691244
838 2960623675 2960617483 Bacteria 6727748
839 2960643994 2960637947 Bacteria 7296468
840 2960658468 2960652885 Bacteria 7083688
841 2960672485 2960667422 Bacteria 6763020
842 2960678882 2960674078 Bacteria 6609048
843 2960691683 2960687367 Bacteria 6535474
844 2964610346 2964607997 Bacteria 7101408
845 2964624508 2964621998 Bacteria 6834995
846 2964642184 2964636051 Bacteria 7091832
847 2964649666 2964643177 Bacteria 6820887
848 2964655723 2964649959 Bacteria 6675118
849 2964661199 2964656573 Bacteria 7100150
850 2964669554 2964663802 Bacteria 7019362
851 2964670887 2964670856 Bacteria 6851364
852 2964681941 2964678106 Bacteria 6792020
853 2964690302 2964685014 Bacteria 6839111
854 2964695019 2964691889 Bacteria 6802758
855 2964704260 2964698721 Bacteria 6765331
856 2964711795 2964705432 Bacteria 7114648
857 2964713741 2964712639 Bacteria 6695970
858 2964725340 2964719344 Bacteria 7286602
859 2967666066 2967664464 Bacteria 6948836
860 2967675113 2967671571 Bacteria 7021409
861 2967685414 2967678726 Bacteria 7264382
862 2967694218 2967693043 Bacteria 6804451
863 2967700402 2967699805 Bacteria 6854538
864 2967716017 2967714385 Bacteria 7000047
865 2967727048 2967721400 Bacteria 7073753
866 2967739763 2967735183 Bacteria 6827012
867 2967745345 2967742019 Bacteria 6794534
868 2967750324 2967748971 Bacteria 6733771
869 2967767458 2967762386 Bacteria 6923502
870 2967770144 2967769361 Bacteria 6587838
871 2970019893 2970019648 Bacteria 7072033
872 2970037397 2970033650 Bacteria 7118744
873 2970043143 2970040964 Bacteria 6731123
874 2970050226 2970047711 Bacteria 7088379
875 2970060625 2970054988 Bacteria 6611507
876 2970064365 2970061556 Bacteria 7099761
877 2970072707 2970068827 Bacteria 7123112
878 2970076608 2970076120 Bacteria 6697332
879 2970087439 2970082768 Bacteria 6183754
880 2970095175 2970088815 Bacteria 6933825
881 2970114088 2970109326 Bacteria 6863976
882 2970119947 2970116247 Bacteria 6501857
883 2970130853 2970129317 Bacteria 6806560
884 2970154835 2970149975 Bacteria 6779706
885 2970158203 2970156795 Bacteria 7168044
886 2970165241 2970164137 Bacteria 6861252
887 2970175309 2970170962 Bacteria 6876229
888 2970184815 2970184632 Bacteria 7054431
889 2977523023 2977516862 Bacteria 6940108
890 2977524311 2977523885 Bacteria 6960446
891 2977539241 2977537788 Bacteria 6929320
892 2977558797 2977551784 Bacteria 7125765
893 2977564202 2977558990 Bacteria 6863948
894 2977571163 2977565890 Bacteria 6901543
895 2977576826 2977572785 Bacteria 6763888
896 2977580571 2977579622 Bacteria 6772100
897 2981992183 2981990288 Bacteria 7590678
898 2984590102 2984587000 Bacteria 5263363
899 2995395093 2995392953 Bacteria 4539380
900 2996895013 2996893221 Bacteria 5823108
901 3003671281 3003665799 Bacteria 7279786
902 3005448585 3005445848 Bacteria 6906074
903 639649309 639633055 Bacteria 7751309
904 641645879 641522639 Bacteria 7737025
905 642419921 641736154 Bacteria 7689995
906 648738534 648276728 Bacteria 6968865
907 8003997652 8003992118 Bacteria 7266902
908 8005281344 8005275841 Bacteria 6929066
909 8005284684 8005282627 Bacteria 6675747
910 8005295650 8005289223 Bacteria 6634003
911 8005303260 8005301065 Bacteria 6614431
912 8005309527 8005307578 Bacteria 7395396
913 8005381061 8005376324 Bacteria 6590079
914 8005388991 8005382845 Bacteria 6732062
915 8005437414 8005430974 Bacteria 6689030
916 8005463871 8005460587 Bacteria 7157962
917 8005501028 8005497431 Bacteria 6477605
918 8005556886 8005556819 Bacteria 6908598
919 8005568130 8005563573 Bacteria 7153261
920 8005573329 8005570704 Bacteria 6957481
921 8005622395 8005619151 Bacteria 7030230
922 8005629895 8005626139 Bacteria 6534237
923 8005672445 8005668836 Bacteria 6953162
924 8005682760 8005682033 Bacteria 6726518
925 8005691967 8005688590 Bacteria 6610080
926 8005697538 8005695170 Bacteria 6912330
927 8018164440 8018163183 Bacteria 7277977
928 8018176920 8018176218 Bacteria 6896178
929 8018850110 8018845410 Bacteria 8933938
930 8020813680 8020807995 Bacteria 6801506
931 8020942721 8020938398 Bacteria 7472757
932 8020952891 8020945358 Bacteria 8467355
933 8020957728 8020953355 Bacteria 7439080
934 8021121453 8021120328 Bacteria 8782274
935 8023683033 8023680758 Bacteria 7729763
936 8024482735 8024479707 Bacteria 6954785
937 8039100099 8039098773 Bacteria 6602928
938 8040171125 8040167225 Bacteria 6542727
939 8040179167 8040173305 Bacteria 6827067
940 8046771812 8046767195 Bacteria 7547379
941 8056378270 8056375014 Bacteria 7006639
942 8056384288 8056382006 Bacteria 6408074
943 8057102384 8057101203 Bacteria 5034064
944 8057575570 8057575449 Bacteria 7367519
945 8057878450 8057874678 Bacteria 7494653
946 Ga0500658_0005036
947 JGI24740J21852_10000491
948 JGI24737J22298_10006149
949 JGI25155J39150_1000044
950 JGI25156J39149_1000058
951 JGI25162J39368_1001111
952 JGI25154J39366_1000236
953 JGI25158J39367_1000019
954 JGI25157J39369_1000078
955 JGI25152J39213_1008101
956 JGI25152J39213_1009714
957 JGI25159J45721_1000393
958 JGI25159J45721_1001256
959 JGI25151J46595_10001000
960 JGI25151J46595_10003303
961 JGI25151J46595_10027236
962 JGI25165J46597_1002105
963 JGI25165J46597_1006815
964 JGI25153J46596_10001757
965 JGI25153J46596_10005805
966 rootH1_10002490
967 rootH1_10154918
968 rootH2_10104606
969 rootL2_10000902
970 rootH1_10073995
971 rootH1_10091604
972 JGI25160J50197_1000001
973 JGI25161J50226_1000001
974 JGI25161J50226_1000068
975 Ga0055532_1000337
976 Ga0055532_1000821
977 Ga0055532_1000922
978 Ga0055525_1000119
979 Ga0055527_1000104
980 Ga0055527_1000154
981 Ga0055535_1000218
982 Ga0055535_1000320
983 Ga0055542_1000076
984 Ga0055542_1000153
985 Ga0055542_1003042
986 Ga0055529_1000004
987 Ga0055529_1000176
988 Ga0055526_1000244
989 Ga0055526_1001546
990 Ga0055526_1007492
991 Ga0055526_1008391
992 Ga0055526_1033769
993 Ga0055537_1000178
994 Ga0055524_1000113
995 Ga0055524_1002336
996 Ga0055524_1004246
997 Ga0055524_1013289
998 Ga0055528_1000256
999 Ga0055528_1000261
1000 Ga0055528_1001003
1001 Ga0055528_1001848
1002 Ga0055528_1015200
1003 Ga0055528_1020168
1004 Ga0055530_10002177
1005 Ga0055540_1000268
1006 Ga0055540_1004141
1007 Ga0055540_1010129
1008 Ga0055540_1016808
1009 Ga0055540_1020546
1010 Ga0055531_10000494
1011 Ga0055531_10015091
1012 Ga0055543_1000003
1013 Ga0055543_1000470
1014 Ga0065165_1000335
1015 Ga0065165_1006900
1016 Ga0065714_10069269
1017 Ga0070658_10002454
1018 Ga0070658_10023533
1019 Ga0070666_10000023
1020 Ga0070660_100000808
1021 Ga0070660_100002392
1022 Ga0070661_100020019
1023 Ga0070661_100072065
1024 Ga0070668_100063326
1025 Ga0070669_100100499
1026 Ga0070674_100016877
1027 Ga0070659_100000012
1028 Ga0070667_100007705
1029 Ga0070667_100021962
1030 Ga0070667_100328962
1031 Ga0070663_100000530
1032 Ga0070678_100000786
1033 Ga0068867_100056815
1034 Ga0070672_100010194
1035 Ga0070672_100053334
1036 Ga0070665_100010169
1037 Ga0070665_100174378
1038 Ga0068855_100068316
1039 Ga0070664_100060423
1040 Ga0068857_100107544
1041 Ga0068857_100132824
1042 Ga0068854_100028189
1043 Ga0068854_100055631
1044 Ga0068852_100064479
1045 Ga0068851_10113937
1046 Ga0068858_100130717
1047 Ga0068860_100017387
1048 Ga0068862_100133515
1049 Ga0075365_10008493
1050 Ga0075363_100018898
1051 Ga0070712_100180099
1052 Ga0075362_10007517
1053 Ga0075369_10005897
1054 Ga0075369_10017667
1055 Ga0075369_10112159
1056 Ga0075366_10003422
1057 Ga0075370_10004016
1058 Ga0075370_10048128
1059 Ga0075370_10084033
1060 Ga0075370_10104724
1061 Ga0068865_100023745
1062 Ga0079104_1000056
1063 Ga0105244_10033305
1064 Ga0105240_10001781
1065 Ga0105240_10143890
1066 Ga0111539_10076168
1067 Ga0105243_10000812
1068 Ga0105241_10003240
1069 Ga0105237_10001251
1070 Ga0105237_10030427
1071 Ga0105237_10081269
1072 Ga0105237_10128351
1073 Ga0105237_10804532
1074 Ga0105238_10000331
1075 Ga0105238_10035972
1076 Ga0105238_10048861
1077 Ga0123341_1000028
1078 Ga0123342_1028435
1079 Ga0105239_10035459
1080 Ga0105239_10060729
1081 Ga0105239_10179572
1082 Ga0157371_10000197
1083 Ga0157371_10016751
1084 Ga0157370_10000248
1085 Ga0157370_10001042
1086 Ga0157370_10236176
1087 Ga0157369_10111065
1088 Ga0163162_10001650
1089 Ga0157372_10068297
1090 Ga0157375_10202886
1091 Ga0182007_10003611
1092 Ga0182007_10004059
1093 Ga0182007_10004378
1094 Ga0182005_1000173
1095 Ga0163161_10043529
1096 Ga0214543_1009579
1097 Ga0213876_10035238
1098 Ga0209435_100054
1099 Ga0209436_100070
1100 Ga0209566_100442
1101 Ga0209674_105923
1102 Ga0209672_100032
1103 Ga0209672_100042
1104 Ga0209147_100012
1105 Ga0209147_100046
1106 Ga0209147_100052
1107 Ga0209563_100024
1108 Ga0209563_101162
1109 Ga0209437_100098
1110 Ga0209258_100030
1111 Ga0209258_100073
1112 Ga0207425_1001479
1113 Ga0207425_1012055
1114 Ga0209646_1000170
1115 Ga0209026_1000193
1116 Ga0209148_1000008
1117 Ga0209148_1000022
1118 Ga0209148_1000821
1119 Ga0209759_1000222
1120 Ga0209129_1000252
1121 Ga0209129_1002985
1122 Ga0209129_1018814
1123 Ga0209233_1000095
1124 Ga0209233_1000148
1125 Ga0209565_1000003
1126 Ga0209455_1000002
1127 Ga0209455_1000024
1128 Ga0209455_1000324
1129 Ga0209673_1000010
1130 Ga0209673_1000017
1131 Ga0209673_1000021
1132 Ga0209673_1000025
1133 Ga0209673_1001232
1134 Ga0209673_1004332
1135 Ga0209673_1007335
1136 Ga0209673_1024673
1137 Ga0209130_1000003
1138 Ga0209130_1000020
1139 Ga0209675_1000119
1140 Ga0209675_1028059
1141 Ga0209676_1025937
1142 Ga0209025_1000091
1143 Ga0209025_1002551
1144 Ga0209025_1004772
1145 Ga0209025_1016097
1146 Ga0209564_1000016
1147 Ga0209564_1000588
1148 Ga0209564_1000644
1149 Ga0209564_1000883
1150 Ga0209564_1007448
1151 Ga0209564_1012085
1152 Ga0209758_1000007
1153 Ga0209758_1001217
1154 Ga0209758_1001343
1155 Ga0209758_1001396
1156 Ga0209758_1018413
1157 Ga0209758_1018414
1158 Ga0209050_1001510
1159 Ga0209050_1002600
1160 Ga0209050_1019579
1161 Ga0209256_1000049
1162 Ga0209256_1000210
1163 Ga0209256_1000924
1164 Ga0209256_1002389
1165 Ga0209256_1011242
1166 Ga0209256_1023488
1167 Ga0207426_1000008
1168 Ga0207426_1000011
1169 Ga0209051_1000029
1170 Ga0209051_1000196
1171 Ga0209051_1000400
1172 Ga0209051_1004736
1173 Ga0209051_1006706
1174 Ga0209051_1035357
1175 Ga0209257_1000168
1176 Ga0209257_1000305
1177 Ga0209257_1001180
1178 Ga0207655_1070987
1179 Ga0207680_10000002
1180 Ga0207647_10184401
1181 Ga0207705_10000489
1182 Ga0207705_10002172
1183 Ga0207705_10009527
1184 Ga0207654_10000273
1185 Ga0207695_10000037
1186 Ga0207695_10001076
1187 Ga0207695_10029433
1188 Ga0207671_10004383
1189 Ga0207671_10008263
1190 Ga0207671_10018796
1191 Ga0207693_10146142
1192 Ga0207657_10000013
1193 Ga0207657_10005166
1194 Ga0207657_10027577
1195 Ga0207649_10000443
1196 Ga0207649_10011842
1197 Ga0207694_10000253
1198 Ga0207694_10028372
1199 Ga0207694_10065008
1200 Ga0207694_10148721
1201 Ga0207690_10000048
1202 Ga0207690_10014663
1203 Ga0207706_10069437
1204 Ga0207709_10000005
1205 Ga0207669_10000251
1206 Ga0207691_10026111
1207 Ga0207691_10065584
1208 Ga0207679_10044049
1209 Ga0207667_10000001
1210 Ga0207667_10007355
1211 Ga0207667_10038463
1212 Ga0207667_10074482
1213 Ga0207668_10049653
1214 Ga0207668_10238403
1215 Ga0207640_10001706
1216 Ga0207640_10026274
1217 Ga0207658_10003699
1218 Ga0207658_10327777
1219 Ga0207639_10025615
1220 Ga0207639_10205790
1221 Ga0207678_10001175
1222 Ga0207702_10156415
1223 Ga0207648_10031438
1224 Ga0207674_10171368
1225 Ga0207674_10382261
1226 Ga0207683_10008013
1227 Ga0207698_10008335
1228 Ga0209281_1000125
1229 Ga0209281_1001633
1230 Ga0209371_1000767
1231 Ga0209371_1007474
1232 Ga0268266_10000004
1233 Ga0268266_10071099
1234 Ga0268264_10026646
1235 Ga0307515_10021842
1236 Ga0307515_10044147
1237 Ga0265338_10017549
1238 Ga0268256_1000381
1239 Ga0268256_1034045
1240 Ga0316177_1132731
1241 Ga0265328_10016351
1242 Ga0265327_10007500
1243 Ga0307509_10203133
1244 Ga0307405_10286904
1245 Ga0307412_10000279
1246 Ga0307510_10001025
1247 Ga0307510_10030018
1248 Ga0307510_10156361
1249 Ga0373959_0021938
1250 Ga0373939_0001752
1251 Ga0373960_0039436
1252 Ga0373931_0009437
1253 Ga0395900_0009732
1254 Ga0395900_0124638
1255 Ga0395900_0593518
1256 Ga0395898_0002817
1257 Ga0395905_0000836
1258 Ga0395905_0001684
1259 Ga0395905_0003242
1260 Ga0436364_0266159
1261 Ga0436364_1191496
1262 Ga0395901_0000053
1263 Ga0395901_0000771
1264 Ga0395901_0051719
1265 Ga0436365_1903073
1266 Ga0436363_0094623
1267 Ga0451797_1009375
1268 Ga0451802_0590003
1269 Ga0451802_0864319
1270 Ga0451806_273572
1271 Ga0451807_0250052
1272 Ga0451807_0394883
1273 Ga0451833_0097459
1274 Ga0451837_0500608
1275 Ga0451837_1125556
1276 Ga0451849_1051639
1277 Ga0451843_0511692
1278 Ga0451853_1537113
1279 Ga0439448_0046940
1280 Ga0439449_0019623
1281 Ga0466969_0048147
1282 Ga0466972_0031098
1283 Ga0466973_0073639
1284 Ga0466965_0002833
1285 Ga0466965_0074376
1286 Ga0466966_0024442
1287 Ga0466966_0030275
1288 Ga0466961_0068600
1289 Ga0466963_0000775
1290 Ga0466971_0027711
1291 Ga0466968_0001146
1292 Ga0466968_0054845
1293 Ga0466970_0004290
1294 Ga0466957_0007192
1295 Ga0466957_0014397
1296 Ga0466957_0103143
1297 Ga0466959_0038026
1298 Ga0451576_0046970
1299 Ga0466958_0112472
1300 Ga0495591_000038
1301 Ga0495591_002043
1302 Ga0495629_0011780
1303 Ga0495629_0099923
1304 Ga0495650_0000074
1305 Ga0495650_0000085
1306 Ga0495650_0000792
1307 Ga0495605_0013342
1308 Ga0495605_0019640
1309 Ga0495584_0000234
1310 Ga0495584_0004488
1311 Ga0495584_0017295
1312 Ga0495585_0000503
1313 Ga0495585_0027601
1314 Ga0495585_0044443
1315 Ga0495596_0000353
1316 Ga0495607_0002423
1317 Ga0495607_0010757
1318 Ga0495607_0012593
1319 Ga0495607_0016048
1320 Ga0495583_0003563
1321 Ga0495583_0004282
1322 Ga0495583_0007004
1323 Ga0495583_0034415
1324 Ga0495583_0037583
1325 Ga0495583_0049900
1326 Ga0495606_0003262
1327 Ga0495606_0004275
1328 Ga0495606_0023312
1329 Ga0495606_0053380
1330 Ga0495610_0035819
1331 Ga0495610_0063514
1332 Ga0495616_0005239
1333 Ga0495616_0054958
1334 Ga0495616_0057988
1335 Ga0495620_0021011
1336 Ga0495630_0320565
1337 Ga0495631_0014736
1338 Ga0495631_0024247
1339 Ga0495631_0034272
1340 Ga0495632_0051326
1341 Ga0495643_0003546
1342 Ga0495643_0023729
1343 Ga0495643_0155728
1344 Ga0495644_0020986
1345 Ga0495648_0000123
1346 Ga0495648_0001570
1347 Ga0495648_0033596
1348 Ga0495663_0003381
1349 Ga0495654_0030922
1350 Ga0495609_0000072
1351 Ga0495609_0001961
1352 Ga0495609_0015067
1353 Ga0495609_0047265
1354 Ga0495597_0010430
1355 Ga0495656_0000081
1356 Ga0495668_0047650
1357 Ga0495668_0177093
1358 Ga0495611_0001502
1359 Ga0495611_0018534
1360 Ga0495611_0046262
1361 Ga0495625_0016188
1362 Ga0495625_0017507
1363 Ga0495625_0028250
1364 Ga0495625_0059750
1365 Ga0495625_0083670
1366 Ga0495661_0000040
1367 Ga0495661_0000632
1368 Ga0495661_0035787
1369 Ga0495661_0039944
1370 Ga0495661_0131180
1371 Ga0495669_0000951
1372 Ga0495669_0002830
1373 Ga0495669_0016202
1374 Ga0495670_0036221
1375 Ga0495671_0067962
1376 Ga0495649_0008479
1377 Ga0495649_0104606
1378 Ga0495589_0012514
1379 Ga0495589_0016431
1380 Ga0495600_0029243
1381 Ga0495660_0042271
1382 Ga0495674_0043083
1383 Ga0495672_0001502
1384 Ga0495672_0023150
1385 Ga0495672_0070862
1386 Ga0495676_0110221
1387 Ga0495683_0000751
1388 Ga0495683_0006182
1389 Ga0495683_0102248
1390 Ga0495687_000181
1391 Ga0495687_053514
1392 Ga0495681_0002457
1393 Ga0495681_0027576
1394 Ga0495686_0000051
1395 Ga0495686_0000209
1396 Ga0495686_0001880
1397 Ga0495686_0016214
1398 Ga0495686_0145844
1399 Ga0495686_0157979
1400 Ga0495686_0187695
1401 Ga0495626_0022835
1402 Ga0495626_0037916
1403 Ga0496100_0094115
1404 Ga0496101_0004154
1405 Ga0496101_0014663
1406 Ga0496102_0004598
1407 Ga0496102_0021862
1408 Ga0496103_0000784
1409 Ga0496103_0032993
1410 Ga0496104_0034197
1411 Ga0496104_0210622
1412 Ga0496105_0176741
1413 Ga0496106_0006670
1414 Ga0496106_0087170
1415 Ga0496107_0235483
1416 Ga0496109_0013161
1417 Ga0496111_0097400
1418 Ga0496112_0159356
1419 Ga0496113_0000633
1420 Ga0496113_0016669
1421 Ga0496113_0130020
1422 Ga0496113_0221706
1423 Ga0496114_0003146
1424 Ga0496114_0025174
1425 Ga0496115_0000783
1426 Ga0496116_0044240
1427 Ga0496116_0082733
1428 Ga0496116_0112599
1429 Ga0496117_0001166
1430 Ga0496117_0008212
1431 Ga0496117_0023913
1432 Ga0496117_0032207
1433 Ga0496117_0055217
1434 Ga0496117_0065309
1435 Ga0496118_0000039
1436 Ga0496118_0002904
1437 Ga0496118_0010634
1438 Ga0496118_0013144
1439 Ga0496118_0029235
1440 Ga0496118_0041646
1441 Ga0496118_0071453
1442 Ga0496119_0000678
1443 Ga0496119_0014493
1444 Ga0496119_0034908
1445 Ga0496119_0135895
1446 Ga0496120_0007629
1447 Ga0496121_0001367
1448 Ga0496121_0011982
1449 Ga0496121_0017363
1450 Ga0496121_0043649
1451 Ga0496121_0056235
1452 Ga0496121_0081336
1453 Ga0496121_0094326
1454 Ga0496121_0117822
1455 Ga0496122_0000279
1456 Ga0496122_0000287
1457 Ga0496122_0003383
1458 Ga0496122_0005139
1459 Ga0496122_0012084
1460 Ga0496122_0017366
1461 Ga0496122_0033588
1462 Ga0496122_0039175
1463 Ga0496122_0040356
1464 Ga0496122_0075124
1465 Ga0496122_0130055
1466 Ga0496123_0000146
1467 Ga0496123_0001342
1468 Ga0496123_0005602
1469 Ga0496123_0005726
1470 Ga0496123_0010773
1471 Ga0496123_0016107
1472 Ga0496123_0021444
1473 Ga0496123_0049229
1474 Ga0496123_0053468
1475 Ga0496123_0082517
1476 Ga0496123_0084908
1477 Ga0496124_0000043
1478 Ga0496124_0000232
1479 Ga0496124_0000343
1480 Ga0496124_0002777
1481 Ga0496124_0002928
1482 Ga0496124_0028074
1483 Ga0496124_0032533
1484 Ga0496124_0038378
1485 Ga0496124_0055799
1486 Ga0496124_0114468
1487 Ga0496124_0123284
1488 Ga0496124_0173271
1489 Ga0496125_0000525
1490 Ga0496125_0009938
1491 Ga0496125_0010075
1492 Ga0496125_0030997
1493 Ga0496125_0034181
1494 Ga0496125_0037628
1495 Ga0496125_0104313
1496 Ga0496125_0179631
1497 Ga0496126_0000890
1498 Ga0496126_0001437
1499 Ga0496126_0016491
1500 Ga0496126_0206978
1501 Ga0501034_0056018
1502 Ga0501034_0537780
1503 Ga0501036_0333037
1504 Ga0501047_0004596
1505 Ga0501044_0014603
1506 Ga0501044_0102610
1507 Ga0501044_0615272
1508 nmdc:mga03683_2591_c1
1509 nmdc:mga0yw44_4173_c1
1510 nmdc:mga06z11_67015_c1
1511 nmdc:mga07m45_10860_c1
1512 nmdc:mga07m45_3201_c1
1513 nmdc:mga07m45_42767_c1
1514 nmdc:mga08y16_185363_c1
1515 nmdc:mga0sz30_12277_c1
1516 nmdc:mga0sz30_12293_c1
1517 nmdc:mga0sz30_90334_c1
1518 Ga0495601_0046002
1519 Ga0495612_0081970
1520 Ga0500610_0002998
1521 Ga0495619_0011875
1522 Ga0500643_060660
1523 Ga0500556_0000052
1524 Ga0500569_001663
1525 Ga0500592_011458
1526 Ga0500595_004353
1527 Ga0500618_002324
1528 Ga0500642_0048629
1529 Ga0500655_024233
1530 Ga0500658_0006626
1531 Ga0500568_0003502
1532 Ga0500568_0056921
1533 Ga0500590_075518
1534 Ga0500619_006419
1535 Ga0500622_0003787
1536 Ga0500622_0014724
1537 Ga0500627_0036194
1538 Ga0500633_0000648
1539 Ga0500636_0034674
1540 Ga0500645_000083
1541 Ga0500645_027123
1542 Ga0500596_003000
1543 Ga0466962_0140248
1544 Ga0466962_0165628
1545 2509391897
1546 2509447247
1547 2510308190
1548 2510895511
1549 2511136751
1550 2511199160
1551 2511500185
1552 2512532903
1553 2513567842
1554 2513577084
1555 2513590897
1556 2513619865
1557 2513633249
1558 2513707745
1559 2513886208
1560 2513905845
1561 2514018175
1562 2515113188
1563 2515611381
1564 2515638036
1565 2515645795
1566 2515655217
1567 2515739618
1568 2516897712
1569 2517036850
1570 2517077214
1571 2517095962
1572 2517407585
1573 2519462200
1574 2524453632
1575 2524611548
1576 2545675074
1577 2551711956
1578 2551725300
1579 2585222990
1580 2585271259
1581 2585279197
1582 2585294816
1583 2585323200
1584 2585331305
1585 2585524641
1586 2585531318
1587 2585538329
1588 2585545573
1589 2585552759
1590 2585559004
1591 2585836282
1592 2585904049
1593 2587980833
1594 2599734389
1595 2599747478
1596 2600203907
1597 2600209362
1598 2616311364
1599 2616554378
1600 2617383681
1601 2643856664
1602 2671111300
1603 2676746090
1604 2719181928
1605 2719386540
1606 2719732645
1607 2720614177
1608 2720620945
1609 2720632269
1610 2720775997
1611 2721148019
1612 2721159470
1613 2721164855
1614 2721400244
1615 2722841025
1616 2723027595
1617 2723561224
1618 2723567847
1619 2724039057
1620 2724045401
1621 2724090604
1622 2724105112
1623 2724110939
1624 2725951471
1625 2730108531
1626 2730165163
1627 2730299102
1628 2739032969
1629 2739054544
1630 2793280181
1631 2793315959
1632 2793319308
1633 2793328393
1634 2793335349
1635 2793339404
1636 2793347118
1637 2793351712
1638 2793362009
1639 2793367763
1640 2805932855
1641 2806045108
1642 2806056936
1643 2806064317
1644 2806071584
1645 2809143736
1646 2817258121
1647 2817281464
1648 2817454171
1649 2819637449
1650 2819641423
1651 2819685061
1652 2819718745
1653 2838021585
1654 2838023723
1655 2838033679
1656 2838045097
1657 2838053420
1658 2838065542
1659 2838070019
1660 2838683326
1661 2838686913
1662 2838697730
1663 2838710846
1664 2838730129
1665 2838742856
1666 2841852359
1667 2841867085
1668 2842079019
1669 2842113133
1670 2842118471
1671 2842158183
1672 2842168658
1673 2842181803
1674 2842199237
1675 2842218074
1676 2842230147
1677 2842240382
1678 2842244035
1679 2842257880
1680 2842270830
1681 2842271549
1682 2842292681
1683 2842305180
1684 2842317060
1685 2842347389
1686 2842370197
1687 2842373957
1688 2842379079
1689 2842384981
1690 2842400217
1691 2842423633
1692 2842434713
1693 2842441091
1694 2842447709
1695 2842449422
1696 2842469074
1697 2842475638
1698 2842480426
1699 2842483942
1700 2842496621
1701 2842505353
1702 2842510972
1703 2842917992
1704 2844458210
1705 2852390386
1706 2855830368
1707 2855845853
1708 2857517295
1709 2858805253
1710 2863424083
1711 2896390652
1712 2904567237
1713 2904574282
1714 2915989298
1715 2915995483
1716 2916012565
1717 2916019219
1718 2916026127
1719 2916037241
1720 2916047821
1721 2916053865
1722 2919087675
1723 2919106326
1724 2919410131
1725 2920765944
1726 2921202557
1727 2921214074
1728 2921241701
1729 2921249683
1730 2921284971
1731 2921297483
1732 2924144300
1733 2924151515
1734 2924159393
1735 2924196694
1736 2924201248
1737 2924212446
1738 2924233623
1739 2928029280
1740 2928158697
1741 2928167660
1742 2928174532
1743 2928540596
1744 2928969942
1745 2933570987
1746 2933588810
1747 2933600825
1748 2935896884
1749 2935901820
1750 2936371905
1751 2936379740
1752 2936387486
1753 2936997986
1754 2937007811
1755 2937014663
1756 2937020142
1757 2937051608
1758 2937059488
1759 2937067397
1760 2937096347
1761 2937105794
1762 2937108978
1763 2937116897
1764 2937124883
1765 2946008272
1766 2946788709
1767 2957385460
1768 2957405972
1769 2957409497
1770 2957418720
1771 2957424407
1772 2957430207
1773 2957455142
1774 2957460089
1775 2957464917
1776 2957475318
1777 2957490399
1778 2957492289
1779 2960590701
1780 2960601345
1781 2960606284
1782 2960616011
1783 2960623675
1784 2960643994
1785 2960658468
1786 2960672485
1787 2960678882
1788 2960691683
1789 2964610346
1790 2964624508
1791 2964642184
1792 2964649666
1793 2964655723
1794 2964661199
1795 2964669554
1796 2964670887
1797 2964681941
1798 2964690302
1799 2964695019
1800 2964704260
1801 2964711795
1802 2964713741
1803 2964725340
1804 2967666066
1805 2967675113
1806 2967685414
1807 2967694218
1808 2967700402
1809 2967716017
1810 2967727048
1811 2967739763
1812 2967745345
1813 2967750324
1814 2967767458
1815 2967770144
1816 2970019893
1817 2970037397
1818 2970043143
1819 2970050226
1820 2970060625
1821 2970064365
1822 2970072707
1823 2970076608
1824 2970087439
1825 2970095175
1826 2970114088
1827 2970119947
1828 2970130853
1829 2970154835
1830 2970158203
1831 2970165241
1832 2970175309
1833 2970184815
1834 2977523023
1835 2977524311
1836 2977539241
1837 2977558797
1838 2977564202
1839 2977571163
1840 2977576826
1841 2977580571
1842 2981992183
1843 2984590102
1844 2995395093
1845 2996895013
1846 3003671281
1847 3005448585
1848 639649309
1849 641645879
1850 642419921
1851 648738534
1852 8003997652
1853 8005281344
1854 8005284684
1855 8005295650
1856 8005303260
1857 8005309527
1858 8005381061
1859 8005388991
1860 8005437414
1861 8005463871
1862 8005501028
1863 8005556886
1864 8005568130
1865 8005573329
1866 8005622395
1867 8005629895
1868 8005672445
1869 8005682760
1870 8005691967
1871 8005697538
1872 8018164440
1873 8018176920
1874 8018850110
1875 8020813680
1876 8020942721
1877 8020952891
1878 8020957728
1879 8021121453
1880 8023683033
1881 8024482735
1882 8039100099
1883 8040171125
1884 8040179167
1885 8046771812
1886 8056378270
1887 8056384288
1888 8057102384
1889 8057575570
1890 8057878450

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

264

0.77

PF13460

NAD_binding_10

NAD(P)H-binding

47

209

0.77

PF05368

NmrA

NmrA-like family

43

154

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f5l-assembly1.cif.gz_A the structure of monooxygenase ksta11 in the biosynthetic pathway of kosinostatin 0.8353 8 314
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8304 8 318
4yra-assembly6.cif.gz_I mouse tdh in the apo form 0.8303 8 317
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8222 8 318
4yra-assembly6.cif.gz_I mouse tdh in the apo form 0.8197 8 317
ID Description Score Start End Superfamily
af_A0A1D6I798_6_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9014 8 82 3.40.50.720
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8834 7 104 3.40.50.720
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8826 7 104 3.40.50.20
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8686 5 105 3.40.50.20
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8416 4 82 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A346YN02-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9875 8 324 GO:0004029
GO:0005737
AF-N6UCK9-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9771 1 325 GO:0004029
GO:0005737
AF-A3RSK7-F1-model_v4 deleted 0.977 3 322
AF-N6UCK9-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9741 1 325 GO:0004029
GO:0005737
AF-A0A829MUP5-F1-model_v4 deleted 0.9734 8 325

Map