F486472

General Info

Members Datasets Scaffolds Average Seq Length
946 668 1892 408

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510917014|2511099148
Length 450
Sequence IMSKTIHGAPQHETPDASKPDSKPDSKPDSKPDSKPGSNPDAKPLLDRSDVRVKHASGVGESVSAFVDRVRSGDLGSLPVIAGLVIIWTVFTSLNPVFLSADNLVNMLFDCSTVGVISLGIVCVLLLGQIDLSVGSMSGFASALVGTLWVNDGWPVLLAVAAAIAVGAVIGALYALLLNWIGMPSFVSTLAGLLAILGMQLYVLGSTGSINLPYGSAMVNFGQLMVIPPVVSHVIALLPGIVLLLLGMRTRARRHAARLSAPSVAGLLGRAAALTVFLEIVVAYLNRGRGVPLMFGLFLGLAVVMQYALTRTRWGRSMHAVGGNHEAARRAGIKVGAIYTSAFVLCASLAAIGGVLTAARLASASQQAGTGDVNLNAIAAAVIGGTSLFGGRGSAWSAVLGIIVIQSIASGLTLLNLSSSLRFMITGAVLAIAVIVDSLARQSRVSHGRA

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
52 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
137 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
273 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
274 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
275 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
276 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
277 2508501050 Microvirga lupini Lut6 Isolate Nodule
278 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
279 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
280 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
281 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
282 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
283 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
284 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
285 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
286 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
287 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
288 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
289 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
290 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
291 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
292 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
293 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
294 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
295 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
296 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
297 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
298 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
299 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
300 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
301 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
302 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
303 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
304 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
305 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
306 2516143018 Ensifer sp. BR816 Isolate Nodule
307 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
308 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
309 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
310 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
311 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
312 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
313 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
314 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
315 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
316 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
317 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
318 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
319 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
320 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
321 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
322 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
323 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
324 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
325 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
326 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
327 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
328 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
329 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
330 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
331 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
332 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
333 2643221558 Rhizobium sp. Root149 Isolate Unclassified
334 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
335 2643221599 Rhizobium sp. Root708 Isolate Unclassified
336 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
337 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
338 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
339 2643221688 Rhizobium sp. Root482 Isolate Unclassified
340 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
341 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
342 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
343 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
344 2718217882 Rhizobium sp. N741 Isolate Nodule
345 2718217927 Rhizobium sp. N324 Isolate Nodule
346 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
347 2718218009 Rhizobium sp. N561 Isolate Nodule
348 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
349 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
350 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
351 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
352 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
353 2718218363 Rhizobium sp. N113 Isolate Nodule
354 2718218365 Rhizobium sp. N731 Isolate Nodule
355 2718218366 Rhizobium sp. N621 Isolate Nodule
356 2718218423 Rhizobium sp. N941 Isolate Nodule
357 2721755514 Rhizobium sp. N6212 Isolate Nodule
358 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
359 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
360 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
361 2721755809 Rhizobium sp. N541 Isolate Nodule
362 2721755810 Rhizobium sp. N871 Isolate Nodule
363 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
364 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
365 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
366 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
367 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
368 2728369365 Rhizobium sp. N1341 Isolate Nodule
369 2728369397 Rhizobium sp. N1314 Isolate Nodule
370 2738541293 Rhizobium sp. GV031 Isolate Unclassified
371 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
372 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
373 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
374 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
375 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
376 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
377 2773857925 Microvirga vignae BR3299 Isolate Unclassified
378 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
379 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
380 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
381 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
382 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
383 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
384 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
385 2791355256 Rhizobium sp. M10 Isolate Nodule
386 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
387 2791355260 Rhizobium sp. L9 Isolate Nodule
388 2791355261 Rhizobium sp. J15 Isolate Nodule
389 2791355262 Rhizobium sp. M1 Isolate Nodule
390 2791355263 Rhizobium chutanense C5 Isolate Nodule
391 2791355264 Rhizobium sp. S9 Isolate Nodule
392 2791355265 Rhizobium sp. H4 Isolate Nodule
393 2791355266 Rhizobium sp. L43 Isolate Nodule
394 2791355267 Rhizobium sp. L18 Isolate Nodule
395 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
396 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
397 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
398 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
399 2802429633 Rhizobium anhuiense J3 Isolate Nodule
400 2802429634 Rhizobium anhuiense S10 Isolate Nodule
401 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
402 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
403 2802429637 Rhizobium anhuiense C15 Isolate Nodule
404 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
405 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
406 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
407 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
408 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
409 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
410 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
411 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
412 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
413 2838061910 Rhizobium phaseoli L15 Isolate Nodule
414 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
415 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
416 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
417 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
418 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
419 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
420 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
421 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
422 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
423 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
424 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
425 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
426 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
427 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
428 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
429 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
430 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
431 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
432 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
433 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
434 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
435 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
436 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
437 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
438 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
439 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
440 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
441 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
442 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
443 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
444 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
445 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
446 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
447 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
448 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
449 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
450 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
451 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
452 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
453 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
454 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
455 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
456 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
457 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
458 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
459 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
460 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
461 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
462 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
463 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
464 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
465 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
466 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
467 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
468 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
469 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
470 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
471 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
472 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
473 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
474 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
475 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
476 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
477 2854911287 Brucella lupini LUP21 Isolate Unclassified
478 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
479 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
480 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
481 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
482 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
483 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
484 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
485 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
486 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
487 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
488 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
489 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
490 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
491 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
492 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
493 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
494 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
495 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
496 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
497 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
498 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
499 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
500 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
501 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
502 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
503 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
504 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
505 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
506 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
507 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
508 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
509 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
510 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
511 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
512 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
513 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
514 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
515 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
516 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
517 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
518 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
519 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
520 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
521 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
522 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
523 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
524 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
525 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
526 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
527 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
528 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
529 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
530 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
531 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
532 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
533 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
534 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
535 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
536 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
537 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
538 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
539 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
540 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
541 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
542 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
543 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
544 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
545 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
546 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
547 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
548 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
549 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
550 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
551 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
552 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
553 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
554 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
555 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
556 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
557 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
558 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
559 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
560 2936381700 Rhizobium chutanense C16 Isolate Unclassified
561 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
562 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
563 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
564 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
565 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
566 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
567 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
568 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
569 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
570 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
571 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
572 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
573 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
574 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
575 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
576 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
577 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
578 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
579 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
580 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
581 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
582 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
583 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
584 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
585 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
586 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
587 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
588 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
589 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
590 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
591 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
592 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
593 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
594 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
595 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
596 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
597 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
598 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
599 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
600 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
601 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
602 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
603 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
604 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
605 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
606 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
607 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
608 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
609 2996887358 Rhizobium sp. R711 Isolate Nodule
610 2996893221 Rhizobium sp. R635 Isolate Nodule
611 3004167301 Mesorhizobium loti 582 Isolate Unclassified
612 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
613 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
614 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
615 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
616 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
617 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
618 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
619 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
620 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
621 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
622 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
623 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
624 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
625 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
626 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
627 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
628 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
629 8005258706 Rhizobium sp. R693 Isolate Nodule
630 8005275841 Rhizobium sp. N4311 Isolate Nodule
631 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
632 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
633 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
634 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
635 8005321885 Rhizobium sp. R72 Isolate Nodule
636 8005382845 Rhizobium sp. R634 Isolate Nodule
637 8005395548 Rhizobium sp. R339 Isolate Nodule
638 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
639 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
640 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
641 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
642 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
643 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
644 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
645 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
646 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
647 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
648 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
649 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
650 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
651 8018176218 Rhizobium sp. N122 Isolate Nodule
652 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
653 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
654 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
655 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
656 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
657 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
658 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
659 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
660 8024501048 Rhizobium sp. H4 Isolate Nodule
661 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
662 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
663 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
664 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
665 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
666 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
667 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
668 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.72
Metatranscriptomes 0
Isolates 42.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.16
Nodule 32.03
Rhizoplane 2.43
Rhizosphere 35.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000252 3300002737 Bacteria 52122
2 JGI25157J39369_1000894 3300002741 Bacteria 14355
3 JGI25152J39213_1001228 3300002773 Bacteria 11729
4 JGI25152J39213_1004613 3300002773 Bacteria 4285
5 JGI25152J39213_1004663 3300002773 Bacteria 4246
6 JGI25150J39212_1000155 3300002774 Bacteria 38722
7 JGI25151J46595_10000007 3300003187 Bacteria 411751
8 JGI25151J46595_10000341 3300003187 Bacteria 50002
9 JGI25165J46597_1000102 3300003214 Bacteria 155002
10 JGI25165J46597_1000198 3300003214 Bacteria 88888
11 JGI25153J46596_10000068 3300003215 Bacteria 117909
12 JGI25153J46596_10000344 3300003215 Bacteria 32730
13 JGI25153J46596_10000569 3300003215 Bacteria 22766
14 JGI25153J46596_10005313 3300003215 Bacteria 6770
15 JGI25153J46596_10017750 3300003215 Bacteria 2792
16 JGI25160J50197_1005260 3300003354 Bacteria 5416
17 JGI25161J50226_1000321 3300003374 Bacteria 26201
18 Ga0055526_1000400 3300003771 Bacteria 35032
19 Ga0055526_1006249 3300003771 Bacteria 6530
20 Ga0055526_1015426 3300003771 Bacteria 3066
21 Ga0055524_1003728 3300003775 Bacteria 7284
22 Ga0055524_1009170 3300003775 Bacteria 4047
23 Ga0055528_1000034 3300003790 Bacteria 118577
24 Ga0055528_1000275 3300003790 Bacteria 43696
25 Ga0055528_1001654 3300003790 Bacteria 13074
26 Ga0055528_1001947 3300003790 Bacteria 11677
27 Ga0055528_1004676 3300003790 Bacteria 6544
28 Ga0055528_1018115 3300003790 Bacteria 2403
29 Ga0055540_1000066 3300003792 Bacteria 122947
30 Ga0055540_1023754 3300003792 Bacteria 1537
31 Ga0055543_1000036 3300004625 Bacteria 126054
32 Ga0055543_1001227 3300004625 Bacteria 10715
33 Ga0065165_1002947 3300005262 Bacteria 12963
34 Ga0065165_1009612 3300005262 Bacteria 4305
35 Ga0065165_1010226 3300005262 Bacteria 4087
36 Ga0070666_10056307 3300005335 Bacteria 2655
37 Ga0070660_100046951 3300005339 Bacteria 3311
38 Ga0070668_100033178 3300005347 Bacteria 3930
39 Ga0070671_100004103 3300005355 Bacteria 11499
40 Ga0070671_100015963 3300005355 Bacteria 6067
41 Ga0070667_100006416 3300005367 Bacteria 9775
42 Ga0070708_100143598 3300005445 Bacteria 2215
43 Ga0070663_100050051 3300005455 Bacteria 2970
44 Ga0070663_100064749 3300005455 Bacteria 2643
45 Ga0070706_100001519 3300005467 Bacteria 24333
46 Ga0070698_100016916 3300005471 Bacteria 7688
47 Ga0068855_100049649 3300005563 Bacteria 4948
48 Ga0068857_100040169 3300005577 Bacteria 4149
49 Ga0068859_100228235 3300005617 Bacteria 1950
50 Ga0068863_100258801 3300005841 Bacteria 1682
51 Ga0075365_10006151 3300006038 Bacteria 6570
52 Ga0075368_10003745 3300006042 Bacteria 5105
53 Ga0075363_100024083 3300006048 Bacteria 3092
54 Ga0075363_100040574 3300006048 Bacteria 2454
55 Ga0075363_100048575 3300006048 Bacteria 2257
56 Ga0075367_10001204 3300006178 Bacteria 10848
57 Ga0075367_10014703 3300006178 Bacteria 4238
58 Ga0075367_10055737 3300006178 Bacteria 2347
59 Ga0075367_10073323 3300006178 Bacteria 2062
60 Ga0075369_10006548 3300006186 Bacteria 4407
61 Ga0075369_10024380 3300006186 Bacteria 2506
62 Ga0075366_10008319 3300006195 Bacteria 5760
63 Ga0075366_10012720 3300006195 Bacteria 4781
64 Ga0075366_10050672 3300006195 Bacteria 2466
65 Ga0097621_100168078 3300006237 Bacteria 1889
66 Ga0075370_10004202 3300006353 Bacteria 6953
67 Ga0075370_10013549 3300006353 Bacteria 4339
68 Ga0075370_10020993 3300006353 Bacteria 3576
69 Ga0097620_100228254 3300006931 Bacteria 1950
70 Ga0105251_10001112 3300009011 Bacteria 23400
71 Ga0105244_10000856 3300009036 Bacteria 25653
72 Ga0105250_10000147 3300009092 Bacteria 62020
73 Ga0105240_10297873 3300009093 Bacteria 1846
74 Ga0111539_10248668 3300009094 Bacteria 2070
75 Ga0105245_10042667 3300009098 Bacteria 4047
76 Ga0105247_10027754 3300009101 Bacteria 3424
77 Ga0105243_10006971 3300009148 Bacteria 8702
78 Ga0105243_10029609 3300009148 Bacteria 4211
79 Ga0105243_10066436 3300009148 Bacteria 2900
80 Ga0105241_10011996 3300009174 Bacteria 6363
81 Ga0105248_10002756 3300009177 Bacteria 19521
82 Ga0105237_10003553 3300009545 Bacteria 18482
83 Ga0105238_10060653 3300009551 Bacteria 3786
84 Ga0105238_10163070 3300009551 Bacteria 2205
85 Ga0105249_10177314 3300009553 Bacteria 2071
86 Ga0123341_1000005 3300009765 Bacteria 150422
87 Ga0123342_1009438 3300009766 Bacteria 11689
88 Ga0123342_1012999 3300009766 Bacteria 8474
89 Ga0105239_10045985 3300010375 Bacteria 4783
90 Ga0105246_10007911 3300011119 Bacteria 6523
91 Ga0157374_10003640 3300013296 Bacteria 12968
92 Ga0163162_10032691 3300013306 Bacteria 5168
93 Ga0163162_10132592 3300013306 Bacteria 2601
94 Ga0163163_10018086 3300014325 Bacteria 6586
95 Ga0157379_10061223 3300014968 Bacteria 3366
96 Ga0214544_1000158 3300021320 Bacteria 101943
97 Ga0214542_1001567 3300021321 Bacteria 47020
98 Ga0214543_1000234 3300021327 Bacteria 84243
99 Ga0209437_100042 3300025233 Bacteria 444095
100 Ga0209437_100062 3300025233 Bacteria 336900
101 Ga0207425_1000018 3300025245 Bacteria 411841
102 Ga0207425_1001094 3300025245 Bacteria 12300
103 Ga0209026_1000005 3300025250 Bacteria 731387
104 Ga0209759_1000385 3300025256 Bacteria 55125
105 Ga0209759_1022408 3300025256 Bacteria 1413
106 Ga0209129_1000019 3300025258 Bacteria 460802
107 Ga0209129_1000026 3300025258 Bacteria 411839
108 Ga0209129_1000594 3300025258 Bacteria 24717
109 Ga0209129_1001241 3300025258 Bacteria 14641
110 Ga0209129_1001717 3300025258 Bacteria 11807
111 Ga0209129_1002292 3300025258 Bacteria 9530
112 Ga0209129_1007208 3300025258 Bacteria 3372
113 Ga0209233_1000068 3300025261 Bacteria 377969
114 Ga0209233_1000082 3300025261 Bacteria 336320
115 Ga0209233_1000103 3300025261 Bacteria 284123
116 Ga0209673_1000020 3300025273 Bacteria 430653
117 Ga0209673_1000132 3300025273 Bacteria 162349
118 Ga0209673_1000462 3300025273 Bacteria 68568
119 Ga0209673_1000607 3300025273 Bacteria 55095
120 Ga0209673_1002413 3300025273 Bacteria 13044
121 Ga0209673_1003228 3300025273 Bacteria 9867
122 Ga0209673_1005352 3300025273 Bacteria 6490
123 Ga0209130_1000019 3300025284 Bacteria 381993
124 Ga0209676_1011527 3300025292 Bacteria 3556
125 Ga0209676_1011889 3300025292 Bacteria 3467
126 Ga0209025_1000035 3300025294 Bacteria 411841
127 Ga0209025_1000081 3300025294 Bacteria 265899
128 Ga0209025_1001347 3300025294 Bacteria 33157
129 Ga0209025_1007161 3300025294 Bacteria 8423
130 Ga0209025_1008392 3300025294 Bacteria 7445
131 Ga0209025_1008442 3300025294 Bacteria 7412
132 Ga0209025_1027099 3300025294 Bacteria 2853
133 Ga0209564_1000205 3300025295 Bacteria 135901
134 Ga0209564_1001753 3300025295 Bacteria 20252
135 Ga0209564_1001887 3300025295 Bacteria 18843
136 Ga0209564_1008232 3300025295 Bacteria 5197
137 Ga0209564_1029832 3300025295 Bacteria 1705
138 Ga0209758_1000040 3300025297 Bacteria 411841
139 Ga0209758_1000076 3300025297 Bacteria 270615
140 Ga0209758_1000097 3300025297 Bacteria 230529
141 Ga0209758_1002328 3300025297 Bacteria 19630
142 Ga0209758_1002907 3300025297 Bacteria 16523
143 Ga0209758_1003451 3300025297 Bacteria 14348
144 Ga0209758_1015093 3300025297 Bacteria 4035
145 Ga0209758_1015203 3300025297 Bacteria 4011
146 Ga0209050_1003157 3300025298 Bacteria 12556
147 Ga0209256_1000500 3300025299 Bacteria 57552
148 Ga0209256_1000805 3300025299 Bacteria 40172
149 Ga0209256_1009308 3300025299 Bacteria 4331
150 Ga0209256_1028844 3300025299 Bacteria 1557
151 Ga0207426_1000005 3300025302 Bacteria 1037188
152 Ga0207426_1000169 3300025302 Bacteria 164859
153 Ga0207426_1000947 3300025302 Bacteria 28646
154 Ga0209051_1000038 3300025303 Bacteria 320926
155 Ga0209051_1001518 3300025303 Bacteria 19346
156 Ga0209051_1002689 3300025303 Bacteria 12390
157 Ga0209051_1008934 3300025303 Bacteria 5233
158 Ga0209257_1017269 3300025304 Bacteria 2855
159 Ga0209257_1039634 3300025304 Bacteria 1414
160 Ga0207696_1000008 3300025711 Bacteria 568181
161 Ga0207696_1000012 3300025711 Bacteria 527363
162 Ga0207655_1006570 3300025728 Bacteria 7674
163 Ga0207713_1000076 3300025735 Bacteria 178268
164 Ga0207688_10022953 3300025901 Bacteria 3415
165 Ga0207680_10169823 3300025903 Bacteria 1468
166 Ga0207647_10001418 3300025904 Bacteria 18397
167 Ga0207705_10043723 3300025909 Bacteria 3218
168 Ga0207684_10024124 3300025910 Bacteria 5188
169 Ga0207654_10097433 3300025911 Bacteria 1806
170 Ga0207695_10200127 3300025913 Bacteria 1912
171 Ga0207657_10058024 3300025919 Bacteria 3333
172 Ga0207652_10052820 3300025921 Bacteria 3490
173 Ga0207681_10046346 3300025923 Bacteria 2924
174 Ga0207694_10024443 3300025924 Bacteria 4589
175 Ga0207687_10069870 3300025927 Bacteria 2506
176 Ga0207709_10003911 3300025935 Bacteria 8702
177 Ga0207709_10012857 3300025935 Bacteria 4615
178 Ga0207709_10095513 3300025935 Bacteria 1953
179 Ga0207709_10099284 3300025935 Bacteria 1921
180 Ga0207711_10098963 3300025941 Bacteria 2577
181 Ga0207667_10096410 3300025949 Bacteria 3052
182 Ga0207668_10007178 3300025972 Bacteria 6618
183 Ga0207703_10032178 3300026035 Bacteria 4150
184 Ga0207678_10018207 3300026067 Bacteria 6168
185 Ga0207678_10030455 3300026067 Bacteria 4711
186 Ga0207702_10070072 3300026078 Bacteria 3015
187 Ga0207674_10054276 3300026116 Bacteria 4080
188 Ga0207674_10098706 3300026116 Bacteria 2904
189 Ga0207674_10284215 3300026116 Bacteria 1603
190 Ga0307517_10001635 3300028786 Bacteria 37076
191 Ga0307517_10076567 3300028786 Bacteria 2920
192 Ga0307515_10000109 3300028794 Bacteria 195895
193 Ga0307515_10001382 3300028794 Bacteria 54946
194 Ga0307515_10020539 3300028794 Bacteria 11773
195 Ga0307515_10026303 3300028794 Bacteria 10023
196 Ga0307512_10050643 3300030522 Bacteria 3333
197 Ga0307512_10105228 3300030522 Bacteria 1889
198 Ga0265330_10008935 3300031235 Bacteria 4786
199 Ga0265325_10009442 3300031241 Bacteria 5692
200 Ga0307513_10000990 3300031456 Bacteria 41065
201 Ga0307513_10005720 3300031456 Bacteria 16360
202 Ga0307508_10000612 3300031616 Bacteria 42799
203 Ga0307508_10003625 3300031616 Bacteria 15506
204 Ga0307516_10015932 3300031730 Bacteria 7886
205 Ga0307516_10029310 3300031730 Bacteria 5565
206 Ga0307516_10166904 3300031730 Bacteria 1945
207 Ga0307405_10000846 3300031731 Bacteria 12057
208 Ga0307406_10036049 3300031901 Bacteria 3045
209 Ga0307412_10144041 3300031911 Bacteria 1749
210 Ga0307409_100055711 3300031995 Bacteria 3055
211 Ga0307507_10033874 3300033179 Bacteria 5293
212 Ga0307510_10010214 3300033180 Bacteria 11163
213 Ga0307510_10134586 3300033180 Bacteria 2133
214 Ga0307510_10135212 3300033180 Bacteria 2125
215 Ga0307510_10192195 3300033180 Bacteria 1588
216 Ga0373931_0012161 3300035691 Bacteria 4166
217 Ga0373927_0000057 3300035695 Bacteria 80218
218 Ga0373937_0015361 3300036401 Bacteria 6772
219 Ga0373925_0024688 3300037068 Bacteria 4389
220 Ga0395899_0000374 3300037312 Bacteria 53660
221 Ga0395900_0000302 3300037418 Bacteria 73622
222 Ga0395900_0018024 3300037418 Bacteria 7208
223 Ga0395898_0000518 3300037466 Bacteria 73622
224 Ga0395898_0069477 3300037466 Bacteria 3407
225 Ga0395898_0149404 3300037466 Bacteria 2236
226 Ga0395905_0000285 3300037471 Bacteria 73934
227 Ga0395905_0001410 3300037471 Bacteria 29058
228 Ga0395905_0015167 3300037471 Bacteria 7332
229 Ga0395905_0097647 3300037471 Bacteria 2758
230 Ga0436364_0390800 3300037853 Bacteria 2678
231 Ga0395901_0000210 3300038443 Bacteria 73622
232 Ga0395901_0000749 3300038443 Bacteria 36580
233 Ga0395901_0044620 3300038443 Bacteria 4598
234 Ga0395901_0078249 3300038443 Bacteria 3453
235 Ga0395901_0160136 3300038443 Bacteria 2364
236 Ga0436365_0609406 3300039437 Bacteria 3863
237 Ga0436362_0305810 3300039453 Bacteria 3312
238 Ga0451833_0047502 3300041491 Bacteria 7500
239 Ga0451833_0172985 3300041491 Bacteria 3004
240 Ga0451835_0304073 3300041492 Bacteria 4763
241 Ga0451837_1198351 3300041494 Bacteria 2500
242 Ga0451839_0165640 3300041496 Bacteria 7845
243 Ga0451841_1412459 3300041498 Bacteria 2591
244 Ga0451845_0495161 3300041501 Bacteria 5293
245 Ga0451849_0515669 3300041505 Bacteria 2364
246 Ga0451849_1263981 3300041505 Bacteria 9092
247 Ga0451851_0496842 3300041507 Bacteria 3833
248 Ga0451843_0158345 3300041509 Bacteria 4903
249 Ga0451855_1252208 3300041511 Bacteria 2397
250 Ga0451853_0581710 3300041512 Bacteria 3444
251 Ga0466972_0038601 3300044658 Bacteria 2332
252 Ga0466966_0017107 3300044684 Bacteria 4797
253 Ga0466959_0003231 3300045049 Bacteria 10603
254 Ga0495592_0029253 3300046454 Bacteria 4172
255 Ga0495592_0185946 3300046454 Bacteria 1411
256 Ga0495603_0055993 3300046455 Bacteria 2335
257 Ga0495590_0019336 3300046457 Bacteria 2428
258 Ga0495629_0000291 3300046459 Bacteria 43360
259 Ga0495629_0001055 3300046459 Bacteria 22049
260 Ga0495629_0018162 3300046459 Bacteria 5038
261 Ga0495629_0107663 3300046459 Bacteria 1944
262 Ga0495638_0008499 3300046460 Bacteria 7276
263 Ga0495638_0046261 3300046460 Bacteria 2734
264 Ga0495641_0009517 3300046461 Bacteria 5765
265 Ga0495653_0000940 3300046463 Bacteria 22425
266 Ga0495653_0013833 3300046463 Bacteria 6576
267 Ga0495650_0005830 3300046471 Bacteria 7847
268 Ga0495650_0005927 3300046471 Bacteria 7765
269 Ga0495650_0012589 3300046471 Bacteria 4539
270 Ga0495650_0015767 3300046471 Bacteria 3863
271 Ga0495650_0051210 3300046471 Bacteria 1702
272 Ga0495650_0054051 3300046471 Bacteria 1641
273 Ga0495580_0000022 3300046472 Bacteria 89749
274 Ga0495580_0001018 3300046472 Bacteria 24596
275 Ga0495582_0011117 3300046473 Bacteria 4956
276 Ga0495605_0062914 3300046474 Bacteria 1772
277 Ga0495664_0001400 3300046477 Bacteria 12755
278 Ga0495664_0017921 3300046477 Bacteria 4050
279 Ga0495664_0034630 3300046477 Bacteria 2971
280 Ga0495664_0071268 3300046477 Bacteria 2076
281 Ga0495585_0018033 3300046492 Bacteria 4073
282 Ga0495585_0045474 3300046492 Bacteria 2450
283 Ga0495583_0000133 3300046506 Bacteria 124343
284 Ga0495583_0022266 3300046506 Bacteria 3236
285 Ga0495583_0024174 3300046506 Bacteria 3059
286 Ga0495606_0005245 3300046507 Bacteria 12500
287 Ga0495606_0008226 3300046507 Bacteria 9112
288 Ga0495606_0028443 3300046507 Bacteria 3943
289 Ga0495606_0042991 3300046507 Bacteria 3018
290 Ga0495610_0002362 3300046512 Bacteria 15949
291 Ga0495610_0017775 3300046512 Bacteria 4044
292 Ga0495610_0038512 3300046512 Bacteria 2426
293 Ga0495618_0002113 3300046514 Bacteria 13009
294 Ga0495620_0027007 3300046515 Bacteria 2692
295 Ga0495620_0047395 3300046515 Bacteria 1850
296 Ga0495628_0002858 3300046516 Bacteria 15474
297 Ga0495628_0016387 3300046516 Bacteria 6183
298 Ga0495628_0024019 3300046516 Bacteria 4994
299 Ga0495628_0028292 3300046516 Bacteria 4555
300 Ga0495630_0000977 3300046517 Bacteria 19897
301 Ga0495630_0006962 3300046517 Bacteria 8060
302 Ga0495630_0068875 3300046517 Bacteria 2661
303 Ga0495632_0000360 3300046519 Bacteria 43203
304 Ga0495632_0017169 3300046519 Bacteria 4003
305 Ga0495643_0039321 3300046522 Bacteria 2587
306 Ga0495643_0080355 3300046522 Bacteria 1697
307 Ga0495648_0019901 3300046524 Bacteria 4699
308 Ga0495648_0102381 3300046524 Bacteria 1577
309 Ga0495648_0123162 3300046524 Bacteria 1390
310 Ga0495666_0000422 3300046526 Bacteria 18819
311 Ga0495652_0033259 3300046529 Bacteria 4502
312 Ga0495652_0050098 3300046529 Bacteria 3572
313 Ga0495640_0010351 3300046533 Bacteria 7210
314 Ga0495586_0055897 3300046535 Bacteria 2139
315 Ga0495587_0003823 3300046536 Bacteria 9993
316 Ga0495597_0006990 3300046542 Bacteria 5781
317 Ga0495597_0009601 3300046542 Bacteria 4770
318 Ga0495645_0023636 3300046543 Bacteria 4452
319 Ga0495645_0027709 3300046543 Bacteria 4115
320 Ga0495656_0027048 3300046615 Bacteria 2289
321 Ga0495668_0006217 3300046616 Bacteria 7888
322 Ga0495668_0029961 3300046616 Bacteria 3074
323 Ga0495668_0037267 3300046616 Bacteria 2721
324 Ga0495668_0083956 3300046616 Bacteria 1747
325 Ga0495634_0003148 3300046642 Bacteria 13375
326 Ga0495611_0009512 3300046648 Bacteria 4108
327 Ga0495611_0024391 3300046648 Bacteria 2631
328 Ga0495625_0003246 3300046660 Bacteria 16452
329 Ga0495625_0017309 3300046660 Bacteria 5645
330 Ga0495625_0074251 3300046660 Bacteria 2382
331 Ga0495635_0002692 3300046663 Bacteria 12150
332 Ga0495635_0030308 3300046663 Bacteria 3758
333 Ga0495635_0036756 3300046663 Bacteria 3393
334 Ga0495661_0040310 3300046665 Bacteria 2897
335 Ga0495599_0000836 3300046678 Bacteria 17358
336 Ga0495599_0010360 3300046678 Bacteria 5701
337 Ga0495623_0007435 3300046679 Bacteria 7111
338 Ga0495646_0001627 3300046680 Bacteria 13385
339 Ga0495646_0015696 3300046680 Bacteria 4806
340 Ga0495669_0049795 3300046684 Bacteria 1877
341 Ga0495613_0004246 3300046689 Bacteria 10735
342 Ga0495613_0172611 3300046689 Bacteria 1534
343 Ga0495624_0000362 3300046690 Bacteria 36052
344 Ga0495624_0006325 3300046690 Bacteria 8417
345 Ga0495624_0019926 3300046690 Bacteria 4470
346 Ga0495670_0015784 3300046691 Bacteria 3713
347 Ga0495649_0000437 3300046694 Bacteria 36070
348 Ga0495649_0030230 3300046694 Bacteria 2992
349 Ga0495649_0030378 3300046694 Bacteria 2984
350 Ga0495649_0038971 3300046694 Bacteria 2605
351 Ga0495660_0025608 3300046810 Bacteria 3349
352 Ga0495581_0006308 3300047315 Bacteria 6877
353 Ga0495604_0003671 3300047317 Bacteria 12236
354 Ga0495604_0014673 3300047317 Bacteria 6245
355 Ga0495674_0004868 3300047319 Bacteria 12912
356 Ga0495674_0032184 3300047319 Bacteria 4759
357 Ga0495672_0047208 3300047320 Bacteria 2562
358 Ga0495676_0018347 3300047321 Bacteria 6168
359 Ga0495680_0003928 3300047322 Bacteria 14373
360 Ga0495680_0050985 3300047322 Bacteria 3234
361 Ga0495683_0009114 3300047323 Bacteria 5288
362 Ga0495687_010652 3300047443 Bacteria 5024
363 Ga0495687_011138 3300047443 Bacteria 4858
364 Ga0495687_058182 3300047443 Bacteria 1604
365 Ga0495675_0066660 3300047444 Bacteria 2275
366 Ga0495675_0126051 3300047444 Bacteria 1593
367 Ga0495679_000048 3300047446 Bacteria 127785
368 Ga0495679_000591 3300047446 Bacteria 24978
369 Ga0495679_007172 3300047446 Bacteria 4682
370 Ga0495673_0046663 3300047469 Bacteria 1918
371 Ga0495684_0010984 3300047471 Bacteria 7001
372 Ga0495686_0000110 3300047472 Bacteria 169827
373 Ga0495593_0012031 3300047673 Bacteria 4959
374 Ga0495593_0014877 3300047673 Bacteria 4420
375 Ga0495593_0060080 3300047673 Bacteria 1990
376 Ga0495602_0012413 3300048088 Bacteria 8760
377 Ga0495602_0022349 3300048088 Bacteria 6193
378 Ga0495602_0192106 3300048088 Bacteria 1564
379 Ga0495614_0010394 3300048089 Bacteria 4105
380 Ga0495614_0061971 3300048089 Bacteria 1607
381 Ga0495626_0009917 3300048091 Bacteria 5118
382 Ga0495626_0028055 3300048091 Bacteria 2732
383 Ga0496100_0211509 3300048903 Bacteria 1419
384 Ga0496102_0005131 3300048905 Bacteria 11105
385 Ga0496103_0034494 3300048906 Bacteria 3094
386 Ga0496104_0006520 3300048907 Bacteria 10267
387 Ga0496104_0026617 3300048907 Bacteria 5344
388 Ga0496105_0070990 3300048908 Bacteria 2878
389 Ga0496105_0079192 3300048908 Bacteria 2714
390 Ga0496106_0000211 3300048909 Bacteria 40794
391 Ga0496107_0122981 3300048910 Bacteria 1912
392 Ga0496108_0030774 3300048911 Bacteria 4448
393 Ga0496108_0156836 3300048911 Bacteria 1966
394 Ga0496110_0063916 3300048913 Bacteria 3252
395 Ga0496110_0109600 3300048913 Bacteria 2480
396 Ga0496111_0093201 3300048914 Bacteria 2208
397 Ga0496112_0011758 3300048915 Bacteria 8014
398 Ga0496112_0026727 3300048915 Bacteria 5560
399 Ga0496113_0066056 3300048916 Bacteria 2739
400 Ga0496113_0142296 3300048916 Bacteria 1888
401 Ga0496114_0030390 3300048917 Bacteria 4445
402 Ga0496114_0163378 3300048917 Bacteria 1937
403 Ga0496116_0000216 3300048919 Bacteria 108542
404 Ga0496116_0000692 3300048919 Bacteria 43664
405 Ga0496116_0006938 3300048919 Bacteria 10156
406 Ga0496116_0101861 3300048919 Bacteria 1713
407 Ga0496117_0007393 3300048920 Bacteria 10749
408 Ga0496117_0008218 3300048920 Bacteria 9950
409 Ga0496117_0047510 3300048920 Bacteria 3076
410 Ga0496117_0099465 3300048920 Bacteria 1845
411 Ga0496118_0000477 3300048921 Bacteria 66433
412 Ga0496118_0016242 3300048921 Bacteria 6837
413 Ga0496118_0017132 3300048921 Bacteria 6611
414 Ga0496118_0023848 3300048921 Bacteria 5301
415 Ga0496118_0024372 3300048921 Bacteria 5223
416 Ga0496118_0035612 3300048921 Bacteria 4038
417 Ga0496118_0067096 3300048921 Bacteria 2615
418 Ga0496118_0110744 3300048921 Bacteria 1823
419 Ga0496119_0005307 3300048922 Bacteria 12398
420 Ga0496119_0030704 3300048922 Bacteria 3618
421 Ga0496120_0015826 3300048923 Bacteria 4955
422 Ga0496121_0022741 3300048924 Bacteria 6066
423 Ga0496121_0024645 3300048924 Bacteria 5744
424 Ga0496121_0029318 3300048924 Bacteria 5093
425 Ga0496121_0032032 3300048924 Bacteria 4787
426 Ga0496121_0033509 3300048924 Bacteria 4646
427 Ga0496121_0068983 3300048924 Bacteria 2856
428 Ga0496122_0009151 3300048925 Bacteria 10494
429 Ga0496122_0017814 3300048925 Bacteria 6606
430 Ga0496122_0030611 3300048925 Bacteria 4504
431 Ga0496123_0025074 3300048926 Bacteria 4506
432 Ga0496123_0027053 3300048926 Bacteria 4280
433 Ga0496123_0037086 3300048926 Bacteria 3447
434 Ga0496124_0000023 3300048927 Bacteria 415226
435 Ga0496124_0013759 3300048927 Bacteria 7875
436 Ga0496124_0026067 3300048927 Bacteria 5278
437 Ga0496124_0038758 3300048927 Bacteria 4135
438 Ga0496124_0096954 3300048927 Bacteria 2395
439 Ga0496124_0097347 3300048927 Bacteria 2389
440 Ga0496124_0099942 3300048927 Bacteria 2352
441 Ga0496124_0145991 3300048927 Bacteria 1861
442 Ga0496124_0150224 3300048927 Bacteria 1828
443 Ga0496125_0005642 3300048928 Bacteria 13817
444 Ga0496125_0021331 3300048928 Bacteria 6046
445 Ga0496125_0031077 3300048928 Bacteria 4766
446 Ga0496126_0000065 3300048929 Bacteria 252549
447 Ga0496126_0000414 3300048929 Bacteria 86330
448 Ga0496126_0027824 3300048929 Bacteria 5393
449 Ga0496126_0031841 3300048929 Bacteria 4976
450 Ga0496126_0046544 3300048929 Bacteria 3977
451 Ga0496126_0134056 3300048929 Bacteria 2138
452 Ga0496126_0165196 3300048929 Bacteria 1889
453 Ga0495678_011181 3300049459 Bacteria 4314
454 Ga0501031_0105963 3300049568 Bacteria 1835
455 Ga0501032_0000358 3300049569 Bacteria 38004
456 Ga0501032_0003572 3300049569 Bacteria 11854
457 Ga0501032_0035991 3300049569 Bacteria 3381
458 Ga0501032_0050285 3300049569 Bacteria 2811
459 Ga0501033_0011119 3300049570 Bacteria 6894
460 Ga0501033_0166947 3300049570 Bacteria 1582
461 Ga0501034_0049616 3300049571 Bacteria 4234
462 Ga0501034_0071948 3300049571 Bacteria 3466
463 Ga0501034_0224134 3300049571 Bacteria 1831
464 Ga0501036_0001026 3300049572 Bacteria 21087
465 Ga0501036_0035893 3300049572 Bacteria 4195
466 Ga0501036_0131635 3300049572 Bacteria 2112
467 Ga0501037_0000089 3300049573 Bacteria 85102
468 Ga0501037_0035583 3300049573 Bacteria 3671
469 Ga0501038_0007379 3300049574 Bacteria 10140
470 Ga0501038_0014467 3300049574 Bacteria 7191
471 Ga0501038_0062472 3300049574 Bacteria 3182
472 Ga0501039_0001736 3300049575 Bacteria 16059
473 Ga0501039_0044865 3300049575 Bacteria 3415
474 Ga0501043_0000007 3300049579 Bacteria 224595
475 Ga0501043_0002769 3300049579 Bacteria 14661
476 Ga0501043_0087748 3300049579 Bacteria 2444
477 Ga0501046_0006159 3300049580 Bacteria 10654
478 Ga0501047_0007645 3300049581 Bacteria 10178
479 Ga0501047_0007823 3300049581 Bacteria 10066
480 Ga0501047_0170732 3300049581 Bacteria 2044
481 Ga0501068_0043285 3300049584 Bacteria 2708
482 Ga0501068_0065586 3300049584 Bacteria 2210
483 Ga0501068_0069203 3300049584 Bacteria 2152
484 Ga0501069_0000001 3300049585 Bacteria 289100
485 Ga0501069_0004865 3300049585 Bacteria 6953
486 Ga0501069_0063838 3300049585 Bacteria 2057
487 Ga0501070_0000071 3300049586 Bacteria 86669
488 Ga0501070_0000236 3300049586 Bacteria 52046
489 Ga0501070_0000994 3300049586 Bacteria 25473
490 Ga0501070_0003781 3300049586 Bacteria 13078
491 Ga0501070_0019911 3300049586 Bacteria 5626
492 Ga0501070_0177202 3300049586 Bacteria 1755
493 Ga0501070_0242645 3300049586 Bacteria 1475
494 Ga0501071_0007209 3300049587 Bacteria 7274
495 Ga0501073_0002857 3300049589 Bacteria 12931
496 Ga0501073_0024475 3300049589 Bacteria 4336
497 Ga0501073_0046758 3300049589 Bacteria 3042
498 Ga0501074_0000003 3300049590 Bacteria 116101
499 Ga0501074_0031183 3300049590 Bacteria 3862
500 Ga0501080_0000090 3300049742 Bacteria 61585
501 Ga0501080_0005500 3300049742 Bacteria 11307
502 Ga0501080_0006885 3300049742 Bacteria 10250
503 Ga0501080_0013967 3300049742 Bacteria 7391
504 Ga0501080_0054165 3300049742 Bacteria 3736
505 Ga0501080_0099321 3300049742 Bacteria 2701
506 Ga0501083_0000080 3300049744 Bacteria 64705
507 Ga0501083_0068992 3300049744 Bacteria 2352
508 Ga0501035_0000037 3300049822 Bacteria 160921
509 Ga0501035_0004176 3300049822 Bacteria 13729
510 Ga0501035_0005208 3300049822 Bacteria 12306
511 Ga0501035_0008093 3300049822 Bacteria 9798
512 Ga0501035_0033226 3300049822 Bacteria 4691
513 Ga0501044_0000018 3300049823 Bacteria 225885
514 Ga0501044_0008515 3300049823 Bacteria 11237
515 Ga0501044_0031120 3300049823 Bacteria 5619
516 Ga0501044_0048544 3300049823 Bacteria 4384
517 Ga0501044_0097259 3300049823 Bacteria 2965
518 Ga0501044_0135660 3300049823 Bacteria 2452
519 nmdc:mga03n38_11139_c1 3300050490 Bacteria 3339
520 nmdc:mga03n38_24759_c1 3300050490 Bacteria 2457
521 nmdc:mga0yw44_44878_c1 3300050492 Bacteria 2647
522 nmdc:mga0k408_29433_c1 3300050493 Bacteria 3126
523 nmdc:mga04h51_39437_c1 3300050495 Bacteria 1534
524 nmdc:mga07m45_36631_c1 3300050496 Bacteria 2734
525 nmdc:mga07m45_4288_c2 3300050496 Bacteria 3147
526 nmdc:mga07m45_80899_c1 3300050496 Bacteria 1855
527 Ga0500635_0000018 3300053080 Bacteria 112805
528 Ga0495619_0027028 3300053085 Bacteria 3696
529 Ga0500651_0020044 3300053093 Bacteria 4163
530 Ga0500618_002094 3300053125 Bacteria 7933
531 Ga0500658_0000075 3300053134 Bacteria 45932
532 Ga0500559_0017227 3300053136 Bacteria 3050
533 Ga0500568_0000517 3300053139 Bacteria 28448
534 Ga0500590_001675 3300053148 Bacteria 9269
535 Ga0500604_0031008 3300053151 Bacteria 1567
536 Ga0500616_0008185 3300053153 Bacteria 6527
537 Ga0500620_000324 3300053155 Bacteria 9031
538 Ga0500620_014307 3300053155 Bacteria 2211
539 Ga0500620_035468 3300053155 Bacteria 1608
540 Ga0500622_0000494 3300053156 Bacteria 36823
541 Ga0500634_0000020 3300053161 Bacteria 106250
542 Ga0500636_0000012 3300053177 Bacteria 132207
543 Ga0500636_0000679 3300053177 Bacteria 18258
544 Ga0500587_001865 3300053739 Bacteria 3005
545 Ga0501082_0005057 3300060353 Bacteria 11495
546 Ga0501082_0074074 3300060353 Bacteria 2932
547 2511099148 2510917014 Bacteria 8296963
548 2501076067 2501025501 Bacteria 7768574
549 2501085178 2501025502 Bacteria 9641094
550 2501409619 2501025504 Bacteria 8008976
551 2507510389 2507262055 Bacteria 8048963
552 2508728262 2508501050 Bacteria 9633614
553 2509074817 2508501114 Bacteria 7082538
554 2509368040 2509276018 Bacteria 6910194
555 2509391032 2509276021 Bacteria 7634384
556 2509441814 2509276033 Bacteria 7180565
557 2510133196 2510065019 Bacteria 6903379
558 2510841802 2510461069 Bacteria 5505000
559 2510893281 2510461076 Bacteria 8618824
560 2511090605 2510917013 Bacteria 9951648
561 2511108748 2510917015 Bacteria 7950052
562 2511137001 2510917022 Bacteria 6504556
563 2511185450 2510917028 Bacteria 6185411
564 2511196976 2510917030 Bacteria 7460662
565 2512351800 2512047030 Bacteria 9031815
566 2513572041 2513237084 Bacteria 7231967
567 2513572242 2513237084 Bacteria 7231967
568 2513576029 2513237085 Bacteria 7695351
569 2513608093 2513237090 Bacteria 7096802
570 2513633520 2513237093 Bacteria 7545552
571 2513714247 2513237103 Bacteria 7647401
572 2513866712 2513237138 Bacteria 7368160
573 2514019259 2513237162 Bacteria 7468464
574 2514053539 2513237166 Bacteria 10373764
575 2515109482 2515075009 Bacteria 7288508
576 2515626991 2515154112 Bacteria 8294334
577 2515634253 2515154113 Bacteria 7807172
578 2515641869 2515154114 Bacteria 7848616
579 2515658850 2515154116 Bacteria 7552979
580 2515742548 2515154134 Bacteria 7220242
581 2516019060 2515154189 Bacteria 9629850
582 2516205087 2516143018 Bacteria 6951533
583 2517042559 2516653077 Bacteria 7555578
584 2517081491 2516653085 Bacteria 7346596
585 2517100112 2517093000 Bacteria 7412387
586 2517411348 2517287029 Bacteria 6905599
587 2530648537 2529292951 Bacteria 6916614
588 2535518069 2534681796 Bacteria 7146037
589 2585205228 2582581294 Bacteria 6626667
590 2585226882 2582581298 Bacteria 7315509
591 2585255339 2582581304 Bacteria 5831370
592 2585272273 2582581307 Bacteria 6597605
593 2585397476 2582581866 Bacteria 6859583
594 2585401481 2582581867 Bacteria 7184437
595 2585526581 2585427526 Bacteria 7258840
596 2585538881 2585427528 Bacteria 6842387
597 2585550297 2585427529 Bacteria 7395659
598 2585561663 2585427531 Bacteria 6992870
599 2585821174 2585427590 Bacteria 6824633
600 2585836832 2585427593 Bacteria 7141551
601 2585846086 2585427594 Bacteria 6180594
602 2585899512 2585427608 Bacteria 6544331
603 2585906891 2585427609 Bacteria 6667127
604 2587982312 2585428125 Bacteria 6662905
605 2599938632 2599185301 Bacteria 6161860
606 2603865476 2602042109 Bacteria 5152801
607 2616294258 2615840624 Bacteria 6557588
608 2617346173 2617270735 Bacteria 9163226
609 2643813471 2643221558 Bacteria 5460675
610 2643984248 2643221595 Bacteria 6565519
611 2644004007 2643221599 Bacteria 6292121
612 2644156869 2643221627 Bacteria 6761570
613 2644242165 2643221643 Bacteria 5749658
614 2644248509 2643221644 Bacteria 6865017
615 2644494092 2643221688 Bacteria 5260751
616 2657684346 2657244999 Bacteria 5946535
617 2688598237 2687453392 Bacteria 6880454
618 2694632635 2693429783 Bacteria 7019804
619 2694639636 2693429784 Bacteria 7241525
620 2719184268 2718217882 Bacteria 6556348
621 2719390002 2718217927 Bacteria 6972593
622 2719669604 2718217997 Bacteria 6740740
623 2719729841 2718218009 Bacteria 6478651
624 2720494620 2718218199 Bacteria 6740745
625 2720610955 2718218232 Bacteria 6720332
626 2720616836 2718218233 Bacteria 6662049
627 2720628194 2718218235 Bacteria 6630699
628 2720771772 2718218269 Bacteria 6906114
629 2721144091 2718218363 Bacteria 6524337
630 2721156780 2718218365 Bacteria 6274507
631 2721161466 2718218366 Bacteria 6425255
632 2721403641 2718218423 Bacteria 6438183
633 2722837419 2721755514 Bacteria 6424414
634 2723031026 2721755556 Bacteria 6745503
635 2723563533 2721755684 Bacteria 6859907
636 2723571526 2721755685 Bacteria 6704835
637 2724035217 2721755809 Bacteria 6438790
638 2724040995 2721755810 Bacteria 6479005
639 2724087321 2721755819 Bacteria 6906405
640 2724101032 2721755822 Bacteria 6726041
641 2724108274 2721755823 Bacteria 6752556
642 2725946441 2724679232 Bacteria 7646494
643 2725951781 2724679232 Bacteria 7646494
644 2730105492 2728369352 Bacteria 6745171
645 2730162408 2728369365 Bacteria 6555560
646 2730295541 2728369397 Bacteria 6274511
647 2738799877 2738541293 Bacteria 7065685
648 2738946903 2738541317 Bacteria 5340176
649 2739034299 2738541333 Bacteria 7106503
650 2756672379 2756170246 Bacteria 7451806
651 2758638141 2758568016 Bacteria 5645291
652 2765465506 2765235802 Bacteria 5618596
653 2766068322 2765235942 Bacteria 7445910
654 2774874280 2773857925 Bacteria 6472445
655 2776262135 2775506901 Bacteria 9631051
656 2776267169 2775506902 Bacteria 6208009
657 2776284916 2775506904 Bacteria 5954060
658 2792580381 2791355082 Bacteria 5973319
659 2792752543 2791355123 Bacteria 8049106
660 2793060607 2791355196 Bacteria 7323613
661 2793281420 2791355253 Bacteria 5171699
662 2793295928 2791355256 Bacteria 6798008
663 2793312854 2791355259 Bacteria 7254731
664 2793321840 2791355260 Bacteria 6598818
665 2793326917 2791355261 Bacteria 6661293
666 2793336314 2791355262 Bacteria 6774204
667 2793340614 2791355263 Bacteria 6872478
668 2793348539 2791355264 Bacteria 6429314
669 2793354170 2791355265 Bacteria 6539969
670 2793361717 2791355266 Bacteria 7116587
671 2793367231 2791355267 Bacteria 7222458
672 2804754751 2802429268 Bacteria 6094027
673 2805914737 2802429603 Bacteria 8777136
674 2805930892 2802429605 Bacteria 6875453
675 2805932882 2802429606 Bacteria 6346811
676 2806043100 2802429633 Bacteria 7341974
677 2806051052 2802429634 Bacteria 7083200
678 2806057778 2802429635 Bacteria 7650140
679 2806065504 2802429636 Bacteria 7597525
680 2806075255 2802429637 Bacteria 7067217
681 2808974256 2808606384 Bacteria 8474373
682 2809009042 2808606390 Bacteria 8476311
683 2809016193 2808606391 Bacteria 8308166
684 2824684752 2824679649 Bacteria 8248951
685 2824688965 2824687955 Bacteria 8360029
686 2824701297 2824696289 Bacteria 8335049
687 2824774419 2824773399 Bacteria 8360218
688 2838019668 2838016132 Bacteria 6577831
689 2838027120 2838022645 Bacteria 6494267
690 2838067011 2838061910 Bacteria 6794874
691 2838072539 2838068647 Bacteria 6208656
692 2838080534 2838074704 Bacteria 6785777
693 2838129646 2838122688 Bacteria 8803140
694 2838669117 2838668709 Bacteria 6671819
695 2838686025 2838680041 Bacteria 6545511
696 2838688510 2838686498 Bacteria 7807632
697 2838700604 2838694306 Bacteria 6853137
698 2838701222 2838701080 Bacteria 6669771
699 2838713883 2838707686 Bacteria 6619912
700 2838734356 2838729681 Bacteria 7400765
701 2838746815 2838742623 Bacteria 7396178
702 2841852250 2841851746 Bacteria 7532261
703 2841865630 2841864319 Bacteria 6742987
704 2841946539 2841941048 Bacteria 8688029
705 2841952223 2841949485 Bacteria 8680857
706 2841967962 2841966195 Bacteria 8673214
707 2841983046 2841974524 Bacteria 8931498
708 2841983052 2841974524 Bacteria 8931498
709 2842042352 2842038055 Bacteria 8002051
710 2842050395 2842045827 Bacteria 8006841
711 2842082963 2842077413 Bacteria 6508645
712 2842111720 2842110456 Bacteria 7656360
713 2842124228 2842118031 Bacteria 7033875
714 2842146713 2842146304 Bacteria 5957337
715 2842158675 2842156927 Bacteria 6894975
716 2842166097 2842163707 Bacteria 6916235
717 2842182289 2842180545 Bacteria 6888678
718 2842193898 2842192696 Bacteria 6147454
719 2842200594 2842198810 Bacteria 6608673
720 2842208472 2842205361 Bacteria 6340321
721 2842222566 2842217011 Bacteria 7497767
722 2842234699 2842229732 Bacteria 7475766
723 2842243296 2842237096 Bacteria 6620661
724 2842248431 2842243621 Bacteria 7421798
725 2842251057 2842250916 Bacteria 6579627
726 2842262396 2842257432 Bacteria 7401195
727 2842272540 2842271015 Bacteria 7807131
728 2842282182 2842278818 Bacteria 6340002
729 2842289213 2842285085 Bacteria 6011953
730 2842297222 2842291075 Bacteria 7076806
731 2842310888 2842304105 Bacteria 7023636
732 2842313261 2842311132 Bacteria 6616990
733 2842323185 2842317721 Bacteria 6793725
734 2842345561 2842341865 Bacteria 7003929
735 2842363857 2842363717 Bacteria 6844742
736 2842376356 2842370503 Bacteria 7038661
737 2842383616 2842377471 Bacteria 7140707
738 2842390755 2842384541 Bacteria 7057858
739 2842407419 2842402390 Bacteria 6681310
740 2842413332 2842409023 Bacteria 6687331
741 2842419975 2842415677 Bacteria 6596907
742 2842426013 2842422224 Bacteria 6239196
743 2842430160 2842428310 Bacteria 6767288
744 2842442888 2842441272 Bacteria 6769273
745 2842454471 2842447887 Bacteria 6754142
746 2842464476 2842462802 Bacteria 6588055
747 2842471157 2842469257 Bacteria 6752936
748 2842490645 2842489311 Bacteria 6620893
749 2842498937 2842495871 Bacteria 6820686
750 2844007666 2844002411 Bacteria 7168230
751 2844461438 2844454524 Bacteria 7952546
752 2847947177 2847939898 Bacteria 8606328
753 2854681567 2854681122 Bacteria 4548679
754 2854899682 2854896431 Bacteria 5869725
755 2854914720 2854911287 Bacteria 5582813
756 2854917331 2854916844 Bacteria 5725939
757 2856294537 2856287931 Bacteria 7223934
758 2856334355 2856328259 Bacteria 6528202
759 2856338403 2856334872 Bacteria 7037011
760 2856365339 2856364286 Bacteria 6939991
761 2857354770 2857349434 Bacteria 7926032
762 2857367910 2857357740 Bacteria 9937880
763 2857372812 2857367948 Bacteria 6965560
764 2857520738 2857516855 Bacteria 7787325
765 2869175327 2869169390 Bacteria 6659796
766 2869235341 2869234852 Bacteria 6654993
767 2869242686 2869242130 Bacteria 6609239
768 2869251016 2869249662 Bacteria 6868783
769 2869263403 2869256925 Bacteria 6981691
770 2869268097 2869264136 Bacteria 6880765
771 2869276151 2869271264 Bacteria 6908218
772 2869289250 2869285874 Bacteria 6901219
773 2871431318 2871429161 Bacteria 6547891
774 2871452493 2871451962 Bacteria 7336357
775 2871466171 2871459585 Bacteria 6866887
776 2871488048 2871481445 Bacteria 6700002
777 2874116450 2874109183 Bacteria 6517025
778 2874123288 2874116593 Bacteria 6674494
779 2874126506 2874123672 Bacteria 7238285
780 2874138492 2874131515 Bacteria 6820270
781 2874148517 2874146452 Bacteria 7533118
782 2874156261 2874155637 Bacteria 6724144
783 2874167866 2874162495 Bacteria 6174670
784 2874593006 2874590934 Bacteria 8299676
785 2874621101 2874620515 Bacteria 8290088
786 2874647623 2874645413 Bacteria 8214782
787 2876386889 2876386047 Bacteria 6698674
788 2876403518 2876399893 Bacteria 6927900
789 2876408006 2876406927 Bacteria 6191900
790 2876415296 2876413966 Bacteria 6831344
791 2876422602 2876420981 Bacteria 6687741
792 2876779239 2876771140 Bacteria 8287509
793 2876820158 2876818435 Bacteria 8274608
794 2878747922 2878745973 Bacteria 6867388
795 2879076662 2879074833 Bacteria 8279565
796 2879129436 2879127579 Bacteria 8294491
797 2879145369 2879142872 Bacteria 8267021
798 2882462165 2882456835 Bacteria 6863978
799 2883087684 2883087390 Bacteria 9532701
800 2889013457 2889010040 Bacteria 6749192
801 2889021825 2889016732 Bacteria 6700763
802 2894242037 2894232714 Bacteria 8834183
803 2896391315 2896384573 Bacteria 7700774
804 2903505922 2903492973 Bacteria 13473544
805 2904436991 2904434214 Bacteria 6230908
806 2904673323 2904666416 Bacteria 8226587
807 2906311540 2906308376 Bacteria 6841989
808 2906323280 2906321335 Bacteria 6579571
809 2906366986 2906363423 Bacteria 6856682
810 2906383104 2906378014 Bacteria 6911440
811 2906395167 2906393657 Bacteria 6790866
812 2906405556 2906401398 Bacteria 6693206
813 2906413722 2906408224 Bacteria 6162342
814 2913300922 2913295892 Bacteria 6333755
815 2913311736 2913308742 Bacteria 5350706
816 2915653593 2915650412 Bacteria 4288180
817 2919102277 2919100787 Bacteria 7710546
818 2920764084 2920760137 Bacteria 7427611
819 2922152999 2922151315 Bacteria 6902399
820 2922173771 2922172374 Bacteria 6167644
821 2922181342 2922178524 Bacteria 6025201
822 2922398905 2922393267 Bacteria 8285685
823 2923556938 2923556063 Bacteria 6793593
824 2924715321 2924710171 Bacteria 6752351
825 2924739052 2924733363 Bacteria 7574837
826 2924753087 2924748358 Bacteria 6154725
827 2924766048 2924762789 Bacteria 6561353
828 2932795594 2932794094 Bacteria 7915132
829 2932807810 2932801729 Bacteria 7987968
830 2933577383 2933570622 Bacteria 7023390
831 2933590926 2933586486 Bacteria 7667493
832 2935885987 2935883170 Bacteria 7964738
833 2935900920 2935894831 Bacteria 6620579
834 2935906536 2935901341 Bacteria 7341747
835 2935960918 2935959822 Bacteria 7869783
836 2935981175 2935975950 Bacteria 8347125
837 2936370893 2936367885 Bacteria 7324495
838 2936382598 2936381700 Bacteria 7006523
839 2937818639 2937813078 Bacteria 7783518
840 2937823243 2937822353 Bacteria 7290551
841 2937845988 2937843397 Bacteria 5256375
842 2937988150 2937980651 Bacteria 6517427
843 2938022039 2938014810 Bacteria 6700592
844 2939673004 2939669807 Bacteria 5028511
845 2941534738 2941531003 Bacteria 7653939
846 2958055715 2958041894 Bacteria 13082850
847 2958126843 2958122699 Bacteria 7280457
848 2958133626 2958130278 Bacteria 6897202
849 2958142613 2958137437 Bacteria 6050276
850 2958178243 2958172287 Bacteria 6716688
851 2958183270 2958179912 Bacteria 6874908
852 2961081237 2961077736 Bacteria 7079850
853 2961141299 2961136820 Bacteria 6775228
854 2961183829 2961183825 Bacteria 6688536
855 2965031964 2965025482 Bacteria 6532201
856 2965094006 2965089291 Bacteria 6866420
857 2965107935 2965102966 Bacteria 6800987
858 2965119333 2965110997 Bacteria 6693150
859 2965121107 2965119406 Bacteria 6956431
860 2968118645 2968117919 Bacteria 6536078
861 2970493100 2970489779 Bacteria 6517260
862 2970512389 2970510686 Bacteria 7006402
863 2970550081 2970547951 Bacteria 6931819
864 2970624253 2970619444 Bacteria 6986144
865 2970631274 2970627176 Bacteria 6680862
866 2977844564 2977843712 Bacteria 6753583
867 2977853565 2977851361 Bacteria 6694324
868 2977909348 2977907340 Bacteria 6577984
869 2977919721 2977915119 Bacteria 6829656
870 2977937738 2977935797 Bacteria 6252826
871 2977946551 2977942078 Bacteria 7570577
872 2977956285 2977950692 Bacteria 6893264
873 2977961498 2977957713 Bacteria 6877875
874 2977975071 2977971508 Bacteria 7472917
875 2979712924 2979710463 Bacteria 6785254
876 2979768951 2979764755 Bacteria 6610066
877 2979776203 2979772303 Bacteria 6618277
878 2979795407 2979793036 Bacteria 6808957
879 2980127599 2980125574 Bacteria 5567337
880 2987643372 2987636660 Bacteria 8088555
881 2987649173 2987645492 Bacteria 6117018
882 2987652806 2987652177 Bacteria 6969023
883 2987668438 2987666974 Bacteria 6509233
884 2987678321 2987673487 Bacteria 6884027
885 2996314624 2996310559 Bacteria 6357320
886 2996393744 2996386984 Bacteria 6978667
887 2996887442 2996887358 Bacteria 5795980
888 2996894783 2996893221 Bacteria 5823108
889 3004168630 3004167301 Bacteria 8330599
890 3004206918 3004203850 Bacteria 7307914
891 3004235808 3004232784 Bacteria 6662140
892 3004249286 3004248173 Bacteria 6563236
893 3004273556 3004268573 Bacteria 7043476
894 3005412841 3005409236 Bacteria 7188837
895 3005450673 3005445848 Bacteria 6906074
896 3005458494 3005452660 Bacteria 5889319
897 639651052 639633055 Bacteria 7751309
898 649872773 649633066 Bacteria 6690028
899 8004305713 8004300914 Bacteria 6132239
900 8004319959 8004312739 Bacteria 7444653
901 8004368203 8004361976 Bacteria 6858373
902 8004391129 8004387939 Bacteria 7049250
903 8004646023 8004640170 Bacteria 6723001
904 8004698664 8004695233 Bacteria 6731676
905 8004716500 8004714634 Bacteria 6776161
906 8004732985 8004727605 Bacteria 6643904
907 8005258730 8005258706 Bacteria 6184835
908 8005276128 8005275841 Bacteria 6929066
909 8005287363 8005282627 Bacteria 6675747
910 8005289904 8005289223 Bacteria 6634003
911 8005307409 8005301065 Bacteria 6614431
912 8005311562 8005307578 Bacteria 7395396
913 8005321969 8005321885 Bacteria 5795980
914 8005389257 8005382845 Bacteria 6732062
915 8005396880 8005395548 Bacteria 6806915
916 8005435759 8005430974 Bacteria 6689030
917 8005503504 8005497431 Bacteria 6477605
918 8005548947 8005542996 Bacteria 7077758
919 8005563227 8005556819 Bacteria 6908598
920 8005564776 8005563573 Bacteria 7153261
921 8005575957 8005570704 Bacteria 6957481
922 8005625805 8005619151 Bacteria 7030230
923 8005632062 8005626139 Bacteria 6534237
924 8005675382 8005668836 Bacteria 6953162
925 8005688698 8005688590 Bacteria 6610080
926 8005695278 8005695170 Bacteria 6912330
927 8018134570 8018127388 Bacteria 7351159
928 8018169818 8018163183 Bacteria 7277977
929 8018180713 8018176218 Bacteria 6896178
930 8019619338 8019619141 Bacteria 9218857
931 8019646127 8019638758 Bacteria 9062356
932 8019656509 8019648815 Bacteria 10014479
933 8019661657 8019659431 Bacteria 8577854
934 8019671187 8019668869 Bacteria 8791617
935 8019685000 8019678201 Bacteria 8863603
936 8023686085 8023680758 Bacteria 7729763
937 8024485301 8024479707 Bacteria 6954785
938 8024506947 8024501048 Bacteria 6427847
939 8049294543 8049293176 Bacteria 6128433
940 8054846638 8054844752 Bacteria 4450330
941 8055270537 8055266321 Bacteria 7999742
942 8055308309 8055301274 Bacteria 8587385
943 8056381941 8056375014 Bacteria 7006639
944 8056970014 8056967851 Bacteria 9038162
945 8057308711 8057304971 Bacteria 4649742
946 8057876337 8057874678 Bacteria 7494653
947 JGI25162J39368_1000252
948 JGI25157J39369_1000894
949 JGI25152J39213_1001228
950 JGI25152J39213_1004613
951 JGI25152J39213_1004663
952 JGI25150J39212_1000155
953 JGI25151J46595_10000007
954 JGI25151J46595_10000341
955 JGI25165J46597_1000102
956 JGI25165J46597_1000198
957 JGI25153J46596_10000068
958 JGI25153J46596_10000344
959 JGI25153J46596_10000569
960 JGI25153J46596_10005313
961 JGI25153J46596_10017750
962 JGI25160J50197_1005260
963 JGI25161J50226_1000321
964 Ga0055526_1000400
965 Ga0055526_1006249
966 Ga0055526_1015426
967 Ga0055524_1003728
968 Ga0055524_1009170
969 Ga0055528_1000034
970 Ga0055528_1000275
971 Ga0055528_1001654
972 Ga0055528_1001947
973 Ga0055528_1004676
974 Ga0055528_1018115
975 Ga0055540_1000066
976 Ga0055540_1023754
977 Ga0055543_1000036
978 Ga0055543_1001227
979 Ga0065165_1002947
980 Ga0065165_1009612
981 Ga0065165_1010226
982 Ga0070666_10056307
983 Ga0070660_100046951
984 Ga0070668_100033178
985 Ga0070671_100004103
986 Ga0070671_100015963
987 Ga0070667_100006416
988 Ga0070708_100143598
989 Ga0070663_100050051
990 Ga0070663_100064749
991 Ga0070706_100001519
992 Ga0070698_100016916
993 Ga0068855_100049649
994 Ga0068857_100040169
995 Ga0068859_100228235
996 Ga0068863_100258801
997 Ga0075365_10006151
998 Ga0075368_10003745
999 Ga0075363_100024083
1000 Ga0075363_100040574
1001 Ga0075363_100048575
1002 Ga0075367_10001204
1003 Ga0075367_10014703
1004 Ga0075367_10055737
1005 Ga0075367_10073323
1006 Ga0075369_10006548
1007 Ga0075369_10024380
1008 Ga0075366_10008319
1009 Ga0075366_10012720
1010 Ga0075366_10050672
1011 Ga0097621_100168078
1012 Ga0075370_10004202
1013 Ga0075370_10013549
1014 Ga0075370_10020993
1015 Ga0097620_100228254
1016 Ga0105251_10001112
1017 Ga0105244_10000856
1018 Ga0105250_10000147
1019 Ga0105240_10297873
1020 Ga0111539_10248668
1021 Ga0105245_10042667
1022 Ga0105247_10027754
1023 Ga0105243_10006971
1024 Ga0105243_10029609
1025 Ga0105243_10066436
1026 Ga0105241_10011996
1027 Ga0105248_10002756
1028 Ga0105237_10003553
1029 Ga0105238_10060653
1030 Ga0105238_10163070
1031 Ga0105249_10177314
1032 Ga0123341_1000005
1033 Ga0123342_1009438
1034 Ga0123342_1012999
1035 Ga0105239_10045985
1036 Ga0105246_10007911
1037 Ga0157374_10003640
1038 Ga0163162_10032691
1039 Ga0163162_10132592
1040 Ga0163163_10018086
1041 Ga0157379_10061223
1042 Ga0214544_1000158
1043 Ga0214542_1001567
1044 Ga0214543_1000234
1045 Ga0209437_100042
1046 Ga0209437_100062
1047 Ga0207425_1000018
1048 Ga0207425_1001094
1049 Ga0209026_1000005
1050 Ga0209759_1000385
1051 Ga0209759_1022408
1052 Ga0209129_1000019
1053 Ga0209129_1000026
1054 Ga0209129_1000594
1055 Ga0209129_1001241
1056 Ga0209129_1001717
1057 Ga0209129_1002292
1058 Ga0209129_1007208
1059 Ga0209233_1000068
1060 Ga0209233_1000082
1061 Ga0209233_1000103
1062 Ga0209673_1000020
1063 Ga0209673_1000132
1064 Ga0209673_1000462
1065 Ga0209673_1000607
1066 Ga0209673_1002413
1067 Ga0209673_1003228
1068 Ga0209673_1005352
1069 Ga0209130_1000019
1070 Ga0209676_1011527
1071 Ga0209676_1011889
1072 Ga0209025_1000035
1073 Ga0209025_1000081
1074 Ga0209025_1001347
1075 Ga0209025_1007161
1076 Ga0209025_1008392
1077 Ga0209025_1008442
1078 Ga0209025_1027099
1079 Ga0209564_1000205
1080 Ga0209564_1001753
1081 Ga0209564_1001887
1082 Ga0209564_1008232
1083 Ga0209564_1029832
1084 Ga0209758_1000040
1085 Ga0209758_1000076
1086 Ga0209758_1000097
1087 Ga0209758_1002328
1088 Ga0209758_1002907
1089 Ga0209758_1003451
1090 Ga0209758_1015093
1091 Ga0209758_1015203
1092 Ga0209050_1003157
1093 Ga0209256_1000500
1094 Ga0209256_1000805
1095 Ga0209256_1009308
1096 Ga0209256_1028844
1097 Ga0207426_1000005
1098 Ga0207426_1000169
1099 Ga0207426_1000947
1100 Ga0209051_1000038
1101 Ga0209051_1001518
1102 Ga0209051_1002689
1103 Ga0209051_1008934
1104 Ga0209257_1017269
1105 Ga0209257_1039634
1106 Ga0207696_1000008
1107 Ga0207696_1000012
1108 Ga0207655_1006570
1109 Ga0207713_1000076
1110 Ga0207688_10022953
1111 Ga0207680_10169823
1112 Ga0207647_10001418
1113 Ga0207705_10043723
1114 Ga0207684_10024124
1115 Ga0207654_10097433
1116 Ga0207695_10200127
1117 Ga0207657_10058024
1118 Ga0207652_10052820
1119 Ga0207681_10046346
1120 Ga0207694_10024443
1121 Ga0207687_10069870
1122 Ga0207709_10003911
1123 Ga0207709_10012857
1124 Ga0207709_10095513
1125 Ga0207709_10099284
1126 Ga0207711_10098963
1127 Ga0207667_10096410
1128 Ga0207668_10007178
1129 Ga0207703_10032178
1130 Ga0207678_10018207
1131 Ga0207678_10030455
1132 Ga0207702_10070072
1133 Ga0207674_10054276
1134 Ga0207674_10098706
1135 Ga0207674_10284215
1136 Ga0307517_10001635
1137 Ga0307517_10076567
1138 Ga0307515_10000109
1139 Ga0307515_10001382
1140 Ga0307515_10020539
1141 Ga0307515_10026303
1142 Ga0307512_10050643
1143 Ga0307512_10105228
1144 Ga0265330_10008935
1145 Ga0265325_10009442
1146 Ga0307513_10000990
1147 Ga0307513_10005720
1148 Ga0307508_10000612
1149 Ga0307508_10003625
1150 Ga0307516_10015932
1151 Ga0307516_10029310
1152 Ga0307516_10166904
1153 Ga0307405_10000846
1154 Ga0307406_10036049
1155 Ga0307412_10144041
1156 Ga0307409_100055711
1157 Ga0307507_10033874
1158 Ga0307510_10010214
1159 Ga0307510_10134586
1160 Ga0307510_10135212
1161 Ga0307510_10192195
1162 Ga0373931_0012161
1163 Ga0373927_0000057
1164 Ga0373937_0015361
1165 Ga0373925_0024688
1166 Ga0395899_0000374
1167 Ga0395900_0000302
1168 Ga0395900_0018024
1169 Ga0395898_0000518
1170 Ga0395898_0069477
1171 Ga0395898_0149404
1172 Ga0395905_0000285
1173 Ga0395905_0001410
1174 Ga0395905_0015167
1175 Ga0395905_0097647
1176 Ga0436364_0390800
1177 Ga0395901_0000210
1178 Ga0395901_0000749
1179 Ga0395901_0044620
1180 Ga0395901_0078249
1181 Ga0395901_0160136
1182 Ga0436365_0609406
1183 Ga0436362_0305810
1184 Ga0451833_0047502
1185 Ga0451833_0172985
1186 Ga0451835_0304073
1187 Ga0451837_1198351
1188 Ga0451839_0165640
1189 Ga0451841_1412459
1190 Ga0451845_0495161
1191 Ga0451849_0515669
1192 Ga0451849_1263981
1193 Ga0451851_0496842
1194 Ga0451843_0158345
1195 Ga0451855_1252208
1196 Ga0451853_0581710
1197 Ga0466972_0038601
1198 Ga0466966_0017107
1199 Ga0466959_0003231
1200 Ga0495592_0029253
1201 Ga0495592_0185946
1202 Ga0495603_0055993
1203 Ga0495590_0019336
1204 Ga0495629_0000291
1205 Ga0495629_0001055
1206 Ga0495629_0018162
1207 Ga0495629_0107663
1208 Ga0495638_0008499
1209 Ga0495638_0046261
1210 Ga0495641_0009517
1211 Ga0495653_0000940
1212 Ga0495653_0013833
1213 Ga0495650_0005830
1214 Ga0495650_0005927
1215 Ga0495650_0012589
1216 Ga0495650_0015767
1217 Ga0495650_0051210
1218 Ga0495650_0054051
1219 Ga0495580_0000022
1220 Ga0495580_0001018
1221 Ga0495582_0011117
1222 Ga0495605_0062914
1223 Ga0495664_0001400
1224 Ga0495664_0017921
1225 Ga0495664_0034630
1226 Ga0495664_0071268
1227 Ga0495585_0018033
1228 Ga0495585_0045474
1229 Ga0495583_0000133
1230 Ga0495583_0022266
1231 Ga0495583_0024174
1232 Ga0495606_0005245
1233 Ga0495606_0008226
1234 Ga0495606_0028443
1235 Ga0495606_0042991
1236 Ga0495610_0002362
1237 Ga0495610_0017775
1238 Ga0495610_0038512
1239 Ga0495618_0002113
1240 Ga0495620_0027007
1241 Ga0495620_0047395
1242 Ga0495628_0002858
1243 Ga0495628_0016387
1244 Ga0495628_0024019
1245 Ga0495628_0028292
1246 Ga0495630_0000977
1247 Ga0495630_0006962
1248 Ga0495630_0068875
1249 Ga0495632_0000360
1250 Ga0495632_0017169
1251 Ga0495643_0039321
1252 Ga0495643_0080355
1253 Ga0495648_0019901
1254 Ga0495648_0102381
1255 Ga0495648_0123162
1256 Ga0495666_0000422
1257 Ga0495652_0033259
1258 Ga0495652_0050098
1259 Ga0495640_0010351
1260 Ga0495586_0055897
1261 Ga0495587_0003823
1262 Ga0495597_0006990
1263 Ga0495597_0009601
1264 Ga0495645_0023636
1265 Ga0495645_0027709
1266 Ga0495656_0027048
1267 Ga0495668_0006217
1268 Ga0495668_0029961
1269 Ga0495668_0037267
1270 Ga0495668_0083956
1271 Ga0495634_0003148
1272 Ga0495611_0009512
1273 Ga0495611_0024391
1274 Ga0495625_0003246
1275 Ga0495625_0017309
1276 Ga0495625_0074251
1277 Ga0495635_0002692
1278 Ga0495635_0030308
1279 Ga0495635_0036756
1280 Ga0495661_0040310
1281 Ga0495599_0000836
1282 Ga0495599_0010360
1283 Ga0495623_0007435
1284 Ga0495646_0001627
1285 Ga0495646_0015696
1286 Ga0495669_0049795
1287 Ga0495613_0004246
1288 Ga0495613_0172611
1289 Ga0495624_0000362
1290 Ga0495624_0006325
1291 Ga0495624_0019926
1292 Ga0495670_0015784
1293 Ga0495649_0000437
1294 Ga0495649_0030230
1295 Ga0495649_0030378
1296 Ga0495649_0038971
1297 Ga0495660_0025608
1298 Ga0495581_0006308
1299 Ga0495604_0003671
1300 Ga0495604_0014673
1301 Ga0495674_0004868
1302 Ga0495674_0032184
1303 Ga0495672_0047208
1304 Ga0495676_0018347
1305 Ga0495680_0003928
1306 Ga0495680_0050985
1307 Ga0495683_0009114
1308 Ga0495687_010652
1309 Ga0495687_011138
1310 Ga0495687_058182
1311 Ga0495675_0066660
1312 Ga0495675_0126051
1313 Ga0495679_000048
1314 Ga0495679_000591
1315 Ga0495679_007172
1316 Ga0495673_0046663
1317 Ga0495684_0010984
1318 Ga0495686_0000110
1319 Ga0495593_0012031
1320 Ga0495593_0014877
1321 Ga0495593_0060080
1322 Ga0495602_0012413
1323 Ga0495602_0022349
1324 Ga0495602_0192106
1325 Ga0495614_0010394
1326 Ga0495614_0061971
1327 Ga0495626_0009917
1328 Ga0495626_0028055
1329 Ga0496100_0211509
1330 Ga0496102_0005131
1331 Ga0496103_0034494
1332 Ga0496104_0006520
1333 Ga0496104_0026617
1334 Ga0496105_0070990
1335 Ga0496105_0079192
1336 Ga0496106_0000211
1337 Ga0496107_0122981
1338 Ga0496108_0030774
1339 Ga0496108_0156836
1340 Ga0496110_0063916
1341 Ga0496110_0109600
1342 Ga0496111_0093201
1343 Ga0496112_0011758
1344 Ga0496112_0026727
1345 Ga0496113_0066056
1346 Ga0496113_0142296
1347 Ga0496114_0030390
1348 Ga0496114_0163378
1349 Ga0496116_0000216
1350 Ga0496116_0000692
1351 Ga0496116_0006938
1352 Ga0496116_0101861
1353 Ga0496117_0007393
1354 Ga0496117_0008218
1355 Ga0496117_0047510
1356 Ga0496117_0099465
1357 Ga0496118_0000477
1358 Ga0496118_0016242
1359 Ga0496118_0017132
1360 Ga0496118_0023848
1361 Ga0496118_0024372
1362 Ga0496118_0035612
1363 Ga0496118_0067096
1364 Ga0496118_0110744
1365 Ga0496119_0005307
1366 Ga0496119_0030704
1367 Ga0496120_0015826
1368 Ga0496121_0022741
1369 Ga0496121_0024645
1370 Ga0496121_0029318
1371 Ga0496121_0032032
1372 Ga0496121_0033509
1373 Ga0496121_0068983
1374 Ga0496122_0009151
1375 Ga0496122_0017814
1376 Ga0496122_0030611
1377 Ga0496123_0025074
1378 Ga0496123_0027053
1379 Ga0496123_0037086
1380 Ga0496124_0000023
1381 Ga0496124_0013759
1382 Ga0496124_0026067
1383 Ga0496124_0038758
1384 Ga0496124_0096954
1385 Ga0496124_0097347
1386 Ga0496124_0099942
1387 Ga0496124_0145991
1388 Ga0496124_0150224
1389 Ga0496125_0005642
1390 Ga0496125_0021331
1391 Ga0496125_0031077
1392 Ga0496126_0000065
1393 Ga0496126_0000414
1394 Ga0496126_0027824
1395 Ga0496126_0031841
1396 Ga0496126_0046544
1397 Ga0496126_0134056
1398 Ga0496126_0165196
1399 Ga0495678_011181
1400 Ga0501031_0105963
1401 Ga0501032_0000358
1402 Ga0501032_0003572
1403 Ga0501032_0035991
1404 Ga0501032_0050285
1405 Ga0501033_0011119
1406 Ga0501033_0166947
1407 Ga0501034_0049616
1408 Ga0501034_0071948
1409 Ga0501034_0224134
1410 Ga0501036_0001026
1411 Ga0501036_0035893
1412 Ga0501036_0131635
1413 Ga0501037_0000089
1414 Ga0501037_0035583
1415 Ga0501038_0007379
1416 Ga0501038_0014467
1417 Ga0501038_0062472
1418 Ga0501039_0001736
1419 Ga0501039_0044865
1420 Ga0501043_0000007
1421 Ga0501043_0002769
1422 Ga0501043_0087748
1423 Ga0501046_0006159
1424 Ga0501047_0007645
1425 Ga0501047_0007823
1426 Ga0501047_0170732
1427 Ga0501068_0043285
1428 Ga0501068_0065586
1429 Ga0501068_0069203
1430 Ga0501069_0000001
1431 Ga0501069_0004865
1432 Ga0501069_0063838
1433 Ga0501070_0000071
1434 Ga0501070_0000236
1435 Ga0501070_0000994
1436 Ga0501070_0003781
1437 Ga0501070_0019911
1438 Ga0501070_0177202
1439 Ga0501070_0242645
1440 Ga0501071_0007209
1441 Ga0501073_0002857
1442 Ga0501073_0024475
1443 Ga0501073_0046758
1444 Ga0501074_0000003
1445 Ga0501074_0031183
1446 Ga0501080_0000090
1447 Ga0501080_0005500
1448 Ga0501080_0006885
1449 Ga0501080_0013967
1450 Ga0501080_0054165
1451 Ga0501080_0099321
1452 Ga0501083_0000080
1453 Ga0501083_0068992
1454 Ga0501035_0000037
1455 Ga0501035_0004176
1456 Ga0501035_0005208
1457 Ga0501035_0008093
1458 Ga0501035_0033226
1459 Ga0501044_0000018
1460 Ga0501044_0008515
1461 Ga0501044_0031120
1462 Ga0501044_0048544
1463 Ga0501044_0097259
1464 Ga0501044_0135660
1465 nmdc:mga03n38_11139_c1
1466 nmdc:mga03n38_24759_c1
1467 nmdc:mga0yw44_44878_c1
1468 nmdc:mga0k408_29433_c1
1469 nmdc:mga04h51_39437_c1
1470 nmdc:mga07m45_36631_c1
1471 nmdc:mga07m45_4288_c2
1472 nmdc:mga07m45_80899_c1
1473 Ga0500635_0000018
1474 Ga0495619_0027028
1475 Ga0500651_0020044
1476 Ga0500618_002094
1477 Ga0500658_0000075
1478 Ga0500559_0017227
1479 Ga0500568_0000517
1480 Ga0500590_001675
1481 Ga0500604_0031008
1482 Ga0500616_0008185
1483 Ga0500620_000324
1484 Ga0500620_014307
1485 Ga0500620_035468
1486 Ga0500622_0000494
1487 Ga0500634_0000020
1488 Ga0500636_0000012
1489 Ga0500636_0000679
1490 Ga0500587_001865
1491 Ga0501082_0005057
1492 Ga0501082_0074074
1493 2511099148
1494 2501076067
1495 2501085178
1496 2501409619
1497 2507510389
1498 2508728262
1499 2509074817
1500 2509368040
1501 2509391032
1502 2509441814
1503 2510133196
1504 2510841802
1505 2510893281
1506 2511090605
1507 2511108748
1508 2511137001
1509 2511185450
1510 2511196976
1511 2512351800
1512 2513572041
1513 2513572242
1514 2513576029
1515 2513608093
1516 2513633520
1517 2513714247
1518 2513866712
1519 2514019259
1520 2514053539
1521 2515109482
1522 2515626991
1523 2515634253
1524 2515641869
1525 2515658850
1526 2515742548
1527 2516019060
1528 2516205087
1529 2517042559
1530 2517081491
1531 2517100112
1532 2517411348
1533 2530648537
1534 2535518069
1535 2585205228
1536 2585226882
1537 2585255339
1538 2585272273
1539 2585397476
1540 2585401481
1541 2585526581
1542 2585538881
1543 2585550297
1544 2585561663
1545 2585821174
1546 2585836832
1547 2585846086
1548 2585899512
1549 2585906891
1550 2587982312
1551 2599938632
1552 2603865476
1553 2616294258
1554 2617346173
1555 2643813471
1556 2643984248
1557 2644004007
1558 2644156869
1559 2644242165
1560 2644248509
1561 2644494092
1562 2657684346
1563 2688598237
1564 2694632635
1565 2694639636
1566 2719184268
1567 2719390002
1568 2719669604
1569 2719729841
1570 2720494620
1571 2720610955
1572 2720616836
1573 2720628194
1574 2720771772
1575 2721144091
1576 2721156780
1577 2721161466
1578 2721403641
1579 2722837419
1580 2723031026
1581 2723563533
1582 2723571526
1583 2724035217
1584 2724040995
1585 2724087321
1586 2724101032
1587 2724108274
1588 2725946441
1589 2725951781
1590 2730105492
1591 2730162408
1592 2730295541
1593 2738799877
1594 2738946903
1595 2739034299
1596 2756672379
1597 2758638141
1598 2765465506
1599 2766068322
1600 2774874280
1601 2776262135
1602 2776267169
1603 2776284916
1604 2792580381
1605 2792752543
1606 2793060607
1607 2793281420
1608 2793295928
1609 2793312854
1610 2793321840
1611 2793326917
1612 2793336314
1613 2793340614
1614 2793348539
1615 2793354170
1616 2793361717
1617 2793367231
1618 2804754751
1619 2805914737
1620 2805930892
1621 2805932882
1622 2806043100
1623 2806051052
1624 2806057778
1625 2806065504
1626 2806075255
1627 2808974256
1628 2809009042
1629 2809016193
1630 2824684752
1631 2824688965
1632 2824701297
1633 2824774419
1634 2838019668
1635 2838027120
1636 2838067011
1637 2838072539
1638 2838080534
1639 2838129646
1640 2838669117
1641 2838686025
1642 2838688510
1643 2838700604
1644 2838701222
1645 2838713883
1646 2838734356
1647 2838746815
1648 2841852250
1649 2841865630
1650 2841946539
1651 2841952223
1652 2841967962
1653 2841983046
1654 2841983052
1655 2842042352
1656 2842050395
1657 2842082963
1658 2842111720
1659 2842124228
1660 2842146713
1661 2842158675
1662 2842166097
1663 2842182289
1664 2842193898
1665 2842200594
1666 2842208472
1667 2842222566
1668 2842234699
1669 2842243296
1670 2842248431
1671 2842251057
1672 2842262396
1673 2842272540
1674 2842282182
1675 2842289213
1676 2842297222
1677 2842310888
1678 2842313261
1679 2842323185
1680 2842345561
1681 2842363857
1682 2842376356
1683 2842383616
1684 2842390755
1685 2842407419
1686 2842413332
1687 2842419975
1688 2842426013
1689 2842430160
1690 2842442888
1691 2842454471
1692 2842464476
1693 2842471157
1694 2842490645
1695 2842498937
1696 2844007666
1697 2844461438
1698 2847947177
1699 2854681567
1700 2854899682
1701 2854914720
1702 2854917331
1703 2856294537
1704 2856334355
1705 2856338403
1706 2856365339
1707 2857354770
1708 2857367910
1709 2857372812
1710 2857520738
1711 2869175327
1712 2869235341
1713 2869242686
1714 2869251016
1715 2869263403
1716 2869268097
1717 2869276151
1718 2869289250
1719 2871431318
1720 2871452493
1721 2871466171
1722 2871488048
1723 2874116450
1724 2874123288
1725 2874126506
1726 2874138492
1727 2874148517
1728 2874156261
1729 2874167866
1730 2874593006
1731 2874621101
1732 2874647623
1733 2876386889
1734 2876403518
1735 2876408006
1736 2876415296
1737 2876422602
1738 2876779239
1739 2876820158
1740 2878747922
1741 2879076662
1742 2879129436
1743 2879145369
1744 2882462165
1745 2883087684
1746 2889013457
1747 2889021825
1748 2894242037
1749 2896391315
1750 2903505922
1751 2904436991
1752 2904673323
1753 2906311540
1754 2906323280
1755 2906366986
1756 2906383104
1757 2906395167
1758 2906405556
1759 2906413722
1760 2913300922
1761 2913311736
1762 2915653593
1763 2919102277
1764 2920764084
1765 2922152999
1766 2922173771
1767 2922181342
1768 2922398905
1769 2923556938
1770 2924715321
1771 2924739052
1772 2924753087
1773 2924766048
1774 2932795594
1775 2932807810
1776 2933577383
1777 2933590926
1778 2935885987
1779 2935900920
1780 2935906536
1781 2935960918
1782 2935981175
1783 2936370893
1784 2936382598
1785 2937818639
1786 2937823243
1787 2937845988
1788 2937988150
1789 2938022039
1790 2939673004
1791 2941534738
1792 2958055715
1793 2958126843
1794 2958133626
1795 2958142613
1796 2958178243
1797 2958183270
1798 2961081237
1799 2961141299
1800 2961183829
1801 2965031964
1802 2965094006
1803 2965107935
1804 2965119333
1805 2965121107
1806 2968118645
1807 2970493100
1808 2970512389
1809 2970550081
1810 2970624253
1811 2970631274
1812 2977844564
1813 2977853565
1814 2977909348
1815 2977919721
1816 2977937738
1817 2977946551
1818 2977956285
1819 2977961498
1820 2977975071
1821 2979712924
1822 2979768951
1823 2979776203
1824 2979795407
1825 2980127599
1826 2987643372
1827 2987649173
1828 2987652806
1829 2987668438
1830 2987678321
1831 2996314624
1832 2996393744
1833 2996887442
1834 2996894783
1835 3004168630
1836 3004206918
1837 3004235808
1838 3004249286
1839 3004273556
1840 3005412841
1841 3005450673
1842 3005458494
1843 639651052
1844 649872773
1845 8004305713
1846 8004319959
1847 8004368203
1848 8004391129
1849 8004646023
1850 8004698664
1851 8004716500
1852 8004732985
1853 8005258730
1854 8005276128
1855 8005287363
1856 8005289904
1857 8005307409
1858 8005311562
1859 8005321969
1860 8005389257
1861 8005396880
1862 8005435759
1863 8005503504
1864 8005548947
1865 8005563227
1866 8005564776
1867 8005575957
1868 8005625805
1869 8005632062
1870 8005675382
1871 8005688698
1872 8005695278
1873 8018134570
1874 8018169818
1875 8018180713
1876 8019619338
1877 8019646127
1878 8019656509
1879 8019661657
1880 8019671187
1881 8019685000
1882 8023686085
1883 8024485301
1884 8024506947
1885 8049294543
1886 8054846638
1887 8055270537
1888 8055308309
1889 8056381941
1890 8056970014
1891 8057308711
1892 8057876337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

103

434

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4353 36 387
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4283 36 387
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.4009 43 387
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.3991 25 391
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.3976 56 376
ID Description Score Start End Superfamily
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.84 69 385 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8116 69 385 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7568 70 385 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7492 70 385 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7457 71 385 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A529ZFR5-F1-model_v4 deleted 0.88 108 313
AF-A0A061LYS4-F1-model_v4 Xylose transport system permease protein XylH 0.8797 47 398 GO:0005886
GO:0022857
AF-A0A435ESH8-F1-model_v4 deleted 0.8789 54 402
AF-A0A376FHV7-F1-model_v4 Xylose transport system permease protein XylH 0.876 47 295 GO:0005886
GO:0022857
AF-A0A3B9MTM6-F1-model_v4 Xylose transport system permease protein XylH 0.87 47 314 GO:0005886
GO:0022857

Map