F486477

General Info

Members Datasets Scaffolds Average Seq Length
947 235 1894 445

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100082255|Ga0070673_1000822551
Length 483
Sequence MRPRLACASGGPHDESMGAAANLAPANGDRPWVTELRATMALAWPLILANLTQQAIQATDVLLMGRLGPTQLAAATLALNLTFTFNLLMLGLVIASSPMMATALGQRSNAVRDVRRTFRAGLWLIAVMLPPYWLVLWHVGGLMHAFGISDQLTIQGQTFLRAYMWCTAPWLLFQLLRNFVAALERPRAVLWLSLGGIALNALISWSLIFGKLGLPALGLVGGGLGSTLTWIIMCGALVTVVLADRQFRRFHLFGHWWRFDRQRTLAMVRLGWPIGVTMALEMGVFALAAYFMGWIGAPAVAAHAVALQLAALTFMVPLGLGQAATVRVGLALGRRDEAGIARAGWTAWVIGVGFMGSMALVMWAIPRTLITLFLKDIPANAVVIGLAVSFLRVAAAFQLVDGAQVIGAGMLRGLHDTRWPLVFALVGYWVVGLGIGTWLAFGEDWKGVGIWIGLASGLAAVAALMLTRWILRDRLGLTPPRHG

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
215 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
228 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
229 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 2643221651 Afipia sp. Root123D2 Isolate Unclassified
235 2909042592 Labrys sp. LIt4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0.11
Rhizoplane 3.38
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100082255 3300005364 Bacteria 2613
2 JGI24741J21665_1005796 3300001915 Bacteria 2539
3 JGI24740J21852_10015894 3300001979 Bacteria 2734
4 JGI24739J22299_10008538 3300001989 Bacteria 3825
5 JGI24739J22299_10020650 3300001989 Bacteria 2351
6 JGI24737J22298_10000011 3300001990 Bacteria 53665
7 JGI24737J22298_10003233 3300001990 Bacteria 5780
8 JGI24737J22298_10003789 3300001990 Bacteria 5318
9 JGI24737J22298_10010204 3300001990 Bacteria 3105
10 JGI24737J22298_10011437 3300001990 Bacteria 2909
11 JGI24737J22298_10025015 3300001990 Bacteria 1889
12 JGI24735J21928_10002094 3300002067 Bacteria 7026
13 JGI24735J21928_10009632 3300002067 Bacteria 3097
14 JGI24735J21928_10015513 3300002067 Bacteria 2376
15 JGI24745J21846_1000738 3300002073 Bacteria 2974
16 JGI24738J21930_10000318 3300002075 Bacteria 13312
17 JGI24738J21930_10002851 3300002075 Bacteria 4430
18 JGI24738J21930_10003878 3300002075 Bacteria 3733
19 Ga0065712_10008235 3300005290 Bacteria 2685
20 Ga0070658_10001530 3300005327 Bacteria 19583
21 Ga0070658_10005602 3300005327 Bacteria 10186
22 Ga0070658_10012888 3300005327 Bacteria 6712
23 Ga0070658_10014993 3300005327 Bacteria 6204
24 Ga0070658_10023615 3300005327 Bacteria 4933
25 Ga0070658_10034580 3300005327 Bacteria 4066
26 Ga0070658_10051461 3300005327 Bacteria 3338
27 Ga0070658_10054328 3300005327 Bacteria 3252
28 Ga0070658_10057124 3300005327 Bacteria 3174
29 Ga0070658_10066018 3300005327 Bacteria 2955
30 Ga0070658_10080452 3300005327 Bacteria 2676
31 Ga0070676_10012646 3300005328 Bacteria 4614
32 Ga0070676_10056621 3300005328 Bacteria 2317
33 Ga0070683_100000307 3300005329 Bacteria 33571
34 Ga0070683_100006673 3300005329 Bacteria 9694
35 Ga0070683_100030960 3300005329 Bacteria 4862
36 Ga0070690_100014082 3300005330 Bacteria 4741
37 Ga0070670_100001795 3300005331 Bacteria 17478
38 Ga0070670_100002045 3300005331 Bacteria 16507
39 Ga0070670_100010465 3300005331 Bacteria 7915
40 Ga0070670_100011645 3300005331 Bacteria 7520
41 Ga0070670_100014887 3300005331 Bacteria 6672
42 Ga0070670_100027310 3300005331 Bacteria 4910
43 Ga0070670_100044294 3300005331 Bacteria 3826
44 Ga0070670_100046274 3300005331 Bacteria 3741
45 Ga0070670_100067158 3300005331 Bacteria 3078
46 Ga0070670_100128430 3300005331 Bacteria 2188
47 Ga0068869_100000295 3300005334 Bacteria 26539
48 Ga0068869_100021675 3300005334 Bacteria 4421
49 Ga0070666_10000764 3300005335 Bacteria 19441
50 Ga0070666_10000914 3300005335 Bacteria 17910
51 Ga0070666_10000978 3300005335 Bacteria 17439
52 Ga0070666_10043828 3300005335 Bacteria 2996
53 Ga0070666_10102394 3300005335 Bacteria 1975
54 Ga0070680_100003102 3300005336 Bacteria 12333
55 Ga0070680_100005776 3300005336 Bacteria 9392
56 Ga0070680_100011387 3300005336 Bacteria 6879
57 Ga0070680_100180017 3300005336 Bacteria 1780
58 Ga0070682_100017761 3300005337 Bacteria 4149
59 Ga0070682_100027657 3300005337 Bacteria 3404
60 Ga0070682_100042327 3300005337 Bacteria 2811
61 Ga0070682_100050425 3300005337 Bacteria 2598
62 Ga0068868_100007082 3300005338 Bacteria 7971
63 Ga0068868_100011840 3300005338 Bacteria 6360
64 Ga0068868_100049256 3300005338 Bacteria 3306
65 Ga0070660_100000042 3300005339 Bacteria 73112
66 Ga0070660_100000978 3300005339 Bacteria 19120
67 Ga0070660_100006574 3300005339 Bacteria 8062
68 Ga0070660_100010417 3300005339 Bacteria 6569
69 Ga0070660_100011976 3300005339 Bacteria 6187
70 Ga0070660_100012105 3300005339 Bacteria 6158
71 Ga0070660_100016263 3300005339 Bacteria 5396
72 Ga0070660_100019339 3300005339 Bacteria 4988
73 Ga0070660_100035761 3300005339 Bacteria 3760
74 Ga0070660_100060452 3300005339 Bacteria 2941
75 Ga0070660_100078634 3300005339 Bacteria 2586
76 Ga0070660_100096976 3300005339 Bacteria 2332
77 Ga0070660_100111554 3300005339 Bacteria 2176
78 Ga0070661_100000120 3300005344 Bacteria 65485
79 Ga0070661_100012384 3300005344 Bacteria 5967
80 Ga0070661_100046277 3300005344 Bacteria 3182
81 Ga0070661_100047896 3300005344 Bacteria 3128
82 Ga0070661_100052055 3300005344 Bacteria 2997
83 Ga0070661_100056637 3300005344 Bacteria 2872
84 Ga0070661_100060387 3300005344 Bacteria 2782
85 Ga0070661_100087688 3300005344 Bacteria 2302
86 Ga0070661_100094905 3300005344 Bacteria 2211
87 Ga0070661_100110690 3300005344 Bacteria 2050
88 Ga0070661_100116296 3300005344 Bacteria 2000
89 Ga0070692_10001332 3300005345 Bacteria 8892
90 Ga0070692_10081219 3300005345 Bacteria 1746
91 Ga0070668_100022817 3300005347 Bacteria 4731
92 Ga0070668_100095860 3300005347 Bacteria 2344
93 Ga0070668_100104406 3300005347 Bacteria 2249
94 Ga0070669_100000422 3300005353 Bacteria 32380
95 Ga0070669_100005430 3300005353 Bacteria 9193
96 Ga0070669_100020469 3300005353 Bacteria 4725
97 Ga0070669_100022352 3300005353 Bacteria 4521
98 Ga0070669_100045995 3300005353 Bacteria 3182
99 Ga0070669_100069730 3300005353 Bacteria 2597
100 Ga0070675_100020550 3300005354 Bacteria 5269
101 Ga0070675_100040070 3300005354 Bacteria 3823
102 Ga0070675_100073939 3300005354 Bacteria 2830
103 Ga0070671_100000401 3300005355 Bacteria 29891
104 Ga0070671_100003283 3300005355 Bacteria 12621
105 Ga0070671_100004306 3300005355 Bacteria 11266
106 Ga0070671_100012251 3300005355 Bacteria 6899
107 Ga0070671_100012771 3300005355 Bacteria 6774
108 Ga0070671_100017469 3300005355 Bacteria 5811
109 Ga0070671_100069099 3300005355 Bacteria 2946
110 Ga0070671_100086529 3300005355 Bacteria 2622
111 Ga0070671_100116847 3300005355 Bacteria 2243
112 Ga0070674_100004684 3300005356 Bacteria 7819
113 Ga0070674_100008153 3300005356 Bacteria 6217
114 Ga0070674_100029250 3300005356 Bacteria 3627
115 Ga0070674_100033494 3300005356 Bacteria 3421
116 Ga0070674_100041603 3300005356 Bacteria 3116
117 Ga0070674_100054079 3300005356 Bacteria 2775
118 Ga0070674_100056816 3300005356 Bacteria 2714
119 Ga0070674_100179393 3300005356 Bacteria 1621
120 Ga0070673_100001063 3300005364 Bacteria 15663
121 Ga0070673_100016514 3300005364 Bacteria 5222
122 Ga0070673_100065776 3300005364 Bacteria 2893
123 Ga0070673_100085573 3300005364 Bacteria 2567
124 Ga0070673_100171499 3300005364 Bacteria 1852
125 Ga0070688_100101796 3300005365 Bacteria 1895
126 Ga0070659_100000130 3300005366 Bacteria 57297
127 Ga0070659_100001810 3300005366 Bacteria 15377
128 Ga0070659_100008449 3300005366 Bacteria 7522
129 Ga0070659_100014953 3300005366 Bacteria 5806
130 Ga0070659_100018269 3300005366 Bacteria 5292
131 Ga0070659_100021513 3300005366 Bacteria 4913
132 Ga0070659_100026493 3300005366 Bacteria 4462
133 Ga0070659_100062453 3300005366 Bacteria 2945
134 Ga0070659_100067120 3300005366 Bacteria 2844
135 Ga0070659_100079324 3300005366 Bacteria 2620
136 Ga0070659_100102031 3300005366 Bacteria 2309
137 Ga0070659_100108648 3300005366 Bacteria 2238
138 Ga0070659_100178603 3300005366 Bacteria 1741
139 Ga0070667_100003053 3300005367 Bacteria 14391
140 Ga0070667_100005534 3300005367 Bacteria 10541
141 Ga0070667_100006585 3300005367 Bacteria 9659
142 Ga0070667_100013020 3300005367 Bacteria 6877
143 Ga0070667_100038109 3300005367 Bacteria 4030
144 Ga0070667_100041342 3300005367 Bacteria 3868
145 Ga0070667_100048401 3300005367 Bacteria 3578
146 Ga0070667_100054326 3300005367 Bacteria 3382
147 Ga0070714_100003359 3300005435 Bacteria 11923
148 Ga0070714_100074805 3300005435 Bacteria 2937
149 Ga0070714_100161949 3300005435 Bacteria 2025
150 Ga0070713_100040393 3300005436 Bacteria 3792
151 Ga0070713_100047209 3300005436 Bacteria 3538
152 Ga0070663_100008585 3300005455 Bacteria 6292
153 Ga0070663_100037527 3300005455 Bacteria 3374
154 Ga0070663_100041415 3300005455 Bacteria 3230
155 Ga0070663_100043604 3300005455 Bacteria 3158
156 Ga0070663_100057862 3300005455 Bacteria 2782
157 Ga0070663_100060925 3300005455 Bacteria 2716
158 Ga0070663_100062641 3300005455 Bacteria 2682
159 Ga0070663_100064503 3300005455 Bacteria 2647
160 Ga0070663_100081994 3300005455 Bacteria 2372
161 Ga0070663_100142114 3300005455 Bacteria 1834
162 Ga0070678_100042277 3300005456 Bacteria 3238
163 Ga0070662_100000160 3300005457 Bacteria 38823
164 Ga0070662_100000791 3300005457 Bacteria 19422
165 Ga0070662_100025856 3300005457 Bacteria 4058
166 Ga0070662_100043449 3300005457 Bacteria 3215
167 Ga0070662_100051769 3300005457 Bacteria 2966
168 Ga0070662_100083689 3300005457 Bacteria 2382
169 Ga0070662_100162235 3300005457 Bacteria 1749
170 Ga0070681_10070931 3300005458 Bacteria 3448
171 Ga0070681_10121331 3300005458 Bacteria 2548
172 Ga0070681_10182163 3300005458 Bacteria 2022
173 Ga0068867_100019255 3300005459 Bacteria 4864
174 Ga0068867_100035014 3300005459 Bacteria 3640
175 Ga0068867_100066743 3300005459 Bacteria 2680
176 Ga0070679_100033290 3300005530 Bacteria 5103
177 Ga0070679_100076651 3300005530 Bacteria 3332
178 Ga0070679_100096117 3300005530 Bacteria 2950
179 Ga0070679_100097853 3300005530 Bacteria 2921
180 Ga0070679_100151062 3300005530 Bacteria 2299
181 Ga0070679_100154318 3300005530 Bacteria 2272
182 Ga0070679_100181645 3300005530 Bacteria 2076
183 Ga0070684_100025589 3300005535 Bacteria 4963
184 Ga0070684_100096940 3300005535 Bacteria 2629
185 Ga0070684_100131069 3300005535 Bacteria 2262
186 Ga0068853_100011197 3300005539 Bacteria 7278
187 Ga0068853_100022898 3300005539 Bacteria 5223
188 Ga0068853_100041076 3300005539 Bacteria 3949
189 Ga0068853_100095643 3300005539 Bacteria 2619
190 Ga0068853_100122905 3300005539 Bacteria 2317
191 Ga0068853_100147465 3300005539 Bacteria 2116
192 Ga0068853_100184508 3300005539 Bacteria 1893
193 Ga0068853_100206195 3300005539 Bacteria 1790
194 Ga0068853_100206700 3300005539 Bacteria 1788
195 Ga0070672_100001615 3300005543 Bacteria 14013
196 Ga0070672_100004572 3300005543 Bacteria 9058
197 Ga0070672_100015356 3300005543 Bacteria 5451
198 Ga0070693_100014585 3300005547 Bacteria 4029
199 Ga0070693_100027831 3300005547 Bacteria 3068
200 Ga0070693_100042766 3300005547 Bacteria 2554
201 Ga0070665_100003821 3300005548 Bacteria 15948
202 Ga0070665_100056225 3300005548 Bacteria 3946
203 Ga0070665_100060385 3300005548 Bacteria 3800
204 Ga0070665_100121565 3300005548 Bacteria 2613
205 Ga0070665_100124986 3300005548 Bacteria 2574
206 Ga0070665_100309480 3300005548 Bacteria 1583
207 Ga0068855_100010267 3300005563 Bacteria 11293
208 Ga0068855_100036275 3300005563 Bacteria 5870
209 Ga0068855_100096999 3300005563 Bacteria 3396
210 Ga0068855_100117795 3300005563 Bacteria 3042
211 Ga0068855_100117851 3300005563 Bacteria 3041
212 Ga0068855_100164884 3300005563 Bacteria 2513
213 Ga0070664_100000071 3300005564 Bacteria 63639
214 Ga0070664_100008115 3300005564 Bacteria 8488
215 Ga0070664_100009149 3300005564 Bacteria 8041
216 Ga0070664_100022418 3300005564 Bacteria 5206
217 Ga0070664_100026326 3300005564 Bacteria 4824
218 Ga0070664_100033243 3300005564 Bacteria 4318
219 Ga0070664_100037864 3300005564 Bacteria 4056
220 Ga0070664_100049452 3300005564 Bacteria 3556
221 Ga0070664_100053114 3300005564 Bacteria 3433
222 Ga0070664_100058397 3300005564 Bacteria 3281
223 Ga0070664_100086612 3300005564 Bacteria 2706
224 Ga0070664_100099162 3300005564 Bacteria 2531
225 Ga0070664_100099959 3300005564 Bacteria 2521
226 Ga0070664_100158412 3300005564 Bacteria 2002
227 Ga0068857_100000629 3300005577 Bacteria 25944
228 Ga0068857_100007035 3300005577 Bacteria 9686
229 Ga0068857_100009986 3300005577 Bacteria 8238
230 Ga0068857_100013483 3300005577 Bacteria 7120
231 Ga0068857_100095217 3300005577 Bacteria 2667
232 Ga0068857_100235672 3300005577 Bacteria 1674
233 Ga0068854_100000566 3300005578 Bacteria 22164
234 Ga0068854_100015105 3300005578 Bacteria 5106
235 Ga0068854_100025023 3300005578 Bacteria 4095
236 Ga0068854_100027488 3300005578 Bacteria 3921
237 Ga0068854_100057407 3300005578 Bacteria 2808
238 Ga0068854_100064030 3300005578 Bacteria 2670
239 Ga0068854_100134272 3300005578 Bacteria 1893
240 Ga0068856_100000244 3300005614 Bacteria 59255
241 Ga0068856_100031319 3300005614 Bacteria 5203
242 Ga0068856_100138145 3300005614 Bacteria 2443
243 Ga0068852_100013695 3300005616 Bacteria 6214
244 Ga0068852_100017049 3300005616 Bacteria 5688
245 Ga0068852_100020136 3300005616 Bacteria 5300
246 Ga0068852_100061475 3300005616 Bacteria 3264
247 Ga0068852_100070572 3300005616 Bacteria 3065
248 Ga0068852_100092393 3300005616 Bacteria 2710
249 Ga0068852_100104543 3300005616 Bacteria 2563
250 Ga0068852_100106621 3300005616 Bacteria 2540
251 Ga0068852_100277571 3300005616 Bacteria 1614
252 Ga0068859_100000144 3300005617 Bacteria 67220
253 Ga0068859_100021983 3300005617 Bacteria 6396
254 Ga0068859_100042532 3300005617 Bacteria 4564
255 Ga0068859_100099288 3300005617 Bacteria 2966
256 Ga0068859_100102833 3300005617 Bacteria 2915
257 Ga0068859_100111578 3300005617 Bacteria 2797
258 Ga0068859_100123688 3300005617 Bacteria 2654
259 Ga0068864_100000092 3300005618 Bacteria 94499
260 Ga0068864_100000640 3300005618 Bacteria 29418
261 Ga0068864_100007306 3300005618 Bacteria 9088
262 Ga0068864_100023488 3300005618 Bacteria 5178
263 Ga0068864_100067655 3300005618 Bacteria 3102
264 Ga0068861_100023585 3300005719 Bacteria 4439
265 Ga0068851_10017273 3300005834 Bacteria 3464
266 Ga0068851_10025848 3300005834 Bacteria 2882
267 Ga0068851_10026439 3300005834 Bacteria 2851
268 Ga0068851_10071048 3300005834 Bacteria 1801
269 Ga0068863_100000961 3300005841 Bacteria 28951
270 Ga0068863_100010618 3300005841 Bacteria 8941
271 Ga0068863_100010774 3300005841 Bacteria 8869
272 Ga0068863_100019069 3300005841 Bacteria 6566
273 Ga0068863_100079423 3300005841 Bacteria 3107
274 Ga0068863_100134525 3300005841 Bacteria 2362
275 Ga0068858_100000256 3300005842 Bacteria 56844
276 Ga0068858_100000807 3300005842 Bacteria 32790
277 Ga0068858_100000868 3300005842 Bacteria 31246
278 Ga0068858_100116666 3300005842 Bacteria 2495
279 Ga0068858_100117592 3300005842 Bacteria 2485
280 Ga0068860_100002210 3300005843 Bacteria 20478
281 Ga0068860_100018286 3300005843 Bacteria 6821
282 Ga0068860_100035628 3300005843 Bacteria 4772
283 Ga0068860_100077623 3300005843 Bacteria 3158
284 Ga0068860_100099343 3300005843 Bacteria 2776
285 Ga0068860_100210756 3300005843 Bacteria 1885
286 Ga0068862_100007980 3300005844 Bacteria 8758
287 Ga0068862_100065055 3300005844 Bacteria 3140
288 Ga0068862_100077921 3300005844 Bacteria 2871
289 Ga0068862_100128472 3300005844 Bacteria 2240
290 Ga0068862_100288472 3300005844 Bacteria 1506
291 Ga0068862_100303493 3300005844 Bacteria 1469
292 Ga0081539_10014892 3300005985 Bacteria 5706
293 Ga0070717_10009044 3300006028 Bacteria 7476
294 Ga0075362_10061255 3300006177 Bacteria 1703
295 Ga0097621_100085720 3300006237 Bacteria 2627
296 Ga0068871_100063657 3300006358 Bacteria 3017
297 Ga0075430_100019731 3300006846 Bacteria 5736
298 Ga0068865_100088973 3300006881 Bacteria 2235
299 Ga0068865_100143270 3300006881 Bacteria 1804
300 Ga0097620_100000144 3300006931 Bacteria 67220
301 Ga0097620_100021982 3300006931 Bacteria 6396
302 Ga0097620_100042532 3300006931 Bacteria 4564
303 Ga0097620_100099297 3300006931 Bacteria 2966
304 Ga0097620_100102834 3300006931 Bacteria 2915
305 Ga0097620_100111585 3300006931 Bacteria 2797
306 Ga0097620_100123686 3300006931 Bacteria 2654
307 Ga0105240_10033441 3300009093 Bacteria 6643
308 Ga0105240_10048404 3300009093 Bacteria 5373
309 Ga0105240_10183456 3300009093 Bacteria 2468
310 Ga0105240_10297031 3300009093 Bacteria 1849
311 Ga0105245_10001063 3300009098 Bacteria 24872
312 Ga0105245_10083757 3300009098 Bacteria 2920
313 Ga0105243_10029513 3300009148 Bacteria 4218
314 Ga0105242_10115572 3300009176 Bacteria 2294
315 Ga0105242_10139980 3300009176 Bacteria 2099
316 Ga0105248_10000426 3300009177 Bacteria 47826
317 Ga0105248_10001078 3300009177 Bacteria 30151
318 Ga0105248_10001711 3300009177 Bacteria 24398
319 Ga0105248_10001764 3300009177 Bacteria 24053
320 Ga0105248_10011840 3300009177 Bacteria 9621
321 Ga0105248_10041684 3300009177 Bacteria 5147
322 Ga0105248_10045947 3300009177 Bacteria 4896
323 Ga0105248_10050550 3300009177 Bacteria 4663
324 Ga0105248_10056967 3300009177 Bacteria 4385
325 Ga0105248_10063194 3300009177 Bacteria 4156
326 Ga0105248_10428901 3300009177 Bacteria 1489
327 Ga0105237_10020107 3300009545 Bacteria 6891
328 Ga0105238_10007040 3300009551 Bacteria 11246
329 Ga0105238_10035914 3300009551 Bacteria 5038
330 Ga0105238_10054991 3300009551 Bacteria 3996
331 Ga0105238_10086230 3300009551 Bacteria 3127
332 Ga0105238_10120731 3300009551 Bacteria 2600
333 Ga0105249_10020107 3300009553 Bacteria 5965
334 Ga0105249_10060485 3300009553 Bacteria 3475
335 Ga0105239_10023683 3300010375 Bacteria 6759
336 Ga0105246_10027504 3300011119 Bacteria 3727
337 Ga0157373_10018593 3300013100 Bacteria 5057
338 Ga0157373_10021902 3300013100 Bacteria 4637
339 Ga0157373_10022163 3300013100 Bacteria 4609
340 Ga0157373_10034589 3300013100 Bacteria 3629
341 Ga0157373_10048681 3300013100 Bacteria 3022
342 Ga0157373_10070428 3300013100 Bacteria 2471
343 Ga0157371_10005491 3300013102 Bacteria 10678
344 Ga0157371_10011762 3300013102 Bacteria 6723
345 Ga0157371_10025406 3300013102 Bacteria 4317
346 Ga0157371_10034508 3300013102 Bacteria 3628
347 Ga0157371_10059420 3300013102 Bacteria 2710
348 Ga0157371_10075190 3300013102 Bacteria 2392
349 Ga0157371_10112643 3300013102 Bacteria 1931
350 Ga0157370_10027926 3300013104 Bacteria 5559
351 Ga0157370_10032805 3300013104 Bacteria 5069
352 Ga0157370_10079020 3300013104 Bacteria 3098
353 Ga0157370_10107856 3300013104 Bacteria 2604
354 Ga0157370_10109702 3300013104 Bacteria 2580
355 Ga0157370_10135791 3300013104 Bacteria 2293
356 Ga0157370_10190775 3300013104 Bacteria 1902
357 Ga0157370_10203806 3300013104 Bacteria 1835
358 Ga0157369_10001556 3300013105 Bacteria 28075
359 Ga0157369_10058776 3300013105 Bacteria 4147
360 Ga0157369_10103649 3300013105 Bacteria 3030
361 Ga0157369_10110105 3300013105 Bacteria 2928
362 Ga0157369_10170428 3300013105 Bacteria 2294
363 Ga0157369_10220389 3300013105 Bacteria 1986
364 Ga0157369_10262469 3300013105 Bacteria 1801
365 Ga0157374_10046951 3300013296 Bacteria 4001
366 Ga0157374_10047554 3300013296 Bacteria 3978
367 Ga0157374_10126702 3300013296 Bacteria 2468
368 Ga0157378_10000428 3300013297 Bacteria 41097
369 Ga0163162_10041368 3300013306 Bacteria 4611
370 Ga0163162_10062784 3300013306 Bacteria 3756
371 Ga0157372_10018199 3300013307 Bacteria 7552
372 Ga0157372_10028971 3300013307 Bacteria 6041
373 Ga0157372_10115737 3300013307 Bacteria 3074
374 Ga0157372_10157486 3300013307 Bacteria 2624
375 Ga0157372_10178975 3300013307 Bacteria 2455
376 Ga0157372_10338610 3300013307 Bacteria 1752
377 Ga0157375_10024798 3300013308 Bacteria 5558
378 Ga0157375_10033754 3300013308 Bacteria 4867
379 Ga0157375_10038707 3300013308 Bacteria 4581
380 Ga0157375_10056513 3300013308 Bacteria 3875
381 Ga0157375_10149032 3300013308 Bacteria 2473
382 Ga0157375_10203010 3300013308 Bacteria 2138
383 Ga0163163_10000080 3300014325 Bacteria 106006
384 Ga0163163_10000525 3300014325 Bacteria 34194
385 Ga0163163_10079198 3300014325 Bacteria 3284
386 Ga0157380_10007774 3300014326 Bacteria 7630
387 Ga0157380_10068622 3300014326 Bacteria 2858
388 Ga0157379_10154824 3300014968 Bacteria 2067
389 Ga0157379_10210957 3300014968 Bacteria 1758
390 Ga0157376_10062651 3300014969 Bacteria 3130
391 Ga0163161_10024344 3300017792 Bacteria 4276
392 Ga0213875_10003887 3300021388 Bacteria 8358
393 Ga0207673_1001638 3300025290 Bacteria 2472
394 Ga0207697_10000142 3300025315 Bacteria 34778
395 Ga0207697_10007662 3300025315 Bacteria 4791
396 Ga0207697_10007663 3300025315 Bacteria 4790
397 Ga0207656_10002364 3300025321 Bacteria 6333
398 Ga0207656_10011408 3300025321 Bacteria 3357
399 Ga0207682_10004466 3300025893 Bacteria 5846
400 Ga0207682_10007745 3300025893 Bacteria 4268
401 Ga0207688_10000182 3300025901 Bacteria 27994
402 Ga0207688_10001568 3300025901 Bacteria 12059
403 Ga0207688_10033414 3300025901 Bacteria 2845
404 Ga0207680_10000196 3300025903 Bacteria 29133
405 Ga0207680_10000873 3300025903 Bacteria 14233
406 Ga0207680_10014323 3300025903 Bacteria 4099
407 Ga0207680_10063267 3300025903 Bacteria 2264
408 Ga0207647_10000294 3300025904 Bacteria 40983
409 Ga0207647_10006164 3300025904 Bacteria 8734
410 Ga0207647_10008015 3300025904 Bacteria 7596
411 Ga0207647_10015959 3300025904 Bacteria 5134
412 Ga0207647_10017083 3300025904 Bacteria 4939
413 Ga0207647_10025743 3300025904 Bacteria 3859
414 Ga0207647_10026263 3300025904 Bacteria 3812
415 Ga0207647_10029040 3300025904 Bacteria 3583
416 Ga0207647_10035794 3300025904 Bacteria 3160
417 Ga0207647_10038568 3300025904 Bacteria 3019
418 Ga0207647_10049995 3300025904 Bacteria 2591
419 Ga0207699_10099610 3300025906 Bacteria 1841
420 Ga0207645_10004615 3300025907 Bacteria 10151
421 Ga0207645_10010396 3300025907 Bacteria 6389
422 Ga0207645_10013688 3300025907 Bacteria 5454
423 Ga0207643_10034459 3300025908 Bacteria 2836
424 Ga0207705_10000370 3300025909 Bacteria 40613
425 Ga0207705_10001862 3300025909 Bacteria 16557
426 Ga0207705_10003624 3300025909 Bacteria 11765
427 Ga0207705_10011429 3300025909 Bacteria 6425
428 Ga0207705_10014426 3300025909 Bacteria 5687
429 Ga0207705_10016646 3300025909 Bacteria 5266
430 Ga0207705_10044562 3300025909 Bacteria 3188
431 Ga0207705_10046481 3300025909 Bacteria 3120
432 Ga0207705_10056676 3300025909 Bacteria 2826
433 Ga0207705_10090984 3300025909 Bacteria 2234
434 Ga0207705_10114597 3300025909 Bacteria 1994
435 Ga0207705_10156058 3300025909 Bacteria 1712
436 Ga0207654_10055976 3300025911 Bacteria 2286
437 Ga0207707_10013639 3300025912 Bacteria 7088
438 Ga0207707_10081264 3300025912 Bacteria 2829
439 Ga0207707_10101893 3300025912 Bacteria 2509
440 Ga0207707_10121716 3300025912 Bacteria 2281
441 Ga0207695_10025823 3300025913 Bacteria 6567
442 Ga0207695_10180314 3300025913 Bacteria 2033
443 Ga0207671_10017612 3300025914 Bacteria 5501
444 Ga0207660_10002715 3300025917 Bacteria 11597
445 Ga0207660_10007644 3300025917 Bacteria 6999
446 Ga0207660_10015108 3300025917 Bacteria 5091
447 Ga0207660_10028558 3300025917 Bacteria 3816
448 Ga0207660_10031720 3300025917 Bacteria 3642
449 Ga0207660_10072949 3300025917 Bacteria 2501
450 Ga0207660_10118637 3300025917 Bacteria 2001
451 Ga0207660_10127874 3300025917 Bacteria 1931
452 Ga0207662_10041144 3300025918 Bacteria 2720
453 Ga0207657_10001830 3300025919 Bacteria 22956
454 Ga0207657_10002767 3300025919 Bacteria 18879
455 Ga0207657_10004043 3300025919 Bacteria 15582
456 Ga0207657_10012843 3300025919 Bacteria 8240
457 Ga0207657_10019223 3300025919 Bacteria 6494
458 Ga0207657_10024207 3300025919 Bacteria 5633
459 Ga0207657_10025926 3300025919 Bacteria 5397
460 Ga0207657_10031107 3300025919 Bacteria 4839
461 Ga0207657_10032378 3300025919 Bacteria 4724
462 Ga0207657_10033186 3300025919 Bacteria 4655
463 Ga0207657_10033423 3300025919 Bacteria 4636
464 Ga0207657_10042051 3300025919 Bacteria 4036
465 Ga0207657_10042529 3300025919 Bacteria 4008
466 Ga0207657_10065180 3300025919 Bacteria 3106
467 Ga0207657_10107604 3300025919 Bacteria 2306
468 Ga0207657_10128729 3300025919 Bacteria 2077
469 Ga0207657_10169039 3300025919 Bacteria 1772
470 Ga0207649_10002897 3300025920 Bacteria 9442
471 Ga0207649_10004645 3300025920 Bacteria 7435
472 Ga0207649_10005211 3300025920 Bacteria 7021
473 Ga0207649_10025171 3300025920 Bacteria 3467
474 Ga0207649_10034488 3300025920 Bacteria 3032
475 Ga0207649_10039283 3300025920 Bacteria 2869
476 Ga0207649_10043150 3300025920 Bacteria 2755
477 Ga0207649_10078286 3300025920 Bacteria 2133
478 Ga0207652_10010201 3300025921 Bacteria 7563
479 Ga0207652_10010204 3300025921 Bacteria 7560
480 Ga0207652_10102044 3300025921 Bacteria 2535
481 Ga0207652_10217977 3300025921 Bacteria 1719
482 Ga0207681_10004789 3300025923 Bacteria 8321
483 Ga0207681_10006664 3300025923 Bacteria 7092
484 Ga0207681_10022992 3300025923 Bacteria 3981
485 Ga0207681_10023575 3300025923 Bacteria 3939
486 Ga0207681_10045977 3300025923 Bacteria 2934
487 Ga0207681_10086923 3300025923 Bacteria 2223
488 Ga0207681_10091732 3300025923 Bacteria 2171
489 Ga0207681_10100935 3300025923 Bacteria 2081
490 Ga0207694_10000461 3300025924 Bacteria 37822
491 Ga0207694_10029950 3300025924 Bacteria 4156
492 Ga0207694_10055084 3300025924 Bacteria 3087
493 Ga0207650_10001007 3300025925 Bacteria 21201
494 Ga0207650_10009749 3300025925 Bacteria 6569
495 Ga0207650_10013994 3300025925 Bacteria 5570
496 Ga0207650_10019673 3300025925 Bacteria 4747
497 Ga0207650_10043922 3300025925 Bacteria 3283
498 Ga0207650_10060984 3300025925 Bacteria 2815
499 Ga0207650_10067521 3300025925 Bacteria 2683
500 Ga0207650_10108052 3300025925 Bacteria 2150
501 Ga0207659_10009510 3300025926 Bacteria 6079
502 Ga0207659_10018210 3300025926 Bacteria 4601
503 Ga0207687_10010281 3300025927 Bacteria 6114
504 Ga0207687_10094731 3300025927 Bacteria 2186
505 Ga0207700_10084231 3300025928 Bacteria 2491
506 Ga0207664_10047524 3300025929 Bacteria 3372
507 Ga0207664_10100848 3300025929 Bacteria 2384
508 Ga0207644_10000837 3300025931 Bacteria 19551
509 Ga0207644_10004381 3300025931 Bacteria 9162
510 Ga0207644_10007927 3300025931 Bacteria 6945
511 Ga0207644_10010916 3300025931 Bacteria 6000
512 Ga0207644_10015341 3300025931 Bacteria 5140
513 Ga0207644_10024321 3300025931 Bacteria 4156
514 Ga0207644_10051474 3300025931 Bacteria 2956
515 Ga0207644_10052802 3300025931 Bacteria 2922
516 Ga0207644_10075320 3300025931 Bacteria 2480
517 Ga0207644_10083030 3300025931 Bacteria 2371
518 Ga0207644_10098248 3300025931 Bacteria 2194
519 Ga0207644_10160142 3300025931 Bacteria 1749
520 Ga0207690_10000204 3300025932 Bacteria 46363
521 Ga0207690_10001584 3300025932 Bacteria 14220
522 Ga0207690_10004211 3300025932 Bacteria 8500
523 Ga0207690_10006215 3300025932 Bacteria 7072
524 Ga0207690_10009381 3300025932 Bacteria 5811
525 Ga0207690_10012755 3300025932 Bacteria 5036
526 Ga0207690_10019992 3300025932 Bacteria 4130
527 Ga0207690_10020093 3300025932 Bacteria 4121
528 Ga0207690_10023015 3300025932 Bacteria 3883
529 Ga0207690_10056500 3300025932 Bacteria 2648
530 Ga0207690_10056573 3300025932 Bacteria 2646
531 Ga0207690_10091995 3300025932 Bacteria 2145
532 Ga0207690_10126603 3300025932 Bacteria 1863
533 Ga0207690_10145432 3300025932 Bacteria 1752
534 Ga0207690_10146342 3300025932 Bacteria 1747
535 Ga0207706_10007111 3300025933 Bacteria 10356
536 Ga0207706_10007479 3300025933 Bacteria 10100
537 Ga0207706_10017598 3300025933 Bacteria 6439
538 Ga0207706_10025064 3300025933 Bacteria 5346
539 Ga0207706_10033267 3300025933 Bacteria 4590
540 Ga0207706_10038927 3300025933 Bacteria 4217
541 Ga0207706_10044812 3300025933 Bacteria 3919
542 Ga0207706_10061963 3300025933 Bacteria 3295
543 Ga0207706_10074649 3300025933 Bacteria 2982
544 Ga0207706_10077258 3300025933 Bacteria 2928
545 Ga0207706_10099628 3300025933 Bacteria 2557
546 Ga0207709_10021743 3300025935 Bacteria 3633
547 Ga0207669_10053825 3300025937 Bacteria 2427
548 Ga0207669_10054351 3300025937 Bacteria 2418
549 Ga0207669_10055158 3300025937 Bacteria 2405
550 Ga0207704_10010542 3300025938 Bacteria 4514
551 Ga0207704_10039152 3300025938 Bacteria 2757
552 Ga0207704_10046912 3300025938 Bacteria 2579
553 Ga0207691_10001140 3300025940 Bacteria 26349
554 Ga0207691_10002983 3300025940 Bacteria 16515
555 Ga0207691_10017580 3300025940 Bacteria 6777
556 Ga0207691_10057800 3300025940 Bacteria 3529
557 Ga0207691_10080102 3300025940 Bacteria 2938
558 Ga0207691_10105845 3300025940 Bacteria 2506
559 Ga0207711_10000187 3300025941 Bacteria 66307
560 Ga0207711_10002993 3300025941 Bacteria 14766
561 Ga0207711_10005888 3300025941 Bacteria 10351
562 Ga0207711_10009230 3300025941 Bacteria 8237
563 Ga0207711_10010893 3300025941 Bacteria 7558
564 Ga0207711_10030930 3300025941 Bacteria 4516
565 Ga0207711_10044200 3300025941 Bacteria 3802
566 Ga0207711_10045766 3300025941 Bacteria 3739
567 Ga0207711_10067015 3300025941 Bacteria 3106
568 Ga0207689_10000125 3300025942 Bacteria 64633
569 Ga0207689_10015549 3300025942 Bacteria 6445
570 Ga0207689_10056278 3300025942 Bacteria 3236
571 Ga0207689_10057790 3300025942 Bacteria 3190
572 Ga0207661_10004338 3300025944 Bacteria 9928
573 Ga0207661_10037974 3300025944 Bacteria 3771
574 Ga0207661_10104218 3300025944 Bacteria 2388
575 Ga0207679_10000166 3300025945 Bacteria 54528
576 Ga0207679_10001651 3300025945 Bacteria 13919
577 Ga0207679_10002092 3300025945 Bacteria 12395
578 Ga0207679_10002783 3300025945 Bacteria 10827
579 Ga0207679_10017942 3300025945 Bacteria 4730
580 Ga0207679_10033765 3300025945 Bacteria 3603
581 Ga0207679_10088255 3300025945 Bacteria 2390
582 Ga0207679_10116240 3300025945 Bacteria 2121
583 Ga0207679_10116777 3300025945 Bacteria 2116
584 Ga0207679_10127640 3300025945 Bacteria 2035
585 Ga0207679_10142708 3300025945 Bacteria 1938
586 Ga0207667_10005497 3300025949 Bacteria 15452
587 Ga0207667_10021599 3300025949 Bacteria 7131
588 Ga0207667_10033149 3300025949 Bacteria 5557
589 Ga0207667_10035258 3300025949 Bacteria 5367
590 Ga0207667_10115135 3300025949 Bacteria 2771
591 Ga0207667_10116080 3300025949 Bacteria 2759
592 Ga0207667_10161970 3300025949 Bacteria 2301
593 Ga0207667_10255237 3300025949 Bacteria 1793
594 Ga0207651_10003369 3300025960 Bacteria 7843
595 Ga0207651_10010063 3300025960 Bacteria 5219
596 Ga0207651_10020825 3300025960 Bacteria 3968
597 Ga0207651_10032289 3300025960 Bacteria 3361
598 Ga0207651_10035964 3300025960 Bacteria 3227
599 Ga0207651_10087773 3300025960 Bacteria 2265
600 Ga0207712_10000946 3300025961 Bacteria 20945
601 Ga0207712_10010974 3300025961 Bacteria 5765
602 Ga0207712_10043607 3300025961 Bacteria 3095
603 Ga0207668_10000062 3300025972 Bacteria 88123
604 Ga0207668_10016581 3300025972 Bacteria 4599
605 Ga0207668_10067701 3300025972 Bacteria 2536
606 Ga0207668_10101244 3300025972 Bacteria 2141
607 Ga0207640_10016082 3300025981 Bacteria 4344
608 Ga0207640_10018609 3300025981 Bacteria 4085
609 Ga0207640_10037558 3300025981 Bacteria 3048
610 Ga0207640_10043048 3300025981 Bacteria 2883
611 Ga0207640_10072846 3300025981 Bacteria 2319
612 Ga0207640_10088721 3300025981 Bacteria 2136
613 Ga0207640_10151631 3300025981 Bacteria 1704
614 Ga0207658_10001984 3300025986 Bacteria 15265
615 Ga0207658_10008217 3300025986 Bacteria 7112
616 Ga0207658_10009769 3300025986 Bacteria 6516
617 Ga0207658_10012727 3300025986 Bacteria 5746
618 Ga0207658_10031998 3300025986 Bacteria 3740
619 Ga0207658_10034655 3300025986 Bacteria 3609
620 Ga0207658_10058639 3300025986 Bacteria 2865
621 Ga0207658_10083908 3300025986 Bacteria 2450
622 Ga0207658_10095577 3300025986 Bacteria 2315
623 Ga0207658_10166559 3300025986 Bacteria 1811
624 Ga0207677_10001503 3300026023 Bacteria 12317
625 Ga0207677_10004590 3300026023 Bacteria 7428
626 Ga0207703_10000896 3300026035 Bacteria 29159
627 Ga0207703_10002564 3300026035 Bacteria 15695
628 Ga0207703_10002653 3300026035 Bacteria 15406
629 Ga0207703_10012165 3300026035 Bacteria 6707
630 Ga0207703_10039236 3300026035 Bacteria 3783
631 Ga0207703_10040692 3300026035 Bacteria 3721
632 Ga0207639_10001839 3300026041 Bacteria 14287
633 Ga0207639_10014865 3300026041 Bacteria 5482
634 Ga0207639_10053894 3300026041 Bacteria 3071
635 Ga0207639_10184158 3300026041 Bacteria 1779
636 Ga0207678_10006779 3300026067 Bacteria 10152
637 Ga0207678_10006903 3300026067 Bacteria 10074
638 Ga0207678_10015930 3300026067 Bacteria 6602
639 Ga0207678_10018455 3300026067 Bacteria 6126
640 Ga0207678_10020990 3300026067 Bacteria 5724
641 Ga0207678_10039437 3300026067 Bacteria 4099
642 Ga0207678_10044509 3300026067 Bacteria 3839
643 Ga0207678_10048055 3300026067 Bacteria 3689
644 Ga0207678_10048905 3300026067 Bacteria 3654
645 Ga0207678_10070816 3300026067 Bacteria 2990
646 Ga0207678_10078635 3300026067 Bacteria 2824
647 Ga0207702_10000929 3300026078 Bacteria 30182
648 Ga0207702_10006703 3300026078 Bacteria 9895
649 Ga0207702_10025143 3300026078 Bacteria 4941
650 Ga0207702_10107475 3300026078 Bacteria 2474
651 Ga0207702_10132294 3300026078 Bacteria 2246
652 Ga0207641_10000175 3300026088 Bacteria 89110
653 Ga0207641_10011733 3300026088 Bacteria 7196
654 Ga0207641_10014405 3300026088 Bacteria 6480
655 Ga0207641_10020078 3300026088 Bacteria 5485
656 Ga0207641_10025040 3300026088 Bacteria 4920
657 Ga0207641_10205532 3300026088 Bacteria 1818
658 Ga0207648_10000530 3300026089 Bacteria 42624
659 Ga0207648_10012067 3300026089 Bacteria 8103
660 Ga0207648_10015750 3300026089 Bacteria 6936
661 Ga0207648_10036081 3300026089 Bacteria 4356
662 Ga0207648_10102110 3300026089 Bacteria 2513
663 Ga0207648_10145621 3300026089 Bacteria 2089
664 Ga0207676_10000138 3300026095 Bacteria 63283
665 Ga0207676_10001416 3300026095 Bacteria 17820
666 Ga0207676_10001454 3300026095 Bacteria 17618
667 Ga0207676_10002023 3300026095 Bacteria 14746
668 Ga0207676_10012983 3300026095 Bacteria 5980
669 Ga0207676_10043622 3300026095 Bacteria 3455
670 Ga0207676_10099177 3300026095 Bacteria 2410
671 Ga0207674_10000319 3300026116 Bacteria 61196
672 Ga0207674_10001746 3300026116 Bacteria 27810
673 Ga0207674_10002804 3300026116 Bacteria 21698
674 Ga0207674_10008360 3300026116 Bacteria 11971
675 Ga0207674_10016671 3300026116 Bacteria 8030
676 Ga0207674_10026921 3300026116 Bacteria 6098
677 Ga0207674_10039961 3300026116 Bacteria 4861
678 Ga0207674_10041149 3300026116 Bacteria 4780
679 Ga0207674_10045573 3300026116 Bacteria 4509
680 Ga0207674_10052504 3300026116 Bacteria 4157
681 Ga0207674_10071239 3300026116 Bacteria 3493
682 Ga0207674_10087529 3300026116 Bacteria 3108
683 Ga0207674_10236677 3300026116 Bacteria 1773
684 Ga0207675_100005093 3300026118 Bacteria 12647
685 Ga0207683_10011160 3300026121 Bacteria 7658
686 Ga0207683_10016043 3300026121 Bacteria 6375
687 Ga0207683_10028776 3300026121 Bacteria 4807
688 Ga0207683_10049750 3300026121 Bacteria 3670
689 Ga0207683_10078464 3300026121 Bacteria 2926
690 Ga0207698_10000668 3300026142 Bacteria 19894
691 Ga0207698_10010239 3300026142 Bacteria 6012
692 Ga0207698_10015791 3300026142 Bacteria 5071
693 Ga0207698_10034578 3300026142 Bacteria 3685
694 Ga0207698_10039321 3300026142 Bacteria 3503
695 Ga0207698_10044787 3300026142 Bacteria 3328
696 Ga0207698_10282325 3300026142 Bacteria 1536
697 Ga0209974_10008942 3300027876 Bacteria 3410
698 Ga0268266_10000437 3300028379 Bacteria 62490
699 Ga0268266_10035478 3300028379 Bacteria 4242
700 Ga0268266_10045846 3300028379 Bacteria 3742
701 Ga0268266_10047516 3300028379 Bacteria 3678
702 Ga0268265_10020704 3300028380 Bacteria 4595
703 Ga0268265_10027389 3300028380 Bacteria 4067
704 Ga0268265_10039196 3300028380 Bacteria 3490
705 Ga0268265_10060116 3300028380 Bacteria 2911
706 Ga0268265_10088263 3300028380 Bacteria 2470
707 Ga0268264_10001379 3300028381 Bacteria 22755
708 Ga0268264_10019893 3300028381 Bacteria 5486
709 Ga0268264_10171312 3300028381 Bacteria 1963
710 Ga0307408_100001902 3300031548 Bacteria 15178
711 Ga0307408_100041839 3300031548 Bacteria 3250
712 Ga0307408_100056947 3300031548 Bacteria 2836
713 Ga0307408_100174170 3300031548 Bacteria 1720
714 Ga0307405_10058450 3300031731 Bacteria 2426
715 Ga0307405_10073862 3300031731 Bacteria 2203
716 Ga0307413_10002745 3300031824 Bacteria 7235
717 Ga0307413_10010006 3300031824 Bacteria 4572
718 Ga0307413_10016567 3300031824 Bacteria 3811
719 Ga0307413_10047191 3300031824 Bacteria 2567
720 Ga0307410_10005019 3300031852 Bacteria 6946
721 Ga0307410_10025507 3300031852 Unclassified 3710
722 Ga0307410_10036151 3300031852 Bacteria 3213
723 Ga0307410_10040680 3300031852 Bacteria 3060
724 Ga0307406_10004957 3300031901 Bacteria 7253
725 Ga0307407_10011316 3300031903 Bacteria 4242
726 Ga0307407_10033272 3300031903 Bacteria 2811
727 Ga0307412_10025749 3300031911 Bacteria 3647
728 Ga0307412_10047555 3300031911 Bacteria 2818
729 Ga0307412_10108969 3300031911 Bacteria 1973
730 Ga0307409_100000240 3300031995 Bacteria 22082
731 Ga0307409_100029132 3300031995 Unclassified 3946
732 Ga0307409_100051167 3300031995 Bacteria 3159
733 Ga0307409_100055425 3300031995 Bacteria 3060
734 Ga0307409_100091875 3300031995 Bacteria 2489
735 Ga0307409_100105994 3300031995 Bacteria 2345
736 Ga0307409_100236006 3300031995 Bacteria 1661
737 Ga0307416_100006874 3300032002 Bacteria 7161
738 Ga0307416_100007135 3300032002 Bacteria 7065
739 Ga0307416_100008363 3300032002 Bacteria 6668
740 Ga0307416_100035944 3300032002 Bacteria 3791
741 Ga0307416_100063504 3300032002 Bacteria 3024
742 Ga0307414_10008198 3300032004 Bacteria 5910
743 Ga0307414_10027145 3300032004 Bacteria 3696
744 Ga0307414_10047030 3300032004 Bacteria 2966
745 Ga0307414_10064160 3300032004 Bacteria 2613
746 Ga0307414_10092997 3300032004 Bacteria 2246
747 Ga0307411_10009618 3300032005 Bacteria 5098
748 Ga0307411_10014397 3300032005 Bacteria 4398
749 Ga0307411_10021189 3300032005 Bacteria 3797
750 Ga0307411_10081766 3300032005 Bacteria 2225
751 Ga0307415_100003753 3300032126 Bacteria 7785
752 Ga0307415_100014949 3300032126 Bacteria 4580
753 Ga0373923_0012901 3300035111 Bacteria 3103
754 Ga0373954_0010309 3300035118 Bacteria 4123
755 Ga0373960_0029208 3300035121 Bacteria 1527
756 Ga0373955_0034557 3300035172 Bacteria 2671
757 Ga0373937_0010114 3300036401 Bacteria 8227
758 Ga0395899_0000112 3300037312 Bacteria 138389
759 Ga0395899_0000684 3300037312 Bacteria 34177
760 Ga0395899_0001082 3300037312 Bacteria 24549
761 Ga0395899_0004386 3300037312 Bacteria 10998
762 Ga0395899_0004471 3300037312 Bacteria 10902
763 Ga0395899_0005327 3300037312 Bacteria 9990
764 Ga0395899_0028176 3300037312 Bacteria 4229
765 Ga0395899_0063456 3300037312 Bacteria 2718
766 Ga0395900_0000614 3300037418 Bacteria 48329
767 Ga0395900_0000881 3300037418 Bacteria 39365
768 Ga0395900_0000956 3300037418 Bacteria 37678
769 Ga0395900_0002587 3300037418 Bacteria 19792
770 Ga0395900_0002783 3300037418 Bacteria 19124
771 Ga0395900_0010639 3300037418 Bacteria 9409
772 Ga0395900_0016220 3300037418 Bacteria 7589
773 Ga0395900_0023088 3300037418 Bacteria 6365
774 Ga0395900_0037343 3300037418 Bacteria 5009
775 Ga0395900_0038886 3300037418 Bacteria 4904
776 Ga0395900_0041351 3300037418 Bacteria 4752
777 Ga0395900_0054526 3300037418 Bacteria 4116
778 Ga0395900_0068706 3300037418 Bacteria 3641
779 Ga0395900_0072933 3300037418 Bacteria 3529
780 Ga0395900_0074954 3300037418 Bacteria 3478
781 Ga0395900_0082813 3300037418 Bacteria 3296
782 Ga0395900_0139906 3300037418 Bacteria 2479
783 Ga0395900_0148539 3300037418 Bacteria 2395
784 Ga0395900_0165876 3300037418 Bacteria 2251
785 Ga0395900_0180264 3300037418 Bacteria 2147
786 Ga0395898_0000856 3300037466 Bacteria 49957
787 Ga0395898_0002116 3300037466 Bacteria 24521
788 Ga0395898_0008085 3300037466 Bacteria 11138
789 Ga0395898_0010122 3300037466 Bacteria 9870
790 Ga0395898_0018829 3300037466 Bacteria 7034
791 Ga0395898_0025970 3300037466 Bacteria 5898
792 Ga0395898_0039675 3300037466 Bacteria 4659
793 Ga0395898_0076763 3300037466 Bacteria 3225
794 Ga0395898_0156065 3300037466 Bacteria 2183
795 Ga0395898_0178440 3300037466 Bacteria 2030
796 Ga0395898_0203140 3300037466 Bacteria 1891
797 Ga0395905_0000089 3300037471 Bacteria 152196
798 Ga0395905_0000412 3300037471 Bacteria 60157
799 Ga0395905_0000756 3300037471 Bacteria 42590
800 Ga0395905_0000932 3300037471 Bacteria 37741
801 Ga0395905_0000956 3300037471 Bacteria 37067
802 Ga0395905_0001837 3300037471 Bacteria 24538
803 Ga0395905_0001957 3300037471 Bacteria 23573
804 Ga0395905_0010449 3300037471 Bacteria 9032
805 Ga0395905_0020569 3300037471 Bacteria 6249
806 Ga0395905_0021843 3300037471 Bacteria 6053
807 Ga0395905_0022405 3300037471 Bacteria 5975
808 Ga0395905_0037670 3300037471 Bacteria 4539
809 Ga0395905_0054043 3300037471 Bacteria 3758
810 Ga0395905_0057368 3300037471 Bacteria 3642
811 Ga0395905_0063749 3300037471 Bacteria 3448
812 Ga0395905_0068136 3300037471 Bacteria 3333
813 Ga0395905_0090219 3300037471 Bacteria 2873
814 Ga0395905_0095504 3300037471 Bacteria 2790
815 Ga0395905_0113291 3300037471 Bacteria 2548
816 Ga0395905_0115825 3300037471 Bacteria 2518
817 Ga0395905_0128362 3300037471 Bacteria 2385
818 Ga0395905_0147147 3300037471 Bacteria 2216
819 Ga0395905_0169395 3300037471 Bacteria 2051
820 Ga0395905_0198234 3300037471 Bacteria 1882
821 Ga0395905_0258351 3300037471 Bacteria 1626
822 Ga0436364_1084342 3300037853 Bacteria 5605
823 Ga0395901_0000047 3300038443 Bacteria 175221
824 Ga0395901_0000548 3300038443 Bacteria 43338
825 Ga0395901_0004523 3300038443 Bacteria 14024
826 Ga0395901_0011122 3300038443 Bacteria 9121
827 Ga0395901_0013693 3300038443 Bacteria 8244
828 Ga0395901_0014632 3300038443 Bacteria 7972
829 Ga0395901_0015301 3300038443 Bacteria 7807
830 Ga0395901_0030882 3300038443 Bacteria 5521
831 Ga0395901_0037019 3300038443 Bacteria 5046
832 Ga0395901_0051384 3300038443 Bacteria 4286
833 Ga0395901_0055298 3300038443 Bacteria 4127
834 Ga0395901_0061363 3300038443 Bacteria 3911
835 Ga0395901_0062453 3300038443 Bacteria 3876
836 Ga0395901_0065662 3300038443 Bacteria 3779
837 Ga0395901_0066720 3300038443 Bacteria 3748
838 Ga0395901_0136421 3300038443 Bacteria 2578
839 Ga0395901_0180428 3300038443 Bacteria 2214
840 Ga0395901_0266597 3300038443 Bacteria 1782
841 Ga0395901_0279412 3300038443 Bacteria 1735
842 Ga0436365_0530805 3300039437 Bacteria 4506
843 Ga0436365_1859407 3300039437 Bacteria 6867
844 Ga0436360_0377574 3300039438 Unclassified 2636
845 Ga0439432_020550 3300042006 Bacteria 2194
846 Ga0439464_0001270 3300042439 Bacteria 5864
847 Ga0466969_0029367 3300044656 Bacteria 2807
848 Ga0466966_0064772 3300044684 Bacteria 2300
849 Ga0466961_0010117 3300044693 Bacteria 6009
850 Ga0466961_0062894 3300044693 Bacteria 2358
851 Ga0466963_0005560 3300044694 Bacteria 7385
852 Ga0466963_0022921 3300044694 Bacteria 3959
853 Ga0466963_0064726 3300044694 Bacteria 2450
854 Ga0466964_0011251 3300044706 Bacteria 3380
855 Ga0466964_0054743 3300044706 Bacteria 1645
856 Ga0466971_0007098 3300044719 Bacteria 4876
857 Ga0466968_0027264 3300044735 Bacteria 2350
858 Ga0466970_0005467 3300044765 Bacteria 6305
859 Ga0466970_0021023 3300044765 Bacteria 3397
860 Ga0466957_0007156 3300044842 Bacteria 6309
861 Ga0466957_0034106 3300044842 Bacteria 3053
862 Ga0466957_0040726 3300044842 Bacteria 2807
863 Ga0466960_0043311 3300044901 Bacteria 2140
864 Ga0466960_0051612 3300044901 Bacteria 1987
865 Ga0466959_0035498 3300045049 Bacteria 3686
866 Ga0451576_0011647 3300045051 Bacteria 9961
867 Ga0466967_0019115 3300045976 Bacteria 5500
868 Ga0466967_0019303 3300045976 Bacteria 5477
869 Ga0466967_0024524 3300045976 Bacteria 4960
870 Ga0466967_0026928 3300045976 Bacteria 4773
871 Ga0466967_0053044 3300045976 Bacteria 3563
872 Ga0466967_0091325 3300045976 Bacteria 2767
873 Ga0466967_0124911 3300045976 Bacteria 2382
874 Ga0495585_0056069 3300046492 Bacteria 2177
875 Ga0495616_0070640 3300046513 Bacteria 1690
876 Ga0495663_0012301 3300046525 Bacteria 2385
877 Ga0495621_0026615 3300046539 Bacteria 1953
878 Ga0495633_0012095 3300046558 Bacteria 4607
879 Ga0495668_0003993 3300046616 Bacteria 10744
880 Ga0495668_0046025 3300046616 Bacteria 2424
881 Ga0495668_0072188 3300046616 Bacteria 1896
882 Ga0495669_0001180 3300046684 Bacteria 10848
883 Ga0495669_0019035 3300046684 Bacteria 2961
884 Ga0495669_0020842 3300046684 Bacteria 2839
885 Ga0495669_0023429 3300046684 Bacteria 2687
886 Ga0495669_0032430 3300046684 Bacteria 2296
887 Ga0495669_0042805 3300046684 Bacteria 2014
888 Ga0495669_0048795 3300046684 Bacteria 1894
889 Ga0495602_0090347 3300048088 Bacteria 2544
890 Ga0496100_0026856 3300048903 Bacteria 3534
891 Ga0496101_0092986 3300048904 Bacteria 2246
892 Ga0496102_0048658 3300048905 Bacteria 3855
893 Ga0496104_0106113 3300048907 Bacteria 2692
894 Ga0496105_0046127 3300048908 Bacteria 3597
895 Ga0496105_0065260 3300048908 Bacteria 3005
896 Ga0496107_0043379 3300048910 Bacteria 3231
897 Ga0496107_0096019 3300048910 Bacteria 2169
898 Ga0496108_0001435 3300048911 Bacteria 18820
899 Ga0496108_0019485 3300048911 Bacteria 5572
900 Ga0496109_0021956 3300048912 Bacteria 5651
901 Ga0496109_0094161 3300048912 Bacteria 2772
902 Ga0496110_0032915 3300048913 Bacteria 4481
903 Ga0496110_0039187 3300048913 Bacteria 4125
904 Ga0496110_0053504 3300048913 Bacteria 3549
905 Ga0496110_0102544 3300048913 Bacteria 2566
906 Ga0496110_0113347 3300048913 Bacteria 2438
907 Ga0496110_0115109 3300048913 Bacteria 2420
908 Ga0496110_0252861 3300048913 Bacteria 1604
909 Ga0496111_0023757 3300048914 Bacteria 4306
910 Ga0496111_0032099 3300048914 Bacteria 3743
911 Ga0496111_0096484 3300048914 Bacteria 2170
912 Ga0496112_0015131 3300048915 Bacteria 7188
913 Ga0496112_0028233 3300048915 Bacteria 5414
914 Ga0496112_0068444 3300048915 Bacteria 3505
915 Ga0496112_0129257 3300048915 Bacteria 2497
916 Ga0496113_0027705 3300048916 Bacteria 4065
917 Ga0496113_0059054 3300048916 Bacteria 2888
918 Ga0496113_0062852 3300048916 Bacteria 2805
919 Ga0496114_0000033 3300048917 Bacteria 166897
920 Ga0496114_0089907 3300048917 Bacteria 2606
921 Ga0496115_0000576 3300048918 Bacteria 28247
922 Ga0496126_0031929 3300048929 Bacteria 4968
923 Ga0501290_000041 3300049513 Bacteria 16680
924 Ga0501292_000038 3300049515 Bacteria 31848
925 Ga0501031_0107248 3300049568 Bacteria 1824
926 Ga0501043_0162324 3300049579 Bacteria 1746
927 Ga0501047_0015252 3300049581 Bacteria 7321
928 Ga0501047_0055387 3300049581 Bacteria 3835
929 Ga0501047_0180524 3300049581 Bacteria 1977
930 Ga0501070_0168868 3300049586 Bacteria 1802
931 Ga0501074_0054805 3300049590 Bacteria 2875
932 Ga0501242_001856 3300049674 Bacteria 2174
933 Ga0501249_003674 3300049679 Bacteria 3091
934 Ga0501258_000290 3300049687 Bacteria 3147
935 Ga0501259_000712 3300049688 Bacteria 5394
936 Ga0501221_005758 3300049704 Bacteria 2080
937 Ga0501225_0012040 3300049705 Bacteria 2431
938 Ga0501272_001137 3300049769 Bacteria 2461
939 Ga0501279_000016 3300049775 Bacteria 64067
940 Ga0501280_000059 3300049776 Bacteria 31802
941 Ga0501035_0030110 3300049822 Bacteria 4949
942 Ga0501035_0180486 3300049822 Bacteria 1819
943 nmdc:mga0k408_52247_c1 3300050493 Bacteria 2368
944 nmdc:mga06r32_27537_c1 3300050510 Bacteria 5311
945 Ga0500658_0000023 3300053134 Bacteria 123176
946 2644289821 2643221651 Bacteria 4798932
947 2909046998 2909042592 Bacteria 6499737
948 Ga0070673_100082255
949 JGI24741J21665_1005796
950 JGI24740J21852_10015894
951 JGI24739J22299_10008538
952 JGI24739J22299_10020650
953 JGI24737J22298_10000011
954 JGI24737J22298_10003233
955 JGI24737J22298_10003789
956 JGI24737J22298_10010204
957 JGI24737J22298_10011437
958 JGI24737J22298_10025015
959 JGI24735J21928_10002094
960 JGI24735J21928_10009632
961 JGI24735J21928_10015513
962 JGI24745J21846_1000738
963 JGI24738J21930_10000318
964 JGI24738J21930_10002851
965 JGI24738J21930_10003878
966 Ga0065712_10008235
967 Ga0070658_10001530
968 Ga0070658_10005602
969 Ga0070658_10012888
970 Ga0070658_10014993
971 Ga0070658_10023615
972 Ga0070658_10034580
973 Ga0070658_10051461
974 Ga0070658_10054328
975 Ga0070658_10057124
976 Ga0070658_10066018
977 Ga0070658_10080452
978 Ga0070676_10012646
979 Ga0070676_10056621
980 Ga0070683_100000307
981 Ga0070683_100006673
982 Ga0070683_100030960
983 Ga0070690_100014082
984 Ga0070670_100001795
985 Ga0070670_100002045
986 Ga0070670_100010465
987 Ga0070670_100011645
988 Ga0070670_100014887
989 Ga0070670_100027310
990 Ga0070670_100044294
991 Ga0070670_100046274
992 Ga0070670_100067158
993 Ga0070670_100128430
994 Ga0068869_100000295
995 Ga0068869_100021675
996 Ga0070666_10000764
997 Ga0070666_10000914
998 Ga0070666_10000978
999 Ga0070666_10043828
1000 Ga0070666_10102394
1001 Ga0070680_100003102
1002 Ga0070680_100005776
1003 Ga0070680_100011387
1004 Ga0070680_100180017
1005 Ga0070682_100017761
1006 Ga0070682_100027657
1007 Ga0070682_100042327
1008 Ga0070682_100050425
1009 Ga0068868_100007082
1010 Ga0068868_100011840
1011 Ga0068868_100049256
1012 Ga0070660_100000042
1013 Ga0070660_100000978
1014 Ga0070660_100006574
1015 Ga0070660_100010417
1016 Ga0070660_100011976
1017 Ga0070660_100012105
1018 Ga0070660_100016263
1019 Ga0070660_100019339
1020 Ga0070660_100035761
1021 Ga0070660_100060452
1022 Ga0070660_100078634
1023 Ga0070660_100096976
1024 Ga0070660_100111554
1025 Ga0070661_100000120
1026 Ga0070661_100012384
1027 Ga0070661_100046277
1028 Ga0070661_100047896
1029 Ga0070661_100052055
1030 Ga0070661_100056637
1031 Ga0070661_100060387
1032 Ga0070661_100087688
1033 Ga0070661_100094905
1034 Ga0070661_100110690
1035 Ga0070661_100116296
1036 Ga0070692_10001332
1037 Ga0070692_10081219
1038 Ga0070668_100022817
1039 Ga0070668_100095860
1040 Ga0070668_100104406
1041 Ga0070669_100000422
1042 Ga0070669_100005430
1043 Ga0070669_100020469
1044 Ga0070669_100022352
1045 Ga0070669_100045995
1046 Ga0070669_100069730
1047 Ga0070675_100020550
1048 Ga0070675_100040070
1049 Ga0070675_100073939
1050 Ga0070671_100000401
1051 Ga0070671_100003283
1052 Ga0070671_100004306
1053 Ga0070671_100012251
1054 Ga0070671_100012771
1055 Ga0070671_100017469
1056 Ga0070671_100069099
1057 Ga0070671_100086529
1058 Ga0070671_100116847
1059 Ga0070674_100004684
1060 Ga0070674_100008153
1061 Ga0070674_100029250
1062 Ga0070674_100033494
1063 Ga0070674_100041603
1064 Ga0070674_100054079
1065 Ga0070674_100056816
1066 Ga0070674_100179393
1067 Ga0070673_100001063
1068 Ga0070673_100016514
1069 Ga0070673_100065776
1070 Ga0070673_100085573
1071 Ga0070673_100171499
1072 Ga0070688_100101796
1073 Ga0070659_100000130
1074 Ga0070659_100001810
1075 Ga0070659_100008449
1076 Ga0070659_100014953
1077 Ga0070659_100018269
1078 Ga0070659_100021513
1079 Ga0070659_100026493
1080 Ga0070659_100062453
1081 Ga0070659_100067120
1082 Ga0070659_100079324
1083 Ga0070659_100102031
1084 Ga0070659_100108648
1085 Ga0070659_100178603
1086 Ga0070667_100003053
1087 Ga0070667_100005534
1088 Ga0070667_100006585
1089 Ga0070667_100013020
1090 Ga0070667_100038109
1091 Ga0070667_100041342
1092 Ga0070667_100048401
1093 Ga0070667_100054326
1094 Ga0070714_100003359
1095 Ga0070714_100074805
1096 Ga0070714_100161949
1097 Ga0070713_100040393
1098 Ga0070713_100047209
1099 Ga0070663_100008585
1100 Ga0070663_100037527
1101 Ga0070663_100041415
1102 Ga0070663_100043604
1103 Ga0070663_100057862
1104 Ga0070663_100060925
1105 Ga0070663_100062641
1106 Ga0070663_100064503
1107 Ga0070663_100081994
1108 Ga0070663_100142114
1109 Ga0070678_100042277
1110 Ga0070662_100000160
1111 Ga0070662_100000791
1112 Ga0070662_100025856
1113 Ga0070662_100043449
1114 Ga0070662_100051769
1115 Ga0070662_100083689
1116 Ga0070662_100162235
1117 Ga0070681_10070931
1118 Ga0070681_10121331
1119 Ga0070681_10182163
1120 Ga0068867_100019255
1121 Ga0068867_100035014
1122 Ga0068867_100066743
1123 Ga0070679_100033290
1124 Ga0070679_100076651
1125 Ga0070679_100096117
1126 Ga0070679_100097853
1127 Ga0070679_100151062
1128 Ga0070679_100154318
1129 Ga0070679_100181645
1130 Ga0070684_100025589
1131 Ga0070684_100096940
1132 Ga0070684_100131069
1133 Ga0068853_100011197
1134 Ga0068853_100022898
1135 Ga0068853_100041076
1136 Ga0068853_100095643
1137 Ga0068853_100122905
1138 Ga0068853_100147465
1139 Ga0068853_100184508
1140 Ga0068853_100206195
1141 Ga0068853_100206700
1142 Ga0070672_100001615
1143 Ga0070672_100004572
1144 Ga0070672_100015356
1145 Ga0070693_100014585
1146 Ga0070693_100027831
1147 Ga0070693_100042766
1148 Ga0070665_100003821
1149 Ga0070665_100056225
1150 Ga0070665_100060385
1151 Ga0070665_100121565
1152 Ga0070665_100124986
1153 Ga0070665_100309480
1154 Ga0068855_100010267
1155 Ga0068855_100036275
1156 Ga0068855_100096999
1157 Ga0068855_100117795
1158 Ga0068855_100117851
1159 Ga0068855_100164884
1160 Ga0070664_100000071
1161 Ga0070664_100008115
1162 Ga0070664_100009149
1163 Ga0070664_100022418
1164 Ga0070664_100026326
1165 Ga0070664_100033243
1166 Ga0070664_100037864
1167 Ga0070664_100049452
1168 Ga0070664_100053114
1169 Ga0070664_100058397
1170 Ga0070664_100086612
1171 Ga0070664_100099162
1172 Ga0070664_100099959
1173 Ga0070664_100158412
1174 Ga0068857_100000629
1175 Ga0068857_100007035
1176 Ga0068857_100009986
1177 Ga0068857_100013483
1178 Ga0068857_100095217
1179 Ga0068857_100235672
1180 Ga0068854_100000566
1181 Ga0068854_100015105
1182 Ga0068854_100025023
1183 Ga0068854_100027488
1184 Ga0068854_100057407
1185 Ga0068854_100064030
1186 Ga0068854_100134272
1187 Ga0068856_100000244
1188 Ga0068856_100031319
1189 Ga0068856_100138145
1190 Ga0068852_100013695
1191 Ga0068852_100017049
1192 Ga0068852_100020136
1193 Ga0068852_100061475
1194 Ga0068852_100070572
1195 Ga0068852_100092393
1196 Ga0068852_100104543
1197 Ga0068852_100106621
1198 Ga0068852_100277571
1199 Ga0068859_100000144
1200 Ga0068859_100021983
1201 Ga0068859_100042532
1202 Ga0068859_100099288
1203 Ga0068859_100102833
1204 Ga0068859_100111578
1205 Ga0068859_100123688
1206 Ga0068864_100000092
1207 Ga0068864_100000640
1208 Ga0068864_100007306
1209 Ga0068864_100023488
1210 Ga0068864_100067655
1211 Ga0068861_100023585
1212 Ga0068851_10017273
1213 Ga0068851_10025848
1214 Ga0068851_10026439
1215 Ga0068851_10071048
1216 Ga0068863_100000961
1217 Ga0068863_100010618
1218 Ga0068863_100010774
1219 Ga0068863_100019069
1220 Ga0068863_100079423
1221 Ga0068863_100134525
1222 Ga0068858_100000256
1223 Ga0068858_100000807
1224 Ga0068858_100000868
1225 Ga0068858_100116666
1226 Ga0068858_100117592
1227 Ga0068860_100002210
1228 Ga0068860_100018286
1229 Ga0068860_100035628
1230 Ga0068860_100077623
1231 Ga0068860_100099343
1232 Ga0068860_100210756
1233 Ga0068862_100007980
1234 Ga0068862_100065055
1235 Ga0068862_100077921
1236 Ga0068862_100128472
1237 Ga0068862_100288472
1238 Ga0068862_100303493
1239 Ga0081539_10014892
1240 Ga0070717_10009044
1241 Ga0075362_10061255
1242 Ga0097621_100085720
1243 Ga0068871_100063657
1244 Ga0075430_100019731
1245 Ga0068865_100088973
1246 Ga0068865_100143270
1247 Ga0097620_100000144
1248 Ga0097620_100021982
1249 Ga0097620_100042532
1250 Ga0097620_100099297
1251 Ga0097620_100102834
1252 Ga0097620_100111585
1253 Ga0097620_100123686
1254 Ga0105240_10033441
1255 Ga0105240_10048404
1256 Ga0105240_10183456
1257 Ga0105240_10297031
1258 Ga0105245_10001063
1259 Ga0105245_10083757
1260 Ga0105243_10029513
1261 Ga0105242_10115572
1262 Ga0105242_10139980
1263 Ga0105248_10000426
1264 Ga0105248_10001078
1265 Ga0105248_10001711
1266 Ga0105248_10001764
1267 Ga0105248_10011840
1268 Ga0105248_10041684
1269 Ga0105248_10045947
1270 Ga0105248_10050550
1271 Ga0105248_10056967
1272 Ga0105248_10063194
1273 Ga0105248_10428901
1274 Ga0105237_10020107
1275 Ga0105238_10007040
1276 Ga0105238_10035914
1277 Ga0105238_10054991
1278 Ga0105238_10086230
1279 Ga0105238_10120731
1280 Ga0105249_10020107
1281 Ga0105249_10060485
1282 Ga0105239_10023683
1283 Ga0105246_10027504
1284 Ga0157373_10018593
1285 Ga0157373_10021902
1286 Ga0157373_10022163
1287 Ga0157373_10034589
1288 Ga0157373_10048681
1289 Ga0157373_10070428
1290 Ga0157371_10005491
1291 Ga0157371_10011762
1292 Ga0157371_10025406
1293 Ga0157371_10034508
1294 Ga0157371_10059420
1295 Ga0157371_10075190
1296 Ga0157371_10112643
1297 Ga0157370_10027926
1298 Ga0157370_10032805
1299 Ga0157370_10079020
1300 Ga0157370_10107856
1301 Ga0157370_10109702
1302 Ga0157370_10135791
1303 Ga0157370_10190775
1304 Ga0157370_10203806
1305 Ga0157369_10001556
1306 Ga0157369_10058776
1307 Ga0157369_10103649
1308 Ga0157369_10110105
1309 Ga0157369_10170428
1310 Ga0157369_10220389
1311 Ga0157369_10262469
1312 Ga0157374_10046951
1313 Ga0157374_10047554
1314 Ga0157374_10126702
1315 Ga0157378_10000428
1316 Ga0163162_10041368
1317 Ga0163162_10062784
1318 Ga0157372_10018199
1319 Ga0157372_10028971
1320 Ga0157372_10115737
1321 Ga0157372_10157486
1322 Ga0157372_10178975
1323 Ga0157372_10338610
1324 Ga0157375_10024798
1325 Ga0157375_10033754
1326 Ga0157375_10038707
1327 Ga0157375_10056513
1328 Ga0157375_10149032
1329 Ga0157375_10203010
1330 Ga0163163_10000080
1331 Ga0163163_10000525
1332 Ga0163163_10079198
1333 Ga0157380_10007774
1334 Ga0157380_10068622
1335 Ga0157379_10154824
1336 Ga0157379_10210957
1337 Ga0157376_10062651
1338 Ga0163161_10024344
1339 Ga0213875_10003887
1340 Ga0207673_1001638
1341 Ga0207697_10000142
1342 Ga0207697_10007662
1343 Ga0207697_10007663
1344 Ga0207656_10002364
1345 Ga0207656_10011408
1346 Ga0207682_10004466
1347 Ga0207682_10007745
1348 Ga0207688_10000182
1349 Ga0207688_10001568
1350 Ga0207688_10033414
1351 Ga0207680_10000196
1352 Ga0207680_10000873
1353 Ga0207680_10014323
1354 Ga0207680_10063267
1355 Ga0207647_10000294
1356 Ga0207647_10006164
1357 Ga0207647_10008015
1358 Ga0207647_10015959
1359 Ga0207647_10017083
1360 Ga0207647_10025743
1361 Ga0207647_10026263
1362 Ga0207647_10029040
1363 Ga0207647_10035794
1364 Ga0207647_10038568
1365 Ga0207647_10049995
1366 Ga0207699_10099610
1367 Ga0207645_10004615
1368 Ga0207645_10010396
1369 Ga0207645_10013688
1370 Ga0207643_10034459
1371 Ga0207705_10000370
1372 Ga0207705_10001862
1373 Ga0207705_10003624
1374 Ga0207705_10011429
1375 Ga0207705_10014426
1376 Ga0207705_10016646
1377 Ga0207705_10044562
1378 Ga0207705_10046481
1379 Ga0207705_10056676
1380 Ga0207705_10090984
1381 Ga0207705_10114597
1382 Ga0207705_10156058
1383 Ga0207654_10055976
1384 Ga0207707_10013639
1385 Ga0207707_10081264
1386 Ga0207707_10101893
1387 Ga0207707_10121716
1388 Ga0207695_10025823
1389 Ga0207695_10180314
1390 Ga0207671_10017612
1391 Ga0207660_10002715
1392 Ga0207660_10007644
1393 Ga0207660_10015108
1394 Ga0207660_10028558
1395 Ga0207660_10031720
1396 Ga0207660_10072949
1397 Ga0207660_10118637
1398 Ga0207660_10127874
1399 Ga0207662_10041144
1400 Ga0207657_10001830
1401 Ga0207657_10002767
1402 Ga0207657_10004043
1403 Ga0207657_10012843
1404 Ga0207657_10019223
1405 Ga0207657_10024207
1406 Ga0207657_10025926
1407 Ga0207657_10031107
1408 Ga0207657_10032378
1409 Ga0207657_10033186
1410 Ga0207657_10033423
1411 Ga0207657_10042051
1412 Ga0207657_10042529
1413 Ga0207657_10065180
1414 Ga0207657_10107604
1415 Ga0207657_10128729
1416 Ga0207657_10169039
1417 Ga0207649_10002897
1418 Ga0207649_10004645
1419 Ga0207649_10005211
1420 Ga0207649_10025171
1421 Ga0207649_10034488
1422 Ga0207649_10039283
1423 Ga0207649_10043150
1424 Ga0207649_10078286
1425 Ga0207652_10010201
1426 Ga0207652_10010204
1427 Ga0207652_10102044
1428 Ga0207652_10217977
1429 Ga0207681_10004789
1430 Ga0207681_10006664
1431 Ga0207681_10022992
1432 Ga0207681_10023575
1433 Ga0207681_10045977
1434 Ga0207681_10086923
1435 Ga0207681_10091732
1436 Ga0207681_10100935
1437 Ga0207694_10000461
1438 Ga0207694_10029950
1439 Ga0207694_10055084
1440 Ga0207650_10001007
1441 Ga0207650_10009749
1442 Ga0207650_10013994
1443 Ga0207650_10019673
1444 Ga0207650_10043922
1445 Ga0207650_10060984
1446 Ga0207650_10067521
1447 Ga0207650_10108052
1448 Ga0207659_10009510
1449 Ga0207659_10018210
1450 Ga0207687_10010281
1451 Ga0207687_10094731
1452 Ga0207700_10084231
1453 Ga0207664_10047524
1454 Ga0207664_10100848
1455 Ga0207644_10000837
1456 Ga0207644_10004381
1457 Ga0207644_10007927
1458 Ga0207644_10010916
1459 Ga0207644_10015341
1460 Ga0207644_10024321
1461 Ga0207644_10051474
1462 Ga0207644_10052802
1463 Ga0207644_10075320
1464 Ga0207644_10083030
1465 Ga0207644_10098248
1466 Ga0207644_10160142
1467 Ga0207690_10000204
1468 Ga0207690_10001584
1469 Ga0207690_10004211
1470 Ga0207690_10006215
1471 Ga0207690_10009381
1472 Ga0207690_10012755
1473 Ga0207690_10019992
1474 Ga0207690_10020093
1475 Ga0207690_10023015
1476 Ga0207690_10056500
1477 Ga0207690_10056573
1478 Ga0207690_10091995
1479 Ga0207690_10126603
1480 Ga0207690_10145432
1481 Ga0207690_10146342
1482 Ga0207706_10007111
1483 Ga0207706_10007479
1484 Ga0207706_10017598
1485 Ga0207706_10025064
1486 Ga0207706_10033267
1487 Ga0207706_10038927
1488 Ga0207706_10044812
1489 Ga0207706_10061963
1490 Ga0207706_10074649
1491 Ga0207706_10077258
1492 Ga0207706_10099628
1493 Ga0207709_10021743
1494 Ga0207669_10053825
1495 Ga0207669_10054351
1496 Ga0207669_10055158
1497 Ga0207704_10010542
1498 Ga0207704_10039152
1499 Ga0207704_10046912
1500 Ga0207691_10001140
1501 Ga0207691_10002983
1502 Ga0207691_10017580
1503 Ga0207691_10057800
1504 Ga0207691_10080102
1505 Ga0207691_10105845
1506 Ga0207711_10000187
1507 Ga0207711_10002993
1508 Ga0207711_10005888
1509 Ga0207711_10009230
1510 Ga0207711_10010893
1511 Ga0207711_10030930
1512 Ga0207711_10044200
1513 Ga0207711_10045766
1514 Ga0207711_10067015
1515 Ga0207689_10000125
1516 Ga0207689_10015549
1517 Ga0207689_10056278
1518 Ga0207689_10057790
1519 Ga0207661_10004338
1520 Ga0207661_10037974
1521 Ga0207661_10104218
1522 Ga0207679_10000166
1523 Ga0207679_10001651
1524 Ga0207679_10002092
1525 Ga0207679_10002783
1526 Ga0207679_10017942
1527 Ga0207679_10033765
1528 Ga0207679_10088255
1529 Ga0207679_10116240
1530 Ga0207679_10116777
1531 Ga0207679_10127640
1532 Ga0207679_10142708
1533 Ga0207667_10005497
1534 Ga0207667_10021599
1535 Ga0207667_10033149
1536 Ga0207667_10035258
1537 Ga0207667_10115135
1538 Ga0207667_10116080
1539 Ga0207667_10161970
1540 Ga0207667_10255237
1541 Ga0207651_10003369
1542 Ga0207651_10010063
1543 Ga0207651_10020825
1544 Ga0207651_10032289
1545 Ga0207651_10035964
1546 Ga0207651_10087773
1547 Ga0207712_10000946
1548 Ga0207712_10010974
1549 Ga0207712_10043607
1550 Ga0207668_10000062
1551 Ga0207668_10016581
1552 Ga0207668_10067701
1553 Ga0207668_10101244
1554 Ga0207640_10016082
1555 Ga0207640_10018609
1556 Ga0207640_10037558
1557 Ga0207640_10043048
1558 Ga0207640_10072846
1559 Ga0207640_10088721
1560 Ga0207640_10151631
1561 Ga0207658_10001984
1562 Ga0207658_10008217
1563 Ga0207658_10009769
1564 Ga0207658_10012727
1565 Ga0207658_10031998
1566 Ga0207658_10034655
1567 Ga0207658_10058639
1568 Ga0207658_10083908
1569 Ga0207658_10095577
1570 Ga0207658_10166559
1571 Ga0207677_10001503
1572 Ga0207677_10004590
1573 Ga0207703_10000896
1574 Ga0207703_10002564
1575 Ga0207703_10002653
1576 Ga0207703_10012165
1577 Ga0207703_10039236
1578 Ga0207703_10040692
1579 Ga0207639_10001839
1580 Ga0207639_10014865
1581 Ga0207639_10053894
1582 Ga0207639_10184158
1583 Ga0207678_10006779
1584 Ga0207678_10006903
1585 Ga0207678_10015930
1586 Ga0207678_10018455
1587 Ga0207678_10020990
1588 Ga0207678_10039437
1589 Ga0207678_10044509
1590 Ga0207678_10048055
1591 Ga0207678_10048905
1592 Ga0207678_10070816
1593 Ga0207678_10078635
1594 Ga0207702_10000929
1595 Ga0207702_10006703
1596 Ga0207702_10025143
1597 Ga0207702_10107475
1598 Ga0207702_10132294
1599 Ga0207641_10000175
1600 Ga0207641_10011733
1601 Ga0207641_10014405
1602 Ga0207641_10020078
1603 Ga0207641_10025040
1604 Ga0207641_10205532
1605 Ga0207648_10000530
1606 Ga0207648_10012067
1607 Ga0207648_10015750
1608 Ga0207648_10036081
1609 Ga0207648_10102110
1610 Ga0207648_10145621
1611 Ga0207676_10000138
1612 Ga0207676_10001416
1613 Ga0207676_10001454
1614 Ga0207676_10002023
1615 Ga0207676_10012983
1616 Ga0207676_10043622
1617 Ga0207676_10099177
1618 Ga0207674_10000319
1619 Ga0207674_10001746
1620 Ga0207674_10002804
1621 Ga0207674_10008360
1622 Ga0207674_10016671
1623 Ga0207674_10026921
1624 Ga0207674_10039961
1625 Ga0207674_10041149
1626 Ga0207674_10045573
1627 Ga0207674_10052504
1628 Ga0207674_10071239
1629 Ga0207674_10087529
1630 Ga0207674_10236677
1631 Ga0207675_100005093
1632 Ga0207683_10011160
1633 Ga0207683_10016043
1634 Ga0207683_10028776
1635 Ga0207683_10049750
1636 Ga0207683_10078464
1637 Ga0207698_10000668
1638 Ga0207698_10010239
1639 Ga0207698_10015791
1640 Ga0207698_10034578
1641 Ga0207698_10039321
1642 Ga0207698_10044787
1643 Ga0207698_10282325
1644 Ga0209974_10008942
1645 Ga0268266_10000437
1646 Ga0268266_10035478
1647 Ga0268266_10045846
1648 Ga0268266_10047516
1649 Ga0268265_10020704
1650 Ga0268265_10027389
1651 Ga0268265_10039196
1652 Ga0268265_10060116
1653 Ga0268265_10088263
1654 Ga0268264_10001379
1655 Ga0268264_10019893
1656 Ga0268264_10171312
1657 Ga0307408_100001902
1658 Ga0307408_100041839
1659 Ga0307408_100056947
1660 Ga0307408_100174170
1661 Ga0307405_10058450
1662 Ga0307405_10073862
1663 Ga0307413_10002745
1664 Ga0307413_10010006
1665 Ga0307413_10016567
1666 Ga0307413_10047191
1667 Ga0307410_10005019
1668 Ga0307410_10025507
1669 Ga0307410_10036151
1670 Ga0307410_10040680
1671 Ga0307406_10004957
1672 Ga0307407_10011316
1673 Ga0307407_10033272
1674 Ga0307412_10025749
1675 Ga0307412_10047555
1676 Ga0307412_10108969
1677 Ga0307409_100000240
1678 Ga0307409_100029132
1679 Ga0307409_100051167
1680 Ga0307409_100055425
1681 Ga0307409_100091875
1682 Ga0307409_100105994
1683 Ga0307409_100236006
1684 Ga0307416_100006874
1685 Ga0307416_100007135
1686 Ga0307416_100008363
1687 Ga0307416_100035944
1688 Ga0307416_100063504
1689 Ga0307414_10008198
1690 Ga0307414_10027145
1691 Ga0307414_10047030
1692 Ga0307414_10064160
1693 Ga0307414_10092997
1694 Ga0307411_10009618
1695 Ga0307411_10014397
1696 Ga0307411_10021189
1697 Ga0307411_10081766
1698 Ga0307415_100003753
1699 Ga0307415_100014949
1700 Ga0373923_0012901
1701 Ga0373954_0010309
1702 Ga0373960_0029208
1703 Ga0373955_0034557
1704 Ga0373937_0010114
1705 Ga0395899_0000112
1706 Ga0395899_0000684
1707 Ga0395899_0001082
1708 Ga0395899_0004386
1709 Ga0395899_0004471
1710 Ga0395899_0005327
1711 Ga0395899_0028176
1712 Ga0395899_0063456
1713 Ga0395900_0000614
1714 Ga0395900_0000881
1715 Ga0395900_0000956
1716 Ga0395900_0002587
1717 Ga0395900_0002783
1718 Ga0395900_0010639
1719 Ga0395900_0016220
1720 Ga0395900_0023088
1721 Ga0395900_0037343
1722 Ga0395900_0038886
1723 Ga0395900_0041351
1724 Ga0395900_0054526
1725 Ga0395900_0068706
1726 Ga0395900_0072933
1727 Ga0395900_0074954
1728 Ga0395900_0082813
1729 Ga0395900_0139906
1730 Ga0395900_0148539
1731 Ga0395900_0165876
1732 Ga0395900_0180264
1733 Ga0395898_0000856
1734 Ga0395898_0002116
1735 Ga0395898_0008085
1736 Ga0395898_0010122
1737 Ga0395898_0018829
1738 Ga0395898_0025970
1739 Ga0395898_0039675
1740 Ga0395898_0076763
1741 Ga0395898_0156065
1742 Ga0395898_0178440
1743 Ga0395898_0203140
1744 Ga0395905_0000089
1745 Ga0395905_0000412
1746 Ga0395905_0000756
1747 Ga0395905_0000932
1748 Ga0395905_0000956
1749 Ga0395905_0001837
1750 Ga0395905_0001957
1751 Ga0395905_0010449
1752 Ga0395905_0020569
1753 Ga0395905_0021843
1754 Ga0395905_0022405
1755 Ga0395905_0037670
1756 Ga0395905_0054043
1757 Ga0395905_0057368
1758 Ga0395905_0063749
1759 Ga0395905_0068136
1760 Ga0395905_0090219
1761 Ga0395905_0095504
1762 Ga0395905_0113291
1763 Ga0395905_0115825
1764 Ga0395905_0128362
1765 Ga0395905_0147147
1766 Ga0395905_0169395
1767 Ga0395905_0198234
1768 Ga0395905_0258351
1769 Ga0436364_1084342
1770 Ga0395901_0000047
1771 Ga0395901_0000548
1772 Ga0395901_0004523
1773 Ga0395901_0011122
1774 Ga0395901_0013693
1775 Ga0395901_0014632
1776 Ga0395901_0015301
1777 Ga0395901_0030882
1778 Ga0395901_0037019
1779 Ga0395901_0051384
1780 Ga0395901_0055298
1781 Ga0395901_0061363
1782 Ga0395901_0062453
1783 Ga0395901_0065662
1784 Ga0395901_0066720
1785 Ga0395901_0136421
1786 Ga0395901_0180428
1787 Ga0395901_0266597
1788 Ga0395901_0279412
1789 Ga0436365_0530805
1790 Ga0436365_1859407
1791 Ga0436360_0377574
1792 Ga0439432_020550
1793 Ga0439464_0001270
1794 Ga0466969_0029367
1795 Ga0466966_0064772
1796 Ga0466961_0010117
1797 Ga0466961_0062894
1798 Ga0466963_0005560
1799 Ga0466963_0022921
1800 Ga0466963_0064726
1801 Ga0466964_0011251
1802 Ga0466964_0054743
1803 Ga0466971_0007098
1804 Ga0466968_0027264
1805 Ga0466970_0005467
1806 Ga0466970_0021023
1807 Ga0466957_0007156
1808 Ga0466957_0034106
1809 Ga0466957_0040726
1810 Ga0466960_0043311
1811 Ga0466960_0051612
1812 Ga0466959_0035498
1813 Ga0451576_0011647
1814 Ga0466967_0019115
1815 Ga0466967_0019303
1816 Ga0466967_0024524
1817 Ga0466967_0026928
1818 Ga0466967_0053044
1819 Ga0466967_0091325
1820 Ga0466967_0124911
1821 Ga0495585_0056069
1822 Ga0495616_0070640
1823 Ga0495663_0012301
1824 Ga0495621_0026615
1825 Ga0495633_0012095
1826 Ga0495668_0003993
1827 Ga0495668_0046025
1828 Ga0495668_0072188
1829 Ga0495669_0001180
1830 Ga0495669_0019035
1831 Ga0495669_0020842
1832 Ga0495669_0023429
1833 Ga0495669_0032430
1834 Ga0495669_0042805
1835 Ga0495669_0048795
1836 Ga0495602_0090347
1837 Ga0496100_0026856
1838 Ga0496101_0092986
1839 Ga0496102_0048658
1840 Ga0496104_0106113
1841 Ga0496105_0046127
1842 Ga0496105_0065260
1843 Ga0496107_0043379
1844 Ga0496107_0096019
1845 Ga0496108_0001435
1846 Ga0496108_0019485
1847 Ga0496109_0021956
1848 Ga0496109_0094161
1849 Ga0496110_0032915
1850 Ga0496110_0039187
1851 Ga0496110_0053504
1852 Ga0496110_0102544
1853 Ga0496110_0113347
1854 Ga0496110_0115109
1855 Ga0496110_0252861
1856 Ga0496111_0023757
1857 Ga0496111_0032099
1858 Ga0496111_0096484
1859 Ga0496112_0015131
1860 Ga0496112_0028233
1861 Ga0496112_0068444
1862 Ga0496112_0129257
1863 Ga0496113_0027705
1864 Ga0496113_0059054
1865 Ga0496113_0062852
1866 Ga0496114_0000033
1867 Ga0496114_0089907
1868 Ga0496115_0000576
1869 Ga0496126_0031929
1870 Ga0501290_000041
1871 Ga0501292_000038
1872 Ga0501031_0107248
1873 Ga0501043_0162324
1874 Ga0501047_0015252
1875 Ga0501047_0055387
1876 Ga0501047_0180524
1877 Ga0501070_0168868
1878 Ga0501074_0054805
1879 Ga0501242_001856
1880 Ga0501249_003674
1881 Ga0501258_000290
1882 Ga0501259_000712
1883 Ga0501221_005758
1884 Ga0501225_0012040
1885 Ga0501272_001137
1886 Ga0501279_000016
1887 Ga0501280_000059
1888 Ga0501035_0030110
1889 Ga0501035_0180486
1890 nmdc:mga0k408_52247_c1
1891 nmdc:mga06r32_27537_c1
1892 Ga0500658_0000023
1893 2644289821
1894 2909046998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

273

438

0.97

PF01554

MatE

MatE

45

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.769 6 431
5y50-assembly1.cif.gz_A crystal structure of eukaryotic mate transporter atdtx14 0.7659 2 428
7waw-assembly1.cif.gz_A murj inward closed form 0.7644 9 424
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.7579 6 431
5y50-assembly1.cif.gz_A crystal structure of eukaryotic mate transporter atdtx14 0.7565 2 428
ID Description Score Start End Superfamily
af_A0A1D8PCB5_370_524_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9617 226 382 1.20.1250.20
af_E7FEQ7_267_428_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9581 225 383 1.20.1250.20
af_P37340_244_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9515 222 386 1.20.1250.20
af_U3Q0C3_281_442_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9487 225 385 1.20.1250.20
af_Q59R29_400_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.948 225 383 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0D6PIC2-F1-model_v4 Efflux pump norm, mate family 0.9331 220 432 GO:0005886
GO:0015297
GO:0042910
AF-A0A848UCM0-F1-model_v4 MATE family efflux transporter 0.9085 2 431 GO:0005886
GO:0015297
GO:0042910
AF-A0A848UCM0-F1-model_v4 MATE family efflux transporter 0.9025 2 431 GO:0005886
GO:0015297
GO:0042910
AF-A0A657AR32-F1-model_v4 Multidrug-efflux transporter 0.8985 6 431 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A0D6PIC2-F1-model_v4 Efflux pump norm, mate family 0.8925 220 432 GO:0005886
GO:0015297
GO:0042910

Map