F486479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 947 | 352 | 947 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100020119|Ga0070708_1000201194 |
| Length | 242 |
| Sequence | MGSNSINWFKFASPASFFPFAGRLARWFAVLAAPLAAAGLWLGLVVAPTDAQQGDAYRIIFIHVPAAWMSMFIYLVMAAWCAASLTLNARLSAMMAQALAPTGALFTVIALWTGAGTYWAWDARMTSELILLFLYLGYMALRHAIDEPRRADRASAVLALVGAVNVPIIYFSVKWWNTLHQGATVSLTAAPKMASIMLTAMLLMTFAAWFYAIAVAMVRVRAIILERERRTSWAGAFVGAAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 345 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.7 |
| Nodule | 0 |
| Rhizoplane | 3.17 |
| Rhizosphere | 91.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10212722 | 3300005327 | Bacteria | 1633 |
| 2 | Ga0070676_10001735 | 3300005328 | Bacteria | 11096 |
| 3 | Ga0070676_10194201 | 3300005328 | Bacteria | 1327 |
| 4 | Ga0070676_10300112 | 3300005328 | Bacteria | 1089 |
| 5 | Ga0070683_100099341 | 3300005329 | Bacteria | 2739 |
| 6 | Ga0070690_100001151 | 3300005330 | Bacteria | 13613 |
| 7 | Ga0070690_100051502 | 3300005330 | Bacteria | 2628 |
| 8 | Ga0070670_100005989 | 3300005331 | Bacteria | 10289 |
| 9 | Ga0070670_100038187 | 3300005331 | Bacteria | 4129 |
| 10 | Ga0070670_100052284 | 3300005331 | Bacteria | 3508 |
| 11 | Ga0070670_100085666 | 3300005331 | Bacteria | 2707 |
| 12 | Ga0070670_100089859 | 3300005331 | Bacteria | 2640 |
| 13 | Ga0070670_100440444 | 3300005331 | Bacteria | 1154 |
| 14 | Ga0070677_10005263 | 3300005333 | Bacteria | 4257 |
| 15 | Ga0070677_10121222 | 3300005333 | Bacteria | 1181 |
| 16 | Ga0068869_100000926 | 3300005334 | Bacteria | 16926 |
| 17 | Ga0068869_100004899 | 3300005334 | Bacteria | 8377 |
| 18 | Ga0068869_100022670 | 3300005334 | Bacteria | 4329 |
| 19 | Ga0068869_100082175 | 3300005334 | Bacteria | 2407 |
| 20 | Ga0068869_100088068 | 3300005334 | Bacteria | 2330 |
| 21 | Ga0068869_100211483 | 3300005334 | Bacteria | 1533 |
| 22 | Ga0068869_100233691 | 3300005334 | Bacteria | 1462 |
| 23 | Ga0070666_10003246 | 3300005335 | Bacteria | 9877 |
| 24 | Ga0070666_10005482 | 3300005335 | Bacteria | 7780 |
| 25 | Ga0070666_10008121 | 3300005335 | Bacteria | 6500 |
| 26 | Ga0070666_10125564 | 3300005335 | Bacteria | 1781 |
| 27 | Ga0070682_100024903 | 3300005337 | Bacteria | 3567 |
| 28 | Ga0068868_100002572 | 3300005338 | Bacteria | 12589 |
| 29 | Ga0068868_100007250 | 3300005338 | Bacteria | 7885 |
| 30 | Ga0068868_100017866 | 3300005338 | Bacteria | 5291 |
| 31 | Ga0068868_100027784 | 3300005338 | Bacteria | 4319 |
| 32 | Ga0068868_100671195 | 3300005338 | Bacteria | 925 |
| 33 | Ga0070660_100012880 | 3300005339 | Bacteria | 5983 |
| 34 | Ga0070689_100000968 | 3300005340 | Bacteria | 17929 |
| 35 | Ga0070689_100012276 | 3300005340 | Bacteria | 6165 |
| 36 | Ga0070689_100019778 | 3300005340 | Bacteria | 4983 |
| 37 | Ga0070691_10034323 | 3300005341 | Bacteria | 2388 |
| 38 | Ga0070691_10048127 | 3300005341 | Bacteria | 2028 |
| 39 | Ga0070687_100045865 | 3300005343 | Bacteria | 2235 |
| 40 | Ga0070687_100175570 | 3300005343 | Bacteria | 1279 |
| 41 | Ga0070661_100013701 | 3300005344 | Bacteria | 5696 |
| 42 | Ga0070661_100026640 | 3300005344 | Bacteria | 4159 |
| 43 | Ga0070661_100297307 | 3300005344 | Bacteria | 1256 |
| 44 | Ga0070692_10022249 | 3300005345 | Bacteria | 3095 |
| 45 | Ga0070668_100004119 | 3300005347 | Bacteria | 10765 |
| 46 | Ga0070668_100066950 | 3300005347 | Bacteria | 2788 |
| 47 | Ga0070669_100000668 | 3300005353 | Bacteria | 25208 |
| 48 | Ga0070669_100001340 | 3300005353 | Bacteria | 17754 |
| 49 | Ga0070669_100069103 | 3300005353 | Bacteria | 2608 |
| 50 | Ga0070675_100002913 | 3300005354 | Bacteria | 12900 |
| 51 | Ga0070675_100017405 | 3300005354 | Bacteria | 5711 |
| 52 | Ga0070675_100033252 | 3300005354 | Bacteria | 4180 |
| 53 | Ga0070675_100115036 | 3300005354 | Bacteria | 2280 |
| 54 | Ga0070675_100221877 | 3300005354 | Bacteria | 1646 |
| 55 | Ga0070675_100294807 | 3300005354 | Bacteria | 1428 |
| 56 | Ga0070671_100010442 | 3300005355 | Bacteria | 7450 |
| 57 | Ga0070671_100019898 | 3300005355 | Bacteria | 5469 |
| 58 | Ga0070671_100039862 | 3300005355 | Bacteria | 3899 |
| 59 | Ga0070671_100212959 | 3300005355 | Bacteria | 1639 |
| 60 | Ga0070674_100164352 | 3300005356 | Bacteria | 1687 |
| 61 | Ga0070674_100166671 | 3300005356 | Bacteria | 1676 |
| 62 | Ga0070673_100002041 | 3300005364 | Bacteria | 12191 |
| 63 | Ga0070673_100005216 | 3300005364 | Bacteria | 8297 |
| 64 | Ga0070673_100034039 | 3300005364 | Bacteria | 3851 |
| 65 | Ga0070673_100048540 | 3300005364 | Bacteria | 3310 |
| 66 | Ga0070673_100083572 | 3300005364 | Bacteria | 2594 |
| 67 | Ga0070673_100206584 | 3300005364 | Bacteria | 1694 |
| 68 | Ga0070673_100347214 | 3300005364 | Bacteria | 1316 |
| 69 | Ga0070673_100468341 | 3300005364 | Bacteria | 1136 |
| 70 | Ga0070688_100008334 | 3300005365 | Bacteria | 5625 |
| 71 | Ga0070688_100026064 | 3300005365 | Bacteria | 3469 |
| 72 | Ga0070659_100052498 | 3300005366 | Bacteria | 3207 |
| 73 | Ga0070659_100127375 | 3300005366 | Bacteria | 2066 |
| 74 | Ga0070659_100362490 | 3300005366 | Bacteria | 1218 |
| 75 | Ga0070667_100001232 | 3300005367 | Bacteria | 23249 |
| 76 | Ga0070667_100004388 | 3300005367 | Bacteria | 11903 |
| 77 | Ga0070667_100006263 | 3300005367 | Bacteria | 9893 |
| 78 | Ga0070667_100018925 | 3300005367 | Bacteria | 5710 |
| 79 | Ga0070667_100063935 | 3300005367 | Bacteria | 3121 |
| 80 | Ga0070667_100583766 | 3300005367 | Bacteria | 1029 |
| 81 | Ga0070713_100009864 | 3300005436 | Bacteria | 6868 |
| 82 | Ga0070713_100021191 | 3300005436 | Bacteria | 4994 |
| 83 | Ga0070710_10006201 | 3300005437 | Bacteria | 5722 |
| 84 | Ga0070701_10011700 | 3300005438 | Bacteria | 3936 |
| 85 | Ga0070711_100000893 | 3300005439 | Bacteria | 15682 |
| 86 | Ga0070705_100014603 | 3300005440 | Bacteria | 4044 |
| 87 | Ga0070700_100014701 | 3300005441 | Bacteria | 4423 |
| 88 | Ga0070700_100030180 | 3300005441 | Bacteria | 3237 |
| 89 | Ga0070700_100118979 | 3300005441 | Bacteria | 1767 |
| 90 | Ga0070694_100012252 | 3300005444 | Bacteria | 5327 |
| 91 | Ga0070708_100020119 | 3300005445 | Bacteria | 5622 |
| 92 | Ga0070708_100119277 | 3300005445 | Bacteria | 2431 |
| 93 | Ga0070663_100091829 | 3300005455 | Bacteria | 2250 |
| 94 | Ga0070678_100000107 | 3300005456 | Bacteria | 32267 |
| 95 | Ga0070678_100001539 | 3300005456 | Bacteria | 12334 |
| 96 | Ga0070678_100016518 | 3300005456 | Bacteria | 4725 |
| 97 | Ga0070678_100070096 | 3300005456 | Bacteria | 2620 |
| 98 | Ga0070678_100077931 | 3300005456 | Bacteria | 2502 |
| 99 | Ga0070678_100246214 | 3300005456 | Bacteria | 1497 |
| 100 | Ga0070678_100325755 | 3300005456 | Bacteria | 1313 |
| 101 | Ga0070678_100339044 | 3300005456 | Bacteria | 1289 |
| 102 | Ga0070678_100444285 | 3300005456 | Bacteria | 1135 |
| 103 | Ga0070662_100028287 | 3300005457 | Bacteria | 3900 |
| 104 | Ga0070662_100040230 | 3300005457 | Bacteria | 3327 |
| 105 | Ga0070662_100143663 | 3300005457 | Bacteria | 1852 |
| 106 | Ga0070681_10007168 | 3300005458 | Bacteria | 10859 |
| 107 | Ga0070681_10082525 | 3300005458 | Bacteria | 3170 |
| 108 | Ga0068867_100012431 | 3300005459 | Bacteria | 6023 |
| 109 | Ga0068867_100029690 | 3300005459 | Bacteria | 3940 |
| 110 | Ga0068867_100044376 | 3300005459 | Bacteria | 3257 |
| 111 | Ga0068867_100055039 | 3300005459 | Bacteria | 2940 |
| 112 | Ga0068867_100068502 | 3300005459 | Bacteria | 2648 |
| 113 | Ga0068867_100091991 | 3300005459 | Bacteria | 2303 |
| 114 | Ga0068867_100113331 | 3300005459 | Bacteria | 2086 |
| 115 | Ga0068867_100130879 | 3300005459 | Bacteria | 1950 |
| 116 | Ga0068867_100240035 | 3300005459 | Bacteria | 1469 |
| 117 | Ga0070685_10000221 | 3300005466 | Bacteria | 37567 |
| 118 | Ga0070706_100091964 | 3300005467 | Bacteria | 2814 |
| 119 | Ga0070706_100131071 | 3300005467 | Bacteria | 2339 |
| 120 | Ga0070706_100146874 | 3300005467 | Bacteria | 2202 |
| 121 | Ga0070706_100504900 | 3300005467 | Bacteria | 1125 |
| 122 | Ga0070706_100584627 | 3300005467 | Bacteria | 1038 |
| 123 | Ga0070707_100027242 | 3300005468 | Bacteria | 5437 |
| 124 | Ga0070698_100095739 | 3300005471 | Bacteria | 2946 |
| 125 | Ga0070699_100145386 | 3300005518 | Bacteria | 2095 |
| 126 | Ga0070699_100160196 | 3300005518 | Bacteria | 1991 |
| 127 | Ga0070679_100144794 | 3300005530 | Bacteria | 2354 |
| 128 | Ga0070679_100339159 | 3300005530 | Bacteria | 1451 |
| 129 | Ga0070684_100009252 | 3300005535 | Bacteria | 7753 |
| 130 | Ga0070697_100002608 | 3300005536 | Bacteria | 13872 |
| 131 | Ga0068853_100022499 | 3300005539 | Bacteria | 5265 |
| 132 | Ga0068853_100125706 | 3300005539 | Bacteria | 2291 |
| 133 | Ga0068853_100250004 | 3300005539 | Bacteria | 1626 |
| 134 | Ga0068853_100250468 | 3300005539 | Bacteria | 1625 |
| 135 | Ga0070672_100000287 | 3300005543 | Bacteria | 28567 |
| 136 | Ga0070672_100009036 | 3300005543 | Bacteria | 6851 |
| 137 | Ga0070672_100066153 | 3300005543 | Bacteria | 2861 |
| 138 | Ga0070672_100067150 | 3300005543 | Bacteria | 2841 |
| 139 | Ga0070672_100071664 | 3300005543 | Bacteria | 2757 |
| 140 | Ga0070672_100082633 | 3300005543 | Bacteria | 2577 |
| 141 | Ga0070672_100123089 | 3300005543 | Bacteria | 2125 |
| 142 | Ga0070686_100021520 | 3300005544 | Bacteria | 3835 |
| 143 | Ga0070686_100055642 | 3300005544 | Bacteria | 2535 |
| 144 | Ga0070686_100306748 | 3300005544 | Bacteria | 1179 |
| 145 | Ga0070686_100377124 | 3300005544 | Bacteria | 1073 |
| 146 | Ga0070695_100077736 | 3300005545 | Bacteria | 2187 |
| 147 | Ga0070695_100183001 | 3300005545 | Bacteria | 1486 |
| 148 | Ga0070695_100578281 | 3300005545 | Bacteria | 879 |
| 149 | Ga0070696_100055582 | 3300005546 | Bacteria | 2760 |
| 150 | Ga0070696_100109391 | 3300005546 | Bacteria | 1989 |
| 151 | Ga0070693_100009100 | 3300005547 | Bacteria | 4929 |
| 152 | Ga0070693_100234281 | 3300005547 | Bacteria | 1209 |
| 153 | Ga0070665_100005852 | 3300005548 | Bacteria | 12613 |
| 154 | Ga0070665_100023957 | 3300005548 | Bacteria | 6147 |
| 155 | Ga0070665_100192649 | 3300005548 | Bacteria | 2039 |
| 156 | Ga0070704_100018809 | 3300005549 | Bacteria | 4427 |
| 157 | Ga0068855_100345279 | 3300005563 | Bacteria | 1640 |
| 158 | Ga0068855_100590673 | 3300005563 | Bacteria | 1198 |
| 159 | Ga0070664_100041961 | 3300005564 | Bacteria | 3862 |
| 160 | Ga0070664_100173679 | 3300005564 | Bacteria | 1912 |
| 161 | Ga0070664_100368865 | 3300005564 | Bacteria | 1308 |
| 162 | Ga0070664_100515269 | 3300005564 | Bacteria | 1103 |
| 163 | Ga0068857_100083257 | 3300005577 | Bacteria | 2858 |
| 164 | Ga0068857_100097293 | 3300005577 | Bacteria | 2638 |
| 165 | Ga0068857_100132982 | 3300005577 | Bacteria | 2245 |
| 166 | Ga0068857_100568161 | 3300005577 | Bacteria | 1070 |
| 167 | Ga0068857_100804393 | 3300005577 | Bacteria | 898 |
| 168 | Ga0068854_100009962 | 3300005578 | Bacteria | 6152 |
| 169 | Ga0068854_100086543 | 3300005578 | Bacteria | 2323 |
| 170 | Ga0068856_100190024 | 3300005614 | Bacteria | 2067 |
| 171 | Ga0068856_100201580 | 3300005614 | Bacteria | 2004 |
| 172 | Ga0070702_100241410 | 3300005615 | Bacteria | 1219 |
| 173 | Ga0068852_100034538 | 3300005616 | Bacteria | 4208 |
| 174 | Ga0068852_100068867 | 3300005616 | Bacteria | 3099 |
| 175 | Ga0068852_100118552 | 3300005616 | Bacteria | 2419 |
| 176 | Ga0068852_100130364 | 3300005616 | Bacteria | 2315 |
| 177 | Ga0068852_100242460 | 3300005616 | Bacteria | 1723 |
| 178 | Ga0068852_100245979 | 3300005616 | Bacteria | 1711 |
| 179 | Ga0068852_100568284 | 3300005616 | Bacteria | 1136 |
| 180 | Ga0068859_100003177 | 3300005617 | Bacteria | 16715 |
| 181 | Ga0068859_100020837 | 3300005617 | Bacteria | 6580 |
| 182 | Ga0068859_100140187 | 3300005617 | Bacteria | 2491 |
| 183 | Ga0068859_100290582 | 3300005617 | Bacteria | 1728 |
| 184 | Ga0068859_100298302 | 3300005617 | Bacteria | 1705 |
| 185 | Ga0068864_100002616 | 3300005618 | Bacteria | 14866 |
| 186 | Ga0068864_100002879 | 3300005618 | Bacteria | 14221 |
| 187 | Ga0068864_100008284 | 3300005618 | Bacteria | 8574 |
| 188 | Ga0068864_100017069 | 3300005618 | Bacteria | 6050 |
| 189 | Ga0068864_100047375 | 3300005618 | Bacteria | 3692 |
| 190 | Ga0068864_100049900 | 3300005618 | Bacteria | 3601 |
| 191 | Ga0068864_100079160 | 3300005618 | Bacteria | 2877 |
| 192 | Ga0068864_100087580 | 3300005618 | Bacteria | 2742 |
| 193 | Ga0068864_100454306 | 3300005618 | Bacteria | 1225 |
| 194 | Ga0068864_100778558 | 3300005618 | Bacteria | 939 |
| 195 | Ga0068866_10000652 | 3300005718 | Bacteria | 15743 |
| 196 | Ga0068866_10001673 | 3300005718 | Bacteria | 9346 |
| 197 | Ga0068866_10029507 | 3300005718 | Bacteria | 2624 |
| 198 | Ga0068866_10047815 | 3300005718 | Bacteria | 2159 |
| 199 | Ga0068866_10066202 | 3300005718 | Bacteria | 1892 |
| 200 | Ga0068861_100000757 | 3300005719 | Bacteria | 19364 |
| 201 | Ga0068861_100003709 | 3300005719 | Bacteria | 10193 |
| 202 | Ga0068861_100004546 | 3300005719 | Bacteria | 9316 |
| 203 | Ga0068861_100016929 | 3300005719 | Bacteria | 5168 |
| 204 | Ga0068861_100021338 | 3300005719 | Bacteria | 4654 |
| 205 | Ga0068861_100047329 | 3300005719 | Bacteria | 3246 |
| 206 | Ga0068861_100069108 | 3300005719 | Bacteria | 2731 |
| 207 | Ga0068861_100242081 | 3300005719 | Bacteria | 1535 |
| 208 | Ga0068851_10042280 | 3300005834 | Bacteria | 2294 |
| 209 | Ga0068851_10072779 | 3300005834 | Bacteria | 1781 |
| 210 | Ga0068870_10006402 | 3300005840 | Bacteria | 5188 |
| 211 | Ga0068870_10009878 | 3300005840 | Bacteria | 4358 |
| 212 | Ga0068863_100000585 | 3300005841 | Bacteria | 37128 |
| 213 | Ga0068863_100002985 | 3300005841 | Bacteria | 16732 |
| 214 | Ga0068863_100029355 | 3300005841 | Bacteria | 5249 |
| 215 | Ga0068863_100082415 | 3300005841 | Bacteria | 3048 |
| 216 | Ga0068863_100085590 | 3300005841 | Bacteria | 2987 |
| 217 | Ga0068863_100227080 | 3300005841 | Bacteria | 1800 |
| 218 | Ga0068858_100000603 | 3300005842 | Bacteria | 37588 |
| 219 | Ga0068858_100003791 | 3300005842 | Bacteria | 14951 |
| 220 | Ga0068858_100004338 | 3300005842 | Bacteria | 13920 |
| 221 | Ga0068858_100019626 | 3300005842 | Bacteria | 6319 |
| 222 | Ga0068858_100021707 | 3300005842 | Bacteria | 5999 |
| 223 | Ga0068858_100022884 | 3300005842 | Bacteria | 5829 |
| 224 | Ga0068858_100146076 | 3300005842 | Bacteria | 2221 |
| 225 | Ga0068858_100150173 | 3300005842 | Bacteria | 2190 |
| 226 | Ga0068858_100282847 | 3300005842 | Bacteria | 1580 |
| 227 | Ga0068858_100501201 | 3300005842 | Bacteria | 1173 |
| 228 | Ga0068860_100002076 | 3300005843 | Bacteria | 21118 |
| 229 | Ga0068860_100005493 | 3300005843 | Bacteria | 12840 |
| 230 | Ga0068860_100005815 | 3300005843 | Bacteria | 12419 |
| 231 | Ga0068860_100009426 | 3300005843 | Bacteria | 9703 |
| 232 | Ga0068860_100013332 | 3300005843 | Bacteria | 8058 |
| 233 | Ga0068860_100017524 | 3300005843 | Bacteria | 6979 |
| 234 | Ga0068860_100027701 | 3300005843 | Bacteria | 5456 |
| 235 | Ga0068860_100033089 | 3300005843 | Bacteria | 4963 |
| 236 | Ga0068860_100787193 | 3300005843 | Bacteria | 964 |
| 237 | Ga0068862_100016504 | 3300005844 | Bacteria | 6147 |
| 238 | Ga0068862_100066477 | 3300005844 | Bacteria | 3107 |
| 239 | Ga0068862_100110121 | 3300005844 | Bacteria | 2417 |
| 240 | Ga0068862_100119139 | 3300005844 | Bacteria | 2325 |
| 241 | Ga0075363_100086097 | 3300006048 | Bacteria | 1724 |
| 242 | Ga0075364_10014913 | 3300006051 | Bacteria | 4810 |
| 243 | Ga0070716_100001339 | 3300006173 | Bacteria | 10909 |
| 244 | Ga0070716_100020690 | 3300006173 | Bacteria | 3456 |
| 245 | Ga0070716_100188955 | 3300006173 | Bacteria | 1359 |
| 246 | Ga0070712_100002453 | 3300006175 | Bacteria | 11432 |
| 247 | Ga0075362_10008625 | 3300006177 | Bacteria | 3910 |
| 248 | Ga0075362_10024025 | 3300006177 | Bacteria | 2583 |
| 249 | Ga0075367_10287278 | 3300006178 | Bacteria | 1034 |
| 250 | Ga0075369_10081983 | 3300006186 | Bacteria | 1431 |
| 251 | Ga0075366_10002701 | 3300006195 | Bacteria | 9156 |
| 252 | Ga0075366_10003106 | 3300006195 | Bacteria | 8684 |
| 253 | Ga0075366_10004261 | 3300006195 | Bacteria | 7673 |
| 254 | Ga0075366_10036923 | 3300006195 | Bacteria | 2882 |
| 255 | Ga0075366_10054389 | 3300006195 | Bacteria | 2377 |
| 256 | Ga0075366_10076205 | 3300006195 | Bacteria | 2001 |
| 257 | Ga0097621_100001308 | 3300006237 | Bacteria | 17135 |
| 258 | Ga0097621_100020593 | 3300006237 | Bacteria | 5083 |
| 259 | Ga0097621_100135560 | 3300006237 | Bacteria | 2099 |
| 260 | Ga0097621_100168073 | 3300006237 | Bacteria | 1889 |
| 261 | Ga0097621_100223517 | 3300006237 | Bacteria | 1641 |
| 262 | Ga0097621_100378184 | 3300006237 | Bacteria | 1264 |
| 263 | Ga0097621_100454851 | 3300006237 | Bacteria | 1154 |
| 264 | Ga0097621_100574461 | 3300006237 | Bacteria | 1028 |
| 265 | Ga0075370_10002336 | 3300006353 | Bacteria | 8766 |
| 266 | Ga0075370_10012106 | 3300006353 | Bacteria | 4551 |
| 267 | Ga0075370_10097440 | 3300006353 | Bacteria | 1700 |
| 268 | Ga0075370_10117967 | 3300006353 | Bacteria | 1543 |
| 269 | Ga0068871_100001077 | 3300006358 | Bacteria | 18307 |
| 270 | Ga0068871_100041396 | 3300006358 | Bacteria | 3694 |
| 271 | Ga0068871_100109944 | 3300006358 | Bacteria | 2318 |
| 272 | Ga0068871_100162973 | 3300006358 | Bacteria | 1908 |
| 273 | Ga0068871_100181838 | 3300006358 | Bacteria | 1807 |
| 274 | Ga0068871_100195588 | 3300006358 | Bacteria | 1744 |
| 275 | Ga0075430_100061527 | 3300006846 | Bacteria | 3155 |
| 276 | Ga0075433_10049587 | 3300006852 | Bacteria | 3653 |
| 277 | Ga0075434_100020488 | 3300006871 | Bacteria | 6415 |
| 278 | Ga0075434_100048092 | 3300006871 | Bacteria | 4233 |
| 279 | Ga0075434_100844094 | 3300006871 | Bacteria | 932 |
| 280 | Ga0075429_100006183 | 3300006880 | Bacteria | 10351 |
| 281 | Ga0068865_100001397 | 3300006881 | Bacteria | 14036 |
| 282 | Ga0068865_100063168 | 3300006881 | Bacteria | 2602 |
| 283 | Ga0068865_100086501 | 3300006881 | Bacteria | 2263 |
| 284 | Ga0068865_100200552 | 3300006881 | Bacteria | 1548 |
| 285 | Ga0075436_100164282 | 3300006914 | Bacteria | 1566 |
| 286 | Ga0097620_100003176 | 3300006931 | Bacteria | 16715 |
| 287 | Ga0097620_100020837 | 3300006931 | Bacteria | 6580 |
| 288 | Ga0097620_100140194 | 3300006931 | Bacteria | 2491 |
| 289 | Ga0097620_100290566 | 3300006931 | Bacteria | 1728 |
| 290 | Ga0097620_100298316 | 3300006931 | Bacteria | 1705 |
| 291 | Ga0075435_100017023 | 3300007076 | Bacteria | 5491 |
| 292 | Ga0075435_100017178 | 3300007076 | Bacteria | 5469 |
| 293 | Ga0075435_100217711 | 3300007076 | Bacteria | 1621 |
| 294 | Ga0075435_100552764 | 3300007076 | Bacteria | 997 |
| 295 | Ga0105240_10095347 | 3300009093 | Bacteria | 3628 |
| 296 | Ga0111539_10785273 | 3300009094 | Bacteria | 1108 |
| 297 | Ga0105245_10005497 | 3300009098 | Bacteria | 11132 |
| 298 | Ga0105245_10014037 | 3300009098 | Bacteria | 6975 |
| 299 | Ga0105245_10020376 | 3300009098 | Bacteria | 5816 |
| 300 | Ga0105245_10025793 | 3300009098 | Bacteria | 5169 |
| 301 | Ga0105245_10106237 | 3300009098 | Bacteria | 2605 |
| 302 | Ga0105247_10340706 | 3300009101 | Bacteria | 1051 |
| 303 | Ga0114129_10172919 | 3300009147 | Bacteria | 2944 |
| 304 | Ga0105243_10003255 | 3300009148 | Bacteria | 13216 |
| 305 | Ga0105243_10110471 | 3300009148 | Bacteria | 2299 |
| 306 | Ga0105241_10014472 | 3300009174 | Bacteria | 5777 |
| 307 | Ga0105241_10298974 | 3300009174 | Bacteria | 1381 |
| 308 | Ga0105241_10332946 | 3300009174 | Bacteria | 1313 |
| 309 | Ga0105242_10002918 | 3300009176 | Bacteria | 13363 |
| 310 | Ga0105242_10063808 | 3300009176 | Bacteria | 3034 |
| 311 | Ga0105248_10002074 | 3300009177 | Bacteria | 22178 |
| 312 | Ga0105248_10018068 | 3300009177 | Bacteria | 7784 |
| 313 | Ga0105248_10022083 | 3300009177 | Bacteria | 7051 |
| 314 | Ga0105248_10129464 | 3300009177 | Bacteria | 2847 |
| 315 | Ga0105237_10021940 | 3300009545 | Bacteria | 6558 |
| 316 | Ga0105237_10156291 | 3300009545 | Bacteria | 2277 |
| 317 | Ga0105238_10047138 | 3300009551 | Bacteria | 4347 |
| 318 | Ga0105238_10477940 | 3300009551 | Bacteria | 1245 |
| 319 | Ga0105249_10026569 | 3300009553 | Bacteria | 5218 |
| 320 | Ga0105249_10043839 | 3300009553 | Bacteria | 4069 |
| 321 | Ga0105249_10097812 | 3300009553 | Bacteria | 2755 |
| 322 | Ga0105249_10118839 | 3300009553 | Bacteria | 2509 |
| 323 | Ga0105249_10230804 | 3300009553 | Bacteria | 1825 |
| 324 | Ga0105239_10020138 | 3300010375 | Bacteria | 7360 |
| 325 | Ga0105239_10033050 | 3300010375 | Bacteria | 5682 |
| 326 | Ga0105239_10050795 | 3300010375 | Bacteria | 4546 |
| 327 | Ga0105239_10235169 | 3300010375 | Bacteria | 2056 |
| 328 | Ga0105246_10033904 | 3300011119 | Bacteria | 3396 |
| 329 | Ga0105246_10175926 | 3300011119 | Bacteria | 1643 |
| 330 | Ga0105246_10448577 | 3300011119 | Bacteria | 1083 |
| 331 | Ga0157373_10055871 | 3300013100 | Bacteria | 2804 |
| 332 | Ga0157369_10041396 | 3300013105 | Bacteria | 5029 |
| 333 | Ga0157369_10357187 | 3300013105 | Bacteria | 1517 |
| 334 | Ga0157374_10000565 | 3300013296 | Bacteria | 32833 |
| 335 | Ga0157374_10001312 | 3300013296 | Bacteria | 21166 |
| 336 | Ga0157374_10025744 | 3300013296 | Bacteria | 5287 |
| 337 | Ga0157374_10110327 | 3300013296 | Bacteria | 2646 |
| 338 | Ga0157374_10144119 | 3300013296 | Bacteria | 2313 |
| 339 | Ga0157374_10246341 | 3300013296 | Bacteria | 1758 |
| 340 | Ga0157378_10025900 | 3300013297 | Bacteria | 5168 |
| 341 | Ga0157378_10059126 | 3300013297 | Bacteria | 3419 |
| 342 | Ga0157378_10076219 | 3300013297 | Bacteria | 3021 |
| 343 | Ga0157378_10205292 | 3300013297 | Bacteria | 1866 |
| 344 | Ga0157378_10225973 | 3300013297 | Bacteria | 1781 |
| 345 | Ga0157378_10226018 | 3300013297 | Bacteria | 1781 |
| 346 | Ga0157378_10439617 | 3300013297 | Bacteria | 1293 |
| 347 | Ga0163162_10005459 | 3300013306 | Bacteria | 12283 |
| 348 | Ga0163162_10005575 | 3300013306 | Bacteria | 12177 |
| 349 | Ga0163162_10014444 | 3300013306 | Bacteria | 7715 |
| 350 | Ga0163162_10022644 | 3300013306 | Bacteria | 6194 |
| 351 | Ga0163162_10074167 | 3300013306 | Bacteria | 3460 |
| 352 | Ga0163162_10154069 | 3300013306 | Bacteria | 2417 |
| 353 | Ga0163162_11180129 | 3300013306 | Bacteria | 868 |
| 354 | Ga0157372_10059283 | 3300013307 | Bacteria | 4281 |
| 355 | Ga0157372_10360198 | 3300013307 | Bacteria | 1695 |
| 356 | Ga0157375_10002469 | 3300013308 | Bacteria | 16013 |
| 357 | Ga0157375_10004526 | 3300013308 | Bacteria | 12081 |
| 358 | Ga0157375_10006387 | 3300013308 | Bacteria | 10274 |
| 359 | Ga0157375_10048845 | 3300013308 | Bacteria | 4142 |
| 360 | Ga0157375_10052688 | 3300013308 | Bacteria | 4001 |
| 361 | Ga0157375_10077756 | 3300013308 | Bacteria | 3349 |
| 362 | Ga0157375_10125067 | 3300013308 | Bacteria | 2685 |
| 363 | Ga0157375_10197128 | 3300013308 | Bacteria | 2169 |
| 364 | Ga0157375_11289329 | 3300013308 | Bacteria | 858 |
| 365 | Ga0163163_10000689 | 3300014325 | Bacteria | 28712 |
| 366 | Ga0163163_10044884 | 3300014325 | Bacteria | 4337 |
| 367 | Ga0163163_10087119 | 3300014325 | Bacteria | 3133 |
| 368 | Ga0163163_10330808 | 3300014325 | Bacteria | 1578 |
| 369 | Ga0157380_10027611 | 3300014326 | Bacteria | 4318 |
| 370 | Ga0157380_10068261 | 3300014326 | Bacteria | 2865 |
| 371 | Ga0157380_10068761 | 3300014326 | Bacteria | 2856 |
| 372 | Ga0157380_10081889 | 3300014326 | Bacteria | 2641 |
| 373 | Ga0157380_10539762 | 3300014326 | Bacteria | 1142 |
| 374 | Ga0157377_10000047 | 3300014745 | Bacteria | 94451 |
| 375 | Ga0157377_10061033 | 3300014745 | Bacteria | 2154 |
| 376 | Ga0157379_10000858 | 3300014968 | Bacteria | 24649 |
| 377 | Ga0157379_10003863 | 3300014968 | Bacteria | 12770 |
| 378 | Ga0157379_10004449 | 3300014968 | Bacteria | 12018 |
| 379 | Ga0157379_10039788 | 3300014968 | Bacteria | 4195 |
| 380 | Ga0157379_10043521 | 3300014968 | Bacteria | 4009 |
| 381 | Ga0157379_10125926 | 3300014968 | Bacteria | 2305 |
| 382 | Ga0157379_10195591 | 3300014968 | Bacteria | 1827 |
| 383 | Ga0157376_10007657 | 3300014969 | Bacteria | 7734 |
| 384 | Ga0157376_10007747 | 3300014969 | Bacteria | 7696 |
| 385 | Ga0157376_10012373 | 3300014969 | Bacteria | 6332 |
| 386 | Ga0157376_10181649 | 3300014969 | Bacteria | 1923 |
| 387 | Ga0157376_10228127 | 3300014969 | Bacteria | 1728 |
| 388 | Ga0157376_10877646 | 3300014969 | Bacteria | 914 |
| 389 | Ga0163161_10011289 | 3300017792 | Bacteria | 6190 |
| 390 | Ga0163161_10039951 | 3300017792 | Bacteria | 3369 |
| 391 | Ga0163161_10040889 | 3300017792 | Bacteria | 3331 |
| 392 | Ga0163161_10051067 | 3300017792 | Bacteria | 2994 |
| 393 | Ga0163161_10056174 | 3300017792 | Bacteria | 2859 |
| 394 | Ga0209257_1011000 | 3300025304 | Bacteria | 4445 |
| 395 | Ga0207697_10059926 | 3300025315 | Bacteria | 1582 |
| 396 | Ga0207682_10009826 | 3300025893 | Bacteria | 3764 |
| 397 | Ga0207682_10030848 | 3300025893 | Bacteria | 2149 |
| 398 | Ga0207692_10152743 | 3300025898 | Bacteria | 1324 |
| 399 | Ga0207692_10476843 | 3300025898 | Bacteria | 789 |
| 400 | Ga0207642_10000852 | 3300025899 | Bacteria | 9489 |
| 401 | Ga0207642_10051891 | 3300025899 | Bacteria | 1858 |
| 402 | Ga0207642_10069057 | 3300025899 | Bacteria | 1674 |
| 403 | Ga0207710_10143368 | 3300025900 | Bacteria | 1155 |
| 404 | Ga0207710_10187497 | 3300025900 | Bacteria | 1017 |
| 405 | Ga0207680_10000458 | 3300025903 | Bacteria | 19273 |
| 406 | Ga0207680_10001962 | 3300025903 | Bacteria | 9626 |
| 407 | Ga0207680_10030074 | 3300025903 | Bacteria | 3058 |
| 408 | Ga0207680_10110288 | 3300025903 | Bacteria | 1783 |
| 409 | Ga0207647_10302587 | 3300025904 | Bacteria | 910 |
| 410 | Ga0207699_10146661 | 3300025906 | Bacteria | 1557 |
| 411 | Ga0207645_10001318 | 3300025907 | Bacteria | 20383 |
| 412 | Ga0207645_10005283 | 3300025907 | Bacteria | 9402 |
| 413 | Ga0207645_10021770 | 3300025907 | Bacteria | 4177 |
| 414 | Ga0207645_10026002 | 3300025907 | Bacteria | 3786 |
| 415 | Ga0207645_10098667 | 3300025907 | Bacteria | 1883 |
| 416 | Ga0207643_10010319 | 3300025908 | Bacteria | 5028 |
| 417 | Ga0207643_10011382 | 3300025908 | Bacteria | 4803 |
| 418 | Ga0207643_10065333 | 3300025908 | Bacteria | 2084 |
| 419 | Ga0207643_10076328 | 3300025908 | Bacteria | 1935 |
| 420 | Ga0207643_10178872 | 3300025908 | Bacteria | 1283 |
| 421 | Ga0207705_10193527 | 3300025909 | Bacteria | 1539 |
| 422 | Ga0207684_10026389 | 3300025910 | Bacteria | 4952 |
| 423 | Ga0207684_10082931 | 3300025910 | Bacteria | 2730 |
| 424 | Ga0207684_10122928 | 3300025910 | Bacteria | 2226 |
| 425 | Ga0207684_10123164 | 3300025910 | Bacteria | 2224 |
| 426 | Ga0207654_10003842 | 3300025911 | Bacteria | 7571 |
| 427 | Ga0207654_10094366 | 3300025911 | Bacteria | 1831 |
| 428 | Ga0207654_10190846 | 3300025911 | Bacteria | 1343 |
| 429 | Ga0207654_10237427 | 3300025911 | Bacteria | 1216 |
| 430 | Ga0207707_10055187 | 3300025912 | Bacteria | 3456 |
| 431 | Ga0207707_10079703 | 3300025912 | Bacteria | 2859 |
| 432 | Ga0207695_10180450 | 3300025913 | Bacteria | 2032 |
| 433 | Ga0207671_10016519 | 3300025914 | Bacteria | 5732 |
| 434 | Ga0207671_10394315 | 3300025914 | Bacteria | 1101 |
| 435 | Ga0207693_10001163 | 3300025915 | Bacteria | 23479 |
| 436 | Ga0207693_10044072 | 3300025915 | Bacteria | 3506 |
| 437 | Ga0207663_10002183 | 3300025916 | Bacteria | 9348 |
| 438 | Ga0207662_10026400 | 3300025918 | Bacteria | 3350 |
| 439 | Ga0207662_10201721 | 3300025918 | Bacteria | 1288 |
| 440 | Ga0207657_10000280 | 3300025919 | Bacteria | 54274 |
| 441 | Ga0207657_10265852 | 3300025919 | Bacteria | 1364 |
| 442 | Ga0207649_10010360 | 3300025920 | Bacteria | 5119 |
| 443 | Ga0207649_10077606 | 3300025920 | Bacteria | 2141 |
| 444 | Ga0207649_10139247 | 3300025920 | Bacteria | 1658 |
| 445 | Ga0207652_10080923 | 3300025921 | Bacteria | 2841 |
| 446 | Ga0207646_10010826 | 3300025922 | Bacteria | 8863 |
| 447 | Ga0207646_10465438 | 3300025922 | Bacteria | 1140 |
| 448 | Ga0207681_10002043 | 3300025923 | Bacteria | 12940 |
| 449 | Ga0207681_10026428 | 3300025923 | Bacteria | 3744 |
| 450 | Ga0207681_10126456 | 3300025923 | Bacteria | 1883 |
| 451 | Ga0207681_10287120 | 3300025923 | Bacteria | 1297 |
| 452 | Ga0207694_10168492 | 3300025924 | Bacteria | 1772 |
| 453 | Ga0207694_10367874 | 3300025924 | Bacteria | 1192 |
| 454 | Ga0207650_10001150 | 3300025925 | Bacteria | 19435 |
| 455 | Ga0207650_10014573 | 3300025925 | Bacteria | 5461 |
| 456 | Ga0207650_10064700 | 3300025925 | Bacteria | 2738 |
| 457 | Ga0207650_10093449 | 3300025925 | Bacteria | 2302 |
| 458 | Ga0207650_10111783 | 3300025925 | Bacteria | 2116 |
| 459 | Ga0207650_10303220 | 3300025925 | Bacteria | 1305 |
| 460 | Ga0207659_10000313 | 3300025926 | Bacteria | 29491 |
| 461 | Ga0207659_10001947 | 3300025926 | Bacteria | 12255 |
| 462 | Ga0207659_10021930 | 3300025926 | Bacteria | 4247 |
| 463 | Ga0207659_10056065 | 3300025926 | Bacteria | 2821 |
| 464 | Ga0207659_10238648 | 3300025926 | Bacteria | 1469 |
| 465 | Ga0207687_10000741 | 3300025927 | Bacteria | 22128 |
| 466 | Ga0207687_10061247 | 3300025927 | Bacteria | 2657 |
| 467 | Ga0207687_10345439 | 3300025927 | Bacteria | 1211 |
| 468 | Ga0207700_10438709 | 3300025928 | Bacteria | 1149 |
| 469 | Ga0207644_10000517 | 3300025931 | Bacteria | 24952 |
| 470 | Ga0207644_10002123 | 3300025931 | Bacteria | 12863 |
| 471 | Ga0207644_10004658 | 3300025931 | Bacteria | 8914 |
| 472 | Ga0207644_10005549 | 3300025931 | Bacteria | 8209 |
| 473 | Ga0207644_10031525 | 3300025931 | Bacteria | 3693 |
| 474 | Ga0207644_10100751 | 3300025931 | Bacteria | 2169 |
| 475 | Ga0207644_10172753 | 3300025931 | Bacteria | 1688 |
| 476 | Ga0207644_10213745 | 3300025931 | Bacteria | 1526 |
| 477 | Ga0207644_10406883 | 3300025931 | Bacteria | 1113 |
| 478 | Ga0207690_10036473 | 3300025932 | Bacteria | 3184 |
| 479 | Ga0207690_10065445 | 3300025932 | Bacteria | 2486 |
| 480 | Ga0207690_10527940 | 3300025932 | Bacteria | 957 |
| 481 | Ga0207706_10012311 | 3300025933 | Bacteria | 7793 |
| 482 | Ga0207706_10025594 | 3300025933 | Bacteria | 5286 |
| 483 | Ga0207706_10027747 | 3300025933 | Bacteria | 5061 |
| 484 | Ga0207706_10124061 | 3300025933 | Bacteria | 2272 |
| 485 | Ga0207686_10000521 | 3300025934 | Bacteria | 24900 |
| 486 | Ga0207670_10000894 | 3300025936 | Bacteria | 15736 |
| 487 | Ga0207670_10014247 | 3300025936 | Bacteria | 4714 |
| 488 | Ga0207670_10094199 | 3300025936 | Bacteria | 2124 |
| 489 | Ga0207669_10011731 | 3300025937 | Bacteria | 4279 |
| 490 | Ga0207669_10031901 | 3300025937 | Bacteria | 2950 |
| 491 | Ga0207669_10034806 | 3300025937 | Bacteria | 2858 |
| 492 | Ga0207669_10309881 | 3300025937 | Bacteria | 1203 |
| 493 | Ga0207669_10328371 | 3300025937 | Bacteria | 1173 |
| 494 | Ga0207669_10334879 | 3300025937 | Bacteria | 1163 |
| 495 | Ga0207704_10008876 | 3300025938 | Bacteria | 4828 |
| 496 | Ga0207704_10015099 | 3300025938 | Bacteria | 3925 |
| 497 | Ga0207704_10036082 | 3300025938 | Bacteria | 2841 |
| 498 | Ga0207704_10180678 | 3300025938 | Bacteria | 1524 |
| 499 | Ga0207704_10287762 | 3300025938 | Bacteria | 1252 |
| 500 | Ga0207665_10004353 | 3300025939 | Bacteria | 9406 |
| 501 | Ga0207665_10025043 | 3300025939 | Bacteria | 3935 |
| 502 | Ga0207665_10125350 | 3300025939 | Bacteria | 1818 |
| 503 | Ga0207691_10000249 | 3300025940 | Bacteria | 53276 |
| 504 | Ga0207691_10005968 | 3300025940 | Bacteria | 11764 |
| 505 | Ga0207691_10015882 | 3300025940 | Bacteria | 7155 |
| 506 | Ga0207691_10044197 | 3300025940 | Bacteria | 4102 |
| 507 | Ga0207691_10086127 | 3300025940 | Bacteria | 2819 |
| 508 | Ga0207691_10093556 | 3300025940 | Bacteria | 2691 |
| 509 | Ga0207691_10109171 | 3300025940 | Bacteria | 2461 |
| 510 | Ga0207691_10130041 | 3300025940 | Bacteria | 2225 |
| 511 | Ga0207691_10257792 | 3300025940 | Bacteria | 1504 |
| 512 | Ga0207711_10000448 | 3300025941 | Bacteria | 43007 |
| 513 | Ga0207711_10015792 | 3300025941 | Bacteria | 6264 |
| 514 | Ga0207711_10030180 | 3300025941 | Bacteria | 4572 |
| 515 | Ga0207711_10100675 | 3300025941 | Bacteria | 2556 |
| 516 | Ga0207711_10301634 | 3300025941 | Bacteria | 1477 |
| 517 | Ga0207711_10382017 | 3300025941 | Bacteria | 1307 |
| 518 | Ga0207689_10002181 | 3300025942 | Bacteria | 18377 |
| 519 | Ga0207689_10005377 | 3300025942 | Bacteria | 11463 |
| 520 | Ga0207689_10009869 | 3300025942 | Bacteria | 8230 |
| 521 | Ga0207689_10037236 | 3300025942 | Bacteria | 4036 |
| 522 | Ga0207689_10073788 | 3300025942 | Bacteria | 2803 |
| 523 | Ga0207689_10181727 | 3300025942 | Bacteria | 1734 |
| 524 | Ga0207689_10225844 | 3300025942 | Bacteria | 1547 |
| 525 | Ga0207661_10028878 | 3300025944 | Bacteria | 4252 |
| 526 | Ga0207661_10187410 | 3300025944 | Bacteria | 1812 |
| 527 | Ga0207679_10061296 | 3300025945 | Bacteria | 2800 |
| 528 | Ga0207679_10247848 | 3300025945 | Bacteria | 1513 |
| 529 | Ga0207679_10286217 | 3300025945 | Bacteria | 1415 |
| 530 | Ga0207667_10064079 | 3300025949 | Bacteria | 3839 |
| 531 | Ga0207667_10067633 | 3300025949 | Bacteria | 3721 |
| 532 | Ga0207667_10302926 | 3300025949 | Bacteria | 1633 |
| 533 | Ga0207651_10000600 | 3300025960 | Bacteria | 15181 |
| 534 | Ga0207651_10002125 | 3300025960 | Bacteria | 9356 |
| 535 | Ga0207651_10006459 | 3300025960 | Bacteria | 6140 |
| 536 | Ga0207651_10104767 | 3300025960 | Bacteria | 2108 |
| 537 | Ga0207651_10224419 | 3300025960 | Bacteria | 1521 |
| 538 | Ga0207651_10487669 | 3300025960 | Bacteria | 1063 |
| 539 | Ga0207712_10032745 | 3300025961 | Bacteria | 3510 |
| 540 | Ga0207712_10099473 | 3300025961 | Bacteria | 2159 |
| 541 | Ga0207668_10002554 | 3300025972 | Bacteria | 10635 |
| 542 | Ga0207640_10006937 | 3300025981 | Bacteria | 6232 |
| 543 | Ga0207640_10100204 | 3300025981 | Bacteria | 2029 |
| 544 | Ga0207640_10271458 | 3300025981 | Bacteria | 1327 |
| 545 | Ga0207640_10624108 | 3300025981 | Bacteria | 915 |
| 546 | Ga0207658_10000812 | 3300025986 | Bacteria | 26147 |
| 547 | Ga0207658_10001272 | 3300025986 | Bacteria | 19944 |
| 548 | Ga0207658_10004524 | 3300025986 | Bacteria | 9661 |
| 549 | Ga0207658_10006610 | 3300025986 | Bacteria | 7902 |
| 550 | Ga0207658_10042260 | 3300025986 | Bacteria | 3305 |
| 551 | Ga0207658_10069198 | 3300025986 | Bacteria | 2666 |
| 552 | Ga0207658_10082425 | 3300025986 | Bacteria | 2470 |
| 553 | Ga0207658_10084055 | 3300025986 | Bacteria | 2448 |
| 554 | Ga0207677_10000253 | 3300026023 | Bacteria | 41332 |
| 555 | Ga0207677_10003852 | 3300026023 | Bacteria | 7986 |
| 556 | Ga0207677_10027628 | 3300026023 | Bacteria | 3578 |
| 557 | Ga0207677_10107242 | 3300026023 | Bacteria | 2071 |
| 558 | Ga0207677_10161090 | 3300026023 | Bacteria | 1743 |
| 559 | Ga0207703_10000517 | 3300026035 | Bacteria | 39928 |
| 560 | Ga0207703_10000929 | 3300026035 | Bacteria | 28489 |
| 561 | Ga0207703_10001541 | 3300026035 | Bacteria | 20913 |
| 562 | Ga0207703_10002267 | 3300026035 | Bacteria | 16814 |
| 563 | Ga0207703_10012267 | 3300026035 | Bacteria | 6683 |
| 564 | Ga0207703_10074906 | 3300026035 | Bacteria | 2804 |
| 565 | Ga0207703_10146894 | 3300026035 | Bacteria | 2052 |
| 566 | Ga0207703_10305468 | 3300026035 | Bacteria | 1452 |
| 567 | Ga0207703_10344020 | 3300026035 | Bacteria | 1371 |
| 568 | Ga0207703_10475492 | 3300026035 | Bacteria | 1170 |
| 569 | Ga0207703_10629739 | 3300026035 | Bacteria | 1016 |
| 570 | Ga0207639_10011019 | 3300026041 | Bacteria | 6269 |
| 571 | Ga0207639_10029896 | 3300026041 | Bacteria | 3993 |
| 572 | Ga0207639_10057994 | 3300026041 | Bacteria | 2976 |
| 573 | Ga0207639_10107392 | 3300026041 | Bacteria | 2267 |
| 574 | Ga0207639_10383595 | 3300026041 | Bacteria | 1262 |
| 575 | Ga0207639_10636952 | 3300026041 | Bacteria | 985 |
| 576 | Ga0207678_10002428 | 3300026067 | Bacteria | 16950 |
| 577 | Ga0207678_10170155 | 3300026067 | Bacteria | 1860 |
| 578 | Ga0207678_10283317 | 3300026067 | Bacteria | 1423 |
| 579 | Ga0207708_10077651 | 3300026075 | Bacteria | 2548 |
| 580 | Ga0207708_10200100 | 3300026075 | Bacteria | 1594 |
| 581 | Ga0207702_10009791 | 3300026078 | Bacteria | 8039 |
| 582 | Ga0207702_10031029 | 3300026078 | Bacteria | 4455 |
| 583 | Ga0207702_10230902 | 3300026078 | Bacteria | 1729 |
| 584 | Ga0207702_10574596 | 3300026078 | Bacteria | 1104 |
| 585 | Ga0207641_10000374 | 3300026088 | Bacteria | 53088 |
| 586 | Ga0207641_10000610 | 3300026088 | Bacteria | 39160 |
| 587 | Ga0207641_10000655 | 3300026088 | Bacteria | 37743 |
| 588 | Ga0207641_10073091 | 3300026088 | Bacteria | 2955 |
| 589 | Ga0207648_10000523 | 3300026089 | Bacteria | 42961 |
| 590 | Ga0207648_10006616 | 3300026089 | Bacteria | 11512 |
| 591 | Ga0207648_10009462 | 3300026089 | Bacteria | 9333 |
| 592 | Ga0207648_10013282 | 3300026089 | Bacteria | 7672 |
| 593 | Ga0207648_10022490 | 3300026089 | Bacteria | 5659 |
| 594 | Ga0207648_10065401 | 3300026089 | Bacteria | 3170 |
| 595 | Ga0207648_10073149 | 3300026089 | Bacteria | 2987 |
| 596 | Ga0207676_10000167 | 3300026095 | Bacteria | 57507 |
| 597 | Ga0207676_10002990 | 3300026095 | Bacteria | 12054 |
| 598 | Ga0207676_10012265 | 3300026095 | Bacteria | 6134 |
| 599 | Ga0207676_10025604 | 3300026095 | Bacteria | 4378 |
| 600 | Ga0207676_10261563 | 3300026095 | Bacteria | 1563 |
| 601 | Ga0207676_10488707 | 3300026095 | Bacteria | 1167 |
| 602 | Ga0207676_10489257 | 3300026095 | Bacteria | 1166 |
| 603 | Ga0207674_10051412 | 3300026116 | Bacteria | 4205 |
| 604 | Ga0207674_10075205 | 3300026116 | Bacteria | 3388 |
| 605 | Ga0207674_10124573 | 3300026116 | Bacteria | 2543 |
| 606 | Ga0207674_10184357 | 3300026116 | Bacteria | 2038 |
| 607 | Ga0207674_10201652 | 3300026116 | Bacteria | 1939 |
| 608 | Ga0207675_100000956 | 3300026118 | Bacteria | 28809 |
| 609 | Ga0207675_100008746 | 3300026118 | Bacteria | 9511 |
| 610 | Ga0207675_100009453 | 3300026118 | Bacteria | 9126 |
| 611 | Ga0207675_100037246 | 3300026118 | Bacteria | 4538 |
| 612 | Ga0207675_100057657 | 3300026118 | Bacteria | 3624 |
| 613 | Ga0207675_100070994 | 3300026118 | Bacteria | 3255 |
| 614 | Ga0207675_100073780 | 3300026118 | Bacteria | 3192 |
| 615 | Ga0207675_100105278 | 3300026118 | Bacteria | 2659 |
| 616 | Ga0207675_100339083 | 3300026118 | Bacteria | 1471 |
| 617 | Ga0207683_10000476 | 3300026121 | Bacteria | 37318 |
| 618 | Ga0207683_10000965 | 3300026121 | Bacteria | 26325 |
| 619 | Ga0207683_10010865 | 3300026121 | Bacteria | 7765 |
| 620 | Ga0207683_10060215 | 3300026121 | Bacteria | 3337 |
| 621 | Ga0207683_10067830 | 3300026121 | Bacteria | 3148 |
| 622 | Ga0207683_10418544 | 3300026121 | Bacteria | 1234 |
| 623 | Ga0207683_10457631 | 3300026121 | Bacteria | 1177 |
| 624 | Ga0207698_10011374 | 3300026142 | Bacteria | 5768 |
| 625 | Ga0207698_10015009 | 3300026142 | Bacteria | 5172 |
| 626 | Ga0207698_10031064 | 3300026142 | Bacteria | 3851 |
| 627 | Ga0207698_10073747 | 3300026142 | Bacteria | 2719 |
| 628 | Ga0207698_10114530 | 3300026142 | Bacteria | 2268 |
| 629 | Ga0207698_10142504 | 3300026142 | Bacteria | 2067 |
| 630 | Ga0207698_10422331 | 3300026142 | Bacteria | 1280 |
| 631 | Ga0268266_10005004 | 3300028379 | Bacteria | 12519 |
| 632 | Ga0268266_10005562 | 3300028379 | Bacteria | 11729 |
| 633 | Ga0268266_10139611 | 3300028379 | Bacteria | 2174 |
| 634 | Ga0268266_10361038 | 3300028379 | Bacteria | 1367 |
| 635 | Ga0268266_10769759 | 3300028379 | Bacteria | 929 |
| 636 | Ga0268265_10067967 | 3300028380 | Bacteria | 2761 |
| 637 | Ga0268265_10464116 | 3300028380 | Bacteria | 1185 |
| 638 | Ga0268264_10001027 | 3300028381 | Bacteria | 28045 |
| 639 | Ga0268264_10002170 | 3300028381 | Bacteria | 17490 |
| 640 | Ga0268264_10002850 | 3300028381 | Bacteria | 15079 |
| 641 | Ga0268264_10005179 | 3300028381 | Bacteria | 11047 |
| 642 | Ga0268264_10005310 | 3300028381 | Bacteria | 10907 |
| 643 | Ga0268264_10043681 | 3300028381 | Bacteria | 3715 |
| 644 | Ga0268264_10111146 | 3300028381 | Bacteria | 2400 |
| 645 | Ga0268264_10427501 | 3300028381 | Bacteria | 1278 |
| 646 | Ga0307515_10000240 | 3300028794 | Bacteria | 135655 |
| 647 | Ga0307515_10003269 | 3300028794 | Bacteria | 34269 |
| 648 | Ga0307515_10032662 | 3300028794 | Bacteria | 8609 |
| 649 | Ga0265330_10004062 | 3300031235 | Bacteria | 7506 |
| 650 | Ga0265332_10002489 | 3300031238 | Bacteria | 9372 |
| 651 | Ga0265329_10018394 | 3300031242 | Bacteria | 2391 |
| 652 | Ga0265331_10001690 | 3300031250 | Bacteria | 15915 |
| 653 | Ga0265327_10004035 | 3300031251 | Bacteria | 13340 |
| 654 | Ga0265327_10010785 | 3300031251 | Bacteria | 6373 |
| 655 | Ga0265327_10059222 | 3300031251 | Bacteria | 1962 |
| 656 | Ga0265316_10000391 | 3300031344 | Bacteria | 50025 |
| 657 | Ga0265316_10014609 | 3300031344 | Bacteria | 6902 |
| 658 | Ga0307509_10086371 | 3300031507 | Bacteria | 3226 |
| 659 | Ga0307509_10132030 | 3300031507 | Bacteria | 2450 |
| 660 | Ga0307508_10001476 | 3300031616 | Bacteria | 26376 |
| 661 | Ga0307514_10005105 | 3300031649 | Bacteria | 11863 |
| 662 | Ga0265314_10009278 | 3300031711 | Bacteria | 8333 |
| 663 | Ga0265342_10020514 | 3300031712 | Bacteria | 4236 |
| 664 | Ga0307516_10112272 | 3300031730 | Bacteria | 2526 |
| 665 | Ga0307405_10007522 | 3300031731 | Bacteria | 5455 |
| 666 | Ga0307410_10166727 | 3300031852 | Bacteria | 1656 |
| 667 | Ga0307407_10062245 | 3300031903 | Bacteria | 2185 |
| 668 | Ga0307409_100001376 | 3300031995 | Bacteria | 11862 |
| 669 | Ga0307414_10084315 | 3300032004 | Bacteria | 2337 |
| 670 | Ga0307411_10228744 | 3300032005 | Bacteria | 1448 |
| 671 | Ga0307415_100006664 | 3300032126 | Bacteria | 6250 |
| 672 | Ga0307415_100609229 | 3300032126 | Bacteria | 973 |
| 673 | Ga0307507_10019471 | 3300033179 | Bacteria | 7642 |
| 674 | Ga0307510_10160299 | 3300033180 | Bacteria | 1848 |
| 675 | Ga0373926_0000538 | 3300035083 | Bacteria | 10133 |
| 676 | Ga0373934_0010461 | 3300035086 | Bacteria | 3481 |
| 677 | Ga0373944_0008176 | 3300035089 | Bacteria | 2821 |
| 678 | Ga0373923_0001149 | 3300035111 | Bacteria | 7344 |
| 679 | Ga0373923_0022357 | 3300035111 | Bacteria | 2479 |
| 680 | Ga0373923_0120251 | 3300035111 | Bacteria | 1173 |
| 681 | Ga0373936_0004984 | 3300035113 | Bacteria | 5000 |
| 682 | Ga0373936_0034218 | 3300035113 | Bacteria | 2017 |
| 683 | Ga0373945_0021459 | 3300035116 | Bacteria | 2219 |
| 684 | Ga0373945_0049386 | 3300035116 | Bacteria | 1544 |
| 685 | Ga0373945_0063728 | 3300035116 | Bacteria | 1381 |
| 686 | Ga0373954_0000524 | 3300035118 | Bacteria | 14404 |
| 687 | Ga0373954_0024736 | 3300035118 | Bacteria | 2739 |
| 688 | Ga0373956_0012689 | 3300035119 | Bacteria | 3496 |
| 689 | Ga0373956_0017997 | 3300035119 | Bacteria | 2988 |
| 690 | Ga0373956_0182603 | 3300035119 | Bacteria | 992 |
| 691 | Ga0373957_0000976 | 3300035120 | Bacteria | 7508 |
| 692 | Ga0373943_0028575 | 3300035170 | Bacteria | 2628 |
| 693 | Ga0373943_0065725 | 3300035170 | Bacteria | 1824 |
| 694 | Ga0373946_0017324 | 3300035171 | Bacteria | 2756 |
| 695 | Ga0373946_0021281 | 3300035171 | Bacteria | 2514 |
| 696 | Ga0373946_0038127 | 3300035171 | Bacteria | 1957 |
| 697 | Ga0373955_0033139 | 3300035172 | Bacteria | 2718 |
| 698 | Ga0373955_0036706 | 3300035172 | Bacteria | 2602 |
| 699 | Ga0373955_0261355 | 3300035172 | Bacteria | 1039 |
| 700 | Ga0373924_0002572 | 3300035410 | Bacteria | 6121 |
| 701 | Ga0373924_0012784 | 3300035410 | Bacteria | 3141 |
| 702 | Ga0373924_0097463 | 3300035410 | Bacteria | 1263 |
| 703 | Ga0373935_0028592 | 3300035692 | Bacteria | 3445 |
| 704 | Ga0373927_0117951 | 3300035695 | Bacteria | 1731 |
| 705 | Ga0373927_0130344 | 3300035695 | Bacteria | 1643 |
| 706 | Ga0373927_0263878 | 3300035695 | Bacteria | 1133 |
| 707 | Ga0373933_0001547 | 3300035724 | Bacteria | 13469 |
| 708 | Ga0373933_0011412 | 3300035724 | Bacteria | 4895 |
| 709 | Ga0373933_0027815 | 3300035724 | Bacteria | 3259 |
| 710 | Ga0373933_0036668 | 3300035724 | Bacteria | 2872 |
| 711 | Ga0373947_0068623 | 3300035725 | Bacteria | 2168 |
| 712 | Ga0373947_0210112 | 3300035725 | Bacteria | 1276 |
| 713 | Ga0373947_0345130 | 3300035725 | Bacteria | 998 |
| 714 | Ga0373937_0015112 | 3300036401 | Bacteria | 6820 |
| 715 | Ga0373937_0032191 | 3300036401 | Bacteria | 4755 |
| 716 | Ga0373937_0032560 | 3300036401 | Bacteria | 4729 |
| 717 | Ga0373937_0049100 | 3300036401 | Bacteria | 3864 |
| 718 | Ga0373937_0080351 | 3300036401 | Bacteria | 3015 |
| 719 | Ga0373937_0243794 | 3300036401 | Bacteria | 1693 |
| 720 | Ga0373937_0272057 | 3300036401 | Bacteria | 1599 |
| 721 | Ga0373937_0287946 | 3300036401 | Bacteria | 1552 |
| 722 | Ga0316582_0000275 | 3300036647 | Bacteria | 17519 |
| 723 | Ga0316584_0002877 | 3300036712 | Bacteria | 11039 |
| 724 | Ga0373925_0007555 | 3300037068 | Bacteria | 7921 |
| 725 | Ga0373925_0018839 | 3300037068 | Bacteria | 5018 |
| 726 | Ga0373925_0028685 | 3300037068 | Bacteria | 4078 |
| 727 | Ga0373925_0043701 | 3300037068 | Bacteria | 3326 |
| 728 | Ga0373925_0106671 | 3300037068 | Bacteria | 2160 |
| 729 | Ga0373925_0473308 | 3300037068 | Bacteria | 1027 |
| 730 | Ga0373925_0600347 | 3300037068 | Bacteria | 906 |
| 731 | Ga0395905_0052315 | 3300037471 | Bacteria | 3823 |
| 732 | Ga0316581_0003201 | 3300037588 | Bacteria | 4048 |
| 733 | Ga0436363_0944619 | 3300039450 | Bacteria | 1957 |
| 734 | Ga0451853_2845378 | 3300041512 | Bacteria | 1028 |
| 735 | Ga0439443_010295 | 3300042003 | Bacteria | 1354 |
| 736 | Ga0451577_0006056 | 3300042876 | Bacteria | 12164 |
| 737 | Ga0451577_0028215 | 3300042876 | Bacteria | 5078 |
| 738 | Ga0451577_0303322 | 3300042876 | Bacteria | 1447 |
| 739 | Ga0453683_0002919 | 3300044673 | Bacteria | 12916 |
| 740 | Ga0453684_0023590 | 3300044712 | Bacteria | 9046 |
| 741 | Ga0466960_0042923 | 3300044901 | Bacteria | 2149 |
| 742 | Ga0451576_0009861 | 3300045051 | Bacteria | 11034 |
| 743 | Ga0451576_0031288 | 3300045051 | Bacteria | 5676 |
| 744 | Ga0451576_0187226 | 3300045051 | Bacteria | 2162 |
| 745 | Ga0451576_0493405 | 3300045051 | Bacteria | 1286 |
| 746 | Ga0495592_0033494 | 3300046454 | Bacteria | 3874 |
| 747 | Ga0495603_0000495 | 3300046455 | Bacteria | 21792 |
| 748 | Ga0495603_0297075 | 3300046455 | Bacteria | 928 |
| 749 | Ga0495629_0011863 | 3300046459 | Bacteria | 6319 |
| 750 | Ga0495641_0004406 | 3300046461 | Bacteria | 9967 |
| 751 | Ga0495651_0005497 | 3300046462 | Bacteria | 9667 |
| 752 | Ga0495653_0002547 | 3300046463 | Bacteria | 14525 |
| 753 | Ga0495650_0055747 | 3300046471 | Bacteria | 1607 |
| 754 | Ga0495580_0000400 | 3300046472 | Bacteria | 35542 |
| 755 | Ga0495580_0014629 | 3300046472 | Bacteria | 5947 |
| 756 | Ga0495580_0035978 | 3300046472 | Bacteria | 3558 |
| 757 | Ga0495580_0050624 | 3300046472 | Bacteria | 2937 |
| 758 | Ga0495580_0065337 | 3300046472 | Bacteria | 2548 |
| 759 | Ga0495582_0006109 | 3300046473 | Bacteria | 6703 |
| 760 | Ga0495582_0051344 | 3300046473 | Bacteria | 2273 |
| 761 | Ga0495582_0137236 | 3300046473 | Bacteria | 1384 |
| 762 | Ga0495582_0304836 | 3300046473 | Bacteria | 916 |
| 763 | Ga0495639_0002708 | 3300046475 | Bacteria | 7707 |
| 764 | Ga0495639_0023118 | 3300046475 | Bacteria | 2730 |
| 765 | Ga0495639_0025893 | 3300046475 | Bacteria | 2589 |
| 766 | Ga0495662_0015640 | 3300046476 | Bacteria | 3682 |
| 767 | Ga0495662_0098419 | 3300046476 | Bacteria | 1430 |
| 768 | Ga0495664_0030369 | 3300046477 | Bacteria | 3165 |
| 769 | Ga0495664_0032401 | 3300046477 | Bacteria | 3066 |
| 770 | Ga0495664_0155380 | 3300046477 | Bacteria | 1388 |
| 771 | Ga0495594_0077326 | 3300046499 | Bacteria | 1856 |
| 772 | Ga0495608_0013445 | 3300046511 | Bacteria | 5676 |
| 773 | Ga0495630_0004190 | 3300046517 | Bacteria | 10097 |
| 774 | Ga0495630_0067811 | 3300046517 | Bacteria | 2682 |
| 775 | Ga0495632_0006371 | 3300046519 | Bacteria | 7607 |
| 776 | Ga0495643_0066167 | 3300046522 | Bacteria | 1907 |
| 777 | Ga0495666_0018735 | 3300046526 | Bacteria | 3440 |
| 778 | Ga0495665_0017444 | 3300046531 | Bacteria | 3861 |
| 779 | Ga0495665_0038597 | 3300046531 | Bacteria | 2546 |
| 780 | Ga0495665_0049519 | 3300046531 | Bacteria | 2227 |
| 781 | Ga0495640_0028050 | 3300046533 | Bacteria | 4055 |
| 782 | Ga0495586_0003105 | 3300046535 | Bacteria | 8952 |
| 783 | Ga0495586_0013809 | 3300046535 | Bacteria | 4285 |
| 784 | Ga0495586_0080431 | 3300046535 | Bacteria | 1790 |
| 785 | Ga0495587_0024333 | 3300046536 | Bacteria | 3712 |
| 786 | Ga0495597_0097878 | 3300046542 | Bacteria | 1239 |
| 787 | Ga0495645_0067218 | 3300046543 | Bacteria | 2588 |
| 788 | Ga0495645_0141655 | 3300046543 | Bacteria | 1677 |
| 789 | Ga0495622_0036285 | 3300046557 | Bacteria | 2299 |
| 790 | Ga0495667_0051603 | 3300046559 | Bacteria | 2712 |
| 791 | Ga0495667_0243437 | 3300046559 | Bacteria | 1145 |
| 792 | Ga0495668_0037713 | 3300046616 | Bacteria | 2704 |
| 793 | Ga0495634_0019778 | 3300046642 | Bacteria | 4779 |
| 794 | Ga0495634_0069913 | 3300046642 | Bacteria | 2315 |
| 795 | Ga0495625_0039033 | 3300046660 | Bacteria | 3470 |
| 796 | Ga0495635_0018827 | 3300046663 | Bacteria | 4818 |
| 797 | Ga0495635_0083751 | 3300046663 | Bacteria | 2182 |
| 798 | Ga0495588_0028034 | 3300046674 | Bacteria | 2817 |
| 799 | Ga0495588_0082110 | 3300046674 | Bacteria | 1683 |
| 800 | Ga0495657_0022306 | 3300046675 | Bacteria | 4537 |
| 801 | Ga0495599_0022755 | 3300046678 | Bacteria | 3914 |
| 802 | Ga0495599_0069856 | 3300046678 | Bacteria | 2192 |
| 803 | Ga0495623_0034959 | 3300046679 | Bacteria | 3222 |
| 804 | Ga0495646_0216384 | 3300046680 | Bacteria | 1038 |
| 805 | Ga0495647_0000194 | 3300046681 | Bacteria | 16186 |
| 806 | Ga0495647_0011741 | 3300046681 | Bacteria | 3004 |
| 807 | Ga0495647_0036397 | 3300046681 | Bacteria | 1852 |
| 808 | Ga0495647_0121502 | 3300046681 | Bacteria | 1099 |
| 809 | Ga0495658_0005064 | 3300046683 | Bacteria | 6476 |
| 810 | Ga0495658_0021101 | 3300046683 | Bacteria | 3429 |
| 811 | Ga0495658_0032524 | 3300046683 | Bacteria | 2849 |
| 812 | Ga0495658_0035505 | 3300046683 | Bacteria | 2744 |
| 813 | Ga0495658_0049562 | 3300046683 | Bacteria | 2373 |
| 814 | Ga0495658_0089696 | 3300046683 | Bacteria | 1818 |
| 815 | Ga0495613_0008532 | 3300046689 | Bacteria | 7605 |
| 816 | Ga0495613_0072673 | 3300046689 | Bacteria | 2507 |
| 817 | Ga0495624_0057445 | 3300046690 | Bacteria | 2446 |
| 818 | Ga0495624_0420079 | 3300046690 | Bacteria | 802 |
| 819 | Ga0495649_0003045 | 3300046694 | Bacteria | 11498 |
| 820 | Ga0495600_0022922 | 3300046809 | Bacteria | 4013 |
| 821 | Ga0495600_0087997 | 3300046809 | Bacteria | 2026 |
| 822 | Ga0495600_0256770 | 3300046809 | Bacteria | 1111 |
| 823 | Ga0495660_0044144 | 3300046810 | Bacteria | 2454 |
| 824 | Ga0495581_0006167 | 3300047315 | Bacteria | 6953 |
| 825 | Ga0495581_0045007 | 3300047315 | Bacteria | 2552 |
| 826 | Ga0495604_0097090 | 3300047317 | Bacteria | 2173 |
| 827 | Ga0495674_0059696 | 3300047319 | Bacteria | 3330 |
| 828 | Ga0495674_0272692 | 3300047319 | Bacteria | 1388 |
| 829 | Ga0495680_0010104 | 3300047322 | Bacteria | 8439 |
| 830 | Ga0495680_0040379 | 3300047322 | Bacteria | 3719 |
| 831 | Ga0495687_000364 | 3300047443 | Bacteria | 56454 |
| 832 | Ga0495687_006950 | 3300047443 | Bacteria | 6805 |
| 833 | Ga0495675_0017142 | 3300047444 | Bacteria | 4585 |
| 834 | Ga0495681_0121096 | 3300047470 | Bacteria | 1123 |
| 835 | Ga0495684_0040402 | 3300047471 | Bacteria | 3576 |
| 836 | Ga0495684_0123832 | 3300047471 | Bacteria | 1946 |
| 837 | Ga0495602_0127416 | 3300048088 | Bacteria | 2037 |
| 838 | Ga0495626_0081747 | 3300048091 | Bacteria | 1434 |
| 839 | Ga0496100_0068160 | 3300048903 | Bacteria | 2365 |
| 840 | Ga0496100_0208603 | 3300048903 | Bacteria | 1428 |
| 841 | Ga0496101_0012612 | 3300048904 | Bacteria | 5644 |
| 842 | Ga0496101_0361781 | 3300048904 | Bacteria | 1141 |
| 843 | Ga0496101_0460325 | 3300048904 | Bacteria | 1004 |
| 844 | Ga0496102_0150328 | 3300048905 | Bacteria | 2188 |
| 845 | Ga0496104_0002793 | 3300048907 | Bacteria | 15045 |
| 846 | Ga0496104_0424300 | 3300048907 | Bacteria | 1242 |
| 847 | Ga0496105_0022747 | 3300048908 | Bacteria | 5078 |
| 848 | Ga0496105_0140740 | 3300048908 | Bacteria | 1986 |
| 849 | Ga0496106_0053765 | 3300048909 | Bacteria | 3042 |
| 850 | Ga0496106_0396733 | 3300048909 | Bacteria | 1109 |
| 851 | Ga0496107_0101771 | 3300048910 | Bacteria | 2107 |
| 852 | Ga0496108_0099605 | 3300048911 | Bacteria | 2478 |
| 853 | Ga0496108_0238384 | 3300048911 | Bacteria | 1582 |
| 854 | Ga0496108_0260503 | 3300048911 | Bacteria | 1509 |
| 855 | Ga0496109_0006393 | 3300048912 | Bacteria | 9920 |
| 856 | Ga0496109_0077834 | 3300048912 | Bacteria | 3052 |
| 857 | Ga0496109_0083807 | 3300048912 | Bacteria | 2940 |
| 858 | Ga0496109_0160408 | 3300048912 | Bacteria | 2107 |
| 859 | Ga0496109_0213379 | 3300048912 | Bacteria | 1815 |
| 860 | Ga0496110_0013837 | 3300048913 | Bacteria | 6686 |
| 861 | Ga0496110_0672363 | 3300048913 | Bacteria | 936 |
| 862 | Ga0496111_0065975 | 3300048914 | Bacteria | 2628 |
| 863 | Ga0496111_0094672 | 3300048914 | Bacteria | 2191 |
| 864 | Ga0496112_0001041 | 3300048915 | Bacteria | 20441 |
| 865 | Ga0496112_0778369 | 3300048915 | Bacteria | 882 |
| 866 | Ga0496113_0022247 | 3300048916 | Bacteria | 4482 |
| 867 | Ga0496114_0063262 | 3300048917 | Bacteria | 3098 |
| 868 | Ga0496114_0169931 | 3300048917 | Bacteria | 1899 |
| 869 | Ga0501031_0069128 | 3300049568 | Bacteria | 2300 |
| 870 | Ga0501036_0000096 | 3300049572 | Bacteria | 54442 |
| 871 | Ga0501036_0099909 | 3300049572 | Bacteria | 2454 |
| 872 | Ga0501038_0000475 | 3300049574 | Bacteria | 35310 |
| 873 | Ga0501039_0000494 | 3300049575 | Bacteria | 28535 |
| 874 | Ga0501039_0065576 | 3300049575 | Bacteria | 2817 |
| 875 | Ga0501039_0139102 | 3300049575 | Bacteria | 1907 |
| 876 | Ga0501040_0000047 | 3300049576 | Bacteria | 55739 |
| 877 | Ga0501041_0005369 | 3300049577 | Bacteria | 7506 |
| 878 | Ga0501041_0060581 | 3300049577 | Bacteria | 2317 |
| 879 | Ga0501041_0144787 | 3300049577 | Bacteria | 1482 |
| 880 | Ga0501043_0028083 | 3300049579 | Bacteria | 4416 |
| 881 | Ga0501046_0000200 | 3300049580 | Bacteria | 61991 |
| 882 | Ga0501048_0045182 | 3300049582 | Bacteria | 3147 |
| 883 | Ga0501048_0312185 | 3300049582 | Bacteria | 1119 |
| 884 | Ga0501068_0418467 | 3300049584 | Bacteria | 865 |
| 885 | Ga0501070_0015252 | 3300049586 | Bacteria | 6466 |
| 886 | Ga0501071_0057717 | 3300049587 | Bacteria | 2805 |
| 887 | Ga0501072_0002231 | 3300049588 | Bacteria | 14467 |
| 888 | Ga0501072_0068996 | 3300049588 | Bacteria | 2791 |
| 889 | Ga0501073_0220458 | 3300049589 | Bacteria | 1310 |
| 890 | Ga0501074_0000734 | 3300049590 | Bacteria | 20570 |
| 891 | Ga0501075_0000303 | 3300049591 | Bacteria | 27515 |
| 892 | Ga0501075_0039305 | 3300049591 | Bacteria | 3541 |
| 893 | Ga0501076_0240167 | 3300049592 | Bacteria | 1482 |
| 894 | Ga0501077_0000322 | 3300049593 | Bacteria | 28649 |
| 895 | Ga0501198_000002 | 3300049649 | Bacteria | 197356 |
| 896 | Ga0501222_000093 | 3300049662 | Bacteria | 23934 |
| 897 | Ga0501079_0003406 | 3300049741 | Bacteria | 11674 |
| 898 | Ga0501079_0103427 | 3300049741 | Bacteria | 2209 |
| 899 | Ga0501080_0003611 | 3300049742 | Bacteria | 13626 |
| 900 | Ga0501081_0000087 | 3300049743 | Bacteria | 37059 |
| 901 | Ga0501081_0074538 | 3300049743 | Bacteria | 2368 |
| 902 | Ga0501081_0209921 | 3300049743 | Bacteria | 1414 |
| 903 | Ga0501083_0355683 | 3300049744 | Bacteria | 952 |
| 904 | Ga0501035_0001393 | 3300049822 | Bacteria | 24810 |
| 905 | Ga0501045_0000348 | 3300049824 | Bacteria | 27381 |
| 906 | nmdc:mga03683_13947_c1 | 3300050489 | Bacteria | 2966 |
| 907 | nmdc:mga03683_24221_c1 | 3300050489 | Bacteria | 2078 |
| 908 | nmdc:mga03683_47777_c1 | 3300050489 | Bacteria | 1777 |
| 909 | nmdc:mga0k408_143959_c1 | 3300050493 | Bacteria | 1419 |
| 910 | nmdc:mga0k408_15843_c1 | 3300050493 | Bacteria | 4174 |
| 911 | nmdc:mga0k408_33287_c1 | 3300050493 | Bacteria | 2948 |
| 912 | nmdc:mga0k408_613_c1 | 3300050493 | Bacteria | 19671 |
| 913 | nmdc:mga0k408_8078_c1 | 3300050493 | Bacteria | 5640 |
| 914 | nmdc:mga07m45_50638_c1 | 3300050496 | Bacteria | 2341 |
| 915 | nmdc:mga07m45_8254_c1 | 3300050496 | Bacteria | 5345 |
| 916 | nmdc:mga05p37_76448_c1 | 3300050507 | Bacteria | 4122 |
| 917 | nmdc:mga09592_22218_c1 | 3300050508 | Bacteria | 5236 |
| 918 | nmdc:mga0qj67_59364_c1 | 3300050509 | Bacteria | 3033 |
| 919 | nmdc:mga08y16_107115_c1 | 3300050511 | Bacteria | 2909 |
| 920 | nmdc:mga0n895_270323_c1 | 3300050512 | Bacteria | 1724 |
| 921 | nmdc:mga0n895_45549_c1 | 3300050512 | Bacteria | 4280 |
| 922 | nmdc:mga0n895_608738_c1 | 3300050512 | Bacteria | 1094 |
| 923 | nmdc:mga0n895_86981_c1 | 3300050512 | Bacteria | 3122 |
| 924 | nmdc:mga0rr50_121217_c1 | 3300050513 | Bacteria | 2082 |
| 925 | nmdc:mga0rr50_182959_c1 | 3300050513 | Bacteria | 1714 |
| 926 | nmdc:mga08x19_34409_c1 | 3300050514 | Bacteria | 3202 |
| 927 | nmdc:mga0a205_233004_c1 | 3300050515 | Bacteria | 1724 |
| 928 | nmdc:mga0sz30_40686_c1 | 3300050516 | Bacteria | 1954 |
| 929 | Ga0495601_0029790 | 3300053077 | Bacteria | 3388 |
| 930 | Ga0495601_0113426 | 3300053077 | Bacteria | 1757 |
| 931 | Ga0495601_0188689 | 3300053077 | Bacteria | 1347 |
| 932 | Ga0495595_0002305 | 3300053084 | Bacteria | 7440 |
| 933 | Ga0495595_0051531 | 3300053084 | Bacteria | 1908 |
| 934 | Ga0495619_0008259 | 3300053085 | Bacteria | 6586 |
| 935 | Ga0495619_0016462 | 3300053085 | Bacteria | 4681 |
| 936 | Ga0500578_0016313 | 3300053086 | Bacteria | 4768 |
| 937 | Ga0500583_0117339 | 3300053092 | Bacteria | 1315 |
| 938 | Ga0500658_0014541 | 3300053134 | Bacteria | 2915 |
| 939 | Ga0500568_0018892 | 3300053139 | Bacteria | 3007 |
| 940 | Ga0500619_000063 | 3300053154 | Bacteria | 32493 |
| 941 | Ga0500645_011255 | 3300053730 | Bacteria | 2928 |
| 942 | Ga0500587_001818 | 3300053739 | Bacteria | 3032 |
| 943 | Ga0501084_0002888 | 3300054114 | Bacteria | 13896 |
| 944 | Ga0501084_0468677 | 3300054114 | Bacteria | 1065 |
| 945 | Ga0501082_0144500 | 3300060353 | Bacteria | 2065 |
| 946 | Ga0530510_0003039 | 3300061734 | Bacteria | 11522 |
| 947 | Ga0530510_0112935 | 3300061734 | Bacteria | 1991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0065576 | Ga0501039_0065576_356_1096 | 212 |
| 2 | 3300049592 | Ga0501076_0240167 | Ga0501076_0240167_666_1406 | 212 |
| 3 | 3300053086 | Ga0500578_0016313 | Ga0500578_0016313_1305_2048 | 212 |
| 4 | 3300053730 | Ga0500645_011255 | Ga0500645_011255_139_882 | 212 |
| 5 | 3300005441 | Ga0070700_100030180 | Ga0070700_1000301804 | 213 |
| 6 | 3300005456 | Ga0070678_100246214 | Ga0070678_1002462143 | 213 |
| 7 | 3300005617 | Ga0068859_100298302 | Ga0068859_1002983023 | 213 |
| 8 | 3300005718 | Ga0068866_10029507 | Ga0068866_100295073 | 213 |
| 9 | 3300005719 | Ga0068861_100016929 | Ga0068861_1000169294 | 213 |
| 10 | 3300005842 | Ga0068858_100146076 | Ga0068858_1001460762 | 213 |
| 11 | 3300005843 | Ga0068860_100002076 | Ga0068860_1000020769 | 213 |
| 12 | 3300005844 | Ga0068862_100016504 | Ga0068862_1000165042 | 213 |
| 13 | 3300006881 | Ga0068865_100001397 | Ga0068865_1000013973 | 213 |
| 14 | 3300006931 | Ga0097620_100298316 | Ga0097620_1002983162 | 213 |
| 15 | 3300009553 | Ga0105249_10026569 | Ga0105249_100265694 | 213 |
| 16 | 3300013297 | Ga0157378_10025900 | Ga0157378_100259003 | 213 |
| 17 | 3300013306 | Ga0163162_10005575 | Ga0163162_1000557510 | 213 |
| 18 | 3300013308 | Ga0157375_10052688 | Ga0157375_100526884 | 213 |
| 19 | 3300014326 | Ga0157380_10068261 | Ga0157380_100682614 | 213 |
| 20 | 3300014968 | Ga0157379_10195591 | Ga0157379_101955914 | 213 |
| 21 | 3300025899 | Ga0207642_10069057 | Ga0207642_100690572 | 213 |
| 22 | 3300025908 | Ga0207643_10178872 | Ga0207643_101788722 | 213 |
| 23 | 3300025923 | Ga0207681_10126456 | Ga0207681_101264563 | 213 |
| 24 | 3300025937 | Ga0207669_10034806 | Ga0207669_100348062 | 213 |
| 25 | 3300025940 | Ga0207691_10015882 | Ga0207691_100158824 | 213 |
| 26 | 3300026035 | Ga0207703_10074906 | Ga0207703_100749064 | 213 |
| 27 | 3300026067 | Ga0207678_10283317 | Ga0207678_102833171 | 213 |
| 28 | 3300026075 | Ga0207708_10077651 | Ga0207708_100776514 | 213 |
| 29 | 3300026118 | Ga0207675_100008746 | Ga0207675_1000087466 | 213 |
| 30 | 3300028380 | Ga0268265_10464116 | Ga0268265_104641162 | 213 |
| 31 | 3300028381 | Ga0268264_10005310 | Ga0268264_100053106 | 213 |
| 32 | 3300005341 | Ga0070691_10034323 | Ga0070691_100343233 | 215 |
| 33 | 3300005438 | Ga0070701_10011700 | Ga0070701_100117003 | 215 |
| 34 | 3300005441 | Ga0070700_100014701 | Ga0070700_1000147016 | 215 |
| 35 | 3300005459 | Ga0068867_100029690 | Ga0068867_1000296904 | 215 |
| 36 | 3300005544 | Ga0070686_100021520 | Ga0070686_1000215204 | 215 |
| 37 | 3300005718 | Ga0068866_10001673 | Ga0068866_1000167312 | 215 |
| 38 | 3300005719 | Ga0068861_100004546 | Ga0068861_1000045463 | 215 |
| 39 | 3300009098 | Ga0105245_10025793 | Ga0105245_100257934 | 215 |
| 40 | 3300014326 | Ga0157380_10027611 | Ga0157380_100276116 | 215 |
| 41 | 3300014968 | Ga0157379_10039788 | Ga0157379_100397884 | 215 |
| 42 | 3300049744 | Ga0501083_0355683 | Ga0501083_0355683_287_937 | 216 |
| 43 | 3300006051 | Ga0075364_10014913 | Ga0075364_100149135 | 217 |
| 44 | 3300006186 | Ga0075369_10081983 | Ga0075369_100819833 | 217 |
| 45 | 3300006353 | Ga0075370_10097440 | Ga0075370_100974404 | 217 |
| 46 | 3300026041 | Ga0207639_10636952 | Ga0207639_106369522 | 217 |
| 47 | 3300041512 | Ga0451853_2845378 | Ga0451853_2845378_154_906 | 217 |
| 48 | 3300050489 | nmdc:mga03683_47777_c1 | nmdc:mga03683_47777_c1_311_1069 | 217 |
| 49 | 3300025903 | Ga0207680_10000458 | Ga0207680_1000045821 | 218 |
| 50 | 3300025906 | Ga0207699_10146661 | Ga0207699_101466612 | 218 |
| 51 | 3300046543 | Ga0495645_0141655 | Ga0495645_0141655_794_1561 | 218 |
| 52 | 3300046683 | Ga0495658_0035505 | Ga0495658_0035505_1339_2106 | 218 |
| 53 | 3300046809 | Ga0495600_0256770 | Ga0495600_0256770_22_789 | 218 |
| 54 | 3300047319 | Ga0495674_0272692 | Ga0495674_0272692_268_1035 | 218 |
| 55 | 3300048917 | Ga0496114_0169931 | Ga0496114_0169931_402_1178 | 218 |
| 56 | 3300006048 | Ga0075363_100086097 | Ga0075363_1000860972 | 219 |
| 57 | 3300006177 | Ga0075362_10008625 | Ga0075362_100086253 | 219 |
| 58 | 3300006195 | Ga0075366_10076205 | Ga0075366_100762054 | 219 |
| 59 | 3300031730 | Ga0307516_10112272 | Ga0307516_101122723 | 219 |
| 60 | 3300046519 | Ga0495632_0006371 | Ga0495632_0006371_5485_6243 | 219 |
| 61 | 3300046542 | Ga0495597_0097878 | Ga0495597_0097878_141_899 | 219 |
| 62 | 3300046616 | Ga0495668_0037713 | Ga0495668_0037713_1348_2106 | 219 |
| 63 | 3300046694 | Ga0495649_0003045 | Ga0495649_0003045_10117_10875 | 219 |
| 64 | 3300046810 | Ga0495660_0044144 | Ga0495660_0044144_869_1627 | 219 |
| 65 | 3300047443 | Ga0495687_006950 | Ga0495687_006950_1177_1935 | 219 |
| 66 | 3300048091 | Ga0495626_0081747 | Ga0495626_0081747_186_944 | 219 |
| 67 | 3300050493 | nmdc:mga0k408_143959_c1 | nmdc:mga0k408_143959_c1_269_1027 | 219 |
| 68 | 3300050493 | nmdc:mga0k408_15843_c1 | nmdc:mga0k408_15843_c1_1155_1913 | 219 |
| 69 | 3300005617 | Ga0068859_100290582 | Ga0068859_1002905824 | 220 |
| 70 | 3300006931 | Ga0097620_100290566 | Ga0097620_1002905664 | 220 |
| 71 | 3300007076 | Ga0075435_100017178 | Ga0075435_1000171785 | 220 |
| 72 | 3300050513 | nmdc:mga0rr50_121217_c1 | nmdc:mga0rr50_121217_c1_80_772 | 220 |
| 73 | 3300050515 | nmdc:mga0a205_233004_c1 | nmdc:mga0a205_233004_c1_177_869 | 220 |
| 74 | 3300006178 | Ga0075367_10287278 | Ga0075367_102872781 | 221 |
| 75 | 3300006195 | Ga0075366_10002701 | Ga0075366_100027015 | 221 |
| 76 | 3300006195 | Ga0075366_10054389 | Ga0075366_100543894 | 221 |
| 77 | 3300006353 | Ga0075370_10002336 | Ga0075370_100023363 | 221 |
| 78 | 3300028379 | Ga0268266_10361038 | Ga0268266_103610382 | 221 |
| 79 | 3300050493 | nmdc:mga0k408_613_c1 | nmdc:mga0k408_613_c1_12877_13635 | 221 |
| 80 | 3300026116 | Ga0207674_10184357 | Ga0207674_101843572 | 222 |
| 81 | 3300042003 | Ga0439443_010295 | Ga0439443_010295_40_732 | 223 |
| 82 | 3300045051 | Ga0451576_0493405 | Ga0451576_0493405_23_703 | 224 |
| 83 | 3300005457 | Ga0070662_100143663 | Ga0070662_1001436632 | 225 |
| 84 | 3300005459 | Ga0068867_100130879 | Ga0068867_1001308794 | 225 |
| 85 | 3300006353 | Ga0075370_10117967 | Ga0075370_101179672 | 225 |
| 86 | 3300025933 | Ga0207706_10025594 | Ga0207706_100255943 | 225 |
| 87 | 3300046660 | Ga0495625_0039033 | Ga0495625_0039033_671_1429 | 225 |
| 88 | 3300050496 | nmdc:mga07m45_50638_c1 | nmdc:mga07m45_50638_c1_661_1410 | 225 |
| 89 | 3300053092 | Ga0500583_0117339 | Ga0500583_0117339_356_1114 | 225 |
| 90 | 3300053139 | Ga0500568_0018892 | Ga0500568_0018892_1516_2274 | 225 |
| 91 | 3300005331 | Ga0070670_100052284 | Ga0070670_1000522844 | 226 |
| 92 | 3300006871 | Ga0075434_100844094 | Ga0075434_1008440941 | 226 |
| 93 | 3300013100 | Ga0157373_10055871 | Ga0157373_100558714 | 226 |
| 94 | 3300009553 | Ga0105249_10230804 | Ga0105249_102308044 | 227 |
| 95 | 3300033180 | Ga0307510_10160299 | Ga0307510_101602991 | 227 |
| 96 | 3300005334 | Ga0068869_100088068 | Ga0068869_1000880683 | 229 |
| 97 | 3300005367 | Ga0070667_100583766 | Ga0070667_1005837661 | 229 |
| 98 | 3300005539 | Ga0068853_100250468 | Ga0068853_1002504682 | 229 |
| 99 | 3300009093 | Ga0105240_10095347 | Ga0105240_100953473 | 229 |
| 100 | 3300009545 | Ga0105237_10156291 | Ga0105237_101562914 | 229 |
| 101 | 3300010375 | Ga0105239_10020138 | Ga0105239_100201385 | 229 |
| 102 | 3300025914 | Ga0207671_10016519 | Ga0207671_100165192 | 229 |
| 103 | 3300026041 | Ga0207639_10057994 | Ga0207639_100579943 | 229 |
| 104 | 3300026142 | Ga0207698_10015009 | Ga0207698_100150094 | 229 |
| 105 | 3300050489 | nmdc:mga03683_13947_c1 | nmdc:mga03683_13947_c1_1513_2283 | 229 |
| 106 | 3300050516 | nmdc:mga0sz30_40686_c1 | nmdc:mga0sz30_40686_c1_752_1522 | 229 |
| 107 | 3300005344 | Ga0070661_100013701 | Ga0070661_1000137015 | 230 |
| 108 | 3300005366 | Ga0070659_100052498 | Ga0070659_1000524983 | 230 |
| 109 | 3300005467 | Ga0070706_100091964 | Ga0070706_1000919644 | 230 |
| 110 | 3300005536 | Ga0070697_100002608 | Ga0070697_1000026088 | 230 |
| 111 | 3300005539 | Ga0068853_100125706 | Ga0068853_1001257064 | 230 |
| 112 | 3300005564 | Ga0070664_100041961 | Ga0070664_1000419615 | 230 |
| 113 | 3300005578 | Ga0068854_100009962 | Ga0068854_1000099629 | 230 |
| 114 | 3300005614 | Ga0068856_100201580 | Ga0068856_1002015802 | 230 |
| 115 | 3300005616 | Ga0068852_100245979 | Ga0068852_1002459794 | 230 |
| 116 | 3300005834 | Ga0068851_10042280 | Ga0068851_100422802 | 230 |
| 117 | 3300009551 | Ga0105238_10047138 | Ga0105238_100471384 | 230 |
| 118 | 3300013105 | Ga0157369_10041396 | Ga0157369_100413964 | 230 |
| 119 | 3300013296 | Ga0157374_10144119 | Ga0157374_101441194 | 230 |
| 120 | 3300013307 | Ga0157372_10360198 | Ga0157372_103601983 | 230 |
| 121 | 3300025910 | Ga0207684_10026389 | Ga0207684_100263894 | 230 |
| 122 | 3300025920 | Ga0207649_10010360 | Ga0207649_100103604 | 230 |
| 123 | 3300025924 | Ga0207694_10168492 | Ga0207694_101684921 | 230 |
| 124 | 3300026041 | Ga0207639_10383595 | Ga0207639_103835952 | 230 |
| 125 | 3300026078 | Ga0207702_10031029 | Ga0207702_100310295 | 230 |
| 126 | 3300026142 | Ga0207698_10031064 | Ga0207698_100310644 | 230 |
| 127 | 3300050511 | nmdc:mga08y16_107115_c1 | nmdc:mga08y16_107115_c1_995_1762 | 231 |
| 128 | 3300031507 | Ga0307509_10086371 | Ga0307509_100863715 | 232 |
| 129 | 3300031616 | Ga0307508_10001476 | Ga0307508_100014766 | 232 |
| 130 | 3300031649 | Ga0307514_10005105 | Ga0307514_100051055 | 232 |
| 131 | 3300033179 | Ga0307507_10019471 | Ga0307507_100194713 | 232 |
| 132 | 3300006353 | Ga0075370_10012106 | Ga0075370_100121063 | 233 |
| 133 | 3300013306 | Ga0163162_11180129 | Ga0163162_111801292 | 233 |
| 134 | 3300025938 | Ga0207704_10287762 | Ga0207704_102877621 | 233 |
| 135 | 3300028794 | Ga0307515_10003269 | Ga0307515_100032696 | 233 |
| 136 | 3300046522 | Ga0495643_0066167 | Ga0495643_0066167_821_1579 | 233 |
| 137 | 3300047443 | Ga0495687_000364 | Ga0495687_000364_12747_13505 | 233 |
| 138 | 3300050496 | nmdc:mga07m45_8254_c1 | nmdc:mga07m45_8254_c1_1001_1759 | 233 |
| 139 | 3300005356 | Ga0070674_100164352 | Ga0070674_1001643522 | 234 |
| 140 | 3300005364 | Ga0070673_100347214 | Ga0070673_1003472142 | 234 |
| 141 | 3300005456 | Ga0070678_100077931 | Ga0070678_1000779312 | 234 |
| 142 | 3300005458 | Ga0070681_10007168 | Ga0070681_100071687 | 234 |
| 143 | 3300005459 | Ga0068867_100055039 | Ga0068867_1000550394 | 234 |
| 144 | 3300005459 | Ga0068867_100240035 | Ga0068867_1002400352 | 234 |
| 145 | 3300005530 | Ga0070679_100144794 | Ga0070679_1001447941 | 234 |
| 146 | 3300005577 | Ga0068857_100804393 | Ga0068857_1008043932 | 234 |
| 147 | 3300005615 | Ga0070702_100241410 | Ga0070702_1002414102 | 234 |
| 148 | 3300005718 | Ga0068866_10047815 | Ga0068866_100478154 | 234 |
| 149 | 3300006358 | Ga0068871_100162973 | Ga0068871_1001629733 | 234 |
| 150 | 3300006846 | Ga0075430_100061527 | Ga0075430_1000615273 | 234 |
| 151 | 3300006880 | Ga0075429_100006183 | Ga0075429_1000061834 | 234 |
| 152 | 3300006881 | Ga0068865_100200552 | Ga0068865_1002005522 | 234 |
| 153 | 3300009148 | Ga0105243_10110471 | Ga0105243_101104714 | 234 |
| 154 | 3300013296 | Ga0157374_10025744 | Ga0157374_100257444 | 234 |
| 155 | 3300013297 | Ga0157378_10439617 | Ga0157378_104396172 | 234 |
| 156 | 3300014326 | Ga0157380_10081889 | Ga0157380_100818892 | 234 |
| 157 | 3300017792 | Ga0163161_10040889 | Ga0163161_100408893 | 234 |
| 158 | 3300025899 | Ga0207642_10051891 | Ga0207642_100518912 | 234 |
| 159 | 3300025908 | Ga0207643_10065333 | Ga0207643_100653332 | 234 |
| 160 | 3300025912 | Ga0207707_10079703 | Ga0207707_100797034 | 234 |
| 161 | 3300025937 | Ga0207669_10328371 | Ga0207669_103283713 | 234 |
| 162 | 3300025938 | Ga0207704_10180678 | Ga0207704_101806782 | 234 |
| 163 | 3300026089 | Ga0207648_10013282 | Ga0207648_100132825 | 234 |
| 164 | 3300026116 | Ga0207674_10201652 | Ga0207674_102016523 | 234 |
| 165 | 3300035083 | Ga0373926_0000538 | Ga0373926_0000538_6029_6739 | 234 |
| 166 | 3300035089 | Ga0373944_0008176 | Ga0373944_0008176_1717_2427 | 234 |
| 167 | 3300035111 | Ga0373923_0120251 | Ga0373923_0120251_11_721 | 234 |
| 168 | 3300035113 | Ga0373936_0034218 | Ga0373936_0034218_434_1144 | 234 |
| 169 | 3300035170 | Ga0373943_0065725 | Ga0373943_0065725_795_1505 | 234 |
| 170 | 3300035410 | Ga0373924_0097463 | Ga0373924_0097463_167_898 | 234 |
| 171 | 3300035695 | Ga0373927_0130344 | Ga0373927_0130344_891_1622 | 234 |
| 172 | 3300035725 | Ga0373947_0068623 | Ga0373947_0068623_1165_1875 | 234 |
| 173 | 3300036401 | Ga0373937_0287946 | Ga0373937_0287946_528_1259 | 234 |
| 174 | 3300037068 | Ga0373925_0106671 | Ga0373925_0106671_1364_2095 | 234 |
| 175 | 3300046455 | Ga0495603_0000495 | Ga0495603_0000495_9150_9860 | 234 |
| 176 | 3300046472 | Ga0495580_0000400 | Ga0495580_0000400_31328_32038 | 234 |
| 177 | 3300046473 | Ga0495582_0051344 | Ga0495582_0051344_138_848 | 234 |
| 178 | 3300046475 | Ga0495639_0002708 | Ga0495639_0002708_1136_1846 | 234 |
| 179 | 3300046531 | Ga0495665_0038597 | Ga0495665_0038597_1407_2117 | 234 |
| 180 | 3300046535 | Ga0495586_0003105 | Ga0495586_0003105_2687_3397 | 234 |
| 181 | 3300046674 | Ga0495588_0028034 | Ga0495588_0028034_358_1068 | 234 |
| 182 | 3300046681 | Ga0495647_0000194 | Ga0495647_0000194_8596_9306 | 234 |
| 183 | 3300046683 | Ga0495658_0005064 | Ga0495658_0005064_4364_5074 | 234 |
| 184 | 3300047315 | Ga0495581_0045007 | Ga0495581_0045007_1128_1838 | 234 |
| 185 | 3300049568 | Ga0501031_0069128 | Ga0501031_0069128_267_1007 | 234 |
| 186 | 3300049572 | Ga0501036_0000096 | Ga0501036_0000096_16591_17331 | 234 |
| 187 | 3300049572 | Ga0501036_0099909 | Ga0501036_0099909_1272_1976 | 234 |
| 188 | 3300049574 | Ga0501038_0000475 | Ga0501038_0000475_17610_18350 | 234 |
| 189 | 3300049575 | Ga0501039_0000494 | Ga0501039_0000494_8629_9369 | 234 |
| 190 | 3300049575 | Ga0501039_0139102 | Ga0501039_0139102_953_1657 | 234 |
| 191 | 3300049576 | Ga0501040_0000047 | Ga0501040_0000047_8646_9386 | 234 |
| 192 | 3300049577 | Ga0501041_0005369 | Ga0501041_0005369_240_980 | 234 |
| 193 | 3300049577 | Ga0501041_0144787 | Ga0501041_0144787_13_717 | 234 |
| 194 | 3300049579 | Ga0501043_0028083 | Ga0501043_0028083_2890_3630 | 234 |
| 195 | 3300049580 | Ga0501046_0000200 | Ga0501046_0000200_11776_12516 | 234 |
| 196 | 3300049582 | Ga0501048_0045182 | Ga0501048_0045182_1274_2014 | 234 |
| 197 | 3300049582 | Ga0501048_0312185 | Ga0501048_0312185_348_1052 | 234 |
| 198 | 3300049584 | Ga0501068_0418467 | Ga0501068_0418467_148_852 | 234 |
| 199 | 3300049586 | Ga0501070_0015252 | Ga0501070_0015252_3154_3894 | 234 |
| 200 | 3300049587 | Ga0501071_0057717 | Ga0501071_0057717_1416_2156 | 234 |
| 201 | 3300049588 | Ga0501072_0002231 | Ga0501072_0002231_1265_1969 | 234 |
| 202 | 3300049588 | Ga0501072_0068996 | Ga0501072_0068996_317_1021 | 234 |
| 203 | 3300049589 | Ga0501073_0220458 | Ga0501073_0220458_94_798 | 234 |
| 204 | 3300049590 | Ga0501074_0000734 | Ga0501074_0000734_7064_7804 | 234 |
| 205 | 3300049591 | Ga0501075_0000303 | Ga0501075_0000303_18128_18868 | 234 |
| 206 | 3300049591 | Ga0501075_0039305 | Ga0501075_0039305_860_1564 | 234 |
| 207 | 3300049593 | Ga0501077_0000322 | Ga0501077_0000322_22276_22980 | 234 |
| 208 | 3300049741 | Ga0501079_0003406 | Ga0501079_0003406_8648_9388 | 234 |
| 209 | 3300049741 | Ga0501079_0103427 | Ga0501079_0103427_150_854 | 234 |
| 210 | 3300049742 | Ga0501080_0003611 | Ga0501080_0003611_12431_13171 | 234 |
| 211 | 3300049743 | Ga0501081_0000087 | Ga0501081_0000087_8937_9677 | 234 |
| 212 | 3300049743 | Ga0501081_0074538 | Ga0501081_0074538_932_1636 | 234 |
| 213 | 3300049822 | Ga0501035_0001393 | Ga0501035_0001393_8401_9105 | 234 |
| 214 | 3300049824 | Ga0501045_0000348 | Ga0501045_0000348_8881_9621 | 234 |
| 215 | 3300050508 | nmdc:mga09592_22218_c1 | nmdc:mga09592_22218_c1_2157_2915 | 234 |
| 216 | 3300050509 | nmdc:mga0qj67_59364_c1 | nmdc:mga0qj67_59364_c1_1183_1941 | 234 |
| 217 | 3300054114 | Ga0501084_0002888 | Ga0501084_0002888_4256_4996 | 234 |
| 218 | 3300060353 | Ga0501082_0144500 | Ga0501082_0144500_238_942 | 234 |
| 219 | 3300061734 | Ga0530510_0003039 | Ga0530510_0003039_4396_5136 | 234 |
| 220 | 3300061734 | Ga0530510_0112935 | Ga0530510_0112935_1029_1733 | 234 |
| 221 | 3300005328 | Ga0070676_10194201 | Ga0070676_101942011 | 235 |
| 222 | 3300005331 | Ga0070670_100005989 | Ga0070670_10000598910 | 235 |
| 223 | 3300005334 | Ga0068869_100082175 | Ga0068869_1000821752 | 235 |
| 224 | 3300005335 | Ga0070666_10125564 | Ga0070666_101255641 | 235 |
| 225 | 3300005354 | Ga0070675_100115036 | Ga0070675_1001150361 | 235 |
| 226 | 3300005367 | Ga0070667_100001232 | Ga0070667_1000012323 | 235 |
| 227 | 3300005436 | Ga0070713_100021191 | Ga0070713_1000211914 | 235 |
| 228 | 3300005441 | Ga0070700_100118979 | Ga0070700_1001189792 | 235 |
| 229 | 3300005459 | Ga0068867_100044376 | Ga0068867_1000443764 | 235 |
| 230 | 3300005467 | Ga0070706_100504900 | Ga0070706_1005049002 | 235 |
| 231 | 3300005545 | Ga0070695_100183001 | Ga0070695_1001830012 | 235 |
| 232 | 3300005564 | Ga0070664_100368865 | Ga0070664_1003688652 | 235 |
| 233 | 3300005577 | Ga0068857_100083257 | Ga0068857_1000832573 | 235 |
| 234 | 3300005616 | Ga0068852_100130364 | Ga0068852_1001303642 | 235 |
| 235 | 3300005617 | Ga0068859_100020837 | Ga0068859_1000208379 | 235 |
| 236 | 3300005618 | Ga0068864_100002879 | Ga0068864_10000287912 | 235 |
| 237 | 3300005719 | Ga0068861_100003709 | Ga0068861_1000037098 | 235 |
| 238 | 3300005840 | Ga0068870_10006402 | Ga0068870_100064024 | 235 |
| 239 | 3300005842 | Ga0068858_100022884 | Ga0068858_1000228844 | 235 |
| 240 | 3300005843 | Ga0068860_100005815 | Ga0068860_10000581514 | 235 |
| 241 | 3300006871 | Ga0075434_100048092 | Ga0075434_1000480924 | 235 |
| 242 | 3300006881 | Ga0068865_100086501 | Ga0068865_1000865012 | 235 |
| 243 | 3300006931 | Ga0097620_100020837 | Ga0097620_1000208379 | 235 |
| 244 | 3300007076 | Ga0075435_100217711 | Ga0075435_1002177113 | 235 |
| 245 | 3300009177 | Ga0105248_10002074 | Ga0105248_100020745 | 235 |
| 246 | 3300013297 | Ga0157378_10225973 | Ga0157378_102259733 | 235 |
| 247 | 3300014325 | Ga0163163_10044884 | Ga0163163_100448844 | 235 |
| 248 | 3300014326 | Ga0157380_10539762 | Ga0157380_105397621 | 235 |
| 249 | 3300014968 | Ga0157379_10004449 | Ga0157379_1000444911 | 235 |
| 250 | 3300025903 | Ga0207680_10110288 | Ga0207680_101102883 | 235 |
| 251 | 3300025907 | Ga0207645_10026002 | Ga0207645_100260024 | 235 |
| 252 | 3300025918 | Ga0207662_10026400 | Ga0207662_100264004 | 235 |
| 253 | 3300025925 | Ga0207650_10093449 | Ga0207650_100934493 | 235 |
| 254 | 3300025941 | Ga0207711_10030180 | Ga0207711_100301803 | 235 |
| 255 | 3300025942 | Ga0207689_10002181 | Ga0207689_100021814 | 235 |
| 256 | 3300025960 | Ga0207651_10104767 | Ga0207651_101047674 | 235 |
| 257 | 3300025986 | Ga0207658_10069198 | Ga0207658_100691982 | 235 |
| 258 | 3300026035 | Ga0207703_10002267 | Ga0207703_1000226710 | 235 |
| 259 | 3300026089 | Ga0207648_10009462 | Ga0207648_100094624 | 235 |
| 260 | 3300026095 | Ga0207676_10025604 | Ga0207676_100256044 | 235 |
| 261 | 3300026116 | Ga0207674_10075205 | Ga0207674_100752054 | 235 |
| 262 | 3300026118 | Ga0207675_100037246 | Ga0207675_1000372464 | 235 |
| 263 | 3300028381 | Ga0268264_10005179 | Ga0268264_100051794 | 235 |
| 264 | 3300035172 | Ga0373955_0036706 | Ga0373955_0036706_1467_2177 | 235 |
| 265 | 3300035724 | Ga0373933_0001547 | Ga0373933_0001547_912_1622 | 235 |
| 266 | 3300036401 | Ga0373937_0032560 | Ga0373937_0032560_1497_2207 | 235 |
| 267 | 3300046559 | Ga0495667_0243437 | Ga0495667_0243437_420_1130 | 235 |
| 268 | 3300048905 | Ga0496102_0150328 | Ga0496102_0150328_148_882 | 235 |
| 269 | 3300048912 | Ga0496109_0083807 | Ga0496109_0083807_1083_1817 | 235 |
| 270 | 3300050512 | nmdc:mga0n895_45549_c1 | nmdc:mga0n895_45549_c1_1836_2582 | 235 |
| 271 | 3300054114 | Ga0501084_0468677 | Ga0501084_0468677_43_750 | 235 |
| 272 | 3300005445 | Ga0070708_100020119 | Ga0070708_1000201194 | 238 |
| 273 | 3300005467 | Ga0070706_100131071 | Ga0070706_1001310714 | 238 |
| 274 | 3300005471 | Ga0070698_100095739 | Ga0070698_1000957391 | 238 |
| 275 | 3300005616 | Ga0068852_100118552 | Ga0068852_1001185524 | 238 |
| 276 | 3300006173 | Ga0070716_100188955 | Ga0070716_1001889552 | 238 |
| 277 | 3300006852 | Ga0075433_10049587 | Ga0075433_100495873 | 238 |
| 278 | 3300006871 | Ga0075434_100020488 | Ga0075434_1000204885 | 238 |
| 279 | 3300006914 | Ga0075436_100164282 | Ga0075436_1001642823 | 238 |
| 280 | 3300007076 | Ga0075435_100017023 | Ga0075435_1000170235 | 238 |
| 281 | 3300025910 | Ga0207684_10082931 | Ga0207684_100829314 | 238 |
| 282 | 3300025922 | Ga0207646_10010826 | Ga0207646_100108267 | 238 |
| 283 | 3300025939 | Ga0207665_10125350 | Ga0207665_101253502 | 238 |
| 284 | 3300032126 | Ga0307415_100609229 | Ga0307415_1006092292 | 238 |
| 285 | 3300035086 | Ga0373934_0010461 | Ga0373934_0010461_1439_2179 | 238 |
| 286 | 3300035111 | Ga0373923_0022357 | Ga0373923_0022357_347_1087 | 238 |
| 287 | 3300035113 | Ga0373936_0004984 | Ga0373936_0004984_2174_2914 | 238 |
| 288 | 3300035116 | Ga0373945_0049386 | Ga0373945_0049386_787_1527 | 238 |
| 289 | 3300035118 | Ga0373954_0024736 | Ga0373954_0024736_561_1301 | 238 |
| 290 | 3300035119 | Ga0373956_0012689 | Ga0373956_0012689_2153_2893 | 238 |
| 291 | 3300035120 | Ga0373957_0000976 | Ga0373957_0000976_700_1440 | 238 |
| 292 | 3300035171 | Ga0373946_0038127 | Ga0373946_0038127_388_1128 | 238 |
| 293 | 3300035172 | Ga0373955_0033139 | Ga0373955_0033139_1439_2179 | 238 |
| 294 | 3300035410 | Ga0373924_0012784 | Ga0373924_0012784_882_1622 | 238 |
| 295 | 3300035692 | Ga0373935_0028592 | Ga0373935_0028592_487_1227 | 238 |
| 296 | 3300035695 | Ga0373927_0117951 | Ga0373927_0117951_815_1555 | 238 |
| 297 | 3300035724 | Ga0373933_0011412 | Ga0373933_0011412_3274_4014 | 238 |
| 298 | 3300035725 | Ga0373947_0210112 | Ga0373947_0210112_385_1125 | 238 |
| 299 | 3300036401 | Ga0373937_0032191 | Ga0373937_0032191_3476_4216 | 238 |
| 300 | 3300037068 | Ga0373925_0043701 | Ga0373925_0043701_1439_2179 | 238 |
| 301 | 3300046454 | Ga0495592_0033494 | Ga0495592_0033494_824_1564 | 238 |
| 302 | 3300046461 | Ga0495641_0004406 | Ga0495641_0004406_338_1078 | 238 |
| 303 | 3300046462 | Ga0495651_0005497 | Ga0495651_0005497_8166_8906 | 238 |
| 304 | 3300046463 | Ga0495653_0002547 | Ga0495653_0002547_4585_5325 | 238 |
| 305 | 3300046472 | Ga0495580_0014629 | Ga0495580_0014629_4339_5079 | 238 |
| 306 | 3300046473 | Ga0495582_0137236 | Ga0495582_0137236_305_1045 | 238 |
| 307 | 3300046475 | Ga0495639_0025893 | Ga0495639_0025893_760_1500 | 238 |
| 308 | 3300046476 | Ga0495662_0098419 | Ga0495662_0098419_615_1355 | 238 |
| 309 | 3300046477 | Ga0495664_0030369 | Ga0495664_0030369_1070_1810 | 238 |
| 310 | 3300046499 | Ga0495594_0077326 | Ga0495594_0077326_699_1439 | 238 |
| 311 | 3300046511 | Ga0495608_0013445 | Ga0495608_0013445_3476_4216 | 238 |
| 312 | 3300046517 | Ga0495630_0004190 | Ga0495630_0004190_2843_3583 | 238 |
| 313 | 3300046526 | Ga0495666_0018735 | Ga0495666_0018735_143_883 | 238 |
| 314 | 3300046531 | Ga0495665_0049519 | Ga0495665_0049519_1309_2049 | 238 |
| 315 | 3300046533 | Ga0495640_0028050 | Ga0495640_0028050_2395_3135 | 238 |
| 316 | 3300046535 | Ga0495586_0013809 | Ga0495586_0013809_2312_3052 | 238 |
| 317 | 3300046536 | Ga0495587_0024333 | Ga0495587_0024333_2854_3594 | 238 |
| 318 | 3300046557 | Ga0495622_0036285 | Ga0495622_0036285_1069_1809 | 238 |
| 319 | 3300046559 | Ga0495667_0051603 | Ga0495667_0051603_1091_1831 | 238 |
| 320 | 3300046642 | Ga0495634_0019778 | Ga0495634_0019778_2162_2902 | 238 |
| 321 | 3300046663 | Ga0495635_0083751 | Ga0495635_0083751_612_1352 | 238 |
| 322 | 3300046675 | Ga0495657_0022306 | Ga0495657_0022306_2357_3097 | 238 |
| 323 | 3300046678 | Ga0495599_0022755 | Ga0495599_0022755_864_1604 | 238 |
| 324 | 3300046680 | Ga0495646_0216384 | Ga0495646_0216384_264_1004 | 238 |
| 325 | 3300046681 | Ga0495647_0011741 | Ga0495647_0011741_1091_1831 | 238 |
| 326 | 3300046683 | Ga0495658_0021101 | Ga0495658_0021101_506_1246 | 238 |
| 327 | 3300046689 | Ga0495613_0072673 | Ga0495613_0072673_265_1005 | 238 |
| 328 | 3300046690 | Ga0495624_0057445 | Ga0495624_0057445_104_844 | 238 |
| 329 | 3300046809 | Ga0495600_0022922 | Ga0495600_0022922_1234_1974 | 238 |
| 330 | 3300047317 | Ga0495604_0097090 | Ga0495604_0097090_561_1301 | 238 |
| 331 | 3300047319 | Ga0495674_0059696 | Ga0495674_0059696_876_1616 | 238 |
| 332 | 3300047322 | Ga0495680_0010104 | Ga0495680_0010104_2254_2994 | 238 |
| 333 | 3300047444 | Ga0495675_0017142 | Ga0495675_0017142_2721_3461 | 238 |
| 334 | 3300047471 | Ga0495684_0040402 | Ga0495684_0040402_1091_1831 | 238 |
| 335 | 3300050512 | nmdc:mga0n895_86981_c1 | nmdc:mga0n895_86981_c1_1765_2514 | 238 |
| 336 | 3300050513 | nmdc:mga0rr50_182959_c1 | nmdc:mga0rr50_182959_c1_807_1556 | 238 |
| 337 | 3300050514 | nmdc:mga08x19_34409_c1 | nmdc:mga08x19_34409_c1_309_1058 | 238 |
| 338 | 3300053077 | Ga0495601_0188689 | Ga0495601_0188689_166_906 | 238 |
| 339 | 3300053084 | Ga0495595_0002305 | Ga0495595_0002305_2843_3583 | 238 |
| 340 | 3300053085 | Ga0495619_0016462 | Ga0495619_0016462_1981_2721 | 238 |
| 341 | 3300005616 | Ga0068852_100068867 | Ga0068852_1000688673 | 239 |
| 342 | 3300006177 | Ga0075362_10024025 | Ga0075362_100240254 | 239 |
| 343 | 3300006195 | Ga0075366_10003106 | Ga0075366_100031064 | 239 |
| 344 | 3300006195 | Ga0075366_10004261 | Ga0075366_100042617 | 239 |
| 345 | 3300026142 | Ga0207698_10073747 | Ga0207698_100737472 | 239 |
| 346 | 3300028794 | Ga0307515_10032662 | Ga0307515_100326625 | 239 |
| 347 | 3300031731 | Ga0307405_10007522 | Ga0307405_100075224 | 239 |
| 348 | 3300031852 | Ga0307410_10166727 | Ga0307410_101667272 | 239 |
| 349 | 3300031903 | Ga0307407_10062245 | Ga0307407_100622453 | 239 |
| 350 | 3300031995 | Ga0307409_100001376 | Ga0307409_10000137614 | 239 |
| 351 | 3300032004 | Ga0307414_10084315 | Ga0307414_100843153 | 239 |
| 352 | 3300032126 | Ga0307415_100006664 | Ga0307415_10000666410 | 239 |
| 353 | 3300039450 | Ga0436363_0944619 | Ga0436363_0944619_214_993 | 239 |
| 354 | 3300050489 | nmdc:mga03683_24221_c1 | nmdc:mga03683_24221_c1_995_1741 | 239 |
| 355 | 3300050493 | nmdc:mga0k408_8078_c1 | nmdc:mga0k408_8078_c1_4516_5268 | 239 |
| 356 | 3300005518 | Ga0070699_100145386 | Ga0070699_1001453862 | 240 |
| 357 | 3300013297 | Ga0157378_10226018 | Ga0157378_102260182 | 240 |
| 358 | 3300005545 | Ga0070695_100578281 | Ga0070695_1005782811 | 241 |
| 359 | 3300005618 | Ga0068864_100778558 | Ga0068864_1007785582 | 241 |
| 360 | 3300005842 | Ga0068858_100282847 | Ga0068858_1002828472 | 241 |
| 361 | 3300006237 | Ga0097621_100378184 | Ga0097621_1003781842 | 241 |
| 362 | 3300006237 | Ga0097621_100454851 | Ga0097621_1004548512 | 241 |
| 363 | 3300025931 | Ga0207644_10000517 | Ga0207644_1000051728 | 241 |
| 364 | 3300025931 | Ga0207644_10406883 | Ga0207644_104068832 | 241 |
| 365 | 3300025941 | Ga0207711_10100675 | Ga0207711_101006754 | 241 |
| 366 | 3300025960 | Ga0207651_10487669 | Ga0207651_104876692 | 241 |
| 367 | 3300026035 | Ga0207703_10305468 | Ga0207703_103054683 | 241 |
| 368 | 3300026088 | Ga0207641_10073091 | Ga0207641_100730914 | 241 |
| 369 | 3300048904 | Ga0496101_0460325 | Ga0496101_0460325_222_950 | 241 |
| 370 | 3300048913 | Ga0496110_0672363 | Ga0496110_0672363_42_770 | 241 |
| 371 | 3300005334 | Ga0068869_100233691 | Ga0068869_1002336912 | 242 |
| 372 | 3300005354 | Ga0070675_100294807 | Ga0070675_1002948073 | 242 |
| 373 | 3300005366 | Ga0070659_100127375 | Ga0070659_1001273752 | 242 |
| 374 | 3300005456 | Ga0070678_100339044 | Ga0070678_1003390441 | 242 |
| 375 | 3300005459 | Ga0068867_100113331 | Ga0068867_1001133313 | 242 |
| 376 | 3300005543 | Ga0070672_100067150 | Ga0070672_1000671503 | 242 |
| 377 | 3300005548 | Ga0070665_100192649 | Ga0070665_1001926492 | 242 |
| 378 | 3300005842 | Ga0068858_100501201 | Ga0068858_1005012011 | 242 |
| 379 | 3300009094 | Ga0111539_10785273 | Ga0111539_107852732 | 242 |
| 380 | 3300009553 | Ga0105249_10118839 | Ga0105249_101188393 | 242 |
| 381 | 3300010375 | Ga0105239_10235169 | Ga0105239_102351692 | 242 |
| 382 | 3300013308 | Ga0157375_10125067 | Ga0157375_101250674 | 242 |
| 383 | 3300014745 | Ga0157377_10061033 | Ga0157377_100610334 | 242 |
| 384 | 3300025908 | Ga0207643_10010319 | Ga0207643_100103193 | 242 |
| 385 | 3300026035 | Ga0207703_10146894 | Ga0207703_101468943 | 242 |
| 386 | 3300026075 | Ga0207708_10200100 | Ga0207708_102001002 | 242 |
| 387 | 3300026089 | Ga0207648_10065401 | Ga0207648_100654014 | 242 |
| 388 | 3300028379 | Ga0268266_10139611 | Ga0268266_101396113 | 242 |
| 389 | 3300048909 | Ga0496106_0396733 | Ga0496106_0396733_114_848 | 242 |
| 390 | 3300048911 | Ga0496108_0099605 | Ga0496108_0099605_133_867 | 242 |
| 391 | 3300048915 | Ga0496112_0778369 | Ga0496112_0778369_52_786 | 242 |
| 392 | 3300005328 | Ga0070676_10001735 | Ga0070676_100017354 | 243 |
| 393 | 3300005333 | Ga0070677_10005263 | Ga0070677_100052634 | 243 |
| 394 | 3300005334 | Ga0068869_100000926 | Ga0068869_1000009266 | 243 |
| 395 | 3300005335 | Ga0070666_10008121 | Ga0070666_100081219 | 243 |
| 396 | 3300005338 | Ga0068868_100017866 | Ga0068868_1000178664 | 243 |
| 397 | 3300005340 | Ga0070689_100012276 | Ga0070689_1000122762 | 243 |
| 398 | 3300005347 | Ga0070668_100004119 | Ga0070668_1000041198 | 243 |
| 399 | 3300005353 | Ga0070669_100000668 | Ga0070669_10000066826 | 243 |
| 400 | 3300005354 | Ga0070675_100017405 | Ga0070675_1000174052 | 243 |
| 401 | 3300005355 | Ga0070671_100019898 | Ga0070671_1000198988 | 243 |
| 402 | 3300005364 | Ga0070673_100002041 | Ga0070673_1000020417 | 243 |
| 403 | 3300005365 | Ga0070688_100026064 | Ga0070688_1000260644 | 243 |
| 404 | 3300005367 | Ga0070667_100018925 | Ga0070667_1000189252 | 243 |
| 405 | 3300005456 | Ga0070678_100001539 | Ga0070678_1000015397 | 243 |
| 406 | 3300005459 | Ga0068867_100012431 | Ga0068867_1000124318 | 243 |
| 407 | 3300005543 | Ga0070672_100000287 | Ga0070672_10000028733 | 243 |
| 408 | 3300005543 | Ga0070672_100066153 | Ga0070672_1000661534 | 243 |
| 409 | 3300005548 | Ga0070665_100023957 | Ga0070665_1000239578 | 243 |
| 410 | 3300005618 | Ga0068864_100008284 | Ga0068864_1000082849 | 243 |
| 411 | 3300005842 | Ga0068858_100021707 | Ga0068858_1000217078 | 243 |
| 412 | 3300005843 | Ga0068860_100005493 | Ga0068860_1000054937 | 243 |
| 413 | 3300005843 | Ga0068860_100013332 | Ga0068860_1000133324 | 243 |
| 414 | 3300005844 | Ga0068862_100110121 | Ga0068862_1001101213 | 243 |
| 415 | 3300006237 | Ga0097621_100001308 | Ga0097621_10000130816 | 243 |
| 416 | 3300006358 | Ga0068871_100001077 | Ga0068871_1000010776 | 243 |
| 417 | 3300006881 | Ga0068865_100063168 | Ga0068865_1000631684 | 243 |
| 418 | 3300009177 | Ga0105248_10018068 | Ga0105248_100180685 | 243 |
| 419 | 3300009553 | Ga0105249_10097812 | Ga0105249_100978124 | 243 |
| 420 | 3300013296 | Ga0157374_10001312 | Ga0157374_1000131213 | 243 |
| 421 | 3300013297 | Ga0157378_10205292 | Ga0157378_102052924 | 243 |
| 422 | 3300013306 | Ga0163162_10005459 | Ga0163162_1000545912 | 243 |
| 423 | 3300013308 | Ga0157375_10002469 | Ga0157375_100024696 | 243 |
| 424 | 3300014968 | Ga0157379_10000858 | Ga0157379_100008585 | 243 |
| 425 | 3300014969 | Ga0157376_10012373 | Ga0157376_100123739 | 243 |
| 426 | 3300017792 | Ga0163161_10011289 | Ga0163161_100112896 | 243 |
| 427 | 3300025893 | Ga0207682_10030848 | Ga0207682_100308482 | 243 |
| 428 | 3300025907 | Ga0207645_10001318 | Ga0207645_100013188 | 243 |
| 429 | 3300025923 | Ga0207681_10026428 | Ga0207681_100264283 | 243 |
| 430 | 3300025926 | Ga0207659_10001947 | Ga0207659_100019475 | 243 |
| 431 | 3300025931 | Ga0207644_10004658 | Ga0207644_1000465810 | 243 |
| 432 | 3300025933 | Ga0207706_10124061 | Ga0207706_101240613 | 243 |
| 433 | 3300025936 | Ga0207670_10094199 | Ga0207670_100941993 | 243 |
| 434 | 3300025937 | Ga0207669_10309881 | Ga0207669_103098813 | 243 |
| 435 | 3300025938 | Ga0207704_10015099 | Ga0207704_100150991 | 243 |
| 436 | 3300025940 | Ga0207691_10000249 | Ga0207691_1000024917 | 243 |
| 437 | 3300025940 | Ga0207691_10130041 | Ga0207691_101300414 | 243 |
| 438 | 3300025941 | Ga0207711_10015792 | Ga0207711_100157928 | 243 |
| 439 | 3300025942 | Ga0207689_10005377 | Ga0207689_100053778 | 243 |
| 440 | 3300025960 | Ga0207651_10006459 | Ga0207651_100064598 | 243 |
| 441 | 3300025961 | Ga0207712_10099473 | Ga0207712_100994734 | 243 |
| 442 | 3300025972 | Ga0207668_10002554 | Ga0207668_100025542 | 243 |
| 443 | 3300025986 | Ga0207658_10001272 | Ga0207658_100012723 | 243 |
| 444 | 3300026023 | Ga0207677_10027628 | Ga0207677_100276285 | 243 |
| 445 | 3300026035 | Ga0207703_10012267 | Ga0207703_100122674 | 243 |
| 446 | 3300026088 | Ga0207641_10000374 | Ga0207641_1000037458 | 243 |
| 447 | 3300026089 | Ga0207648_10000523 | Ga0207648_1000052328 | 243 |
| 448 | 3300026089 | Ga0207648_10073149 | Ga0207648_100731492 | 243 |
| 449 | 3300026095 | Ga0207676_10012265 | Ga0207676_100122654 | 243 |
| 450 | 3300026095 | Ga0207676_10261563 | Ga0207676_102615632 | 243 |
| 451 | 3300026121 | Ga0207683_10000476 | Ga0207683_1000047632 | 243 |
| 452 | 3300028379 | Ga0268266_10005562 | Ga0268266_1000556212 | 243 |
| 453 | 3300028381 | Ga0268264_10002850 | Ga0268264_100028503 | 243 |
| 454 | 3300031235 | Ga0265330_10004062 | Ga0265330_100040622 | 243 |
| 455 | 3300031238 | Ga0265332_10002489 | Ga0265332_100024894 | 243 |
| 456 | 3300031242 | Ga0265329_10018394 | Ga0265329_100183943 | 243 |
| 457 | 3300031250 | Ga0265331_10001690 | Ga0265331_100016904 | 243 |
| 458 | 3300031251 | Ga0265327_10004035 | Ga0265327_100040356 | 243 |
| 459 | 3300031251 | Ga0265327_10059222 | Ga0265327_100592222 | 243 |
| 460 | 3300031344 | Ga0265316_10014609 | Ga0265316_100146095 | 243 |
| 461 | 3300031711 | Ga0265314_10009278 | Ga0265314_100092787 | 243 |
| 462 | 3300031712 | Ga0265342_10020514 | Ga0265342_100205145 | 243 |
| 463 | 3300032005 | Ga0307411_10228744 | Ga0307411_102287442 | 243 |
| 464 | 3300042876 | Ga0451577_0006056 | Ga0451577_0006056_3321_4058 | 243 |
| 465 | 3300044673 | Ga0453683_0002919 | Ga0453683_0002919_2578_3315 | 243 |
| 466 | 3300044712 | Ga0453684_0023590 | Ga0453684_0023590_4324_5061 | 243 |
| 467 | 3300045051 | Ga0451576_0009861 | Ga0451576_0009861_6957_7694 | 243 |
| 468 | 3300048903 | Ga0496100_0208603 | Ga0496100_0208603_350_1087 | 243 |
| 469 | 3300048912 | Ga0496109_0213379 | Ga0496109_0213379_946_1683 | 243 |
| 470 | 3300005355 | Ga0070671_100212959 | Ga0070671_1002129592 | 244 |
| 471 | 3300005456 | Ga0070678_100325755 | Ga0070678_1003257551 | 244 |
| 472 | 3300005458 | Ga0070681_10082525 | Ga0070681_100825252 | 244 |
| 473 | 3300005467 | Ga0070706_100146874 | Ga0070706_1001468743 | 244 |
| 474 | 3300005539 | Ga0068853_100022499 | Ga0068853_1000224993 | 244 |
| 475 | 3300005577 | Ga0068857_100568161 | Ga0068857_1005681612 | 244 |
| 476 | 3300005841 | Ga0068863_100085590 | Ga0068863_1000855902 | 244 |
| 477 | 3300005842 | Ga0068858_100150173 | Ga0068858_1001501733 | 244 |
| 478 | 3300005843 | Ga0068860_100017524 | Ga0068860_1000175249 | 244 |
| 479 | 3300006237 | Ga0097621_100574461 | Ga0097621_1005744612 | 244 |
| 480 | 3300009147 | Ga0114129_10172919 | Ga0114129_101729194 | 244 |
| 481 | 3300009174 | Ga0105241_10014472 | Ga0105241_100144724 | 244 |
| 482 | 3300009545 | Ga0105237_10021940 | Ga0105237_100219404 | 244 |
| 483 | 3300013308 | Ga0157375_11289329 | Ga0157375_112893291 | 244 |
| 484 | 3300025304 | Ga0209257_1011000 | Ga0209257_10110004 | 244 |
| 485 | 3300025904 | Ga0207647_10302587 | Ga0207647_103025871 | 244 |
| 486 | 3300025910 | Ga0207684_10122928 | Ga0207684_101229283 | 244 |
| 487 | 3300025911 | Ga0207654_10094366 | Ga0207654_100943663 | 244 |
| 488 | 3300025912 | Ga0207707_10055187 | Ga0207707_100551873 | 244 |
| 489 | 3300025914 | Ga0207671_10394315 | Ga0207671_103943151 | 244 |
| 490 | 3300025932 | Ga0207690_10065445 | Ga0207690_100654454 | 244 |
| 491 | 3300025986 | Ga0207658_10082425 | Ga0207658_100824252 | 244 |
| 492 | 3300026035 | Ga0207703_10344020 | Ga0207703_103440202 | 244 |
| 493 | 3300026041 | Ga0207639_10029896 | Ga0207639_100298964 | 244 |
| 494 | 3300026118 | Ga0207675_100105278 | Ga0207675_1001052784 | 244 |
| 495 | 3300026121 | Ga0207683_10418544 | Ga0207683_104185442 | 244 |
| 496 | 3300035119 | Ga0373956_0182603 | Ga0373956_0182603_106_852 | 244 |
| 497 | 3300042876 | Ga0451577_0303322 | Ga0451577_0303322_420_1163 | 244 |
| 498 | 3300046472 | Ga0495580_0065337 | Ga0495580_0065337_420_1166 | 244 |
| 499 | 3300050507 | nmdc:mga05p37_76448_c1 | nmdc:mga05p37_76448_c1_176_919 | 244 |
| 500 | 3300005330 | Ga0070690_100001151 | Ga0070690_1000011515 | 245 |
| 501 | 3300005331 | Ga0070670_100089859 | Ga0070670_1000898594 | 245 |
| 502 | 3300005333 | Ga0070677_10121222 | Ga0070677_101212222 | 245 |
| 503 | 3300005334 | Ga0068869_100004899 | Ga0068869_1000048994 | 245 |
| 504 | 3300005334 | Ga0068869_100211483 | Ga0068869_1002114832 | 245 |
| 505 | 3300005335 | Ga0070666_10003246 | Ga0070666_100032466 | 245 |
| 506 | 3300005337 | Ga0070682_100024903 | Ga0070682_1000249033 | 245 |
| 507 | 3300005338 | Ga0068868_100002572 | Ga0068868_1000025729 | 245 |
| 508 | 3300005339 | Ga0070660_100012880 | Ga0070660_1000128805 | 245 |
| 509 | 3300005340 | Ga0070689_100000968 | Ga0070689_1000009685 | 245 |
| 510 | 3300005341 | Ga0070691_10048127 | Ga0070691_100481273 | 245 |
| 511 | 3300005343 | Ga0070687_100045865 | Ga0070687_1000458653 | 245 |
| 512 | 3300005343 | Ga0070687_100175570 | Ga0070687_1001755702 | 245 |
| 513 | 3300005344 | Ga0070661_100026640 | Ga0070661_1000266404 | 245 |
| 514 | 3300005345 | Ga0070692_10022249 | Ga0070692_100222494 | 245 |
| 515 | 3300005355 | Ga0070671_100010442 | Ga0070671_1000104429 | 245 |
| 516 | 3300005356 | Ga0070674_100166671 | Ga0070674_1001666712 | 245 |
| 517 | 3300005364 | Ga0070673_100005216 | Ga0070673_10000521610 | 245 |
| 518 | 3300005365 | Ga0070688_100008334 | Ga0070688_1000083341 | 245 |
| 519 | 3300005366 | Ga0070659_100362490 | Ga0070659_1003624902 | 245 |
| 520 | 3300005436 | Ga0070713_100009864 | Ga0070713_10000986410 | 245 |
| 521 | 3300005437 | Ga0070710_10006201 | Ga0070710_100062015 | 245 |
| 522 | 3300005439 | Ga0070711_100000893 | Ga0070711_1000008939 | 245 |
| 523 | 3300005440 | Ga0070705_100014603 | Ga0070705_1000146035 | 245 |
| 524 | 3300005444 | Ga0070694_100012252 | Ga0070694_1000122525 | 245 |
| 525 | 3300005445 | Ga0070708_100119277 | Ga0070708_1001192771 | 245 |
| 526 | 3300005456 | Ga0070678_100000107 | Ga0070678_1000001078 | 245 |
| 527 | 3300005457 | Ga0070662_100028287 | Ga0070662_1000282874 | 245 |
| 528 | 3300005459 | Ga0068867_100091991 | Ga0068867_1000919913 | 245 |
| 529 | 3300005466 | Ga0070685_10000221 | Ga0070685_1000022112 | 245 |
| 530 | 3300005468 | Ga0070707_100027242 | Ga0070707_1000272424 | 245 |
| 531 | 3300005518 | Ga0070699_100160196 | Ga0070699_1001601964 | 245 |
| 532 | 3300005543 | Ga0070672_100082633 | Ga0070672_1000826332 | 245 |
| 533 | 3300005544 | Ga0070686_100055642 | Ga0070686_1000556423 | 245 |
| 534 | 3300005544 | Ga0070686_100377124 | Ga0070686_1003771241 | 245 |
| 535 | 3300005545 | Ga0070695_100077736 | Ga0070695_1000777362 | 245 |
| 536 | 3300005546 | Ga0070696_100055582 | Ga0070696_1000555824 | 245 |
| 537 | 3300005546 | Ga0070696_100109391 | Ga0070696_1001093911 | 245 |
| 538 | 3300005547 | Ga0070693_100009100 | Ga0070693_1000091005 | 245 |
| 539 | 3300005547 | Ga0070693_100234281 | Ga0070693_1002342812 | 245 |
| 540 | 3300005548 | Ga0070665_100005852 | Ga0070665_10000585216 | 245 |
| 541 | 3300005549 | Ga0070704_100018809 | Ga0070704_1000188094 | 245 |
| 542 | 3300005563 | Ga0068855_100345279 | Ga0068855_1003452791 | 245 |
| 543 | 3300005578 | Ga0068854_100086543 | Ga0068854_1000865432 | 245 |
| 544 | 3300005617 | Ga0068859_100003177 | Ga0068859_10000317712 | 245 |
| 545 | 3300005618 | Ga0068864_100002616 | Ga0068864_1000026169 | 245 |
| 546 | 3300005718 | Ga0068866_10000652 | Ga0068866_1000065216 | 245 |
| 547 | 3300005719 | Ga0068861_100047329 | Ga0068861_1000473293 | 245 |
| 548 | 3300005719 | Ga0068861_100069108 | Ga0068861_1000691083 | 245 |
| 549 | 3300005840 | Ga0068870_10009878 | Ga0068870_100098783 | 245 |
| 550 | 3300005841 | Ga0068863_100002985 | Ga0068863_1000029855 | 245 |
| 551 | 3300005842 | Ga0068858_100000603 | Ga0068858_10000060312 | 245 |
| 552 | 3300005843 | Ga0068860_100033089 | Ga0068860_1000330893 | 245 |
| 553 | 3300005843 | Ga0068860_100787193 | Ga0068860_1007871932 | 245 |
| 554 | 3300005844 | Ga0068862_100066477 | Ga0068862_1000664774 | 245 |
| 555 | 3300006173 | Ga0070716_100001339 | Ga0070716_10000133915 | 245 |
| 556 | 3300006173 | Ga0070716_100020690 | Ga0070716_1000206904 | 245 |
| 557 | 3300006175 | Ga0070712_100002453 | Ga0070712_1000024538 | 245 |
| 558 | 3300006237 | Ga0097621_100020593 | Ga0097621_1000205933 | 245 |
| 559 | 3300006358 | Ga0068871_100041396 | Ga0068871_1000413964 | 245 |
| 560 | 3300006931 | Ga0097620_100003176 | Ga0097620_10000317612 | 245 |
| 561 | 3300009098 | Ga0105245_10014037 | Ga0105245_100140379 | 245 |
| 562 | 3300009098 | Ga0105245_10020376 | Ga0105245_100203768 | 245 |
| 563 | 3300009101 | Ga0105247_10340706 | Ga0105247_103407062 | 245 |
| 564 | 3300009176 | Ga0105242_10002918 | Ga0105242_100029185 | 245 |
| 565 | 3300009177 | Ga0105248_10129464 | Ga0105248_101294644 | 245 |
| 566 | 3300010375 | Ga0105239_10033050 | Ga0105239_100330508 | 245 |
| 567 | 3300011119 | Ga0105246_10033904 | Ga0105246_100339042 | 245 |
| 568 | 3300013297 | Ga0157378_10076219 | Ga0157378_100762193 | 245 |
| 569 | 3300013306 | Ga0163162_10154069 | Ga0163162_101540693 | 245 |
| 570 | 3300014969 | Ga0157376_10007657 | Ga0157376_100076579 | 245 |
| 571 | 3300017792 | Ga0163161_10039951 | Ga0163161_100399514 | 245 |
| 572 | 3300025898 | Ga0207692_10152743 | Ga0207692_101527432 | 245 |
| 573 | 3300025898 | Ga0207692_10476843 | Ga0207692_104768431 | 245 |
| 574 | 3300025899 | Ga0207642_10000852 | Ga0207642_100008522 | 245 |
| 575 | 3300025900 | Ga0207710_10143368 | Ga0207710_101433682 | 245 |
| 576 | 3300025900 | Ga0207710_10187497 | Ga0207710_101874972 | 245 |
| 577 | 3300025903 | Ga0207680_10001962 | Ga0207680_100019624 | 245 |
| 578 | 3300025908 | Ga0207643_10011382 | Ga0207643_100113824 | 245 |
| 579 | 3300025910 | Ga0207684_10123164 | Ga0207684_101231643 | 245 |
| 580 | 3300025911 | Ga0207654_10003842 | Ga0207654_100038425 | 245 |
| 581 | 3300025911 | Ga0207654_10190846 | Ga0207654_101908462 | 245 |
| 582 | 3300025913 | Ga0207695_10180450 | Ga0207695_101804502 | 245 |
| 583 | 3300025915 | Ga0207693_10001163 | Ga0207693_100011639 | 245 |
| 584 | 3300025915 | Ga0207693_10044072 | Ga0207693_100440724 | 245 |
| 585 | 3300025916 | Ga0207663_10002183 | Ga0207663_100021838 | 245 |
| 586 | 3300025918 | Ga0207662_10201721 | Ga0207662_102017212 | 245 |
| 587 | 3300025919 | Ga0207657_10000280 | Ga0207657_1000028026 | 245 |
| 588 | 3300025922 | Ga0207646_10465438 | Ga0207646_104654382 | 245 |
| 589 | 3300025924 | Ga0207694_10367874 | Ga0207694_103678743 | 245 |
| 590 | 3300025925 | Ga0207650_10014573 | Ga0207650_100145733 | 245 |
| 591 | 3300025927 | Ga0207687_10000741 | Ga0207687_100007419 | 245 |
| 592 | 3300025928 | Ga0207700_10438709 | Ga0207700_104387092 | 245 |
| 593 | 3300025931 | Ga0207644_10002123 | Ga0207644_100021236 | 245 |
| 594 | 3300025931 | Ga0207644_10172753 | Ga0207644_101727532 | 245 |
| 595 | 3300025932 | Ga0207690_10527940 | Ga0207690_105279402 | 245 |
| 596 | 3300025933 | Ga0207706_10012311 | Ga0207706_100123117 | 245 |
| 597 | 3300025933 | Ga0207706_10027747 | Ga0207706_100277474 | 245 |
| 598 | 3300025934 | Ga0207686_10000521 | Ga0207686_1000052138 | 245 |
| 599 | 3300025936 | Ga0207670_10000894 | Ga0207670_100008947 | 245 |
| 600 | 3300025937 | Ga0207669_10011731 | Ga0207669_100117313 | 245 |
| 601 | 3300025938 | Ga0207704_10036082 | Ga0207704_100360823 | 245 |
| 602 | 3300025939 | Ga0207665_10004353 | Ga0207665_100043535 | 245 |
| 603 | 3300025939 | Ga0207665_10025043 | Ga0207665_100250434 | 245 |
| 604 | 3300025940 | Ga0207691_10044197 | Ga0207691_100441974 | 245 |
| 605 | 3300025941 | Ga0207711_10000448 | Ga0207711_1000044819 | 245 |
| 606 | 3300025941 | Ga0207711_10382017 | Ga0207711_103820172 | 245 |
| 607 | 3300025942 | Ga0207689_10037236 | Ga0207689_100372362 | 245 |
| 608 | 3300025942 | Ga0207689_10225844 | Ga0207689_102258442 | 245 |
| 609 | 3300025949 | Ga0207667_10067633 | Ga0207667_100676332 | 245 |
| 610 | 3300025960 | Ga0207651_10002125 | Ga0207651_100021252 | 245 |
| 611 | 3300025981 | Ga0207640_10006937 | Ga0207640_100069375 | 245 |
| 612 | 3300025981 | Ga0207640_10624108 | Ga0207640_106241082 | 245 |
| 613 | 3300025986 | Ga0207658_10006610 | Ga0207658_100066109 | 245 |
| 614 | 3300025986 | Ga0207658_10042260 | Ga0207658_100422602 | 245 |
| 615 | 3300026023 | Ga0207677_10000253 | Ga0207677_1000025316 | 245 |
| 616 | 3300026023 | Ga0207677_10161090 | Ga0207677_101610902 | 245 |
| 617 | 3300026035 | Ga0207703_10000517 | Ga0207703_1000051738 | 245 |
| 618 | 3300026078 | Ga0207702_10009791 | Ga0207702_100097914 | 245 |
| 619 | 3300026078 | Ga0207702_10230902 | Ga0207702_102309023 | 245 |
| 620 | 3300026088 | Ga0207641_10000610 | Ga0207641_1000061014 | 245 |
| 621 | 3300026089 | Ga0207648_10022490 | Ga0207648_100224905 | 245 |
| 622 | 3300026095 | Ga0207676_10000167 | Ga0207676_1000016751 | 245 |
| 623 | 3300026118 | Ga0207675_100009453 | Ga0207675_1000094534 | 245 |
| 624 | 3300026118 | Ga0207675_100057657 | Ga0207675_1000576573 | 245 |
| 625 | 3300026121 | Ga0207683_10000965 | Ga0207683_100009658 | 245 |
| 626 | 3300026142 | Ga0207698_10142504 | Ga0207698_101425044 | 245 |
| 627 | 3300028379 | Ga0268266_10005004 | Ga0268266_100050044 | 245 |
| 628 | 3300028380 | Ga0268265_10067967 | Ga0268265_100679673 | 245 |
| 629 | 3300028381 | Ga0268264_10001027 | Ga0268264_1000102720 | 245 |
| 630 | 3300028381 | Ga0268264_10111146 | Ga0268264_101111463 | 245 |
| 631 | 3300031251 | Ga0265327_10010785 | Ga0265327_100107857 | 245 |
| 632 | 3300035111 | Ga0373923_0001149 | Ga0373923_0001149_3292_4035 | 245 |
| 633 | 3300035116 | Ga0373945_0021459 | Ga0373945_0021459_669_1412 | 245 |
| 634 | 3300035118 | Ga0373954_0000524 | Ga0373954_0000524_3529_4272 | 245 |
| 635 | 3300035119 | Ga0373956_0017997 | Ga0373956_0017997_1372_2115 | 245 |
| 636 | 3300035170 | Ga0373943_0028575 | Ga0373943_0028575_737_1480 | 245 |
| 637 | 3300035171 | Ga0373946_0017324 | Ga0373946_0017324_543_1286 | 245 |
| 638 | 3300035410 | Ga0373924_0002572 | Ga0373924_0002572_25_768 | 245 |
| 639 | 3300035724 | Ga0373933_0027815 | Ga0373933_0027815_177_920 | 245 |
| 640 | 3300036401 | Ga0373937_0015112 | Ga0373937_0015112_4272_5015 | 245 |
| 641 | 3300036401 | Ga0373937_0049100 | Ga0373937_0049100_1722_2465 | 245 |
| 642 | 3300036401 | Ga0373937_0272057 | Ga0373937_0272057_485_1234 | 245 |
| 643 | 3300037068 | Ga0373925_0007555 | Ga0373925_0007555_1651_2394 | 245 |
| 644 | 3300037068 | Ga0373925_0473308 | Ga0373925_0473308_230_979 | 245 |
| 645 | 3300046459 | Ga0495629_0011863 | Ga0495629_0011863_144_887 | 245 |
| 646 | 3300046471 | Ga0495650_0055747 | Ga0495650_0055747_584_1321 | 245 |
| 647 | 3300046472 | Ga0495580_0035978 | Ga0495580_0035978_1988_2731 | 245 |
| 648 | 3300046473 | Ga0495582_0006109 | Ga0495582_0006109_547_1290 | 245 |
| 649 | 3300046475 | Ga0495639_0023118 | Ga0495639_0023118_1409_2152 | 245 |
| 650 | 3300046476 | Ga0495662_0015640 | Ga0495662_0015640_1464_2207 | 245 |
| 651 | 3300046477 | Ga0495664_0032401 | Ga0495664_0032401_1896_2639 | 245 |
| 652 | 3300046477 | Ga0495664_0155380 | Ga0495664_0155380_596_1339 | 245 |
| 653 | 3300046517 | Ga0495630_0067811 | Ga0495630_0067811_885_1628 | 245 |
| 654 | 3300046531 | Ga0495665_0017444 | Ga0495665_0017444_547_1290 | 245 |
| 655 | 3300046535 | Ga0495586_0080431 | Ga0495586_0080431_260_1003 | 245 |
| 656 | 3300046543 | Ga0495645_0067218 | Ga0495645_0067218_1378_2121 | 245 |
| 657 | 3300046642 | Ga0495634_0069913 | Ga0495634_0069913_546_1289 | 245 |
| 658 | 3300046663 | Ga0495635_0018827 | Ga0495635_0018827_1740_2483 | 245 |
| 659 | 3300046674 | Ga0495588_0082110 | Ga0495588_0082110_99_842 | 245 |
| 660 | 3300046678 | Ga0495599_0069856 | Ga0495599_0069856_845_1588 | 245 |
| 661 | 3300046679 | Ga0495623_0034959 | Ga0495623_0034959_1105_1848 | 245 |
| 662 | 3300046681 | Ga0495647_0036397 | Ga0495647_0036397_160_903 | 245 |
| 663 | 3300046683 | Ga0495658_0089696 | Ga0495658_0089696_916_1659 | 245 |
| 664 | 3300046689 | Ga0495613_0008532 | Ga0495613_0008532_4124_4867 | 245 |
| 665 | 3300046690 | Ga0495624_0420079 | Ga0495624_0420079_14_757 | 245 |
| 666 | 3300046809 | Ga0495600_0087997 | Ga0495600_0087997_444_1187 | 245 |
| 667 | 3300047315 | Ga0495581_0006167 | Ga0495581_0006167_1396_2139 | 245 |
| 668 | 3300047322 | Ga0495680_0040379 | Ga0495680_0040379_621_1364 | 245 |
| 669 | 3300048903 | Ga0496100_0068160 | Ga0496100_0068160_139_882 | 245 |
| 670 | 3300048904 | Ga0496101_0012612 | Ga0496101_0012612_826_1569 | 245 |
| 671 | 3300048907 | Ga0496104_0002793 | Ga0496104_0002793_7344_8087 | 245 |
| 672 | 3300048908 | Ga0496105_0022747 | Ga0496105_0022747_3707_4450 | 245 |
| 673 | 3300048909 | Ga0496106_0053765 | Ga0496106_0053765_1540_2283 | 245 |
| 674 | 3300048910 | Ga0496107_0101771 | Ga0496107_0101771_343_1086 | 245 |
| 675 | 3300048912 | Ga0496109_0006393 | Ga0496109_0006393_3737_4480 | 245 |
| 676 | 3300048914 | Ga0496111_0094672 | Ga0496111_0094672_857_1600 | 245 |
| 677 | 3300048915 | Ga0496112_0001041 | Ga0496112_0001041_11072_11815 | 245 |
| 678 | 3300048917 | Ga0496114_0063262 | Ga0496114_0063262_77_820 | 245 |
| 679 | 3300050512 | nmdc:mga0n895_270323_c1 | nmdc:mga0n895_270323_c1_157_900 | 245 |
| 680 | 3300053077 | Ga0495601_0029790 | Ga0495601_0029790_2126_2869 | 245 |
| 681 | 3300053084 | Ga0495595_0051531 | Ga0495595_0051531_732_1475 | 245 |
| 682 | 3300053085 | Ga0495619_0008259 | Ga0495619_0008259_602_1345 | 245 |
| 683 | 3300005331 | Ga0070670_100440444 | Ga0070670_1004404442 | 246 |
| 684 | 3300005334 | Ga0068869_100022670 | Ga0068869_1000226705 | 246 |
| 685 | 3300005338 | Ga0068868_100671195 | Ga0068868_1006711951 | 246 |
| 686 | 3300005364 | Ga0070673_100206584 | Ga0070673_1002065844 | 246 |
| 687 | 3300005563 | Ga0068855_100590673 | Ga0068855_1005906732 | 246 |
| 688 | 3300005577 | Ga0068857_100132982 | Ga0068857_1001329823 | 246 |
| 689 | 3300005614 | Ga0068856_100190024 | Ga0068856_1001900243 | 246 |
| 690 | 3300005719 | Ga0068861_100242081 | Ga0068861_1002420812 | 246 |
| 691 | 3300005841 | Ga0068863_100227080 | Ga0068863_1002270802 | 246 |
| 692 | 3300006358 | Ga0068871_100109944 | Ga0068871_1001099444 | 246 |
| 693 | 3300009174 | Ga0105241_10332946 | Ga0105241_103329462 | 246 |
| 694 | 3300009176 | Ga0105242_10063808 | Ga0105242_100638083 | 246 |
| 695 | 3300013308 | Ga0157375_10197128 | Ga0157375_101971285 | 246 |
| 696 | 3300014325 | Ga0163163_10330808 | Ga0163163_103308082 | 246 |
| 697 | 3300014968 | Ga0157379_10125926 | Ga0157379_101259264 | 246 |
| 698 | 3300014969 | Ga0157376_10877646 | Ga0157376_108776461 | 246 |
| 699 | 3300025911 | Ga0207654_10237427 | Ga0207654_102374272 | 246 |
| 700 | 3300025925 | Ga0207650_10303220 | Ga0207650_103032202 | 246 |
| 701 | 3300025926 | Ga0207659_10056065 | Ga0207659_100560652 | 246 |
| 702 | 3300025942 | Ga0207689_10009869 | Ga0207689_1000986910 | 246 |
| 703 | 3300025942 | Ga0207689_10181727 | Ga0207689_101817271 | 246 |
| 704 | 3300025949 | Ga0207667_10302926 | Ga0207667_103029263 | 246 |
| 705 | 3300025960 | Ga0207651_10224419 | Ga0207651_102244193 | 246 |
| 706 | 3300026023 | Ga0207677_10107242 | Ga0207677_101072423 | 246 |
| 707 | 3300026035 | Ga0207703_10629739 | Ga0207703_106297392 | 246 |
| 708 | 3300026078 | Ga0207702_10574596 | Ga0207702_105745962 | 246 |
| 709 | 3300026116 | Ga0207674_10124573 | Ga0207674_101245733 | 246 |
| 710 | 3300026118 | Ga0207675_100073780 | Ga0207675_1000737804 | 246 |
| 711 | 3300031344 | Ga0265316_10000391 | Ga0265316_1000039122 | 246 |
| 712 | 3300035171 | Ga0373946_0021281 | Ga0373946_0021281_1225_1971 | 246 |
| 713 | 3300035172 | Ga0373955_0261355 | Ga0373955_0261355_136_885 | 246 |
| 714 | 3300035724 | Ga0373933_0036668 | Ga0373933_0036668_2070_2819 | 246 |
| 715 | 3300035725 | Ga0373947_0345130 | Ga0373947_0345130_190_936 | 246 |
| 716 | 3300036401 | Ga0373937_0243794 | Ga0373937_0243794_569_1318 | 246 |
| 717 | 3300036647 | Ga0316582_0000275 | Ga0316582_0000275_394_1194 | 246 |
| 718 | 3300036712 | Ga0316584_0002877 | Ga0316584_0002877_8831_9631 | 246 |
| 719 | 3300037068 | Ga0373925_0018839 | Ga0373925_0018839_392_1138 | 246 |
| 720 | 3300037588 | Ga0316581_0003201 | Ga0316581_0003201_2802_3602 | 246 |
| 721 | 3300042876 | Ga0451577_0028215 | Ga0451577_0028215_2121_2903 | 246 |
| 722 | 3300044901 | Ga0466960_0042923 | Ga0466960_0042923_191_949 | 246 |
| 723 | 3300048088 | Ga0495602_0127416 | Ga0495602_0127416_788_1537 | 246 |
| 724 | 3300050512 | nmdc:mga0n895_608738_c1 | nmdc:mga0n895_608738_c1_281_1030 | 246 |
| 725 | 3300005530 | Ga0070679_100339159 | Ga0070679_1003391591 | 247 |
| 726 | 3300009551 | Ga0105238_10477940 | Ga0105238_104779402 | 247 |
| 727 | 3300037471 | Ga0395905_0052315 | Ga0395905_0052315_1053_1826 | 247 |
| 728 | 3300005467 | Ga0070706_100584627 | Ga0070706_1005846271 | 248 |
| 729 | 3300011119 | Ga0105246_10448577 | Ga0105246_104485772 | 248 |
| 730 | 3300026121 | Ga0207683_10457631 | Ga0207683_104576312 | 248 |
| 731 | 3300028794 | Ga0307515_10000240 | Ga0307515_10000240141 | 248 |
| 732 | 3300045051 | Ga0451576_0187226 | Ga0451576_0187226_230_982 | 248 |
| 733 | 3300049649 | Ga0501198_000002 | Ga0501198_000002_192716_193471 | 248 |
| 734 | 3300049662 | Ga0501222_000093 | Ga0501222_000093_3950_4705 | 248 |
| 735 | 3300053154 | Ga0500619_000063 | Ga0500619_000063_8102_8860 | 248 |
| 736 | 3300009098 | Ga0105245_10005497 | Ga0105245_100054976 | 249 |
| 737 | 3300009148 | Ga0105243_10003255 | Ga0105243_100032555 | 249 |
| 738 | 3300011119 | Ga0105246_10175926 | Ga0105246_101759263 | 249 |
| 739 | 3300013296 | Ga0157374_10000565 | Ga0157374_1000056538 | 249 |
| 740 | 3300013297 | Ga0157378_10059126 | Ga0157378_100591263 | 249 |
| 741 | 3300013306 | Ga0163162_10022644 | Ga0163162_100226448 | 249 |
| 742 | 3300013308 | Ga0157375_10004526 | Ga0157375_100045266 | 249 |
| 743 | 3300014325 | Ga0163163_10000689 | Ga0163163_100006898 | 249 |
| 744 | 3300014745 | Ga0157377_10000047 | Ga0157377_1000004747 | 249 |
| 745 | 3300014968 | Ga0157379_10003863 | Ga0157379_100038639 | 249 |
| 746 | 3300014969 | Ga0157376_10007747 | Ga0157376_100077479 | 249 |
| 747 | 3300026067 | Ga0207678_10002428 | Ga0207678_100024287 | 249 |
| 748 | 3300028381 | Ga0268264_10427501 | Ga0268264_104275012 | 249 |
| 749 | 3300031507 | Ga0307509_10132030 | Ga0307509_101320304 | 249 |
| 750 | 3300037068 | Ga0373925_0028685 | Ga0373925_0028685_25_822 | 249 |
| 751 | 3300046455 | Ga0495603_0297075 | Ga0495603_0297075_88_855 | 249 |
| 752 | 3300048911 | Ga0496108_0260503 | Ga0496108_0260503_38_835 | 249 |
| 753 | 3300049577 | Ga0501041_0060581 | Ga0501041_0060581_215_970 | 249 |
| 754 | 3300049743 | Ga0501081_0209921 | Ga0501081_0209921_429_1184 | 249 |
| 755 | 3300053134 | Ga0500658_0014541 | Ga0500658_0014541_1270_2025 | 249 |
| 756 | 3300053739 | Ga0500587_001818 | Ga0500587_001818_1615_2370 | 249 |
| 757 | 3300005329 | Ga0070683_100099341 | Ga0070683_1000993413 | 250 |
| 758 | 3300005331 | Ga0070670_100085666 | Ga0070670_1000856664 | 250 |
| 759 | 3300005364 | Ga0070673_100468341 | Ga0070673_1004683412 | 250 |
| 760 | 3300005535 | Ga0070684_100009252 | Ga0070684_1000092523 | 250 |
| 761 | 3300005543 | Ga0070672_100071664 | Ga0070672_1000716642 | 250 |
| 762 | 3300005577 | Ga0068857_100097293 | Ga0068857_1000972933 | 250 |
| 763 | 3300005618 | Ga0068864_100454306 | Ga0068864_1004543062 | 250 |
| 764 | 3300005834 | Ga0068851_10072779 | Ga0068851_100727791 | 250 |
| 765 | 3300025923 | Ga0207681_10287120 | Ga0207681_102871202 | 250 |
| 766 | 3300025925 | Ga0207650_10001150 | Ga0207650_1000115023 | 250 |
| 767 | 3300025940 | Ga0207691_10086127 | Ga0207691_100861274 | 250 |
| 768 | 3300025944 | Ga0207661_10028878 | Ga0207661_100288786 | 250 |
| 769 | 3300026095 | Ga0207676_10488707 | Ga0207676_104887072 | 250 |
| 770 | 3300026116 | Ga0207674_10051412 | Ga0207674_100514123 | 250 |
| 771 | 3300028379 | Ga0268266_10769759 | Ga0268266_107697591 | 250 |
| 772 | 3300036401 | Ga0373937_0080351 | Ga0373937_0080351_984_1739 | 250 |
| 773 | 3300046472 | Ga0495580_0050624 | Ga0495580_0050624_516_1283 | 250 |
| 774 | 3300048912 | Ga0496109_0160408 | Ga0496109_0160408_319_1086 | 250 |
| 775 | 3300005330 | Ga0070690_100051502 | Ga0070690_1000515024 | 251 |
| 776 | 3300005353 | Ga0070669_100001340 | Ga0070669_1000013405 | 251 |
| 777 | 3300005367 | Ga0070667_100004388 | Ga0070667_10000438811 | 251 |
| 778 | 3300006195 | Ga0075366_10036923 | Ga0075366_100369233 | 251 |
| 779 | 3300025981 | Ga0207640_10271458 | Ga0207640_102714582 | 251 |
| 780 | 3300045051 | Ga0451576_0031288 | Ga0451576_0031288_3773_4561 | 251 |
| 781 | 3300050493 | nmdc:mga0k408_33287_c1 | nmdc:mga0k408_33287_c1_1309_2070 | 251 |
| 782 | 3300005364 | Ga0070673_100083572 | Ga0070673_1000835723 | 253 |
| 783 | 3300005618 | Ga0068864_100079160 | Ga0068864_1000791602 | 253 |
| 784 | 3300013105 | Ga0157369_10357187 | Ga0157369_103571871 | 253 |
| 785 | 3300025920 | Ga0207649_10139247 | Ga0207649_101392473 | 253 |
| 786 | 3300025940 | Ga0207691_10093556 | Ga0207691_100935564 | 253 |
| 787 | 3300005544 | Ga0070686_100306748 | Ga0070686_1003067482 | 254 |
| 788 | 3300005327 | Ga0070658_10212722 | Ga0070658_102127222 | 255 |
| 789 | 3300005328 | Ga0070676_10300112 | Ga0070676_103001121 | 255 |
| 790 | 3300005331 | Ga0070670_100038187 | Ga0070670_1000381875 | 255 |
| 791 | 3300005335 | Ga0070666_10005482 | Ga0070666_100054828 | 255 |
| 792 | 3300005338 | Ga0068868_100007250 | Ga0068868_1000072504 | 255 |
| 793 | 3300005338 | Ga0068868_100027784 | Ga0068868_1000277844 | 255 |
| 794 | 3300005340 | Ga0070689_100019778 | Ga0070689_1000197784 | 255 |
| 795 | 3300005344 | Ga0070661_100297307 | Ga0070661_1002973071 | 255 |
| 796 | 3300005347 | Ga0070668_100066950 | Ga0070668_1000669502 | 255 |
| 797 | 3300005353 | Ga0070669_100069103 | Ga0070669_1000691034 | 255 |
| 798 | 3300005354 | Ga0070675_100002913 | Ga0070675_10000291310 | 255 |
| 799 | 3300005354 | Ga0070675_100033252 | Ga0070675_1000332524 | 255 |
| 800 | 3300005354 | Ga0070675_100221877 | Ga0070675_1002218773 | 255 |
| 801 | 3300005355 | Ga0070671_100039862 | Ga0070671_1000398624 | 255 |
| 802 | 3300005364 | Ga0070673_100034039 | Ga0070673_1000340394 | 255 |
| 803 | 3300005364 | Ga0070673_100048540 | Ga0070673_1000485404 | 255 |
| 804 | 3300005367 | Ga0070667_100006263 | Ga0070667_1000062634 | 255 |
| 805 | 3300005367 | Ga0070667_100063935 | Ga0070667_1000639354 | 255 |
| 806 | 3300005455 | Ga0070663_100091829 | Ga0070663_1000918294 | 255 |
| 807 | 3300005456 | Ga0070678_100016518 | Ga0070678_1000165186 | 255 |
| 808 | 3300005456 | Ga0070678_100070096 | Ga0070678_1000700963 | 255 |
| 809 | 3300005456 | Ga0070678_100444285 | Ga0070678_1004442852 | 255 |
| 810 | 3300005457 | Ga0070662_100040230 | Ga0070662_1000402303 | 255 |
| 811 | 3300005459 | Ga0068867_100068502 | Ga0068867_1000685021 | 255 |
| 812 | 3300005539 | Ga0068853_100250004 | Ga0068853_1002500043 | 255 |
| 813 | 3300005543 | Ga0070672_100009036 | Ga0070672_1000090364 | 255 |
| 814 | 3300005543 | Ga0070672_100123089 | Ga0070672_1001230893 | 255 |
| 815 | 3300005564 | Ga0070664_100173679 | Ga0070664_1001736793 | 255 |
| 816 | 3300005564 | Ga0070664_100515269 | Ga0070664_1005152691 | 255 |
| 817 | 3300005616 | Ga0068852_100034538 | Ga0068852_1000345385 | 255 |
| 818 | 3300005616 | Ga0068852_100242460 | Ga0068852_1002424602 | 255 |
| 819 | 3300005616 | Ga0068852_100568284 | Ga0068852_1005682841 | 255 |
| 820 | 3300005617 | Ga0068859_100140187 | Ga0068859_1001401873 | 255 |
| 821 | 3300005618 | Ga0068864_100017069 | Ga0068864_1000170694 | 255 |
| 822 | 3300005618 | Ga0068864_100047375 | Ga0068864_1000473754 | 255 |
| 823 | 3300005618 | Ga0068864_100049900 | Ga0068864_1000499005 | 255 |
| 824 | 3300005618 | Ga0068864_100087580 | Ga0068864_1000875803 | 255 |
| 825 | 3300005718 | Ga0068866_10066202 | Ga0068866_100662021 | 255 |
| 826 | 3300005719 | Ga0068861_100000757 | Ga0068861_10000075720 | 255 |
| 827 | 3300005719 | Ga0068861_100021338 | Ga0068861_1000213385 | 255 |
| 828 | 3300005841 | Ga0068863_100000585 | Ga0068863_10000058535 | 255 |
| 829 | 3300005841 | Ga0068863_100029355 | Ga0068863_1000293555 | 255 |
| 830 | 3300005841 | Ga0068863_100082415 | Ga0068863_1000824153 | 255 |
| 831 | 3300005842 | Ga0068858_100003791 | Ga0068858_10000379112 | 255 |
| 832 | 3300005842 | Ga0068858_100004338 | Ga0068858_10000433811 | 255 |
| 833 | 3300005842 | Ga0068858_100019626 | Ga0068858_1000196262 | 255 |
| 834 | 3300005843 | Ga0068860_100009426 | Ga0068860_10000942611 | 255 |
| 835 | 3300005843 | Ga0068860_100027701 | Ga0068860_1000277014 | 255 |
| 836 | 3300005844 | Ga0068862_100119139 | Ga0068862_1001191394 | 255 |
| 837 | 3300006237 | Ga0097621_100135560 | Ga0097621_1001355604 | 255 |
| 838 | 3300006237 | Ga0097621_100168073 | Ga0097621_1001680733 | 255 |
| 839 | 3300006237 | Ga0097621_100223517 | Ga0097621_1002235173 | 255 |
| 840 | 3300006358 | Ga0068871_100181838 | Ga0068871_1001818383 | 255 |
| 841 | 3300006358 | Ga0068871_100195588 | Ga0068871_1001955881 | 255 |
| 842 | 3300006931 | Ga0097620_100140194 | Ga0097620_1001401943 | 255 |
| 843 | 3300007076 | Ga0075435_100552764 | Ga0075435_1005527641 | 255 |
| 844 | 3300009098 | Ga0105245_10106237 | Ga0105245_101062374 | 255 |
| 845 | 3300009174 | Ga0105241_10298974 | Ga0105241_102989743 | 255 |
| 846 | 3300009177 | Ga0105248_10022083 | Ga0105248_100220834 | 255 |
| 847 | 3300009553 | Ga0105249_10043839 | Ga0105249_100438393 | 255 |
| 848 | 3300010375 | Ga0105239_10050795 | Ga0105239_100507953 | 255 |
| 849 | 3300013296 | Ga0157374_10110327 | Ga0157374_101103272 | 255 |
| 850 | 3300013296 | Ga0157374_10246341 | Ga0157374_102463411 | 255 |
| 851 | 3300013306 | Ga0163162_10014444 | Ga0163162_100144444 | 255 |
| 852 | 3300013306 | Ga0163162_10074167 | Ga0163162_100741675 | 255 |
| 853 | 3300013307 | Ga0157372_10059283 | Ga0157372_100592834 | 255 |
| 854 | 3300013308 | Ga0157375_10006387 | Ga0157375_100063875 | 255 |
| 855 | 3300013308 | Ga0157375_10048845 | Ga0157375_100488454 | 255 |
| 856 | 3300013308 | Ga0157375_10077756 | Ga0157375_100777563 | 255 |
| 857 | 3300014325 | Ga0163163_10087119 | Ga0163163_100871194 | 255 |
| 858 | 3300014326 | Ga0157380_10068761 | Ga0157380_100687612 | 255 |
| 859 | 3300014968 | Ga0157379_10043521 | Ga0157379_100435214 | 255 |
| 860 | 3300014969 | Ga0157376_10181649 | Ga0157376_101816493 | 255 |
| 861 | 3300014969 | Ga0157376_10228127 | Ga0157376_102281272 | 255 |
| 862 | 3300017792 | Ga0163161_10051067 | Ga0163161_100510673 | 255 |
| 863 | 3300017792 | Ga0163161_10056174 | Ga0163161_100561741 | 255 |
| 864 | 3300025315 | Ga0207697_10059926 | Ga0207697_100599262 | 255 |
| 865 | 3300025893 | Ga0207682_10009826 | Ga0207682_100098265 | 255 |
| 866 | 3300025903 | Ga0207680_10030074 | Ga0207680_100300744 | 255 |
| 867 | 3300025907 | Ga0207645_10005283 | Ga0207645_100052834 | 255 |
| 868 | 3300025907 | Ga0207645_10021770 | Ga0207645_100217704 | 255 |
| 869 | 3300025907 | Ga0207645_10098667 | Ga0207645_100986673 | 255 |
| 870 | 3300025908 | Ga0207643_10076328 | Ga0207643_100763281 | 255 |
| 871 | 3300025909 | Ga0207705_10193527 | Ga0207705_101935272 | 255 |
| 872 | 3300025919 | Ga0207657_10265852 | Ga0207657_102658523 | 255 |
| 873 | 3300025920 | Ga0207649_10077606 | Ga0207649_100776063 | 255 |
| 874 | 3300025921 | Ga0207652_10080923 | Ga0207652_100809233 | 255 |
| 875 | 3300025923 | Ga0207681_10002043 | Ga0207681_100020437 | 255 |
| 876 | 3300025925 | Ga0207650_10064700 | Ga0207650_100647003 | 255 |
| 877 | 3300025925 | Ga0207650_10111783 | Ga0207650_101117833 | 255 |
| 878 | 3300025926 | Ga0207659_10000313 | Ga0207659_1000031320 | 255 |
| 879 | 3300025926 | Ga0207659_10021930 | Ga0207659_100219304 | 255 |
| 880 | 3300025926 | Ga0207659_10238648 | Ga0207659_102386482 | 255 |
| 881 | 3300025927 | Ga0207687_10061247 | Ga0207687_100612473 | 255 |
| 882 | 3300025927 | Ga0207687_10345439 | Ga0207687_103454392 | 255 |
| 883 | 3300025931 | Ga0207644_10005549 | Ga0207644_100055492 | 255 |
| 884 | 3300025931 | Ga0207644_10031525 | Ga0207644_100315253 | 255 |
| 885 | 3300025931 | Ga0207644_10100751 | Ga0207644_101007513 | 255 |
| 886 | 3300025931 | Ga0207644_10213745 | Ga0207644_102137452 | 255 |
| 887 | 3300025932 | Ga0207690_10036473 | Ga0207690_100364734 | 255 |
| 888 | 3300025936 | Ga0207670_10014247 | Ga0207670_100142474 | 255 |
| 889 | 3300025937 | Ga0207669_10031901 | Ga0207669_100319014 | 255 |
| 890 | 3300025937 | Ga0207669_10334879 | Ga0207669_103348792 | 255 |
| 891 | 3300025938 | Ga0207704_10008876 | Ga0207704_100088764 | 255 |
| 892 | 3300025940 | Ga0207691_10005968 | Ga0207691_1000596816 | 255 |
| 893 | 3300025940 | Ga0207691_10109171 | Ga0207691_101091714 | 255 |
| 894 | 3300025940 | Ga0207691_10257792 | Ga0207691_102577922 | 255 |
| 895 | 3300025941 | Ga0207711_10301634 | Ga0207711_103016343 | 255 |
| 896 | 3300025942 | Ga0207689_10073788 | Ga0207689_100737883 | 255 |
| 897 | 3300025944 | Ga0207661_10187410 | Ga0207661_101874103 | 255 |
| 898 | 3300025945 | Ga0207679_10061296 | Ga0207679_100612964 | 255 |
| 899 | 3300025945 | Ga0207679_10247848 | Ga0207679_102478483 | 255 |
| 900 | 3300025945 | Ga0207679_10286217 | Ga0207679_102862172 | 255 |
| 901 | 3300025949 | Ga0207667_10064079 | Ga0207667_100640794 | 255 |
| 902 | 3300025960 | Ga0207651_10000600 | Ga0207651_100006007 | 255 |
| 903 | 3300025961 | Ga0207712_10032745 | Ga0207712_100327454 | 255 |
| 904 | 3300025981 | Ga0207640_10100204 | Ga0207640_101002044 | 255 |
| 905 | 3300025986 | Ga0207658_10000812 | Ga0207658_1000081214 | 255 |
| 906 | 3300025986 | Ga0207658_10004524 | Ga0207658_100045245 | 255 |
| 907 | 3300025986 | Ga0207658_10084055 | Ga0207658_100840553 | 255 |
| 908 | 3300026023 | Ga0207677_10003852 | Ga0207677_100038524 | 255 |
| 909 | 3300026035 | Ga0207703_10000929 | Ga0207703_1000092924 | 255 |
| 910 | 3300026035 | Ga0207703_10001541 | Ga0207703_1000154112 | 255 |
| 911 | 3300026035 | Ga0207703_10475492 | Ga0207703_104754922 | 255 |
| 912 | 3300026041 | Ga0207639_10011019 | Ga0207639_100110193 | 255 |
| 913 | 3300026041 | Ga0207639_10107392 | Ga0207639_101073923 | 255 |
| 914 | 3300026067 | Ga0207678_10170155 | Ga0207678_101701552 | 255 |
| 915 | 3300026088 | Ga0207641_10000655 | Ga0207641_1000065535 | 255 |
| 916 | 3300026089 | Ga0207648_10006616 | Ga0207648_100066168 | 255 |
| 917 | 3300026095 | Ga0207676_10002990 | Ga0207676_100029904 | 255 |
| 918 | 3300026095 | Ga0207676_10489257 | Ga0207676_104892572 | 255 |
| 919 | 3300026118 | Ga0207675_100000956 | Ga0207675_10000095630 | 255 |
| 920 | 3300026118 | Ga0207675_100070994 | Ga0207675_1000709944 | 255 |
| 921 | 3300026118 | Ga0207675_100339083 | Ga0207675_1003390833 | 255 |
| 922 | 3300026121 | Ga0207683_10010865 | Ga0207683_1001086512 | 255 |
| 923 | 3300026121 | Ga0207683_10060215 | Ga0207683_100602154 | 255 |
| 924 | 3300026121 | Ga0207683_10067830 | Ga0207683_100678303 | 255 |
| 925 | 3300026142 | Ga0207698_10011374 | Ga0207698_100113746 | 255 |
| 926 | 3300026142 | Ga0207698_10114530 | Ga0207698_101145304 | 255 |
| 927 | 3300026142 | Ga0207698_10422331 | Ga0207698_104223312 | 255 |
| 928 | 3300028381 | Ga0268264_10002170 | Ga0268264_100021707 | 255 |
| 929 | 3300028381 | Ga0268264_10043681 | Ga0268264_100436813 | 255 |
| 930 | 3300035116 | Ga0373945_0063728 | Ga0373945_0063728_341_1108 | 255 |
| 931 | 3300035695 | Ga0373927_0263878 | Ga0373927_0263878_28_795 | 255 |
| 932 | 3300037068 | Ga0373925_0600347 | Ga0373925_0600347_99_866 | 255 |
| 933 | 3300046473 | Ga0495582_0304836 | Ga0495582_0304836_90_857 | 255 |
| 934 | 3300046681 | Ga0495647_0121502 | Ga0495647_0121502_161_937 | 255 |
| 935 | 3300046683 | Ga0495658_0032524 | Ga0495658_0032524_1814_2581 | 255 |
| 936 | 3300046683 | Ga0495658_0049562 | Ga0495658_0049562_651_1526 | 255 |
| 937 | 3300047470 | Ga0495681_0121096 | Ga0495681_0121096_243_1010 | 255 |
| 938 | 3300047471 | Ga0495684_0123832 | Ga0495684_0123832_871_1638 | 255 |
| 939 | 3300048904 | Ga0496101_0361781 | Ga0496101_0361781_201_968 | 255 |
| 940 | 3300048907 | Ga0496104_0424300 | Ga0496104_0424300_360_1136 | 255 |
| 941 | 3300048908 | Ga0496105_0140740 | Ga0496105_0140740_22_798 | 255 |
| 942 | 3300048911 | Ga0496108_0238384 | Ga0496108_0238384_354_1130 | 255 |
| 943 | 3300048912 | Ga0496109_0077834 | Ga0496109_0077834_838_1614 | 255 |
| 944 | 3300048913 | Ga0496110_0013837 | Ga0496110_0013837_1560_2336 | 255 |
| 945 | 3300048914 | Ga0496111_0065975 | Ga0496111_0065975_135_911 | 255 |
| 946 | 3300048916 | Ga0496113_0022247 | Ga0496113_0022247_3324_4100 | 255 |
| 947 | 3300053077 | Ga0495601_0113426 | Ga0495601_0113426_729_1496 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8611 | 16 | 241 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8303 | 16 | 241 |
| 6zmq-assembly1.cif.gz_A | cytochrome c heme lyase ccmf | 0.6605 | 44 | 175 |
| 7oy2-assembly1.cif.gz_C | high resolution structure of cytochrome bd-ii oxidase from e. coli | 0.6207 | 54 | 169 |
| 1oed-assembly1.cif.gz_E | structure of acetylcholine receptor pore from electron images | 0.6064 | 56 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_H3BS89_163_270_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7143 | 55 | 139 | 1.20.140.150 |
| af_Q08CE6_110_279_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6868 | 55 | 142 | 1.20.140.150 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6531 | 58 | 185 | 1.20.120.1770 |
| af_Q6H474_2_116_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6408 | 58 | 172 | 1.20.120.290 |
| af_A0A1D6JN65_108_240_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6297 | 58 | 185 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0YZH0-F1-model_v4 | Cytochrome c assembly protein | 0.9468 | 9 | 169 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A7C8D923-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein CcmC) | 0.9387 | 2 | 169 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-T0YZH0-F1-model_v4 | Cytochrome c assembly protein | 0.9355 | 9 | 169 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A1N6ZL81-F1-model_v4 | Heme exporter protein C | 0.9307 | 12 | 248 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A2M7FI51-F1-model_v4 | Heme exporter protein C | 0.928 | 8 | 176 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar