F486479

General Info

Members Datasets Scaffolds Average Seq Length
947 352 947 244

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100020119|Ga0070708_1000201194
Length 242
Sequence MGSNSINWFKFASPASFFPFAGRLARWFAVLAAPLAAAGLWLGLVVAPTDAQQGDAYRIIFIHVPAAWMSMFIYLVMAAWCAASLTLNARLSAMMAQALAPTGALFTVIALWTGAGTYWAWDARMTSELILLFLYLGYMALRHAIDEPRRADRASAVLALVGAVNVPIIYFSVKWWNTLHQGATVSLTAAPKMASIMLTAMLLMTFAAWFYAIAVAMVRVRAIILERERRTSWAGAFVGAAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
344 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 0
Rhizoplane 3.17
Rhizosphere 91.87
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10212722 3300005327 Bacteria 1633
2 Ga0070676_10001735 3300005328 Bacteria 11096
3 Ga0070676_10194201 3300005328 Bacteria 1327
4 Ga0070676_10300112 3300005328 Bacteria 1089
5 Ga0070683_100099341 3300005329 Bacteria 2739
6 Ga0070690_100001151 3300005330 Bacteria 13613
7 Ga0070690_100051502 3300005330 Bacteria 2628
8 Ga0070670_100005989 3300005331 Bacteria 10289
9 Ga0070670_100038187 3300005331 Bacteria 4129
10 Ga0070670_100052284 3300005331 Bacteria 3508
11 Ga0070670_100085666 3300005331 Bacteria 2707
12 Ga0070670_100089859 3300005331 Bacteria 2640
13 Ga0070670_100440444 3300005331 Bacteria 1154
14 Ga0070677_10005263 3300005333 Bacteria 4257
15 Ga0070677_10121222 3300005333 Bacteria 1181
16 Ga0068869_100000926 3300005334 Bacteria 16926
17 Ga0068869_100004899 3300005334 Bacteria 8377
18 Ga0068869_100022670 3300005334 Bacteria 4329
19 Ga0068869_100082175 3300005334 Bacteria 2407
20 Ga0068869_100088068 3300005334 Bacteria 2330
21 Ga0068869_100211483 3300005334 Bacteria 1533
22 Ga0068869_100233691 3300005334 Bacteria 1462
23 Ga0070666_10003246 3300005335 Bacteria 9877
24 Ga0070666_10005482 3300005335 Bacteria 7780
25 Ga0070666_10008121 3300005335 Bacteria 6500
26 Ga0070666_10125564 3300005335 Bacteria 1781
27 Ga0070682_100024903 3300005337 Bacteria 3567
28 Ga0068868_100002572 3300005338 Bacteria 12589
29 Ga0068868_100007250 3300005338 Bacteria 7885
30 Ga0068868_100017866 3300005338 Bacteria 5291
31 Ga0068868_100027784 3300005338 Bacteria 4319
32 Ga0068868_100671195 3300005338 Bacteria 925
33 Ga0070660_100012880 3300005339 Bacteria 5983
34 Ga0070689_100000968 3300005340 Bacteria 17929
35 Ga0070689_100012276 3300005340 Bacteria 6165
36 Ga0070689_100019778 3300005340 Bacteria 4983
37 Ga0070691_10034323 3300005341 Bacteria 2388
38 Ga0070691_10048127 3300005341 Bacteria 2028
39 Ga0070687_100045865 3300005343 Bacteria 2235
40 Ga0070687_100175570 3300005343 Bacteria 1279
41 Ga0070661_100013701 3300005344 Bacteria 5696
42 Ga0070661_100026640 3300005344 Bacteria 4159
43 Ga0070661_100297307 3300005344 Bacteria 1256
44 Ga0070692_10022249 3300005345 Bacteria 3095
45 Ga0070668_100004119 3300005347 Bacteria 10765
46 Ga0070668_100066950 3300005347 Bacteria 2788
47 Ga0070669_100000668 3300005353 Bacteria 25208
48 Ga0070669_100001340 3300005353 Bacteria 17754
49 Ga0070669_100069103 3300005353 Bacteria 2608
50 Ga0070675_100002913 3300005354 Bacteria 12900
51 Ga0070675_100017405 3300005354 Bacteria 5711
52 Ga0070675_100033252 3300005354 Bacteria 4180
53 Ga0070675_100115036 3300005354 Bacteria 2280
54 Ga0070675_100221877 3300005354 Bacteria 1646
55 Ga0070675_100294807 3300005354 Bacteria 1428
56 Ga0070671_100010442 3300005355 Bacteria 7450
57 Ga0070671_100019898 3300005355 Bacteria 5469
58 Ga0070671_100039862 3300005355 Bacteria 3899
59 Ga0070671_100212959 3300005355 Bacteria 1639
60 Ga0070674_100164352 3300005356 Bacteria 1687
61 Ga0070674_100166671 3300005356 Bacteria 1676
62 Ga0070673_100002041 3300005364 Bacteria 12191
63 Ga0070673_100005216 3300005364 Bacteria 8297
64 Ga0070673_100034039 3300005364 Bacteria 3851
65 Ga0070673_100048540 3300005364 Bacteria 3310
66 Ga0070673_100083572 3300005364 Bacteria 2594
67 Ga0070673_100206584 3300005364 Bacteria 1694
68 Ga0070673_100347214 3300005364 Bacteria 1316
69 Ga0070673_100468341 3300005364 Bacteria 1136
70 Ga0070688_100008334 3300005365 Bacteria 5625
71 Ga0070688_100026064 3300005365 Bacteria 3469
72 Ga0070659_100052498 3300005366 Bacteria 3207
73 Ga0070659_100127375 3300005366 Bacteria 2066
74 Ga0070659_100362490 3300005366 Bacteria 1218
75 Ga0070667_100001232 3300005367 Bacteria 23249
76 Ga0070667_100004388 3300005367 Bacteria 11903
77 Ga0070667_100006263 3300005367 Bacteria 9893
78 Ga0070667_100018925 3300005367 Bacteria 5710
79 Ga0070667_100063935 3300005367 Bacteria 3121
80 Ga0070667_100583766 3300005367 Bacteria 1029
81 Ga0070713_100009864 3300005436 Bacteria 6868
82 Ga0070713_100021191 3300005436 Bacteria 4994
83 Ga0070710_10006201 3300005437 Bacteria 5722
84 Ga0070701_10011700 3300005438 Bacteria 3936
85 Ga0070711_100000893 3300005439 Bacteria 15682
86 Ga0070705_100014603 3300005440 Bacteria 4044
87 Ga0070700_100014701 3300005441 Bacteria 4423
88 Ga0070700_100030180 3300005441 Bacteria 3237
89 Ga0070700_100118979 3300005441 Bacteria 1767
90 Ga0070694_100012252 3300005444 Bacteria 5327
91 Ga0070708_100020119 3300005445 Bacteria 5622
92 Ga0070708_100119277 3300005445 Bacteria 2431
93 Ga0070663_100091829 3300005455 Bacteria 2250
94 Ga0070678_100000107 3300005456 Bacteria 32267
95 Ga0070678_100001539 3300005456 Bacteria 12334
96 Ga0070678_100016518 3300005456 Bacteria 4725
97 Ga0070678_100070096 3300005456 Bacteria 2620
98 Ga0070678_100077931 3300005456 Bacteria 2502
99 Ga0070678_100246214 3300005456 Bacteria 1497
100 Ga0070678_100325755 3300005456 Bacteria 1313
101 Ga0070678_100339044 3300005456 Bacteria 1289
102 Ga0070678_100444285 3300005456 Bacteria 1135
103 Ga0070662_100028287 3300005457 Bacteria 3900
104 Ga0070662_100040230 3300005457 Bacteria 3327
105 Ga0070662_100143663 3300005457 Bacteria 1852
106 Ga0070681_10007168 3300005458 Bacteria 10859
107 Ga0070681_10082525 3300005458 Bacteria 3170
108 Ga0068867_100012431 3300005459 Bacteria 6023
109 Ga0068867_100029690 3300005459 Bacteria 3940
110 Ga0068867_100044376 3300005459 Bacteria 3257
111 Ga0068867_100055039 3300005459 Bacteria 2940
112 Ga0068867_100068502 3300005459 Bacteria 2648
113 Ga0068867_100091991 3300005459 Bacteria 2303
114 Ga0068867_100113331 3300005459 Bacteria 2086
115 Ga0068867_100130879 3300005459 Bacteria 1950
116 Ga0068867_100240035 3300005459 Bacteria 1469
117 Ga0070685_10000221 3300005466 Bacteria 37567
118 Ga0070706_100091964 3300005467 Bacteria 2814
119 Ga0070706_100131071 3300005467 Bacteria 2339
120 Ga0070706_100146874 3300005467 Bacteria 2202
121 Ga0070706_100504900 3300005467 Bacteria 1125
122 Ga0070706_100584627 3300005467 Bacteria 1038
123 Ga0070707_100027242 3300005468 Bacteria 5437
124 Ga0070698_100095739 3300005471 Bacteria 2946
125 Ga0070699_100145386 3300005518 Bacteria 2095
126 Ga0070699_100160196 3300005518 Bacteria 1991
127 Ga0070679_100144794 3300005530 Bacteria 2354
128 Ga0070679_100339159 3300005530 Bacteria 1451
129 Ga0070684_100009252 3300005535 Bacteria 7753
130 Ga0070697_100002608 3300005536 Bacteria 13872
131 Ga0068853_100022499 3300005539 Bacteria 5265
132 Ga0068853_100125706 3300005539 Bacteria 2291
133 Ga0068853_100250004 3300005539 Bacteria 1626
134 Ga0068853_100250468 3300005539 Bacteria 1625
135 Ga0070672_100000287 3300005543 Bacteria 28567
136 Ga0070672_100009036 3300005543 Bacteria 6851
137 Ga0070672_100066153 3300005543 Bacteria 2861
138 Ga0070672_100067150 3300005543 Bacteria 2841
139 Ga0070672_100071664 3300005543 Bacteria 2757
140 Ga0070672_100082633 3300005543 Bacteria 2577
141 Ga0070672_100123089 3300005543 Bacteria 2125
142 Ga0070686_100021520 3300005544 Bacteria 3835
143 Ga0070686_100055642 3300005544 Bacteria 2535
144 Ga0070686_100306748 3300005544 Bacteria 1179
145 Ga0070686_100377124 3300005544 Bacteria 1073
146 Ga0070695_100077736 3300005545 Bacteria 2187
147 Ga0070695_100183001 3300005545 Bacteria 1486
148 Ga0070695_100578281 3300005545 Bacteria 879
149 Ga0070696_100055582 3300005546 Bacteria 2760
150 Ga0070696_100109391 3300005546 Bacteria 1989
151 Ga0070693_100009100 3300005547 Bacteria 4929
152 Ga0070693_100234281 3300005547 Bacteria 1209
153 Ga0070665_100005852 3300005548 Bacteria 12613
154 Ga0070665_100023957 3300005548 Bacteria 6147
155 Ga0070665_100192649 3300005548 Bacteria 2039
156 Ga0070704_100018809 3300005549 Bacteria 4427
157 Ga0068855_100345279 3300005563 Bacteria 1640
158 Ga0068855_100590673 3300005563 Bacteria 1198
159 Ga0070664_100041961 3300005564 Bacteria 3862
160 Ga0070664_100173679 3300005564 Bacteria 1912
161 Ga0070664_100368865 3300005564 Bacteria 1308
162 Ga0070664_100515269 3300005564 Bacteria 1103
163 Ga0068857_100083257 3300005577 Bacteria 2858
164 Ga0068857_100097293 3300005577 Bacteria 2638
165 Ga0068857_100132982 3300005577 Bacteria 2245
166 Ga0068857_100568161 3300005577 Bacteria 1070
167 Ga0068857_100804393 3300005577 Bacteria 898
168 Ga0068854_100009962 3300005578 Bacteria 6152
169 Ga0068854_100086543 3300005578 Bacteria 2323
170 Ga0068856_100190024 3300005614 Bacteria 2067
171 Ga0068856_100201580 3300005614 Bacteria 2004
172 Ga0070702_100241410 3300005615 Bacteria 1219
173 Ga0068852_100034538 3300005616 Bacteria 4208
174 Ga0068852_100068867 3300005616 Bacteria 3099
175 Ga0068852_100118552 3300005616 Bacteria 2419
176 Ga0068852_100130364 3300005616 Bacteria 2315
177 Ga0068852_100242460 3300005616 Bacteria 1723
178 Ga0068852_100245979 3300005616 Bacteria 1711
179 Ga0068852_100568284 3300005616 Bacteria 1136
180 Ga0068859_100003177 3300005617 Bacteria 16715
181 Ga0068859_100020837 3300005617 Bacteria 6580
182 Ga0068859_100140187 3300005617 Bacteria 2491
183 Ga0068859_100290582 3300005617 Bacteria 1728
184 Ga0068859_100298302 3300005617 Bacteria 1705
185 Ga0068864_100002616 3300005618 Bacteria 14866
186 Ga0068864_100002879 3300005618 Bacteria 14221
187 Ga0068864_100008284 3300005618 Bacteria 8574
188 Ga0068864_100017069 3300005618 Bacteria 6050
189 Ga0068864_100047375 3300005618 Bacteria 3692
190 Ga0068864_100049900 3300005618 Bacteria 3601
191 Ga0068864_100079160 3300005618 Bacteria 2877
192 Ga0068864_100087580 3300005618 Bacteria 2742
193 Ga0068864_100454306 3300005618 Bacteria 1225
194 Ga0068864_100778558 3300005618 Bacteria 939
195 Ga0068866_10000652 3300005718 Bacteria 15743
196 Ga0068866_10001673 3300005718 Bacteria 9346
197 Ga0068866_10029507 3300005718 Bacteria 2624
198 Ga0068866_10047815 3300005718 Bacteria 2159
199 Ga0068866_10066202 3300005718 Bacteria 1892
200 Ga0068861_100000757 3300005719 Bacteria 19364
201 Ga0068861_100003709 3300005719 Bacteria 10193
202 Ga0068861_100004546 3300005719 Bacteria 9316
203 Ga0068861_100016929 3300005719 Bacteria 5168
204 Ga0068861_100021338 3300005719 Bacteria 4654
205 Ga0068861_100047329 3300005719 Bacteria 3246
206 Ga0068861_100069108 3300005719 Bacteria 2731
207 Ga0068861_100242081 3300005719 Bacteria 1535
208 Ga0068851_10042280 3300005834 Bacteria 2294
209 Ga0068851_10072779 3300005834 Bacteria 1781
210 Ga0068870_10006402 3300005840 Bacteria 5188
211 Ga0068870_10009878 3300005840 Bacteria 4358
212 Ga0068863_100000585 3300005841 Bacteria 37128
213 Ga0068863_100002985 3300005841 Bacteria 16732
214 Ga0068863_100029355 3300005841 Bacteria 5249
215 Ga0068863_100082415 3300005841 Bacteria 3048
216 Ga0068863_100085590 3300005841 Bacteria 2987
217 Ga0068863_100227080 3300005841 Bacteria 1800
218 Ga0068858_100000603 3300005842 Bacteria 37588
219 Ga0068858_100003791 3300005842 Bacteria 14951
220 Ga0068858_100004338 3300005842 Bacteria 13920
221 Ga0068858_100019626 3300005842 Bacteria 6319
222 Ga0068858_100021707 3300005842 Bacteria 5999
223 Ga0068858_100022884 3300005842 Bacteria 5829
224 Ga0068858_100146076 3300005842 Bacteria 2221
225 Ga0068858_100150173 3300005842 Bacteria 2190
226 Ga0068858_100282847 3300005842 Bacteria 1580
227 Ga0068858_100501201 3300005842 Bacteria 1173
228 Ga0068860_100002076 3300005843 Bacteria 21118
229 Ga0068860_100005493 3300005843 Bacteria 12840
230 Ga0068860_100005815 3300005843 Bacteria 12419
231 Ga0068860_100009426 3300005843 Bacteria 9703
232 Ga0068860_100013332 3300005843 Bacteria 8058
233 Ga0068860_100017524 3300005843 Bacteria 6979
234 Ga0068860_100027701 3300005843 Bacteria 5456
235 Ga0068860_100033089 3300005843 Bacteria 4963
236 Ga0068860_100787193 3300005843 Bacteria 964
237 Ga0068862_100016504 3300005844 Bacteria 6147
238 Ga0068862_100066477 3300005844 Bacteria 3107
239 Ga0068862_100110121 3300005844 Bacteria 2417
240 Ga0068862_100119139 3300005844 Bacteria 2325
241 Ga0075363_100086097 3300006048 Bacteria 1724
242 Ga0075364_10014913 3300006051 Bacteria 4810
243 Ga0070716_100001339 3300006173 Bacteria 10909
244 Ga0070716_100020690 3300006173 Bacteria 3456
245 Ga0070716_100188955 3300006173 Bacteria 1359
246 Ga0070712_100002453 3300006175 Bacteria 11432
247 Ga0075362_10008625 3300006177 Bacteria 3910
248 Ga0075362_10024025 3300006177 Bacteria 2583
249 Ga0075367_10287278 3300006178 Bacteria 1034
250 Ga0075369_10081983 3300006186 Bacteria 1431
251 Ga0075366_10002701 3300006195 Bacteria 9156
252 Ga0075366_10003106 3300006195 Bacteria 8684
253 Ga0075366_10004261 3300006195 Bacteria 7673
254 Ga0075366_10036923 3300006195 Bacteria 2882
255 Ga0075366_10054389 3300006195 Bacteria 2377
256 Ga0075366_10076205 3300006195 Bacteria 2001
257 Ga0097621_100001308 3300006237 Bacteria 17135
258 Ga0097621_100020593 3300006237 Bacteria 5083
259 Ga0097621_100135560 3300006237 Bacteria 2099
260 Ga0097621_100168073 3300006237 Bacteria 1889
261 Ga0097621_100223517 3300006237 Bacteria 1641
262 Ga0097621_100378184 3300006237 Bacteria 1264
263 Ga0097621_100454851 3300006237 Bacteria 1154
264 Ga0097621_100574461 3300006237 Bacteria 1028
265 Ga0075370_10002336 3300006353 Bacteria 8766
266 Ga0075370_10012106 3300006353 Bacteria 4551
267 Ga0075370_10097440 3300006353 Bacteria 1700
268 Ga0075370_10117967 3300006353 Bacteria 1543
269 Ga0068871_100001077 3300006358 Bacteria 18307
270 Ga0068871_100041396 3300006358 Bacteria 3694
271 Ga0068871_100109944 3300006358 Bacteria 2318
272 Ga0068871_100162973 3300006358 Bacteria 1908
273 Ga0068871_100181838 3300006358 Bacteria 1807
274 Ga0068871_100195588 3300006358 Bacteria 1744
275 Ga0075430_100061527 3300006846 Bacteria 3155
276 Ga0075433_10049587 3300006852 Bacteria 3653
277 Ga0075434_100020488 3300006871 Bacteria 6415
278 Ga0075434_100048092 3300006871 Bacteria 4233
279 Ga0075434_100844094 3300006871 Bacteria 932
280 Ga0075429_100006183 3300006880 Bacteria 10351
281 Ga0068865_100001397 3300006881 Bacteria 14036
282 Ga0068865_100063168 3300006881 Bacteria 2602
283 Ga0068865_100086501 3300006881 Bacteria 2263
284 Ga0068865_100200552 3300006881 Bacteria 1548
285 Ga0075436_100164282 3300006914 Bacteria 1566
286 Ga0097620_100003176 3300006931 Bacteria 16715
287 Ga0097620_100020837 3300006931 Bacteria 6580
288 Ga0097620_100140194 3300006931 Bacteria 2491
289 Ga0097620_100290566 3300006931 Bacteria 1728
290 Ga0097620_100298316 3300006931 Bacteria 1705
291 Ga0075435_100017023 3300007076 Bacteria 5491
292 Ga0075435_100017178 3300007076 Bacteria 5469
293 Ga0075435_100217711 3300007076 Bacteria 1621
294 Ga0075435_100552764 3300007076 Bacteria 997
295 Ga0105240_10095347 3300009093 Bacteria 3628
296 Ga0111539_10785273 3300009094 Bacteria 1108
297 Ga0105245_10005497 3300009098 Bacteria 11132
298 Ga0105245_10014037 3300009098 Bacteria 6975
299 Ga0105245_10020376 3300009098 Bacteria 5816
300 Ga0105245_10025793 3300009098 Bacteria 5169
301 Ga0105245_10106237 3300009098 Bacteria 2605
302 Ga0105247_10340706 3300009101 Bacteria 1051
303 Ga0114129_10172919 3300009147 Bacteria 2944
304 Ga0105243_10003255 3300009148 Bacteria 13216
305 Ga0105243_10110471 3300009148 Bacteria 2299
306 Ga0105241_10014472 3300009174 Bacteria 5777
307 Ga0105241_10298974 3300009174 Bacteria 1381
308 Ga0105241_10332946 3300009174 Bacteria 1313
309 Ga0105242_10002918 3300009176 Bacteria 13363
310 Ga0105242_10063808 3300009176 Bacteria 3034
311 Ga0105248_10002074 3300009177 Bacteria 22178
312 Ga0105248_10018068 3300009177 Bacteria 7784
313 Ga0105248_10022083 3300009177 Bacteria 7051
314 Ga0105248_10129464 3300009177 Bacteria 2847
315 Ga0105237_10021940 3300009545 Bacteria 6558
316 Ga0105237_10156291 3300009545 Bacteria 2277
317 Ga0105238_10047138 3300009551 Bacteria 4347
318 Ga0105238_10477940 3300009551 Bacteria 1245
319 Ga0105249_10026569 3300009553 Bacteria 5218
320 Ga0105249_10043839 3300009553 Bacteria 4069
321 Ga0105249_10097812 3300009553 Bacteria 2755
322 Ga0105249_10118839 3300009553 Bacteria 2509
323 Ga0105249_10230804 3300009553 Bacteria 1825
324 Ga0105239_10020138 3300010375 Bacteria 7360
325 Ga0105239_10033050 3300010375 Bacteria 5682
326 Ga0105239_10050795 3300010375 Bacteria 4546
327 Ga0105239_10235169 3300010375 Bacteria 2056
328 Ga0105246_10033904 3300011119 Bacteria 3396
329 Ga0105246_10175926 3300011119 Bacteria 1643
330 Ga0105246_10448577 3300011119 Bacteria 1083
331 Ga0157373_10055871 3300013100 Bacteria 2804
332 Ga0157369_10041396 3300013105 Bacteria 5029
333 Ga0157369_10357187 3300013105 Bacteria 1517
334 Ga0157374_10000565 3300013296 Bacteria 32833
335 Ga0157374_10001312 3300013296 Bacteria 21166
336 Ga0157374_10025744 3300013296 Bacteria 5287
337 Ga0157374_10110327 3300013296 Bacteria 2646
338 Ga0157374_10144119 3300013296 Bacteria 2313
339 Ga0157374_10246341 3300013296 Bacteria 1758
340 Ga0157378_10025900 3300013297 Bacteria 5168
341 Ga0157378_10059126 3300013297 Bacteria 3419
342 Ga0157378_10076219 3300013297 Bacteria 3021
343 Ga0157378_10205292 3300013297 Bacteria 1866
344 Ga0157378_10225973 3300013297 Bacteria 1781
345 Ga0157378_10226018 3300013297 Bacteria 1781
346 Ga0157378_10439617 3300013297 Bacteria 1293
347 Ga0163162_10005459 3300013306 Bacteria 12283
348 Ga0163162_10005575 3300013306 Bacteria 12177
349 Ga0163162_10014444 3300013306 Bacteria 7715
350 Ga0163162_10022644 3300013306 Bacteria 6194
351 Ga0163162_10074167 3300013306 Bacteria 3460
352 Ga0163162_10154069 3300013306 Bacteria 2417
353 Ga0163162_11180129 3300013306 Bacteria 868
354 Ga0157372_10059283 3300013307 Bacteria 4281
355 Ga0157372_10360198 3300013307 Bacteria 1695
356 Ga0157375_10002469 3300013308 Bacteria 16013
357 Ga0157375_10004526 3300013308 Bacteria 12081
358 Ga0157375_10006387 3300013308 Bacteria 10274
359 Ga0157375_10048845 3300013308 Bacteria 4142
360 Ga0157375_10052688 3300013308 Bacteria 4001
361 Ga0157375_10077756 3300013308 Bacteria 3349
362 Ga0157375_10125067 3300013308 Bacteria 2685
363 Ga0157375_10197128 3300013308 Bacteria 2169
364 Ga0157375_11289329 3300013308 Bacteria 858
365 Ga0163163_10000689 3300014325 Bacteria 28712
366 Ga0163163_10044884 3300014325 Bacteria 4337
367 Ga0163163_10087119 3300014325 Bacteria 3133
368 Ga0163163_10330808 3300014325 Bacteria 1578
369 Ga0157380_10027611 3300014326 Bacteria 4318
370 Ga0157380_10068261 3300014326 Bacteria 2865
371 Ga0157380_10068761 3300014326 Bacteria 2856
372 Ga0157380_10081889 3300014326 Bacteria 2641
373 Ga0157380_10539762 3300014326 Bacteria 1142
374 Ga0157377_10000047 3300014745 Bacteria 94451
375 Ga0157377_10061033 3300014745 Bacteria 2154
376 Ga0157379_10000858 3300014968 Bacteria 24649
377 Ga0157379_10003863 3300014968 Bacteria 12770
378 Ga0157379_10004449 3300014968 Bacteria 12018
379 Ga0157379_10039788 3300014968 Bacteria 4195
380 Ga0157379_10043521 3300014968 Bacteria 4009
381 Ga0157379_10125926 3300014968 Bacteria 2305
382 Ga0157379_10195591 3300014968 Bacteria 1827
383 Ga0157376_10007657 3300014969 Bacteria 7734
384 Ga0157376_10007747 3300014969 Bacteria 7696
385 Ga0157376_10012373 3300014969 Bacteria 6332
386 Ga0157376_10181649 3300014969 Bacteria 1923
387 Ga0157376_10228127 3300014969 Bacteria 1728
388 Ga0157376_10877646 3300014969 Bacteria 914
389 Ga0163161_10011289 3300017792 Bacteria 6190
390 Ga0163161_10039951 3300017792 Bacteria 3369
391 Ga0163161_10040889 3300017792 Bacteria 3331
392 Ga0163161_10051067 3300017792 Bacteria 2994
393 Ga0163161_10056174 3300017792 Bacteria 2859
394 Ga0209257_1011000 3300025304 Bacteria 4445
395 Ga0207697_10059926 3300025315 Bacteria 1582
396 Ga0207682_10009826 3300025893 Bacteria 3764
397 Ga0207682_10030848 3300025893 Bacteria 2149
398 Ga0207692_10152743 3300025898 Bacteria 1324
399 Ga0207692_10476843 3300025898 Bacteria 789
400 Ga0207642_10000852 3300025899 Bacteria 9489
401 Ga0207642_10051891 3300025899 Bacteria 1858
402 Ga0207642_10069057 3300025899 Bacteria 1674
403 Ga0207710_10143368 3300025900 Bacteria 1155
404 Ga0207710_10187497 3300025900 Bacteria 1017
405 Ga0207680_10000458 3300025903 Bacteria 19273
406 Ga0207680_10001962 3300025903 Bacteria 9626
407 Ga0207680_10030074 3300025903 Bacteria 3058
408 Ga0207680_10110288 3300025903 Bacteria 1783
409 Ga0207647_10302587 3300025904 Bacteria 910
410 Ga0207699_10146661 3300025906 Bacteria 1557
411 Ga0207645_10001318 3300025907 Bacteria 20383
412 Ga0207645_10005283 3300025907 Bacteria 9402
413 Ga0207645_10021770 3300025907 Bacteria 4177
414 Ga0207645_10026002 3300025907 Bacteria 3786
415 Ga0207645_10098667 3300025907 Bacteria 1883
416 Ga0207643_10010319 3300025908 Bacteria 5028
417 Ga0207643_10011382 3300025908 Bacteria 4803
418 Ga0207643_10065333 3300025908 Bacteria 2084
419 Ga0207643_10076328 3300025908 Bacteria 1935
420 Ga0207643_10178872 3300025908 Bacteria 1283
421 Ga0207705_10193527 3300025909 Bacteria 1539
422 Ga0207684_10026389 3300025910 Bacteria 4952
423 Ga0207684_10082931 3300025910 Bacteria 2730
424 Ga0207684_10122928 3300025910 Bacteria 2226
425 Ga0207684_10123164 3300025910 Bacteria 2224
426 Ga0207654_10003842 3300025911 Bacteria 7571
427 Ga0207654_10094366 3300025911 Bacteria 1831
428 Ga0207654_10190846 3300025911 Bacteria 1343
429 Ga0207654_10237427 3300025911 Bacteria 1216
430 Ga0207707_10055187 3300025912 Bacteria 3456
431 Ga0207707_10079703 3300025912 Bacteria 2859
432 Ga0207695_10180450 3300025913 Bacteria 2032
433 Ga0207671_10016519 3300025914 Bacteria 5732
434 Ga0207671_10394315 3300025914 Bacteria 1101
435 Ga0207693_10001163 3300025915 Bacteria 23479
436 Ga0207693_10044072 3300025915 Bacteria 3506
437 Ga0207663_10002183 3300025916 Bacteria 9348
438 Ga0207662_10026400 3300025918 Bacteria 3350
439 Ga0207662_10201721 3300025918 Bacteria 1288
440 Ga0207657_10000280 3300025919 Bacteria 54274
441 Ga0207657_10265852 3300025919 Bacteria 1364
442 Ga0207649_10010360 3300025920 Bacteria 5119
443 Ga0207649_10077606 3300025920 Bacteria 2141
444 Ga0207649_10139247 3300025920 Bacteria 1658
445 Ga0207652_10080923 3300025921 Bacteria 2841
446 Ga0207646_10010826 3300025922 Bacteria 8863
447 Ga0207646_10465438 3300025922 Bacteria 1140
448 Ga0207681_10002043 3300025923 Bacteria 12940
449 Ga0207681_10026428 3300025923 Bacteria 3744
450 Ga0207681_10126456 3300025923 Bacteria 1883
451 Ga0207681_10287120 3300025923 Bacteria 1297
452 Ga0207694_10168492 3300025924 Bacteria 1772
453 Ga0207694_10367874 3300025924 Bacteria 1192
454 Ga0207650_10001150 3300025925 Bacteria 19435
455 Ga0207650_10014573 3300025925 Bacteria 5461
456 Ga0207650_10064700 3300025925 Bacteria 2738
457 Ga0207650_10093449 3300025925 Bacteria 2302
458 Ga0207650_10111783 3300025925 Bacteria 2116
459 Ga0207650_10303220 3300025925 Bacteria 1305
460 Ga0207659_10000313 3300025926 Bacteria 29491
461 Ga0207659_10001947 3300025926 Bacteria 12255
462 Ga0207659_10021930 3300025926 Bacteria 4247
463 Ga0207659_10056065 3300025926 Bacteria 2821
464 Ga0207659_10238648 3300025926 Bacteria 1469
465 Ga0207687_10000741 3300025927 Bacteria 22128
466 Ga0207687_10061247 3300025927 Bacteria 2657
467 Ga0207687_10345439 3300025927 Bacteria 1211
468 Ga0207700_10438709 3300025928 Bacteria 1149
469 Ga0207644_10000517 3300025931 Bacteria 24952
470 Ga0207644_10002123 3300025931 Bacteria 12863
471 Ga0207644_10004658 3300025931 Bacteria 8914
472 Ga0207644_10005549 3300025931 Bacteria 8209
473 Ga0207644_10031525 3300025931 Bacteria 3693
474 Ga0207644_10100751 3300025931 Bacteria 2169
475 Ga0207644_10172753 3300025931 Bacteria 1688
476 Ga0207644_10213745 3300025931 Bacteria 1526
477 Ga0207644_10406883 3300025931 Bacteria 1113
478 Ga0207690_10036473 3300025932 Bacteria 3184
479 Ga0207690_10065445 3300025932 Bacteria 2486
480 Ga0207690_10527940 3300025932 Bacteria 957
481 Ga0207706_10012311 3300025933 Bacteria 7793
482 Ga0207706_10025594 3300025933 Bacteria 5286
483 Ga0207706_10027747 3300025933 Bacteria 5061
484 Ga0207706_10124061 3300025933 Bacteria 2272
485 Ga0207686_10000521 3300025934 Bacteria 24900
486 Ga0207670_10000894 3300025936 Bacteria 15736
487 Ga0207670_10014247 3300025936 Bacteria 4714
488 Ga0207670_10094199 3300025936 Bacteria 2124
489 Ga0207669_10011731 3300025937 Bacteria 4279
490 Ga0207669_10031901 3300025937 Bacteria 2950
491 Ga0207669_10034806 3300025937 Bacteria 2858
492 Ga0207669_10309881 3300025937 Bacteria 1203
493 Ga0207669_10328371 3300025937 Bacteria 1173
494 Ga0207669_10334879 3300025937 Bacteria 1163
495 Ga0207704_10008876 3300025938 Bacteria 4828
496 Ga0207704_10015099 3300025938 Bacteria 3925
497 Ga0207704_10036082 3300025938 Bacteria 2841
498 Ga0207704_10180678 3300025938 Bacteria 1524
499 Ga0207704_10287762 3300025938 Bacteria 1252
500 Ga0207665_10004353 3300025939 Bacteria 9406
501 Ga0207665_10025043 3300025939 Bacteria 3935
502 Ga0207665_10125350 3300025939 Bacteria 1818
503 Ga0207691_10000249 3300025940 Bacteria 53276
504 Ga0207691_10005968 3300025940 Bacteria 11764
505 Ga0207691_10015882 3300025940 Bacteria 7155
506 Ga0207691_10044197 3300025940 Bacteria 4102
507 Ga0207691_10086127 3300025940 Bacteria 2819
508 Ga0207691_10093556 3300025940 Bacteria 2691
509 Ga0207691_10109171 3300025940 Bacteria 2461
510 Ga0207691_10130041 3300025940 Bacteria 2225
511 Ga0207691_10257792 3300025940 Bacteria 1504
512 Ga0207711_10000448 3300025941 Bacteria 43007
513 Ga0207711_10015792 3300025941 Bacteria 6264
514 Ga0207711_10030180 3300025941 Bacteria 4572
515 Ga0207711_10100675 3300025941 Bacteria 2556
516 Ga0207711_10301634 3300025941 Bacteria 1477
517 Ga0207711_10382017 3300025941 Bacteria 1307
518 Ga0207689_10002181 3300025942 Bacteria 18377
519 Ga0207689_10005377 3300025942 Bacteria 11463
520 Ga0207689_10009869 3300025942 Bacteria 8230
521 Ga0207689_10037236 3300025942 Bacteria 4036
522 Ga0207689_10073788 3300025942 Bacteria 2803
523 Ga0207689_10181727 3300025942 Bacteria 1734
524 Ga0207689_10225844 3300025942 Bacteria 1547
525 Ga0207661_10028878 3300025944 Bacteria 4252
526 Ga0207661_10187410 3300025944 Bacteria 1812
527 Ga0207679_10061296 3300025945 Bacteria 2800
528 Ga0207679_10247848 3300025945 Bacteria 1513
529 Ga0207679_10286217 3300025945 Bacteria 1415
530 Ga0207667_10064079 3300025949 Bacteria 3839
531 Ga0207667_10067633 3300025949 Bacteria 3721
532 Ga0207667_10302926 3300025949 Bacteria 1633
533 Ga0207651_10000600 3300025960 Bacteria 15181
534 Ga0207651_10002125 3300025960 Bacteria 9356
535 Ga0207651_10006459 3300025960 Bacteria 6140
536 Ga0207651_10104767 3300025960 Bacteria 2108
537 Ga0207651_10224419 3300025960 Bacteria 1521
538 Ga0207651_10487669 3300025960 Bacteria 1063
539 Ga0207712_10032745 3300025961 Bacteria 3510
540 Ga0207712_10099473 3300025961 Bacteria 2159
541 Ga0207668_10002554 3300025972 Bacteria 10635
542 Ga0207640_10006937 3300025981 Bacteria 6232
543 Ga0207640_10100204 3300025981 Bacteria 2029
544 Ga0207640_10271458 3300025981 Bacteria 1327
545 Ga0207640_10624108 3300025981 Bacteria 915
546 Ga0207658_10000812 3300025986 Bacteria 26147
547 Ga0207658_10001272 3300025986 Bacteria 19944
548 Ga0207658_10004524 3300025986 Bacteria 9661
549 Ga0207658_10006610 3300025986 Bacteria 7902
550 Ga0207658_10042260 3300025986 Bacteria 3305
551 Ga0207658_10069198 3300025986 Bacteria 2666
552 Ga0207658_10082425 3300025986 Bacteria 2470
553 Ga0207658_10084055 3300025986 Bacteria 2448
554 Ga0207677_10000253 3300026023 Bacteria 41332
555 Ga0207677_10003852 3300026023 Bacteria 7986
556 Ga0207677_10027628 3300026023 Bacteria 3578
557 Ga0207677_10107242 3300026023 Bacteria 2071
558 Ga0207677_10161090 3300026023 Bacteria 1743
559 Ga0207703_10000517 3300026035 Bacteria 39928
560 Ga0207703_10000929 3300026035 Bacteria 28489
561 Ga0207703_10001541 3300026035 Bacteria 20913
562 Ga0207703_10002267 3300026035 Bacteria 16814
563 Ga0207703_10012267 3300026035 Bacteria 6683
564 Ga0207703_10074906 3300026035 Bacteria 2804
565 Ga0207703_10146894 3300026035 Bacteria 2052
566 Ga0207703_10305468 3300026035 Bacteria 1452
567 Ga0207703_10344020 3300026035 Bacteria 1371
568 Ga0207703_10475492 3300026035 Bacteria 1170
569 Ga0207703_10629739 3300026035 Bacteria 1016
570 Ga0207639_10011019 3300026041 Bacteria 6269
571 Ga0207639_10029896 3300026041 Bacteria 3993
572 Ga0207639_10057994 3300026041 Bacteria 2976
573 Ga0207639_10107392 3300026041 Bacteria 2267
574 Ga0207639_10383595 3300026041 Bacteria 1262
575 Ga0207639_10636952 3300026041 Bacteria 985
576 Ga0207678_10002428 3300026067 Bacteria 16950
577 Ga0207678_10170155 3300026067 Bacteria 1860
578 Ga0207678_10283317 3300026067 Bacteria 1423
579 Ga0207708_10077651 3300026075 Bacteria 2548
580 Ga0207708_10200100 3300026075 Bacteria 1594
581 Ga0207702_10009791 3300026078 Bacteria 8039
582 Ga0207702_10031029 3300026078 Bacteria 4455
583 Ga0207702_10230902 3300026078 Bacteria 1729
584 Ga0207702_10574596 3300026078 Bacteria 1104
585 Ga0207641_10000374 3300026088 Bacteria 53088
586 Ga0207641_10000610 3300026088 Bacteria 39160
587 Ga0207641_10000655 3300026088 Bacteria 37743
588 Ga0207641_10073091 3300026088 Bacteria 2955
589 Ga0207648_10000523 3300026089 Bacteria 42961
590 Ga0207648_10006616 3300026089 Bacteria 11512
591 Ga0207648_10009462 3300026089 Bacteria 9333
592 Ga0207648_10013282 3300026089 Bacteria 7672
593 Ga0207648_10022490 3300026089 Bacteria 5659
594 Ga0207648_10065401 3300026089 Bacteria 3170
595 Ga0207648_10073149 3300026089 Bacteria 2987
596 Ga0207676_10000167 3300026095 Bacteria 57507
597 Ga0207676_10002990 3300026095 Bacteria 12054
598 Ga0207676_10012265 3300026095 Bacteria 6134
599 Ga0207676_10025604 3300026095 Bacteria 4378
600 Ga0207676_10261563 3300026095 Bacteria 1563
601 Ga0207676_10488707 3300026095 Bacteria 1167
602 Ga0207676_10489257 3300026095 Bacteria 1166
603 Ga0207674_10051412 3300026116 Bacteria 4205
604 Ga0207674_10075205 3300026116 Bacteria 3388
605 Ga0207674_10124573 3300026116 Bacteria 2543
606 Ga0207674_10184357 3300026116 Bacteria 2038
607 Ga0207674_10201652 3300026116 Bacteria 1939
608 Ga0207675_100000956 3300026118 Bacteria 28809
609 Ga0207675_100008746 3300026118 Bacteria 9511
610 Ga0207675_100009453 3300026118 Bacteria 9126
611 Ga0207675_100037246 3300026118 Bacteria 4538
612 Ga0207675_100057657 3300026118 Bacteria 3624
613 Ga0207675_100070994 3300026118 Bacteria 3255
614 Ga0207675_100073780 3300026118 Bacteria 3192
615 Ga0207675_100105278 3300026118 Bacteria 2659
616 Ga0207675_100339083 3300026118 Bacteria 1471
617 Ga0207683_10000476 3300026121 Bacteria 37318
618 Ga0207683_10000965 3300026121 Bacteria 26325
619 Ga0207683_10010865 3300026121 Bacteria 7765
620 Ga0207683_10060215 3300026121 Bacteria 3337
621 Ga0207683_10067830 3300026121 Bacteria 3148
622 Ga0207683_10418544 3300026121 Bacteria 1234
623 Ga0207683_10457631 3300026121 Bacteria 1177
624 Ga0207698_10011374 3300026142 Bacteria 5768
625 Ga0207698_10015009 3300026142 Bacteria 5172
626 Ga0207698_10031064 3300026142 Bacteria 3851
627 Ga0207698_10073747 3300026142 Bacteria 2719
628 Ga0207698_10114530 3300026142 Bacteria 2268
629 Ga0207698_10142504 3300026142 Bacteria 2067
630 Ga0207698_10422331 3300026142 Bacteria 1280
631 Ga0268266_10005004 3300028379 Bacteria 12519
632 Ga0268266_10005562 3300028379 Bacteria 11729
633 Ga0268266_10139611 3300028379 Bacteria 2174
634 Ga0268266_10361038 3300028379 Bacteria 1367
635 Ga0268266_10769759 3300028379 Bacteria 929
636 Ga0268265_10067967 3300028380 Bacteria 2761
637 Ga0268265_10464116 3300028380 Bacteria 1185
638 Ga0268264_10001027 3300028381 Bacteria 28045
639 Ga0268264_10002170 3300028381 Bacteria 17490
640 Ga0268264_10002850 3300028381 Bacteria 15079
641 Ga0268264_10005179 3300028381 Bacteria 11047
642 Ga0268264_10005310 3300028381 Bacteria 10907
643 Ga0268264_10043681 3300028381 Bacteria 3715
644 Ga0268264_10111146 3300028381 Bacteria 2400
645 Ga0268264_10427501 3300028381 Bacteria 1278
646 Ga0307515_10000240 3300028794 Bacteria 135655
647 Ga0307515_10003269 3300028794 Bacteria 34269
648 Ga0307515_10032662 3300028794 Bacteria 8609
649 Ga0265330_10004062 3300031235 Bacteria 7506
650 Ga0265332_10002489 3300031238 Bacteria 9372
651 Ga0265329_10018394 3300031242 Bacteria 2391
652 Ga0265331_10001690 3300031250 Bacteria 15915
653 Ga0265327_10004035 3300031251 Bacteria 13340
654 Ga0265327_10010785 3300031251 Bacteria 6373
655 Ga0265327_10059222 3300031251 Bacteria 1962
656 Ga0265316_10000391 3300031344 Bacteria 50025
657 Ga0265316_10014609 3300031344 Bacteria 6902
658 Ga0307509_10086371 3300031507 Bacteria 3226
659 Ga0307509_10132030 3300031507 Bacteria 2450
660 Ga0307508_10001476 3300031616 Bacteria 26376
661 Ga0307514_10005105 3300031649 Bacteria 11863
662 Ga0265314_10009278 3300031711 Bacteria 8333
663 Ga0265342_10020514 3300031712 Bacteria 4236
664 Ga0307516_10112272 3300031730 Bacteria 2526
665 Ga0307405_10007522 3300031731 Bacteria 5455
666 Ga0307410_10166727 3300031852 Bacteria 1656
667 Ga0307407_10062245 3300031903 Bacteria 2185
668 Ga0307409_100001376 3300031995 Bacteria 11862
669 Ga0307414_10084315 3300032004 Bacteria 2337
670 Ga0307411_10228744 3300032005 Bacteria 1448
671 Ga0307415_100006664 3300032126 Bacteria 6250
672 Ga0307415_100609229 3300032126 Bacteria 973
673 Ga0307507_10019471 3300033179 Bacteria 7642
674 Ga0307510_10160299 3300033180 Bacteria 1848
675 Ga0373926_0000538 3300035083 Bacteria 10133
676 Ga0373934_0010461 3300035086 Bacteria 3481
677 Ga0373944_0008176 3300035089 Bacteria 2821
678 Ga0373923_0001149 3300035111 Bacteria 7344
679 Ga0373923_0022357 3300035111 Bacteria 2479
680 Ga0373923_0120251 3300035111 Bacteria 1173
681 Ga0373936_0004984 3300035113 Bacteria 5000
682 Ga0373936_0034218 3300035113 Bacteria 2017
683 Ga0373945_0021459 3300035116 Bacteria 2219
684 Ga0373945_0049386 3300035116 Bacteria 1544
685 Ga0373945_0063728 3300035116 Bacteria 1381
686 Ga0373954_0000524 3300035118 Bacteria 14404
687 Ga0373954_0024736 3300035118 Bacteria 2739
688 Ga0373956_0012689 3300035119 Bacteria 3496
689 Ga0373956_0017997 3300035119 Bacteria 2988
690 Ga0373956_0182603 3300035119 Bacteria 992
691 Ga0373957_0000976 3300035120 Bacteria 7508
692 Ga0373943_0028575 3300035170 Bacteria 2628
693 Ga0373943_0065725 3300035170 Bacteria 1824
694 Ga0373946_0017324 3300035171 Bacteria 2756
695 Ga0373946_0021281 3300035171 Bacteria 2514
696 Ga0373946_0038127 3300035171 Bacteria 1957
697 Ga0373955_0033139 3300035172 Bacteria 2718
698 Ga0373955_0036706 3300035172 Bacteria 2602
699 Ga0373955_0261355 3300035172 Bacteria 1039
700 Ga0373924_0002572 3300035410 Bacteria 6121
701 Ga0373924_0012784 3300035410 Bacteria 3141
702 Ga0373924_0097463 3300035410 Bacteria 1263
703 Ga0373935_0028592 3300035692 Bacteria 3445
704 Ga0373927_0117951 3300035695 Bacteria 1731
705 Ga0373927_0130344 3300035695 Bacteria 1643
706 Ga0373927_0263878 3300035695 Bacteria 1133
707 Ga0373933_0001547 3300035724 Bacteria 13469
708 Ga0373933_0011412 3300035724 Bacteria 4895
709 Ga0373933_0027815 3300035724 Bacteria 3259
710 Ga0373933_0036668 3300035724 Bacteria 2872
711 Ga0373947_0068623 3300035725 Bacteria 2168
712 Ga0373947_0210112 3300035725 Bacteria 1276
713 Ga0373947_0345130 3300035725 Bacteria 998
714 Ga0373937_0015112 3300036401 Bacteria 6820
715 Ga0373937_0032191 3300036401 Bacteria 4755
716 Ga0373937_0032560 3300036401 Bacteria 4729
717 Ga0373937_0049100 3300036401 Bacteria 3864
718 Ga0373937_0080351 3300036401 Bacteria 3015
719 Ga0373937_0243794 3300036401 Bacteria 1693
720 Ga0373937_0272057 3300036401 Bacteria 1599
721 Ga0373937_0287946 3300036401 Bacteria 1552
722 Ga0316582_0000275 3300036647 Bacteria 17519
723 Ga0316584_0002877 3300036712 Bacteria 11039
724 Ga0373925_0007555 3300037068 Bacteria 7921
725 Ga0373925_0018839 3300037068 Bacteria 5018
726 Ga0373925_0028685 3300037068 Bacteria 4078
727 Ga0373925_0043701 3300037068 Bacteria 3326
728 Ga0373925_0106671 3300037068 Bacteria 2160
729 Ga0373925_0473308 3300037068 Bacteria 1027
730 Ga0373925_0600347 3300037068 Bacteria 906
731 Ga0395905_0052315 3300037471 Bacteria 3823
732 Ga0316581_0003201 3300037588 Bacteria 4048
733 Ga0436363_0944619 3300039450 Bacteria 1957
734 Ga0451853_2845378 3300041512 Bacteria 1028
735 Ga0439443_010295 3300042003 Bacteria 1354
736 Ga0451577_0006056 3300042876 Bacteria 12164
737 Ga0451577_0028215 3300042876 Bacteria 5078
738 Ga0451577_0303322 3300042876 Bacteria 1447
739 Ga0453683_0002919 3300044673 Bacteria 12916
740 Ga0453684_0023590 3300044712 Bacteria 9046
741 Ga0466960_0042923 3300044901 Bacteria 2149
742 Ga0451576_0009861 3300045051 Bacteria 11034
743 Ga0451576_0031288 3300045051 Bacteria 5676
744 Ga0451576_0187226 3300045051 Bacteria 2162
745 Ga0451576_0493405 3300045051 Bacteria 1286
746 Ga0495592_0033494 3300046454 Bacteria 3874
747 Ga0495603_0000495 3300046455 Bacteria 21792
748 Ga0495603_0297075 3300046455 Bacteria 928
749 Ga0495629_0011863 3300046459 Bacteria 6319
750 Ga0495641_0004406 3300046461 Bacteria 9967
751 Ga0495651_0005497 3300046462 Bacteria 9667
752 Ga0495653_0002547 3300046463 Bacteria 14525
753 Ga0495650_0055747 3300046471 Bacteria 1607
754 Ga0495580_0000400 3300046472 Bacteria 35542
755 Ga0495580_0014629 3300046472 Bacteria 5947
756 Ga0495580_0035978 3300046472 Bacteria 3558
757 Ga0495580_0050624 3300046472 Bacteria 2937
758 Ga0495580_0065337 3300046472 Bacteria 2548
759 Ga0495582_0006109 3300046473 Bacteria 6703
760 Ga0495582_0051344 3300046473 Bacteria 2273
761 Ga0495582_0137236 3300046473 Bacteria 1384
762 Ga0495582_0304836 3300046473 Bacteria 916
763 Ga0495639_0002708 3300046475 Bacteria 7707
764 Ga0495639_0023118 3300046475 Bacteria 2730
765 Ga0495639_0025893 3300046475 Bacteria 2589
766 Ga0495662_0015640 3300046476 Bacteria 3682
767 Ga0495662_0098419 3300046476 Bacteria 1430
768 Ga0495664_0030369 3300046477 Bacteria 3165
769 Ga0495664_0032401 3300046477 Bacteria 3066
770 Ga0495664_0155380 3300046477 Bacteria 1388
771 Ga0495594_0077326 3300046499 Bacteria 1856
772 Ga0495608_0013445 3300046511 Bacteria 5676
773 Ga0495630_0004190 3300046517 Bacteria 10097
774 Ga0495630_0067811 3300046517 Bacteria 2682
775 Ga0495632_0006371 3300046519 Bacteria 7607
776 Ga0495643_0066167 3300046522 Bacteria 1907
777 Ga0495666_0018735 3300046526 Bacteria 3440
778 Ga0495665_0017444 3300046531 Bacteria 3861
779 Ga0495665_0038597 3300046531 Bacteria 2546
780 Ga0495665_0049519 3300046531 Bacteria 2227
781 Ga0495640_0028050 3300046533 Bacteria 4055
782 Ga0495586_0003105 3300046535 Bacteria 8952
783 Ga0495586_0013809 3300046535 Bacteria 4285
784 Ga0495586_0080431 3300046535 Bacteria 1790
785 Ga0495587_0024333 3300046536 Bacteria 3712
786 Ga0495597_0097878 3300046542 Bacteria 1239
787 Ga0495645_0067218 3300046543 Bacteria 2588
788 Ga0495645_0141655 3300046543 Bacteria 1677
789 Ga0495622_0036285 3300046557 Bacteria 2299
790 Ga0495667_0051603 3300046559 Bacteria 2712
791 Ga0495667_0243437 3300046559 Bacteria 1145
792 Ga0495668_0037713 3300046616 Bacteria 2704
793 Ga0495634_0019778 3300046642 Bacteria 4779
794 Ga0495634_0069913 3300046642 Bacteria 2315
795 Ga0495625_0039033 3300046660 Bacteria 3470
796 Ga0495635_0018827 3300046663 Bacteria 4818
797 Ga0495635_0083751 3300046663 Bacteria 2182
798 Ga0495588_0028034 3300046674 Bacteria 2817
799 Ga0495588_0082110 3300046674 Bacteria 1683
800 Ga0495657_0022306 3300046675 Bacteria 4537
801 Ga0495599_0022755 3300046678 Bacteria 3914
802 Ga0495599_0069856 3300046678 Bacteria 2192
803 Ga0495623_0034959 3300046679 Bacteria 3222
804 Ga0495646_0216384 3300046680 Bacteria 1038
805 Ga0495647_0000194 3300046681 Bacteria 16186
806 Ga0495647_0011741 3300046681 Bacteria 3004
807 Ga0495647_0036397 3300046681 Bacteria 1852
808 Ga0495647_0121502 3300046681 Bacteria 1099
809 Ga0495658_0005064 3300046683 Bacteria 6476
810 Ga0495658_0021101 3300046683 Bacteria 3429
811 Ga0495658_0032524 3300046683 Bacteria 2849
812 Ga0495658_0035505 3300046683 Bacteria 2744
813 Ga0495658_0049562 3300046683 Bacteria 2373
814 Ga0495658_0089696 3300046683 Bacteria 1818
815 Ga0495613_0008532 3300046689 Bacteria 7605
816 Ga0495613_0072673 3300046689 Bacteria 2507
817 Ga0495624_0057445 3300046690 Bacteria 2446
818 Ga0495624_0420079 3300046690 Bacteria 802
819 Ga0495649_0003045 3300046694 Bacteria 11498
820 Ga0495600_0022922 3300046809 Bacteria 4013
821 Ga0495600_0087997 3300046809 Bacteria 2026
822 Ga0495600_0256770 3300046809 Bacteria 1111
823 Ga0495660_0044144 3300046810 Bacteria 2454
824 Ga0495581_0006167 3300047315 Bacteria 6953
825 Ga0495581_0045007 3300047315 Bacteria 2552
826 Ga0495604_0097090 3300047317 Bacteria 2173
827 Ga0495674_0059696 3300047319 Bacteria 3330
828 Ga0495674_0272692 3300047319 Bacteria 1388
829 Ga0495680_0010104 3300047322 Bacteria 8439
830 Ga0495680_0040379 3300047322 Bacteria 3719
831 Ga0495687_000364 3300047443 Bacteria 56454
832 Ga0495687_006950 3300047443 Bacteria 6805
833 Ga0495675_0017142 3300047444 Bacteria 4585
834 Ga0495681_0121096 3300047470 Bacteria 1123
835 Ga0495684_0040402 3300047471 Bacteria 3576
836 Ga0495684_0123832 3300047471 Bacteria 1946
837 Ga0495602_0127416 3300048088 Bacteria 2037
838 Ga0495626_0081747 3300048091 Bacteria 1434
839 Ga0496100_0068160 3300048903 Bacteria 2365
840 Ga0496100_0208603 3300048903 Bacteria 1428
841 Ga0496101_0012612 3300048904 Bacteria 5644
842 Ga0496101_0361781 3300048904 Bacteria 1141
843 Ga0496101_0460325 3300048904 Bacteria 1004
844 Ga0496102_0150328 3300048905 Bacteria 2188
845 Ga0496104_0002793 3300048907 Bacteria 15045
846 Ga0496104_0424300 3300048907 Bacteria 1242
847 Ga0496105_0022747 3300048908 Bacteria 5078
848 Ga0496105_0140740 3300048908 Bacteria 1986
849 Ga0496106_0053765 3300048909 Bacteria 3042
850 Ga0496106_0396733 3300048909 Bacteria 1109
851 Ga0496107_0101771 3300048910 Bacteria 2107
852 Ga0496108_0099605 3300048911 Bacteria 2478
853 Ga0496108_0238384 3300048911 Bacteria 1582
854 Ga0496108_0260503 3300048911 Bacteria 1509
855 Ga0496109_0006393 3300048912 Bacteria 9920
856 Ga0496109_0077834 3300048912 Bacteria 3052
857 Ga0496109_0083807 3300048912 Bacteria 2940
858 Ga0496109_0160408 3300048912 Bacteria 2107
859 Ga0496109_0213379 3300048912 Bacteria 1815
860 Ga0496110_0013837 3300048913 Bacteria 6686
861 Ga0496110_0672363 3300048913 Bacteria 936
862 Ga0496111_0065975 3300048914 Bacteria 2628
863 Ga0496111_0094672 3300048914 Bacteria 2191
864 Ga0496112_0001041 3300048915 Bacteria 20441
865 Ga0496112_0778369 3300048915 Bacteria 882
866 Ga0496113_0022247 3300048916 Bacteria 4482
867 Ga0496114_0063262 3300048917 Bacteria 3098
868 Ga0496114_0169931 3300048917 Bacteria 1899
869 Ga0501031_0069128 3300049568 Bacteria 2300
870 Ga0501036_0000096 3300049572 Bacteria 54442
871 Ga0501036_0099909 3300049572 Bacteria 2454
872 Ga0501038_0000475 3300049574 Bacteria 35310
873 Ga0501039_0000494 3300049575 Bacteria 28535
874 Ga0501039_0065576 3300049575 Bacteria 2817
875 Ga0501039_0139102 3300049575 Bacteria 1907
876 Ga0501040_0000047 3300049576 Bacteria 55739
877 Ga0501041_0005369 3300049577 Bacteria 7506
878 Ga0501041_0060581 3300049577 Bacteria 2317
879 Ga0501041_0144787 3300049577 Bacteria 1482
880 Ga0501043_0028083 3300049579 Bacteria 4416
881 Ga0501046_0000200 3300049580 Bacteria 61991
882 Ga0501048_0045182 3300049582 Bacteria 3147
883 Ga0501048_0312185 3300049582 Bacteria 1119
884 Ga0501068_0418467 3300049584 Bacteria 865
885 Ga0501070_0015252 3300049586 Bacteria 6466
886 Ga0501071_0057717 3300049587 Bacteria 2805
887 Ga0501072_0002231 3300049588 Bacteria 14467
888 Ga0501072_0068996 3300049588 Bacteria 2791
889 Ga0501073_0220458 3300049589 Bacteria 1310
890 Ga0501074_0000734 3300049590 Bacteria 20570
891 Ga0501075_0000303 3300049591 Bacteria 27515
892 Ga0501075_0039305 3300049591 Bacteria 3541
893 Ga0501076_0240167 3300049592 Bacteria 1482
894 Ga0501077_0000322 3300049593 Bacteria 28649
895 Ga0501198_000002 3300049649 Bacteria 197356
896 Ga0501222_000093 3300049662 Bacteria 23934
897 Ga0501079_0003406 3300049741 Bacteria 11674
898 Ga0501079_0103427 3300049741 Bacteria 2209
899 Ga0501080_0003611 3300049742 Bacteria 13626
900 Ga0501081_0000087 3300049743 Bacteria 37059
901 Ga0501081_0074538 3300049743 Bacteria 2368
902 Ga0501081_0209921 3300049743 Bacteria 1414
903 Ga0501083_0355683 3300049744 Bacteria 952
904 Ga0501035_0001393 3300049822 Bacteria 24810
905 Ga0501045_0000348 3300049824 Bacteria 27381
906 nmdc:mga03683_13947_c1 3300050489 Bacteria 2966
907 nmdc:mga03683_24221_c1 3300050489 Bacteria 2078
908 nmdc:mga03683_47777_c1 3300050489 Bacteria 1777
909 nmdc:mga0k408_143959_c1 3300050493 Bacteria 1419
910 nmdc:mga0k408_15843_c1 3300050493 Bacteria 4174
911 nmdc:mga0k408_33287_c1 3300050493 Bacteria 2948
912 nmdc:mga0k408_613_c1 3300050493 Bacteria 19671
913 nmdc:mga0k408_8078_c1 3300050493 Bacteria 5640
914 nmdc:mga07m45_50638_c1 3300050496 Bacteria 2341
915 nmdc:mga07m45_8254_c1 3300050496 Bacteria 5345
916 nmdc:mga05p37_76448_c1 3300050507 Bacteria 4122
917 nmdc:mga09592_22218_c1 3300050508 Bacteria 5236
918 nmdc:mga0qj67_59364_c1 3300050509 Bacteria 3033
919 nmdc:mga08y16_107115_c1 3300050511 Bacteria 2909
920 nmdc:mga0n895_270323_c1 3300050512 Bacteria 1724
921 nmdc:mga0n895_45549_c1 3300050512 Bacteria 4280
922 nmdc:mga0n895_608738_c1 3300050512 Bacteria 1094
923 nmdc:mga0n895_86981_c1 3300050512 Bacteria 3122
924 nmdc:mga0rr50_121217_c1 3300050513 Bacteria 2082
925 nmdc:mga0rr50_182959_c1 3300050513 Bacteria 1714
926 nmdc:mga08x19_34409_c1 3300050514 Bacteria 3202
927 nmdc:mga0a205_233004_c1 3300050515 Bacteria 1724
928 nmdc:mga0sz30_40686_c1 3300050516 Bacteria 1954
929 Ga0495601_0029790 3300053077 Bacteria 3388
930 Ga0495601_0113426 3300053077 Bacteria 1757
931 Ga0495601_0188689 3300053077 Bacteria 1347
932 Ga0495595_0002305 3300053084 Bacteria 7440
933 Ga0495595_0051531 3300053084 Bacteria 1908
934 Ga0495619_0008259 3300053085 Bacteria 6586
935 Ga0495619_0016462 3300053085 Bacteria 4681
936 Ga0500578_0016313 3300053086 Bacteria 4768
937 Ga0500583_0117339 3300053092 Bacteria 1315
938 Ga0500658_0014541 3300053134 Bacteria 2915
939 Ga0500568_0018892 3300053139 Bacteria 3007
940 Ga0500619_000063 3300053154 Bacteria 32493
941 Ga0500645_011255 3300053730 Bacteria 2928
942 Ga0500587_001818 3300053739 Bacteria 3032
943 Ga0501084_0002888 3300054114 Bacteria 13896
944 Ga0501084_0468677 3300054114 Bacteria 1065
945 Ga0501082_0144500 3300060353 Bacteria 2065
946 Ga0530510_0003039 3300061734 Bacteria 11522
947 Ga0530510_0112935 3300061734 Bacteria 1991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0065576 Ga0501039_0065576_356_1096 212
2 3300049592 Ga0501076_0240167 Ga0501076_0240167_666_1406 212
3 3300053086 Ga0500578_0016313 Ga0500578_0016313_1305_2048 212
4 3300053730 Ga0500645_011255 Ga0500645_011255_139_882 212
5 3300005441 Ga0070700_100030180 Ga0070700_1000301804 213
6 3300005456 Ga0070678_100246214 Ga0070678_1002462143 213
7 3300005617 Ga0068859_100298302 Ga0068859_1002983023 213
8 3300005718 Ga0068866_10029507 Ga0068866_100295073 213
9 3300005719 Ga0068861_100016929 Ga0068861_1000169294 213
10 3300005842 Ga0068858_100146076 Ga0068858_1001460762 213
11 3300005843 Ga0068860_100002076 Ga0068860_1000020769 213
12 3300005844 Ga0068862_100016504 Ga0068862_1000165042 213
13 3300006881 Ga0068865_100001397 Ga0068865_1000013973 213
14 3300006931 Ga0097620_100298316 Ga0097620_1002983162 213
15 3300009553 Ga0105249_10026569 Ga0105249_100265694 213
16 3300013297 Ga0157378_10025900 Ga0157378_100259003 213
17 3300013306 Ga0163162_10005575 Ga0163162_1000557510 213
18 3300013308 Ga0157375_10052688 Ga0157375_100526884 213
19 3300014326 Ga0157380_10068261 Ga0157380_100682614 213
20 3300014968 Ga0157379_10195591 Ga0157379_101955914 213
21 3300025899 Ga0207642_10069057 Ga0207642_100690572 213
22 3300025908 Ga0207643_10178872 Ga0207643_101788722 213
23 3300025923 Ga0207681_10126456 Ga0207681_101264563 213
24 3300025937 Ga0207669_10034806 Ga0207669_100348062 213
25 3300025940 Ga0207691_10015882 Ga0207691_100158824 213
26 3300026035 Ga0207703_10074906 Ga0207703_100749064 213
27 3300026067 Ga0207678_10283317 Ga0207678_102833171 213
28 3300026075 Ga0207708_10077651 Ga0207708_100776514 213
29 3300026118 Ga0207675_100008746 Ga0207675_1000087466 213
30 3300028380 Ga0268265_10464116 Ga0268265_104641162 213
31 3300028381 Ga0268264_10005310 Ga0268264_100053106 213
32 3300005341 Ga0070691_10034323 Ga0070691_100343233 215
33 3300005438 Ga0070701_10011700 Ga0070701_100117003 215
34 3300005441 Ga0070700_100014701 Ga0070700_1000147016 215
35 3300005459 Ga0068867_100029690 Ga0068867_1000296904 215
36 3300005544 Ga0070686_100021520 Ga0070686_1000215204 215
37 3300005718 Ga0068866_10001673 Ga0068866_1000167312 215
38 3300005719 Ga0068861_100004546 Ga0068861_1000045463 215
39 3300009098 Ga0105245_10025793 Ga0105245_100257934 215
40 3300014326 Ga0157380_10027611 Ga0157380_100276116 215
41 3300014968 Ga0157379_10039788 Ga0157379_100397884 215
42 3300049744 Ga0501083_0355683 Ga0501083_0355683_287_937 216
43 3300006051 Ga0075364_10014913 Ga0075364_100149135 217
44 3300006186 Ga0075369_10081983 Ga0075369_100819833 217
45 3300006353 Ga0075370_10097440 Ga0075370_100974404 217
46 3300026041 Ga0207639_10636952 Ga0207639_106369522 217
47 3300041512 Ga0451853_2845378 Ga0451853_2845378_154_906 217
48 3300050489 nmdc:mga03683_47777_c1 nmdc:mga03683_47777_c1_311_1069 217
49 3300025903 Ga0207680_10000458 Ga0207680_1000045821 218
50 3300025906 Ga0207699_10146661 Ga0207699_101466612 218
51 3300046543 Ga0495645_0141655 Ga0495645_0141655_794_1561 218
52 3300046683 Ga0495658_0035505 Ga0495658_0035505_1339_2106 218
53 3300046809 Ga0495600_0256770 Ga0495600_0256770_22_789 218
54 3300047319 Ga0495674_0272692 Ga0495674_0272692_268_1035 218
55 3300048917 Ga0496114_0169931 Ga0496114_0169931_402_1178 218
56 3300006048 Ga0075363_100086097 Ga0075363_1000860972 219
57 3300006177 Ga0075362_10008625 Ga0075362_100086253 219
58 3300006195 Ga0075366_10076205 Ga0075366_100762054 219
59 3300031730 Ga0307516_10112272 Ga0307516_101122723 219
60 3300046519 Ga0495632_0006371 Ga0495632_0006371_5485_6243 219
61 3300046542 Ga0495597_0097878 Ga0495597_0097878_141_899 219
62 3300046616 Ga0495668_0037713 Ga0495668_0037713_1348_2106 219
63 3300046694 Ga0495649_0003045 Ga0495649_0003045_10117_10875 219
64 3300046810 Ga0495660_0044144 Ga0495660_0044144_869_1627 219
65 3300047443 Ga0495687_006950 Ga0495687_006950_1177_1935 219
66 3300048091 Ga0495626_0081747 Ga0495626_0081747_186_944 219
67 3300050493 nmdc:mga0k408_143959_c1 nmdc:mga0k408_143959_c1_269_1027 219
68 3300050493 nmdc:mga0k408_15843_c1 nmdc:mga0k408_15843_c1_1155_1913 219
69 3300005617 Ga0068859_100290582 Ga0068859_1002905824 220
70 3300006931 Ga0097620_100290566 Ga0097620_1002905664 220
71 3300007076 Ga0075435_100017178 Ga0075435_1000171785 220
72 3300050513 nmdc:mga0rr50_121217_c1 nmdc:mga0rr50_121217_c1_80_772 220
73 3300050515 nmdc:mga0a205_233004_c1 nmdc:mga0a205_233004_c1_177_869 220
74 3300006178 Ga0075367_10287278 Ga0075367_102872781 221
75 3300006195 Ga0075366_10002701 Ga0075366_100027015 221
76 3300006195 Ga0075366_10054389 Ga0075366_100543894 221
77 3300006353 Ga0075370_10002336 Ga0075370_100023363 221
78 3300028379 Ga0268266_10361038 Ga0268266_103610382 221
79 3300050493 nmdc:mga0k408_613_c1 nmdc:mga0k408_613_c1_12877_13635 221
80 3300026116 Ga0207674_10184357 Ga0207674_101843572 222
81 3300042003 Ga0439443_010295 Ga0439443_010295_40_732 223
82 3300045051 Ga0451576_0493405 Ga0451576_0493405_23_703 224
83 3300005457 Ga0070662_100143663 Ga0070662_1001436632 225
84 3300005459 Ga0068867_100130879 Ga0068867_1001308794 225
85 3300006353 Ga0075370_10117967 Ga0075370_101179672 225
86 3300025933 Ga0207706_10025594 Ga0207706_100255943 225
87 3300046660 Ga0495625_0039033 Ga0495625_0039033_671_1429 225
88 3300050496 nmdc:mga07m45_50638_c1 nmdc:mga07m45_50638_c1_661_1410 225
89 3300053092 Ga0500583_0117339 Ga0500583_0117339_356_1114 225
90 3300053139 Ga0500568_0018892 Ga0500568_0018892_1516_2274 225
91 3300005331 Ga0070670_100052284 Ga0070670_1000522844 226
92 3300006871 Ga0075434_100844094 Ga0075434_1008440941 226
93 3300013100 Ga0157373_10055871 Ga0157373_100558714 226
94 3300009553 Ga0105249_10230804 Ga0105249_102308044 227
95 3300033180 Ga0307510_10160299 Ga0307510_101602991 227
96 3300005334 Ga0068869_100088068 Ga0068869_1000880683 229
97 3300005367 Ga0070667_100583766 Ga0070667_1005837661 229
98 3300005539 Ga0068853_100250468 Ga0068853_1002504682 229
99 3300009093 Ga0105240_10095347 Ga0105240_100953473 229
100 3300009545 Ga0105237_10156291 Ga0105237_101562914 229
101 3300010375 Ga0105239_10020138 Ga0105239_100201385 229
102 3300025914 Ga0207671_10016519 Ga0207671_100165192 229
103 3300026041 Ga0207639_10057994 Ga0207639_100579943 229
104 3300026142 Ga0207698_10015009 Ga0207698_100150094 229
105 3300050489 nmdc:mga03683_13947_c1 nmdc:mga03683_13947_c1_1513_2283 229
106 3300050516 nmdc:mga0sz30_40686_c1 nmdc:mga0sz30_40686_c1_752_1522 229
107 3300005344 Ga0070661_100013701 Ga0070661_1000137015 230
108 3300005366 Ga0070659_100052498 Ga0070659_1000524983 230
109 3300005467 Ga0070706_100091964 Ga0070706_1000919644 230
110 3300005536 Ga0070697_100002608 Ga0070697_1000026088 230
111 3300005539 Ga0068853_100125706 Ga0068853_1001257064 230
112 3300005564 Ga0070664_100041961 Ga0070664_1000419615 230
113 3300005578 Ga0068854_100009962 Ga0068854_1000099629 230
114 3300005614 Ga0068856_100201580 Ga0068856_1002015802 230
115 3300005616 Ga0068852_100245979 Ga0068852_1002459794 230
116 3300005834 Ga0068851_10042280 Ga0068851_100422802 230
117 3300009551 Ga0105238_10047138 Ga0105238_100471384 230
118 3300013105 Ga0157369_10041396 Ga0157369_100413964 230
119 3300013296 Ga0157374_10144119 Ga0157374_101441194 230
120 3300013307 Ga0157372_10360198 Ga0157372_103601983 230
121 3300025910 Ga0207684_10026389 Ga0207684_100263894 230
122 3300025920 Ga0207649_10010360 Ga0207649_100103604 230
123 3300025924 Ga0207694_10168492 Ga0207694_101684921 230
124 3300026041 Ga0207639_10383595 Ga0207639_103835952 230
125 3300026078 Ga0207702_10031029 Ga0207702_100310295 230
126 3300026142 Ga0207698_10031064 Ga0207698_100310644 230
127 3300050511 nmdc:mga08y16_107115_c1 nmdc:mga08y16_107115_c1_995_1762 231
128 3300031507 Ga0307509_10086371 Ga0307509_100863715 232
129 3300031616 Ga0307508_10001476 Ga0307508_100014766 232
130 3300031649 Ga0307514_10005105 Ga0307514_100051055 232
131 3300033179 Ga0307507_10019471 Ga0307507_100194713 232
132 3300006353 Ga0075370_10012106 Ga0075370_100121063 233
133 3300013306 Ga0163162_11180129 Ga0163162_111801292 233
134 3300025938 Ga0207704_10287762 Ga0207704_102877621 233
135 3300028794 Ga0307515_10003269 Ga0307515_100032696 233
136 3300046522 Ga0495643_0066167 Ga0495643_0066167_821_1579 233
137 3300047443 Ga0495687_000364 Ga0495687_000364_12747_13505 233
138 3300050496 nmdc:mga07m45_8254_c1 nmdc:mga07m45_8254_c1_1001_1759 233
139 3300005356 Ga0070674_100164352 Ga0070674_1001643522 234
140 3300005364 Ga0070673_100347214 Ga0070673_1003472142 234
141 3300005456 Ga0070678_100077931 Ga0070678_1000779312 234
142 3300005458 Ga0070681_10007168 Ga0070681_100071687 234
143 3300005459 Ga0068867_100055039 Ga0068867_1000550394 234
144 3300005459 Ga0068867_100240035 Ga0068867_1002400352 234
145 3300005530 Ga0070679_100144794 Ga0070679_1001447941 234
146 3300005577 Ga0068857_100804393 Ga0068857_1008043932 234
147 3300005615 Ga0070702_100241410 Ga0070702_1002414102 234
148 3300005718 Ga0068866_10047815 Ga0068866_100478154 234
149 3300006358 Ga0068871_100162973 Ga0068871_1001629733 234
150 3300006846 Ga0075430_100061527 Ga0075430_1000615273 234
151 3300006880 Ga0075429_100006183 Ga0075429_1000061834 234
152 3300006881 Ga0068865_100200552 Ga0068865_1002005522 234
153 3300009148 Ga0105243_10110471 Ga0105243_101104714 234
154 3300013296 Ga0157374_10025744 Ga0157374_100257444 234
155 3300013297 Ga0157378_10439617 Ga0157378_104396172 234
156 3300014326 Ga0157380_10081889 Ga0157380_100818892 234
157 3300017792 Ga0163161_10040889 Ga0163161_100408893 234
158 3300025899 Ga0207642_10051891 Ga0207642_100518912 234
159 3300025908 Ga0207643_10065333 Ga0207643_100653332 234
160 3300025912 Ga0207707_10079703 Ga0207707_100797034 234
161 3300025937 Ga0207669_10328371 Ga0207669_103283713 234
162 3300025938 Ga0207704_10180678 Ga0207704_101806782 234
163 3300026089 Ga0207648_10013282 Ga0207648_100132825 234
164 3300026116 Ga0207674_10201652 Ga0207674_102016523 234
165 3300035083 Ga0373926_0000538 Ga0373926_0000538_6029_6739 234
166 3300035089 Ga0373944_0008176 Ga0373944_0008176_1717_2427 234
167 3300035111 Ga0373923_0120251 Ga0373923_0120251_11_721 234
168 3300035113 Ga0373936_0034218 Ga0373936_0034218_434_1144 234
169 3300035170 Ga0373943_0065725 Ga0373943_0065725_795_1505 234
170 3300035410 Ga0373924_0097463 Ga0373924_0097463_167_898 234
171 3300035695 Ga0373927_0130344 Ga0373927_0130344_891_1622 234
172 3300035725 Ga0373947_0068623 Ga0373947_0068623_1165_1875 234
173 3300036401 Ga0373937_0287946 Ga0373937_0287946_528_1259 234
174 3300037068 Ga0373925_0106671 Ga0373925_0106671_1364_2095 234
175 3300046455 Ga0495603_0000495 Ga0495603_0000495_9150_9860 234
176 3300046472 Ga0495580_0000400 Ga0495580_0000400_31328_32038 234
177 3300046473 Ga0495582_0051344 Ga0495582_0051344_138_848 234
178 3300046475 Ga0495639_0002708 Ga0495639_0002708_1136_1846 234
179 3300046531 Ga0495665_0038597 Ga0495665_0038597_1407_2117 234
180 3300046535 Ga0495586_0003105 Ga0495586_0003105_2687_3397 234
181 3300046674 Ga0495588_0028034 Ga0495588_0028034_358_1068 234
182 3300046681 Ga0495647_0000194 Ga0495647_0000194_8596_9306 234
183 3300046683 Ga0495658_0005064 Ga0495658_0005064_4364_5074 234
184 3300047315 Ga0495581_0045007 Ga0495581_0045007_1128_1838 234
185 3300049568 Ga0501031_0069128 Ga0501031_0069128_267_1007 234
186 3300049572 Ga0501036_0000096 Ga0501036_0000096_16591_17331 234
187 3300049572 Ga0501036_0099909 Ga0501036_0099909_1272_1976 234
188 3300049574 Ga0501038_0000475 Ga0501038_0000475_17610_18350 234
189 3300049575 Ga0501039_0000494 Ga0501039_0000494_8629_9369 234
190 3300049575 Ga0501039_0139102 Ga0501039_0139102_953_1657 234
191 3300049576 Ga0501040_0000047 Ga0501040_0000047_8646_9386 234
192 3300049577 Ga0501041_0005369 Ga0501041_0005369_240_980 234
193 3300049577 Ga0501041_0144787 Ga0501041_0144787_13_717 234
194 3300049579 Ga0501043_0028083 Ga0501043_0028083_2890_3630 234
195 3300049580 Ga0501046_0000200 Ga0501046_0000200_11776_12516 234
196 3300049582 Ga0501048_0045182 Ga0501048_0045182_1274_2014 234
197 3300049582 Ga0501048_0312185 Ga0501048_0312185_348_1052 234
198 3300049584 Ga0501068_0418467 Ga0501068_0418467_148_852 234
199 3300049586 Ga0501070_0015252 Ga0501070_0015252_3154_3894 234
200 3300049587 Ga0501071_0057717 Ga0501071_0057717_1416_2156 234
201 3300049588 Ga0501072_0002231 Ga0501072_0002231_1265_1969 234
202 3300049588 Ga0501072_0068996 Ga0501072_0068996_317_1021 234
203 3300049589 Ga0501073_0220458 Ga0501073_0220458_94_798 234
204 3300049590 Ga0501074_0000734 Ga0501074_0000734_7064_7804 234
205 3300049591 Ga0501075_0000303 Ga0501075_0000303_18128_18868 234
206 3300049591 Ga0501075_0039305 Ga0501075_0039305_860_1564 234
207 3300049593 Ga0501077_0000322 Ga0501077_0000322_22276_22980 234
208 3300049741 Ga0501079_0003406 Ga0501079_0003406_8648_9388 234
209 3300049741 Ga0501079_0103427 Ga0501079_0103427_150_854 234
210 3300049742 Ga0501080_0003611 Ga0501080_0003611_12431_13171 234
211 3300049743 Ga0501081_0000087 Ga0501081_0000087_8937_9677 234
212 3300049743 Ga0501081_0074538 Ga0501081_0074538_932_1636 234
213 3300049822 Ga0501035_0001393 Ga0501035_0001393_8401_9105 234
214 3300049824 Ga0501045_0000348 Ga0501045_0000348_8881_9621 234
215 3300050508 nmdc:mga09592_22218_c1 nmdc:mga09592_22218_c1_2157_2915 234
216 3300050509 nmdc:mga0qj67_59364_c1 nmdc:mga0qj67_59364_c1_1183_1941 234
217 3300054114 Ga0501084_0002888 Ga0501084_0002888_4256_4996 234
218 3300060353 Ga0501082_0144500 Ga0501082_0144500_238_942 234
219 3300061734 Ga0530510_0003039 Ga0530510_0003039_4396_5136 234
220 3300061734 Ga0530510_0112935 Ga0530510_0112935_1029_1733 234
221 3300005328 Ga0070676_10194201 Ga0070676_101942011 235
222 3300005331 Ga0070670_100005989 Ga0070670_10000598910 235
223 3300005334 Ga0068869_100082175 Ga0068869_1000821752 235
224 3300005335 Ga0070666_10125564 Ga0070666_101255641 235
225 3300005354 Ga0070675_100115036 Ga0070675_1001150361 235
226 3300005367 Ga0070667_100001232 Ga0070667_1000012323 235
227 3300005436 Ga0070713_100021191 Ga0070713_1000211914 235
228 3300005441 Ga0070700_100118979 Ga0070700_1001189792 235
229 3300005459 Ga0068867_100044376 Ga0068867_1000443764 235
230 3300005467 Ga0070706_100504900 Ga0070706_1005049002 235
231 3300005545 Ga0070695_100183001 Ga0070695_1001830012 235
232 3300005564 Ga0070664_100368865 Ga0070664_1003688652 235
233 3300005577 Ga0068857_100083257 Ga0068857_1000832573 235
234 3300005616 Ga0068852_100130364 Ga0068852_1001303642 235
235 3300005617 Ga0068859_100020837 Ga0068859_1000208379 235
236 3300005618 Ga0068864_100002879 Ga0068864_10000287912 235
237 3300005719 Ga0068861_100003709 Ga0068861_1000037098 235
238 3300005840 Ga0068870_10006402 Ga0068870_100064024 235
239 3300005842 Ga0068858_100022884 Ga0068858_1000228844 235
240 3300005843 Ga0068860_100005815 Ga0068860_10000581514 235
241 3300006871 Ga0075434_100048092 Ga0075434_1000480924 235
242 3300006881 Ga0068865_100086501 Ga0068865_1000865012 235
243 3300006931 Ga0097620_100020837 Ga0097620_1000208379 235
244 3300007076 Ga0075435_100217711 Ga0075435_1002177113 235
245 3300009177 Ga0105248_10002074 Ga0105248_100020745 235
246 3300013297 Ga0157378_10225973 Ga0157378_102259733 235
247 3300014325 Ga0163163_10044884 Ga0163163_100448844 235
248 3300014326 Ga0157380_10539762 Ga0157380_105397621 235
249 3300014968 Ga0157379_10004449 Ga0157379_1000444911 235
250 3300025903 Ga0207680_10110288 Ga0207680_101102883 235
251 3300025907 Ga0207645_10026002 Ga0207645_100260024 235
252 3300025918 Ga0207662_10026400 Ga0207662_100264004 235
253 3300025925 Ga0207650_10093449 Ga0207650_100934493 235
254 3300025941 Ga0207711_10030180 Ga0207711_100301803 235
255 3300025942 Ga0207689_10002181 Ga0207689_100021814 235
256 3300025960 Ga0207651_10104767 Ga0207651_101047674 235
257 3300025986 Ga0207658_10069198 Ga0207658_100691982 235
258 3300026035 Ga0207703_10002267 Ga0207703_1000226710 235
259 3300026089 Ga0207648_10009462 Ga0207648_100094624 235
260 3300026095 Ga0207676_10025604 Ga0207676_100256044 235
261 3300026116 Ga0207674_10075205 Ga0207674_100752054 235
262 3300026118 Ga0207675_100037246 Ga0207675_1000372464 235
263 3300028381 Ga0268264_10005179 Ga0268264_100051794 235
264 3300035172 Ga0373955_0036706 Ga0373955_0036706_1467_2177 235
265 3300035724 Ga0373933_0001547 Ga0373933_0001547_912_1622 235
266 3300036401 Ga0373937_0032560 Ga0373937_0032560_1497_2207 235
267 3300046559 Ga0495667_0243437 Ga0495667_0243437_420_1130 235
268 3300048905 Ga0496102_0150328 Ga0496102_0150328_148_882 235
269 3300048912 Ga0496109_0083807 Ga0496109_0083807_1083_1817 235
270 3300050512 nmdc:mga0n895_45549_c1 nmdc:mga0n895_45549_c1_1836_2582 235
271 3300054114 Ga0501084_0468677 Ga0501084_0468677_43_750 235
272 3300005445 Ga0070708_100020119 Ga0070708_1000201194 238
273 3300005467 Ga0070706_100131071 Ga0070706_1001310714 238
274 3300005471 Ga0070698_100095739 Ga0070698_1000957391 238
275 3300005616 Ga0068852_100118552 Ga0068852_1001185524 238
276 3300006173 Ga0070716_100188955 Ga0070716_1001889552 238
277 3300006852 Ga0075433_10049587 Ga0075433_100495873 238
278 3300006871 Ga0075434_100020488 Ga0075434_1000204885 238
279 3300006914 Ga0075436_100164282 Ga0075436_1001642823 238
280 3300007076 Ga0075435_100017023 Ga0075435_1000170235 238
281 3300025910 Ga0207684_10082931 Ga0207684_100829314 238
282 3300025922 Ga0207646_10010826 Ga0207646_100108267 238
283 3300025939 Ga0207665_10125350 Ga0207665_101253502 238
284 3300032126 Ga0307415_100609229 Ga0307415_1006092292 238
285 3300035086 Ga0373934_0010461 Ga0373934_0010461_1439_2179 238
286 3300035111 Ga0373923_0022357 Ga0373923_0022357_347_1087 238
287 3300035113 Ga0373936_0004984 Ga0373936_0004984_2174_2914 238
288 3300035116 Ga0373945_0049386 Ga0373945_0049386_787_1527 238
289 3300035118 Ga0373954_0024736 Ga0373954_0024736_561_1301 238
290 3300035119 Ga0373956_0012689 Ga0373956_0012689_2153_2893 238
291 3300035120 Ga0373957_0000976 Ga0373957_0000976_700_1440 238
292 3300035171 Ga0373946_0038127 Ga0373946_0038127_388_1128 238
293 3300035172 Ga0373955_0033139 Ga0373955_0033139_1439_2179 238
294 3300035410 Ga0373924_0012784 Ga0373924_0012784_882_1622 238
295 3300035692 Ga0373935_0028592 Ga0373935_0028592_487_1227 238
296 3300035695 Ga0373927_0117951 Ga0373927_0117951_815_1555 238
297 3300035724 Ga0373933_0011412 Ga0373933_0011412_3274_4014 238
298 3300035725 Ga0373947_0210112 Ga0373947_0210112_385_1125 238
299 3300036401 Ga0373937_0032191 Ga0373937_0032191_3476_4216 238
300 3300037068 Ga0373925_0043701 Ga0373925_0043701_1439_2179 238
301 3300046454 Ga0495592_0033494 Ga0495592_0033494_824_1564 238
302 3300046461 Ga0495641_0004406 Ga0495641_0004406_338_1078 238
303 3300046462 Ga0495651_0005497 Ga0495651_0005497_8166_8906 238
304 3300046463 Ga0495653_0002547 Ga0495653_0002547_4585_5325 238
305 3300046472 Ga0495580_0014629 Ga0495580_0014629_4339_5079 238
306 3300046473 Ga0495582_0137236 Ga0495582_0137236_305_1045 238
307 3300046475 Ga0495639_0025893 Ga0495639_0025893_760_1500 238
308 3300046476 Ga0495662_0098419 Ga0495662_0098419_615_1355 238
309 3300046477 Ga0495664_0030369 Ga0495664_0030369_1070_1810 238
310 3300046499 Ga0495594_0077326 Ga0495594_0077326_699_1439 238
311 3300046511 Ga0495608_0013445 Ga0495608_0013445_3476_4216 238
312 3300046517 Ga0495630_0004190 Ga0495630_0004190_2843_3583 238
313 3300046526 Ga0495666_0018735 Ga0495666_0018735_143_883 238
314 3300046531 Ga0495665_0049519 Ga0495665_0049519_1309_2049 238
315 3300046533 Ga0495640_0028050 Ga0495640_0028050_2395_3135 238
316 3300046535 Ga0495586_0013809 Ga0495586_0013809_2312_3052 238
317 3300046536 Ga0495587_0024333 Ga0495587_0024333_2854_3594 238
318 3300046557 Ga0495622_0036285 Ga0495622_0036285_1069_1809 238
319 3300046559 Ga0495667_0051603 Ga0495667_0051603_1091_1831 238
320 3300046642 Ga0495634_0019778 Ga0495634_0019778_2162_2902 238
321 3300046663 Ga0495635_0083751 Ga0495635_0083751_612_1352 238
322 3300046675 Ga0495657_0022306 Ga0495657_0022306_2357_3097 238
323 3300046678 Ga0495599_0022755 Ga0495599_0022755_864_1604 238
324 3300046680 Ga0495646_0216384 Ga0495646_0216384_264_1004 238
325 3300046681 Ga0495647_0011741 Ga0495647_0011741_1091_1831 238
326 3300046683 Ga0495658_0021101 Ga0495658_0021101_506_1246 238
327 3300046689 Ga0495613_0072673 Ga0495613_0072673_265_1005 238
328 3300046690 Ga0495624_0057445 Ga0495624_0057445_104_844 238
329 3300046809 Ga0495600_0022922 Ga0495600_0022922_1234_1974 238
330 3300047317 Ga0495604_0097090 Ga0495604_0097090_561_1301 238
331 3300047319 Ga0495674_0059696 Ga0495674_0059696_876_1616 238
332 3300047322 Ga0495680_0010104 Ga0495680_0010104_2254_2994 238
333 3300047444 Ga0495675_0017142 Ga0495675_0017142_2721_3461 238
334 3300047471 Ga0495684_0040402 Ga0495684_0040402_1091_1831 238
335 3300050512 nmdc:mga0n895_86981_c1 nmdc:mga0n895_86981_c1_1765_2514 238
336 3300050513 nmdc:mga0rr50_182959_c1 nmdc:mga0rr50_182959_c1_807_1556 238
337 3300050514 nmdc:mga08x19_34409_c1 nmdc:mga08x19_34409_c1_309_1058 238
338 3300053077 Ga0495601_0188689 Ga0495601_0188689_166_906 238
339 3300053084 Ga0495595_0002305 Ga0495595_0002305_2843_3583 238
340 3300053085 Ga0495619_0016462 Ga0495619_0016462_1981_2721 238
341 3300005616 Ga0068852_100068867 Ga0068852_1000688673 239
342 3300006177 Ga0075362_10024025 Ga0075362_100240254 239
343 3300006195 Ga0075366_10003106 Ga0075366_100031064 239
344 3300006195 Ga0075366_10004261 Ga0075366_100042617 239
345 3300026142 Ga0207698_10073747 Ga0207698_100737472 239
346 3300028794 Ga0307515_10032662 Ga0307515_100326625 239
347 3300031731 Ga0307405_10007522 Ga0307405_100075224 239
348 3300031852 Ga0307410_10166727 Ga0307410_101667272 239
349 3300031903 Ga0307407_10062245 Ga0307407_100622453 239
350 3300031995 Ga0307409_100001376 Ga0307409_10000137614 239
351 3300032004 Ga0307414_10084315 Ga0307414_100843153 239
352 3300032126 Ga0307415_100006664 Ga0307415_10000666410 239
353 3300039450 Ga0436363_0944619 Ga0436363_0944619_214_993 239
354 3300050489 nmdc:mga03683_24221_c1 nmdc:mga03683_24221_c1_995_1741 239
355 3300050493 nmdc:mga0k408_8078_c1 nmdc:mga0k408_8078_c1_4516_5268 239
356 3300005518 Ga0070699_100145386 Ga0070699_1001453862 240
357 3300013297 Ga0157378_10226018 Ga0157378_102260182 240
358 3300005545 Ga0070695_100578281 Ga0070695_1005782811 241
359 3300005618 Ga0068864_100778558 Ga0068864_1007785582 241
360 3300005842 Ga0068858_100282847 Ga0068858_1002828472 241
361 3300006237 Ga0097621_100378184 Ga0097621_1003781842 241
362 3300006237 Ga0097621_100454851 Ga0097621_1004548512 241
363 3300025931 Ga0207644_10000517 Ga0207644_1000051728 241
364 3300025931 Ga0207644_10406883 Ga0207644_104068832 241
365 3300025941 Ga0207711_10100675 Ga0207711_101006754 241
366 3300025960 Ga0207651_10487669 Ga0207651_104876692 241
367 3300026035 Ga0207703_10305468 Ga0207703_103054683 241
368 3300026088 Ga0207641_10073091 Ga0207641_100730914 241
369 3300048904 Ga0496101_0460325 Ga0496101_0460325_222_950 241
370 3300048913 Ga0496110_0672363 Ga0496110_0672363_42_770 241
371 3300005334 Ga0068869_100233691 Ga0068869_1002336912 242
372 3300005354 Ga0070675_100294807 Ga0070675_1002948073 242
373 3300005366 Ga0070659_100127375 Ga0070659_1001273752 242
374 3300005456 Ga0070678_100339044 Ga0070678_1003390441 242
375 3300005459 Ga0068867_100113331 Ga0068867_1001133313 242
376 3300005543 Ga0070672_100067150 Ga0070672_1000671503 242
377 3300005548 Ga0070665_100192649 Ga0070665_1001926492 242
378 3300005842 Ga0068858_100501201 Ga0068858_1005012011 242
379 3300009094 Ga0111539_10785273 Ga0111539_107852732 242
380 3300009553 Ga0105249_10118839 Ga0105249_101188393 242
381 3300010375 Ga0105239_10235169 Ga0105239_102351692 242
382 3300013308 Ga0157375_10125067 Ga0157375_101250674 242
383 3300014745 Ga0157377_10061033 Ga0157377_100610334 242
384 3300025908 Ga0207643_10010319 Ga0207643_100103193 242
385 3300026035 Ga0207703_10146894 Ga0207703_101468943 242
386 3300026075 Ga0207708_10200100 Ga0207708_102001002 242
387 3300026089 Ga0207648_10065401 Ga0207648_100654014 242
388 3300028379 Ga0268266_10139611 Ga0268266_101396113 242
389 3300048909 Ga0496106_0396733 Ga0496106_0396733_114_848 242
390 3300048911 Ga0496108_0099605 Ga0496108_0099605_133_867 242
391 3300048915 Ga0496112_0778369 Ga0496112_0778369_52_786 242
392 3300005328 Ga0070676_10001735 Ga0070676_100017354 243
393 3300005333 Ga0070677_10005263 Ga0070677_100052634 243
394 3300005334 Ga0068869_100000926 Ga0068869_1000009266 243
395 3300005335 Ga0070666_10008121 Ga0070666_100081219 243
396 3300005338 Ga0068868_100017866 Ga0068868_1000178664 243
397 3300005340 Ga0070689_100012276 Ga0070689_1000122762 243
398 3300005347 Ga0070668_100004119 Ga0070668_1000041198 243
399 3300005353 Ga0070669_100000668 Ga0070669_10000066826 243
400 3300005354 Ga0070675_100017405 Ga0070675_1000174052 243
401 3300005355 Ga0070671_100019898 Ga0070671_1000198988 243
402 3300005364 Ga0070673_100002041 Ga0070673_1000020417 243
403 3300005365 Ga0070688_100026064 Ga0070688_1000260644 243
404 3300005367 Ga0070667_100018925 Ga0070667_1000189252 243
405 3300005456 Ga0070678_100001539 Ga0070678_1000015397 243
406 3300005459 Ga0068867_100012431 Ga0068867_1000124318 243
407 3300005543 Ga0070672_100000287 Ga0070672_10000028733 243
408 3300005543 Ga0070672_100066153 Ga0070672_1000661534 243
409 3300005548 Ga0070665_100023957 Ga0070665_1000239578 243
410 3300005618 Ga0068864_100008284 Ga0068864_1000082849 243
411 3300005842 Ga0068858_100021707 Ga0068858_1000217078 243
412 3300005843 Ga0068860_100005493 Ga0068860_1000054937 243
413 3300005843 Ga0068860_100013332 Ga0068860_1000133324 243
414 3300005844 Ga0068862_100110121 Ga0068862_1001101213 243
415 3300006237 Ga0097621_100001308 Ga0097621_10000130816 243
416 3300006358 Ga0068871_100001077 Ga0068871_1000010776 243
417 3300006881 Ga0068865_100063168 Ga0068865_1000631684 243
418 3300009177 Ga0105248_10018068 Ga0105248_100180685 243
419 3300009553 Ga0105249_10097812 Ga0105249_100978124 243
420 3300013296 Ga0157374_10001312 Ga0157374_1000131213 243
421 3300013297 Ga0157378_10205292 Ga0157378_102052924 243
422 3300013306 Ga0163162_10005459 Ga0163162_1000545912 243
423 3300013308 Ga0157375_10002469 Ga0157375_100024696 243
424 3300014968 Ga0157379_10000858 Ga0157379_100008585 243
425 3300014969 Ga0157376_10012373 Ga0157376_100123739 243
426 3300017792 Ga0163161_10011289 Ga0163161_100112896 243
427 3300025893 Ga0207682_10030848 Ga0207682_100308482 243
428 3300025907 Ga0207645_10001318 Ga0207645_100013188 243
429 3300025923 Ga0207681_10026428 Ga0207681_100264283 243
430 3300025926 Ga0207659_10001947 Ga0207659_100019475 243
431 3300025931 Ga0207644_10004658 Ga0207644_1000465810 243
432 3300025933 Ga0207706_10124061 Ga0207706_101240613 243
433 3300025936 Ga0207670_10094199 Ga0207670_100941993 243
434 3300025937 Ga0207669_10309881 Ga0207669_103098813 243
435 3300025938 Ga0207704_10015099 Ga0207704_100150991 243
436 3300025940 Ga0207691_10000249 Ga0207691_1000024917 243
437 3300025940 Ga0207691_10130041 Ga0207691_101300414 243
438 3300025941 Ga0207711_10015792 Ga0207711_100157928 243
439 3300025942 Ga0207689_10005377 Ga0207689_100053778 243
440 3300025960 Ga0207651_10006459 Ga0207651_100064598 243
441 3300025961 Ga0207712_10099473 Ga0207712_100994734 243
442 3300025972 Ga0207668_10002554 Ga0207668_100025542 243
443 3300025986 Ga0207658_10001272 Ga0207658_100012723 243
444 3300026023 Ga0207677_10027628 Ga0207677_100276285 243
445 3300026035 Ga0207703_10012267 Ga0207703_100122674 243
446 3300026088 Ga0207641_10000374 Ga0207641_1000037458 243
447 3300026089 Ga0207648_10000523 Ga0207648_1000052328 243
448 3300026089 Ga0207648_10073149 Ga0207648_100731492 243
449 3300026095 Ga0207676_10012265 Ga0207676_100122654 243
450 3300026095 Ga0207676_10261563 Ga0207676_102615632 243
451 3300026121 Ga0207683_10000476 Ga0207683_1000047632 243
452 3300028379 Ga0268266_10005562 Ga0268266_1000556212 243
453 3300028381 Ga0268264_10002850 Ga0268264_100028503 243
454 3300031235 Ga0265330_10004062 Ga0265330_100040622 243
455 3300031238 Ga0265332_10002489 Ga0265332_100024894 243
456 3300031242 Ga0265329_10018394 Ga0265329_100183943 243
457 3300031250 Ga0265331_10001690 Ga0265331_100016904 243
458 3300031251 Ga0265327_10004035 Ga0265327_100040356 243
459 3300031251 Ga0265327_10059222 Ga0265327_100592222 243
460 3300031344 Ga0265316_10014609 Ga0265316_100146095 243
461 3300031711 Ga0265314_10009278 Ga0265314_100092787 243
462 3300031712 Ga0265342_10020514 Ga0265342_100205145 243
463 3300032005 Ga0307411_10228744 Ga0307411_102287442 243
464 3300042876 Ga0451577_0006056 Ga0451577_0006056_3321_4058 243
465 3300044673 Ga0453683_0002919 Ga0453683_0002919_2578_3315 243
466 3300044712 Ga0453684_0023590 Ga0453684_0023590_4324_5061 243
467 3300045051 Ga0451576_0009861 Ga0451576_0009861_6957_7694 243
468 3300048903 Ga0496100_0208603 Ga0496100_0208603_350_1087 243
469 3300048912 Ga0496109_0213379 Ga0496109_0213379_946_1683 243
470 3300005355 Ga0070671_100212959 Ga0070671_1002129592 244
471 3300005456 Ga0070678_100325755 Ga0070678_1003257551 244
472 3300005458 Ga0070681_10082525 Ga0070681_100825252 244
473 3300005467 Ga0070706_100146874 Ga0070706_1001468743 244
474 3300005539 Ga0068853_100022499 Ga0068853_1000224993 244
475 3300005577 Ga0068857_100568161 Ga0068857_1005681612 244
476 3300005841 Ga0068863_100085590 Ga0068863_1000855902 244
477 3300005842 Ga0068858_100150173 Ga0068858_1001501733 244
478 3300005843 Ga0068860_100017524 Ga0068860_1000175249 244
479 3300006237 Ga0097621_100574461 Ga0097621_1005744612 244
480 3300009147 Ga0114129_10172919 Ga0114129_101729194 244
481 3300009174 Ga0105241_10014472 Ga0105241_100144724 244
482 3300009545 Ga0105237_10021940 Ga0105237_100219404 244
483 3300013308 Ga0157375_11289329 Ga0157375_112893291 244
484 3300025304 Ga0209257_1011000 Ga0209257_10110004 244
485 3300025904 Ga0207647_10302587 Ga0207647_103025871 244
486 3300025910 Ga0207684_10122928 Ga0207684_101229283 244
487 3300025911 Ga0207654_10094366 Ga0207654_100943663 244
488 3300025912 Ga0207707_10055187 Ga0207707_100551873 244
489 3300025914 Ga0207671_10394315 Ga0207671_103943151 244
490 3300025932 Ga0207690_10065445 Ga0207690_100654454 244
491 3300025986 Ga0207658_10082425 Ga0207658_100824252 244
492 3300026035 Ga0207703_10344020 Ga0207703_103440202 244
493 3300026041 Ga0207639_10029896 Ga0207639_100298964 244
494 3300026118 Ga0207675_100105278 Ga0207675_1001052784 244
495 3300026121 Ga0207683_10418544 Ga0207683_104185442 244
496 3300035119 Ga0373956_0182603 Ga0373956_0182603_106_852 244
497 3300042876 Ga0451577_0303322 Ga0451577_0303322_420_1163 244
498 3300046472 Ga0495580_0065337 Ga0495580_0065337_420_1166 244
499 3300050507 nmdc:mga05p37_76448_c1 nmdc:mga05p37_76448_c1_176_919 244
500 3300005330 Ga0070690_100001151 Ga0070690_1000011515 245
501 3300005331 Ga0070670_100089859 Ga0070670_1000898594 245
502 3300005333 Ga0070677_10121222 Ga0070677_101212222 245
503 3300005334 Ga0068869_100004899 Ga0068869_1000048994 245
504 3300005334 Ga0068869_100211483 Ga0068869_1002114832 245
505 3300005335 Ga0070666_10003246 Ga0070666_100032466 245
506 3300005337 Ga0070682_100024903 Ga0070682_1000249033 245
507 3300005338 Ga0068868_100002572 Ga0068868_1000025729 245
508 3300005339 Ga0070660_100012880 Ga0070660_1000128805 245
509 3300005340 Ga0070689_100000968 Ga0070689_1000009685 245
510 3300005341 Ga0070691_10048127 Ga0070691_100481273 245
511 3300005343 Ga0070687_100045865 Ga0070687_1000458653 245
512 3300005343 Ga0070687_100175570 Ga0070687_1001755702 245
513 3300005344 Ga0070661_100026640 Ga0070661_1000266404 245
514 3300005345 Ga0070692_10022249 Ga0070692_100222494 245
515 3300005355 Ga0070671_100010442 Ga0070671_1000104429 245
516 3300005356 Ga0070674_100166671 Ga0070674_1001666712 245
517 3300005364 Ga0070673_100005216 Ga0070673_10000521610 245
518 3300005365 Ga0070688_100008334 Ga0070688_1000083341 245
519 3300005366 Ga0070659_100362490 Ga0070659_1003624902 245
520 3300005436 Ga0070713_100009864 Ga0070713_10000986410 245
521 3300005437 Ga0070710_10006201 Ga0070710_100062015 245
522 3300005439 Ga0070711_100000893 Ga0070711_1000008939 245
523 3300005440 Ga0070705_100014603 Ga0070705_1000146035 245
524 3300005444 Ga0070694_100012252 Ga0070694_1000122525 245
525 3300005445 Ga0070708_100119277 Ga0070708_1001192771 245
526 3300005456 Ga0070678_100000107 Ga0070678_1000001078 245
527 3300005457 Ga0070662_100028287 Ga0070662_1000282874 245
528 3300005459 Ga0068867_100091991 Ga0068867_1000919913 245
529 3300005466 Ga0070685_10000221 Ga0070685_1000022112 245
530 3300005468 Ga0070707_100027242 Ga0070707_1000272424 245
531 3300005518 Ga0070699_100160196 Ga0070699_1001601964 245
532 3300005543 Ga0070672_100082633 Ga0070672_1000826332 245
533 3300005544 Ga0070686_100055642 Ga0070686_1000556423 245
534 3300005544 Ga0070686_100377124 Ga0070686_1003771241 245
535 3300005545 Ga0070695_100077736 Ga0070695_1000777362 245
536 3300005546 Ga0070696_100055582 Ga0070696_1000555824 245
537 3300005546 Ga0070696_100109391 Ga0070696_1001093911 245
538 3300005547 Ga0070693_100009100 Ga0070693_1000091005 245
539 3300005547 Ga0070693_100234281 Ga0070693_1002342812 245
540 3300005548 Ga0070665_100005852 Ga0070665_10000585216 245
541 3300005549 Ga0070704_100018809 Ga0070704_1000188094 245
542 3300005563 Ga0068855_100345279 Ga0068855_1003452791 245
543 3300005578 Ga0068854_100086543 Ga0068854_1000865432 245
544 3300005617 Ga0068859_100003177 Ga0068859_10000317712 245
545 3300005618 Ga0068864_100002616 Ga0068864_1000026169 245
546 3300005718 Ga0068866_10000652 Ga0068866_1000065216 245
547 3300005719 Ga0068861_100047329 Ga0068861_1000473293 245
548 3300005719 Ga0068861_100069108 Ga0068861_1000691083 245
549 3300005840 Ga0068870_10009878 Ga0068870_100098783 245
550 3300005841 Ga0068863_100002985 Ga0068863_1000029855 245
551 3300005842 Ga0068858_100000603 Ga0068858_10000060312 245
552 3300005843 Ga0068860_100033089 Ga0068860_1000330893 245
553 3300005843 Ga0068860_100787193 Ga0068860_1007871932 245
554 3300005844 Ga0068862_100066477 Ga0068862_1000664774 245
555 3300006173 Ga0070716_100001339 Ga0070716_10000133915 245
556 3300006173 Ga0070716_100020690 Ga0070716_1000206904 245
557 3300006175 Ga0070712_100002453 Ga0070712_1000024538 245
558 3300006237 Ga0097621_100020593 Ga0097621_1000205933 245
559 3300006358 Ga0068871_100041396 Ga0068871_1000413964 245
560 3300006931 Ga0097620_100003176 Ga0097620_10000317612 245
561 3300009098 Ga0105245_10014037 Ga0105245_100140379 245
562 3300009098 Ga0105245_10020376 Ga0105245_100203768 245
563 3300009101 Ga0105247_10340706 Ga0105247_103407062 245
564 3300009176 Ga0105242_10002918 Ga0105242_100029185 245
565 3300009177 Ga0105248_10129464 Ga0105248_101294644 245
566 3300010375 Ga0105239_10033050 Ga0105239_100330508 245
567 3300011119 Ga0105246_10033904 Ga0105246_100339042 245
568 3300013297 Ga0157378_10076219 Ga0157378_100762193 245
569 3300013306 Ga0163162_10154069 Ga0163162_101540693 245
570 3300014969 Ga0157376_10007657 Ga0157376_100076579 245
571 3300017792 Ga0163161_10039951 Ga0163161_100399514 245
572 3300025898 Ga0207692_10152743 Ga0207692_101527432 245
573 3300025898 Ga0207692_10476843 Ga0207692_104768431 245
574 3300025899 Ga0207642_10000852 Ga0207642_100008522 245
575 3300025900 Ga0207710_10143368 Ga0207710_101433682 245
576 3300025900 Ga0207710_10187497 Ga0207710_101874972 245
577 3300025903 Ga0207680_10001962 Ga0207680_100019624 245
578 3300025908 Ga0207643_10011382 Ga0207643_100113824 245
579 3300025910 Ga0207684_10123164 Ga0207684_101231643 245
580 3300025911 Ga0207654_10003842 Ga0207654_100038425 245
581 3300025911 Ga0207654_10190846 Ga0207654_101908462 245
582 3300025913 Ga0207695_10180450 Ga0207695_101804502 245
583 3300025915 Ga0207693_10001163 Ga0207693_100011639 245
584 3300025915 Ga0207693_10044072 Ga0207693_100440724 245
585 3300025916 Ga0207663_10002183 Ga0207663_100021838 245
586 3300025918 Ga0207662_10201721 Ga0207662_102017212 245
587 3300025919 Ga0207657_10000280 Ga0207657_1000028026 245
588 3300025922 Ga0207646_10465438 Ga0207646_104654382 245
589 3300025924 Ga0207694_10367874 Ga0207694_103678743 245
590 3300025925 Ga0207650_10014573 Ga0207650_100145733 245
591 3300025927 Ga0207687_10000741 Ga0207687_100007419 245
592 3300025928 Ga0207700_10438709 Ga0207700_104387092 245
593 3300025931 Ga0207644_10002123 Ga0207644_100021236 245
594 3300025931 Ga0207644_10172753 Ga0207644_101727532 245
595 3300025932 Ga0207690_10527940 Ga0207690_105279402 245
596 3300025933 Ga0207706_10012311 Ga0207706_100123117 245
597 3300025933 Ga0207706_10027747 Ga0207706_100277474 245
598 3300025934 Ga0207686_10000521 Ga0207686_1000052138 245
599 3300025936 Ga0207670_10000894 Ga0207670_100008947 245
600 3300025937 Ga0207669_10011731 Ga0207669_100117313 245
601 3300025938 Ga0207704_10036082 Ga0207704_100360823 245
602 3300025939 Ga0207665_10004353 Ga0207665_100043535 245
603 3300025939 Ga0207665_10025043 Ga0207665_100250434 245
604 3300025940 Ga0207691_10044197 Ga0207691_100441974 245
605 3300025941 Ga0207711_10000448 Ga0207711_1000044819 245
606 3300025941 Ga0207711_10382017 Ga0207711_103820172 245
607 3300025942 Ga0207689_10037236 Ga0207689_100372362 245
608 3300025942 Ga0207689_10225844 Ga0207689_102258442 245
609 3300025949 Ga0207667_10067633 Ga0207667_100676332 245
610 3300025960 Ga0207651_10002125 Ga0207651_100021252 245
611 3300025981 Ga0207640_10006937 Ga0207640_100069375 245
612 3300025981 Ga0207640_10624108 Ga0207640_106241082 245
613 3300025986 Ga0207658_10006610 Ga0207658_100066109 245
614 3300025986 Ga0207658_10042260 Ga0207658_100422602 245
615 3300026023 Ga0207677_10000253 Ga0207677_1000025316 245
616 3300026023 Ga0207677_10161090 Ga0207677_101610902 245
617 3300026035 Ga0207703_10000517 Ga0207703_1000051738 245
618 3300026078 Ga0207702_10009791 Ga0207702_100097914 245
619 3300026078 Ga0207702_10230902 Ga0207702_102309023 245
620 3300026088 Ga0207641_10000610 Ga0207641_1000061014 245
621 3300026089 Ga0207648_10022490 Ga0207648_100224905 245
622 3300026095 Ga0207676_10000167 Ga0207676_1000016751 245
623 3300026118 Ga0207675_100009453 Ga0207675_1000094534 245
624 3300026118 Ga0207675_100057657 Ga0207675_1000576573 245
625 3300026121 Ga0207683_10000965 Ga0207683_100009658 245
626 3300026142 Ga0207698_10142504 Ga0207698_101425044 245
627 3300028379 Ga0268266_10005004 Ga0268266_100050044 245
628 3300028380 Ga0268265_10067967 Ga0268265_100679673 245
629 3300028381 Ga0268264_10001027 Ga0268264_1000102720 245
630 3300028381 Ga0268264_10111146 Ga0268264_101111463 245
631 3300031251 Ga0265327_10010785 Ga0265327_100107857 245
632 3300035111 Ga0373923_0001149 Ga0373923_0001149_3292_4035 245
633 3300035116 Ga0373945_0021459 Ga0373945_0021459_669_1412 245
634 3300035118 Ga0373954_0000524 Ga0373954_0000524_3529_4272 245
635 3300035119 Ga0373956_0017997 Ga0373956_0017997_1372_2115 245
636 3300035170 Ga0373943_0028575 Ga0373943_0028575_737_1480 245
637 3300035171 Ga0373946_0017324 Ga0373946_0017324_543_1286 245
638 3300035410 Ga0373924_0002572 Ga0373924_0002572_25_768 245
639 3300035724 Ga0373933_0027815 Ga0373933_0027815_177_920 245
640 3300036401 Ga0373937_0015112 Ga0373937_0015112_4272_5015 245
641 3300036401 Ga0373937_0049100 Ga0373937_0049100_1722_2465 245
642 3300036401 Ga0373937_0272057 Ga0373937_0272057_485_1234 245
643 3300037068 Ga0373925_0007555 Ga0373925_0007555_1651_2394 245
644 3300037068 Ga0373925_0473308 Ga0373925_0473308_230_979 245
645 3300046459 Ga0495629_0011863 Ga0495629_0011863_144_887 245
646 3300046471 Ga0495650_0055747 Ga0495650_0055747_584_1321 245
647 3300046472 Ga0495580_0035978 Ga0495580_0035978_1988_2731 245
648 3300046473 Ga0495582_0006109 Ga0495582_0006109_547_1290 245
649 3300046475 Ga0495639_0023118 Ga0495639_0023118_1409_2152 245
650 3300046476 Ga0495662_0015640 Ga0495662_0015640_1464_2207 245
651 3300046477 Ga0495664_0032401 Ga0495664_0032401_1896_2639 245
652 3300046477 Ga0495664_0155380 Ga0495664_0155380_596_1339 245
653 3300046517 Ga0495630_0067811 Ga0495630_0067811_885_1628 245
654 3300046531 Ga0495665_0017444 Ga0495665_0017444_547_1290 245
655 3300046535 Ga0495586_0080431 Ga0495586_0080431_260_1003 245
656 3300046543 Ga0495645_0067218 Ga0495645_0067218_1378_2121 245
657 3300046642 Ga0495634_0069913 Ga0495634_0069913_546_1289 245
658 3300046663 Ga0495635_0018827 Ga0495635_0018827_1740_2483 245
659 3300046674 Ga0495588_0082110 Ga0495588_0082110_99_842 245
660 3300046678 Ga0495599_0069856 Ga0495599_0069856_845_1588 245
661 3300046679 Ga0495623_0034959 Ga0495623_0034959_1105_1848 245
662 3300046681 Ga0495647_0036397 Ga0495647_0036397_160_903 245
663 3300046683 Ga0495658_0089696 Ga0495658_0089696_916_1659 245
664 3300046689 Ga0495613_0008532 Ga0495613_0008532_4124_4867 245
665 3300046690 Ga0495624_0420079 Ga0495624_0420079_14_757 245
666 3300046809 Ga0495600_0087997 Ga0495600_0087997_444_1187 245
667 3300047315 Ga0495581_0006167 Ga0495581_0006167_1396_2139 245
668 3300047322 Ga0495680_0040379 Ga0495680_0040379_621_1364 245
669 3300048903 Ga0496100_0068160 Ga0496100_0068160_139_882 245
670 3300048904 Ga0496101_0012612 Ga0496101_0012612_826_1569 245
671 3300048907 Ga0496104_0002793 Ga0496104_0002793_7344_8087 245
672 3300048908 Ga0496105_0022747 Ga0496105_0022747_3707_4450 245
673 3300048909 Ga0496106_0053765 Ga0496106_0053765_1540_2283 245
674 3300048910 Ga0496107_0101771 Ga0496107_0101771_343_1086 245
675 3300048912 Ga0496109_0006393 Ga0496109_0006393_3737_4480 245
676 3300048914 Ga0496111_0094672 Ga0496111_0094672_857_1600 245
677 3300048915 Ga0496112_0001041 Ga0496112_0001041_11072_11815 245
678 3300048917 Ga0496114_0063262 Ga0496114_0063262_77_820 245
679 3300050512 nmdc:mga0n895_270323_c1 nmdc:mga0n895_270323_c1_157_900 245
680 3300053077 Ga0495601_0029790 Ga0495601_0029790_2126_2869 245
681 3300053084 Ga0495595_0051531 Ga0495595_0051531_732_1475 245
682 3300053085 Ga0495619_0008259 Ga0495619_0008259_602_1345 245
683 3300005331 Ga0070670_100440444 Ga0070670_1004404442 246
684 3300005334 Ga0068869_100022670 Ga0068869_1000226705 246
685 3300005338 Ga0068868_100671195 Ga0068868_1006711951 246
686 3300005364 Ga0070673_100206584 Ga0070673_1002065844 246
687 3300005563 Ga0068855_100590673 Ga0068855_1005906732 246
688 3300005577 Ga0068857_100132982 Ga0068857_1001329823 246
689 3300005614 Ga0068856_100190024 Ga0068856_1001900243 246
690 3300005719 Ga0068861_100242081 Ga0068861_1002420812 246
691 3300005841 Ga0068863_100227080 Ga0068863_1002270802 246
692 3300006358 Ga0068871_100109944 Ga0068871_1001099444 246
693 3300009174 Ga0105241_10332946 Ga0105241_103329462 246
694 3300009176 Ga0105242_10063808 Ga0105242_100638083 246
695 3300013308 Ga0157375_10197128 Ga0157375_101971285 246
696 3300014325 Ga0163163_10330808 Ga0163163_103308082 246
697 3300014968 Ga0157379_10125926 Ga0157379_101259264 246
698 3300014969 Ga0157376_10877646 Ga0157376_108776461 246
699 3300025911 Ga0207654_10237427 Ga0207654_102374272 246
700 3300025925 Ga0207650_10303220 Ga0207650_103032202 246
701 3300025926 Ga0207659_10056065 Ga0207659_100560652 246
702 3300025942 Ga0207689_10009869 Ga0207689_1000986910 246
703 3300025942 Ga0207689_10181727 Ga0207689_101817271 246
704 3300025949 Ga0207667_10302926 Ga0207667_103029263 246
705 3300025960 Ga0207651_10224419 Ga0207651_102244193 246
706 3300026023 Ga0207677_10107242 Ga0207677_101072423 246
707 3300026035 Ga0207703_10629739 Ga0207703_106297392 246
708 3300026078 Ga0207702_10574596 Ga0207702_105745962 246
709 3300026116 Ga0207674_10124573 Ga0207674_101245733 246
710 3300026118 Ga0207675_100073780 Ga0207675_1000737804 246
711 3300031344 Ga0265316_10000391 Ga0265316_1000039122 246
712 3300035171 Ga0373946_0021281 Ga0373946_0021281_1225_1971 246
713 3300035172 Ga0373955_0261355 Ga0373955_0261355_136_885 246
714 3300035724 Ga0373933_0036668 Ga0373933_0036668_2070_2819 246
715 3300035725 Ga0373947_0345130 Ga0373947_0345130_190_936 246
716 3300036401 Ga0373937_0243794 Ga0373937_0243794_569_1318 246
717 3300036647 Ga0316582_0000275 Ga0316582_0000275_394_1194 246
718 3300036712 Ga0316584_0002877 Ga0316584_0002877_8831_9631 246
719 3300037068 Ga0373925_0018839 Ga0373925_0018839_392_1138 246
720 3300037588 Ga0316581_0003201 Ga0316581_0003201_2802_3602 246
721 3300042876 Ga0451577_0028215 Ga0451577_0028215_2121_2903 246
722 3300044901 Ga0466960_0042923 Ga0466960_0042923_191_949 246
723 3300048088 Ga0495602_0127416 Ga0495602_0127416_788_1537 246
724 3300050512 nmdc:mga0n895_608738_c1 nmdc:mga0n895_608738_c1_281_1030 246
725 3300005530 Ga0070679_100339159 Ga0070679_1003391591 247
726 3300009551 Ga0105238_10477940 Ga0105238_104779402 247
727 3300037471 Ga0395905_0052315 Ga0395905_0052315_1053_1826 247
728 3300005467 Ga0070706_100584627 Ga0070706_1005846271 248
729 3300011119 Ga0105246_10448577 Ga0105246_104485772 248
730 3300026121 Ga0207683_10457631 Ga0207683_104576312 248
731 3300028794 Ga0307515_10000240 Ga0307515_10000240141 248
732 3300045051 Ga0451576_0187226 Ga0451576_0187226_230_982 248
733 3300049649 Ga0501198_000002 Ga0501198_000002_192716_193471 248
734 3300049662 Ga0501222_000093 Ga0501222_000093_3950_4705 248
735 3300053154 Ga0500619_000063 Ga0500619_000063_8102_8860 248
736 3300009098 Ga0105245_10005497 Ga0105245_100054976 249
737 3300009148 Ga0105243_10003255 Ga0105243_100032555 249
738 3300011119 Ga0105246_10175926 Ga0105246_101759263 249
739 3300013296 Ga0157374_10000565 Ga0157374_1000056538 249
740 3300013297 Ga0157378_10059126 Ga0157378_100591263 249
741 3300013306 Ga0163162_10022644 Ga0163162_100226448 249
742 3300013308 Ga0157375_10004526 Ga0157375_100045266 249
743 3300014325 Ga0163163_10000689 Ga0163163_100006898 249
744 3300014745 Ga0157377_10000047 Ga0157377_1000004747 249
745 3300014968 Ga0157379_10003863 Ga0157379_100038639 249
746 3300014969 Ga0157376_10007747 Ga0157376_100077479 249
747 3300026067 Ga0207678_10002428 Ga0207678_100024287 249
748 3300028381 Ga0268264_10427501 Ga0268264_104275012 249
749 3300031507 Ga0307509_10132030 Ga0307509_101320304 249
750 3300037068 Ga0373925_0028685 Ga0373925_0028685_25_822 249
751 3300046455 Ga0495603_0297075 Ga0495603_0297075_88_855 249
752 3300048911 Ga0496108_0260503 Ga0496108_0260503_38_835 249
753 3300049577 Ga0501041_0060581 Ga0501041_0060581_215_970 249
754 3300049743 Ga0501081_0209921 Ga0501081_0209921_429_1184 249
755 3300053134 Ga0500658_0014541 Ga0500658_0014541_1270_2025 249
756 3300053739 Ga0500587_001818 Ga0500587_001818_1615_2370 249
757 3300005329 Ga0070683_100099341 Ga0070683_1000993413 250
758 3300005331 Ga0070670_100085666 Ga0070670_1000856664 250
759 3300005364 Ga0070673_100468341 Ga0070673_1004683412 250
760 3300005535 Ga0070684_100009252 Ga0070684_1000092523 250
761 3300005543 Ga0070672_100071664 Ga0070672_1000716642 250
762 3300005577 Ga0068857_100097293 Ga0068857_1000972933 250
763 3300005618 Ga0068864_100454306 Ga0068864_1004543062 250
764 3300005834 Ga0068851_10072779 Ga0068851_100727791 250
765 3300025923 Ga0207681_10287120 Ga0207681_102871202 250
766 3300025925 Ga0207650_10001150 Ga0207650_1000115023 250
767 3300025940 Ga0207691_10086127 Ga0207691_100861274 250
768 3300025944 Ga0207661_10028878 Ga0207661_100288786 250
769 3300026095 Ga0207676_10488707 Ga0207676_104887072 250
770 3300026116 Ga0207674_10051412 Ga0207674_100514123 250
771 3300028379 Ga0268266_10769759 Ga0268266_107697591 250
772 3300036401 Ga0373937_0080351 Ga0373937_0080351_984_1739 250
773 3300046472 Ga0495580_0050624 Ga0495580_0050624_516_1283 250
774 3300048912 Ga0496109_0160408 Ga0496109_0160408_319_1086 250
775 3300005330 Ga0070690_100051502 Ga0070690_1000515024 251
776 3300005353 Ga0070669_100001340 Ga0070669_1000013405 251
777 3300005367 Ga0070667_100004388 Ga0070667_10000438811 251
778 3300006195 Ga0075366_10036923 Ga0075366_100369233 251
779 3300025981 Ga0207640_10271458 Ga0207640_102714582 251
780 3300045051 Ga0451576_0031288 Ga0451576_0031288_3773_4561 251
781 3300050493 nmdc:mga0k408_33287_c1 nmdc:mga0k408_33287_c1_1309_2070 251
782 3300005364 Ga0070673_100083572 Ga0070673_1000835723 253
783 3300005618 Ga0068864_100079160 Ga0068864_1000791602 253
784 3300013105 Ga0157369_10357187 Ga0157369_103571871 253
785 3300025920 Ga0207649_10139247 Ga0207649_101392473 253
786 3300025940 Ga0207691_10093556 Ga0207691_100935564 253
787 3300005544 Ga0070686_100306748 Ga0070686_1003067482 254
788 3300005327 Ga0070658_10212722 Ga0070658_102127222 255
789 3300005328 Ga0070676_10300112 Ga0070676_103001121 255
790 3300005331 Ga0070670_100038187 Ga0070670_1000381875 255
791 3300005335 Ga0070666_10005482 Ga0070666_100054828 255
792 3300005338 Ga0068868_100007250 Ga0068868_1000072504 255
793 3300005338 Ga0068868_100027784 Ga0068868_1000277844 255
794 3300005340 Ga0070689_100019778 Ga0070689_1000197784 255
795 3300005344 Ga0070661_100297307 Ga0070661_1002973071 255
796 3300005347 Ga0070668_100066950 Ga0070668_1000669502 255
797 3300005353 Ga0070669_100069103 Ga0070669_1000691034 255
798 3300005354 Ga0070675_100002913 Ga0070675_10000291310 255
799 3300005354 Ga0070675_100033252 Ga0070675_1000332524 255
800 3300005354 Ga0070675_100221877 Ga0070675_1002218773 255
801 3300005355 Ga0070671_100039862 Ga0070671_1000398624 255
802 3300005364 Ga0070673_100034039 Ga0070673_1000340394 255
803 3300005364 Ga0070673_100048540 Ga0070673_1000485404 255
804 3300005367 Ga0070667_100006263 Ga0070667_1000062634 255
805 3300005367 Ga0070667_100063935 Ga0070667_1000639354 255
806 3300005455 Ga0070663_100091829 Ga0070663_1000918294 255
807 3300005456 Ga0070678_100016518 Ga0070678_1000165186 255
808 3300005456 Ga0070678_100070096 Ga0070678_1000700963 255
809 3300005456 Ga0070678_100444285 Ga0070678_1004442852 255
810 3300005457 Ga0070662_100040230 Ga0070662_1000402303 255
811 3300005459 Ga0068867_100068502 Ga0068867_1000685021 255
812 3300005539 Ga0068853_100250004 Ga0068853_1002500043 255
813 3300005543 Ga0070672_100009036 Ga0070672_1000090364 255
814 3300005543 Ga0070672_100123089 Ga0070672_1001230893 255
815 3300005564 Ga0070664_100173679 Ga0070664_1001736793 255
816 3300005564 Ga0070664_100515269 Ga0070664_1005152691 255
817 3300005616 Ga0068852_100034538 Ga0068852_1000345385 255
818 3300005616 Ga0068852_100242460 Ga0068852_1002424602 255
819 3300005616 Ga0068852_100568284 Ga0068852_1005682841 255
820 3300005617 Ga0068859_100140187 Ga0068859_1001401873 255
821 3300005618 Ga0068864_100017069 Ga0068864_1000170694 255
822 3300005618 Ga0068864_100047375 Ga0068864_1000473754 255
823 3300005618 Ga0068864_100049900 Ga0068864_1000499005 255
824 3300005618 Ga0068864_100087580 Ga0068864_1000875803 255
825 3300005718 Ga0068866_10066202 Ga0068866_100662021 255
826 3300005719 Ga0068861_100000757 Ga0068861_10000075720 255
827 3300005719 Ga0068861_100021338 Ga0068861_1000213385 255
828 3300005841 Ga0068863_100000585 Ga0068863_10000058535 255
829 3300005841 Ga0068863_100029355 Ga0068863_1000293555 255
830 3300005841 Ga0068863_100082415 Ga0068863_1000824153 255
831 3300005842 Ga0068858_100003791 Ga0068858_10000379112 255
832 3300005842 Ga0068858_100004338 Ga0068858_10000433811 255
833 3300005842 Ga0068858_100019626 Ga0068858_1000196262 255
834 3300005843 Ga0068860_100009426 Ga0068860_10000942611 255
835 3300005843 Ga0068860_100027701 Ga0068860_1000277014 255
836 3300005844 Ga0068862_100119139 Ga0068862_1001191394 255
837 3300006237 Ga0097621_100135560 Ga0097621_1001355604 255
838 3300006237 Ga0097621_100168073 Ga0097621_1001680733 255
839 3300006237 Ga0097621_100223517 Ga0097621_1002235173 255
840 3300006358 Ga0068871_100181838 Ga0068871_1001818383 255
841 3300006358 Ga0068871_100195588 Ga0068871_1001955881 255
842 3300006931 Ga0097620_100140194 Ga0097620_1001401943 255
843 3300007076 Ga0075435_100552764 Ga0075435_1005527641 255
844 3300009098 Ga0105245_10106237 Ga0105245_101062374 255
845 3300009174 Ga0105241_10298974 Ga0105241_102989743 255
846 3300009177 Ga0105248_10022083 Ga0105248_100220834 255
847 3300009553 Ga0105249_10043839 Ga0105249_100438393 255
848 3300010375 Ga0105239_10050795 Ga0105239_100507953 255
849 3300013296 Ga0157374_10110327 Ga0157374_101103272 255
850 3300013296 Ga0157374_10246341 Ga0157374_102463411 255
851 3300013306 Ga0163162_10014444 Ga0163162_100144444 255
852 3300013306 Ga0163162_10074167 Ga0163162_100741675 255
853 3300013307 Ga0157372_10059283 Ga0157372_100592834 255
854 3300013308 Ga0157375_10006387 Ga0157375_100063875 255
855 3300013308 Ga0157375_10048845 Ga0157375_100488454 255
856 3300013308 Ga0157375_10077756 Ga0157375_100777563 255
857 3300014325 Ga0163163_10087119 Ga0163163_100871194 255
858 3300014326 Ga0157380_10068761 Ga0157380_100687612 255
859 3300014968 Ga0157379_10043521 Ga0157379_100435214 255
860 3300014969 Ga0157376_10181649 Ga0157376_101816493 255
861 3300014969 Ga0157376_10228127 Ga0157376_102281272 255
862 3300017792 Ga0163161_10051067 Ga0163161_100510673 255
863 3300017792 Ga0163161_10056174 Ga0163161_100561741 255
864 3300025315 Ga0207697_10059926 Ga0207697_100599262 255
865 3300025893 Ga0207682_10009826 Ga0207682_100098265 255
866 3300025903 Ga0207680_10030074 Ga0207680_100300744 255
867 3300025907 Ga0207645_10005283 Ga0207645_100052834 255
868 3300025907 Ga0207645_10021770 Ga0207645_100217704 255
869 3300025907 Ga0207645_10098667 Ga0207645_100986673 255
870 3300025908 Ga0207643_10076328 Ga0207643_100763281 255
871 3300025909 Ga0207705_10193527 Ga0207705_101935272 255
872 3300025919 Ga0207657_10265852 Ga0207657_102658523 255
873 3300025920 Ga0207649_10077606 Ga0207649_100776063 255
874 3300025921 Ga0207652_10080923 Ga0207652_100809233 255
875 3300025923 Ga0207681_10002043 Ga0207681_100020437 255
876 3300025925 Ga0207650_10064700 Ga0207650_100647003 255
877 3300025925 Ga0207650_10111783 Ga0207650_101117833 255
878 3300025926 Ga0207659_10000313 Ga0207659_1000031320 255
879 3300025926 Ga0207659_10021930 Ga0207659_100219304 255
880 3300025926 Ga0207659_10238648 Ga0207659_102386482 255
881 3300025927 Ga0207687_10061247 Ga0207687_100612473 255
882 3300025927 Ga0207687_10345439 Ga0207687_103454392 255
883 3300025931 Ga0207644_10005549 Ga0207644_100055492 255
884 3300025931 Ga0207644_10031525 Ga0207644_100315253 255
885 3300025931 Ga0207644_10100751 Ga0207644_101007513 255
886 3300025931 Ga0207644_10213745 Ga0207644_102137452 255
887 3300025932 Ga0207690_10036473 Ga0207690_100364734 255
888 3300025936 Ga0207670_10014247 Ga0207670_100142474 255
889 3300025937 Ga0207669_10031901 Ga0207669_100319014 255
890 3300025937 Ga0207669_10334879 Ga0207669_103348792 255
891 3300025938 Ga0207704_10008876 Ga0207704_100088764 255
892 3300025940 Ga0207691_10005968 Ga0207691_1000596816 255
893 3300025940 Ga0207691_10109171 Ga0207691_101091714 255
894 3300025940 Ga0207691_10257792 Ga0207691_102577922 255
895 3300025941 Ga0207711_10301634 Ga0207711_103016343 255
896 3300025942 Ga0207689_10073788 Ga0207689_100737883 255
897 3300025944 Ga0207661_10187410 Ga0207661_101874103 255
898 3300025945 Ga0207679_10061296 Ga0207679_100612964 255
899 3300025945 Ga0207679_10247848 Ga0207679_102478483 255
900 3300025945 Ga0207679_10286217 Ga0207679_102862172 255
901 3300025949 Ga0207667_10064079 Ga0207667_100640794 255
902 3300025960 Ga0207651_10000600 Ga0207651_100006007 255
903 3300025961 Ga0207712_10032745 Ga0207712_100327454 255
904 3300025981 Ga0207640_10100204 Ga0207640_101002044 255
905 3300025986 Ga0207658_10000812 Ga0207658_1000081214 255
906 3300025986 Ga0207658_10004524 Ga0207658_100045245 255
907 3300025986 Ga0207658_10084055 Ga0207658_100840553 255
908 3300026023 Ga0207677_10003852 Ga0207677_100038524 255
909 3300026035 Ga0207703_10000929 Ga0207703_1000092924 255
910 3300026035 Ga0207703_10001541 Ga0207703_1000154112 255
911 3300026035 Ga0207703_10475492 Ga0207703_104754922 255
912 3300026041 Ga0207639_10011019 Ga0207639_100110193 255
913 3300026041 Ga0207639_10107392 Ga0207639_101073923 255
914 3300026067 Ga0207678_10170155 Ga0207678_101701552 255
915 3300026088 Ga0207641_10000655 Ga0207641_1000065535 255
916 3300026089 Ga0207648_10006616 Ga0207648_100066168 255
917 3300026095 Ga0207676_10002990 Ga0207676_100029904 255
918 3300026095 Ga0207676_10489257 Ga0207676_104892572 255
919 3300026118 Ga0207675_100000956 Ga0207675_10000095630 255
920 3300026118 Ga0207675_100070994 Ga0207675_1000709944 255
921 3300026118 Ga0207675_100339083 Ga0207675_1003390833 255
922 3300026121 Ga0207683_10010865 Ga0207683_1001086512 255
923 3300026121 Ga0207683_10060215 Ga0207683_100602154 255
924 3300026121 Ga0207683_10067830 Ga0207683_100678303 255
925 3300026142 Ga0207698_10011374 Ga0207698_100113746 255
926 3300026142 Ga0207698_10114530 Ga0207698_101145304 255
927 3300026142 Ga0207698_10422331 Ga0207698_104223312 255
928 3300028381 Ga0268264_10002170 Ga0268264_100021707 255
929 3300028381 Ga0268264_10043681 Ga0268264_100436813 255
930 3300035116 Ga0373945_0063728 Ga0373945_0063728_341_1108 255
931 3300035695 Ga0373927_0263878 Ga0373927_0263878_28_795 255
932 3300037068 Ga0373925_0600347 Ga0373925_0600347_99_866 255
933 3300046473 Ga0495582_0304836 Ga0495582_0304836_90_857 255
934 3300046681 Ga0495647_0121502 Ga0495647_0121502_161_937 255
935 3300046683 Ga0495658_0032524 Ga0495658_0032524_1814_2581 255
936 3300046683 Ga0495658_0049562 Ga0495658_0049562_651_1526 255
937 3300047470 Ga0495681_0121096 Ga0495681_0121096_243_1010 255
938 3300047471 Ga0495684_0123832 Ga0495684_0123832_871_1638 255
939 3300048904 Ga0496101_0361781 Ga0496101_0361781_201_968 255
940 3300048907 Ga0496104_0424300 Ga0496104_0424300_360_1136 255
941 3300048908 Ga0496105_0140740 Ga0496105_0140740_22_798 255
942 3300048911 Ga0496108_0238384 Ga0496108_0238384_354_1130 255
943 3300048912 Ga0496109_0077834 Ga0496109_0077834_838_1614 255
944 3300048913 Ga0496110_0013837 Ga0496110_0013837_1560_2336 255
945 3300048914 Ga0496111_0065975 Ga0496111_0065975_135_911 255
946 3300048916 Ga0496113_0022247 Ga0496113_0022247_3324_4100 255
947 3300053077 Ga0495601_0113426 Ga0495601_0113426_729_1496 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

8

180

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8611 16 241
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8303 16 241
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.6605 44 175
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.6207 54 169
1oed-assembly1.cif.gz_E structure of acetylcholine receptor pore from electron images 0.6064 56 187
ID Description Score Start End Superfamily
af_H3BS89_163_270_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7143 55 139 1.20.140.150
af_Q08CE6_110_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6868 55 142 1.20.140.150
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6531 58 185 1.20.120.1770
af_Q6H474_2_116_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6408 58 172 1.20.120.290
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6297 58 185 1.20.120.1770
ID Description Score Start End GO Terms
AF-T0YZH0-F1-model_v4 Cytochrome c assembly protein 0.9468 9 169 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7C8D923-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein CcmC) 0.9387 2 169 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-T0YZH0-F1-model_v4 Cytochrome c assembly protein 0.9355 9 169 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A1N6ZL81-F1-model_v4 Heme exporter protein C 0.9307 12 248 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A2M7FI51-F1-model_v4 Heme exporter protein C 0.928 8 176 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
81.81 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map