F486493
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 947 | 403 | 904 | 356 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0209397|Ga0436364_0209397_320_1498 |
| Length | 387 |
| Sequence | LAAAAVAGDEVPPVTSSPLTGTRAPRTAVEVRLEDLSRRYGPVIALDHLDLTMEPGELVALLGPSGCGKTTTLRLLAGLEDADTGRITVAGRDLTRVSANKRDMGMVFQAYSLFPHMTVRQNVAFGLRLRRVGSAERDRKALDMLDLVSLSAQADRYPHQLSGGQQQRVALARALAIEPQVLLLDEPLSALDAKVRAQLRDEIRRIQLEVGITTLFVTHDQEEALAIADRVGVMRDGKLEQLAPPTEVYSRPATSFVAEFVGLSNRLPGEVSGGQVVVRGTALPLVDRQTADGSAIALVRPEAVSLASPGTDGAAGAGPLTGTVIAVTFLGATSRVSVDLGDVTVLAQLPTSEATVLSAGSRVTLAIRPDPVLVAASTEPPATGDEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 3 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 4 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 5 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 6 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 7 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 8 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 9 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 10 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 11 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 12 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 13 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 14 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 15 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 16 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 17 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 18 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 19 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 20 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 21 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 22 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 23 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 24 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 25 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 26 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 27 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 28 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 29 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 30 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 31 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 32 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 33 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 34 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 35 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 36 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 37 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 38 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 39 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 40 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 41 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 44 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 279 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 360 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 395 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 396 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 398 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 401 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 402 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 403 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.14 |
| Metatranscriptomes | 0.32 |
| Isolates | 4.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.97 |
| Nodule | 0.53 |
| Rhizoplane | 8.03 |
| Rhizosphere | 76.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002939 | 3300000546 | Bacteria | 2001 |
| 2 | JGI24744J21845_10000925 | 3300002077 | Bacteria | 5566 |
| 3 | JGI24744J21845_10002976 | 3300002077 | Bacteria | 3470 |
| 4 | JGI25164J39214_1000610 | 3300002772 | Bacteria | 15259 |
| 5 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 6 | Ga0006562J51391_1052848 | 3300003578 | Bacteria | 4730 |
| 7 | Ga0006562J51391_1052849 | 3300003578 | Bacteria | 3880 |
| 8 | Ga0055540_1000690 | 3300003792 | Bacteria | 23282 |
| 9 | Ga0055540_1003313 | 3300003792 | Bacteria | 7856 |
| 10 | Ga0055540_1009062 | 3300003792 | Bacteria | 3495 |
| 11 | Ga0070658_10021050 | 3300005327 | Bacteria | 5224 |
| 12 | Ga0070683_100026326 | 3300005329 | Bacteria | 5236 |
| 13 | Ga0070683_100130030 | 3300005329 | Bacteria | 2383 |
| 14 | Ga0070690_100020140 | 3300005330 | Bacteria | 4061 |
| 15 | Ga0070670_100022182 | 3300005331 | Bacteria | 5464 |
| 16 | Ga0068869_100021575 | 3300005334 | Bacteria | 4432 |
| 17 | Ga0068869_100032335 | 3300005334 | Bacteria | 3686 |
| 18 | Ga0070680_100172615 | 3300005336 | Bacteria | 1820 |
| 19 | Ga0070682_100011661 | 3300005337 | Bacteria | 5026 |
| 20 | Ga0070682_100016863 | 3300005337 | Bacteria | 4251 |
| 21 | Ga0068868_100020559 | 3300005338 | Bacteria | 4963 |
| 22 | Ga0070660_100048372 | 3300005339 | Bacteria | 3266 |
| 23 | Ga0070689_100031495 | 3300005340 | Bacteria | 4030 |
| 24 | Ga0070689_100061758 | 3300005340 | Bacteria | 2915 |
| 25 | Ga0070689_100302899 | 3300005340 | Bacteria | 1331 |
| 26 | Ga0070691_10014414 | 3300005341 | Bacteria | 3626 |
| 27 | Ga0070687_100059429 | 3300005343 | Bacteria | 2013 |
| 28 | Ga0070668_100028219 | 3300005347 | Bacteria | 4261 |
| 29 | Ga0070668_100334812 | 3300005347 | Bacteria | 1277 |
| 30 | Ga0070669_100054081 | 3300005353 | Bacteria | 2940 |
| 31 | Ga0070671_100010086 | 3300005355 | Bacteria | 7587 |
| 32 | Ga0070671_100073068 | 3300005355 | Bacteria | 2865 |
| 33 | Ga0070674_100039668 | 3300005356 | Bacteria | 3181 |
| 34 | Ga0070674_100071222 | 3300005356 | Bacteria | 2458 |
| 35 | Ga0070674_100211709 | 3300005356 | Bacteria | 1503 |
| 36 | Ga0070673_100128577 | 3300005364 | Bacteria | 2122 |
| 37 | Ga0070688_100009770 | 3300005365 | Bacteria | 5268 |
| 38 | Ga0070688_100096343 | 3300005365 | Bacteria | 1943 |
| 39 | Ga0070688_100145437 | 3300005365 | Bacteria | 1615 |
| 40 | Ga0070659_100036709 | 3300005366 | Bacteria | 3820 |
| 41 | Ga0070659_100053027 | 3300005366 | Bacteria | 3191 |
| 42 | Ga0070667_100000022 | 3300005367 | Bacteria | 204861 |
| 43 | Ga0070667_100004304 | 3300005367 | Bacteria | 12014 |
| 44 | Ga0070667_100006910 | 3300005367 | Bacteria | 9428 |
| 45 | Ga0070667_100058488 | 3300005367 | Bacteria | 3259 |
| 46 | Ga0070667_100073872 | 3300005367 | Bacteria | 2908 |
| 47 | Ga0070667_100149497 | 3300005367 | Bacteria | 2051 |
| 48 | Ga0070709_10040421 | 3300005434 | Bacteria | 2867 |
| 49 | Ga0070709_10063463 | 3300005434 | Bacteria | 2359 |
| 50 | Ga0070709_10248454 | 3300005434 | Bacteria | 1280 |
| 51 | Ga0070714_100008555 | 3300005435 | Bacteria | 8002 |
| 52 | Ga0070714_100131613 | 3300005435 | Bacteria | 2236 |
| 53 | Ga0070713_100019191 | 3300005436 | Bacteria | 5213 |
| 54 | Ga0070713_100037066 | 3300005436 | Bacteria | 3940 |
| 55 | Ga0070713_100299752 | 3300005436 | Bacteria | 1479 |
| 56 | Ga0070713_100409465 | 3300005436 | Bacteria | 1268 |
| 57 | Ga0070710_10001142 | 3300005437 | Bacteria | 12591 |
| 58 | Ga0070710_10006248 | 3300005437 | Bacteria | 5707 |
| 59 | Ga0070710_10019748 | 3300005437 | Bacteria | 3487 |
| 60 | Ga0070710_10036310 | 3300005437 | Bacteria | 2694 |
| 61 | Ga0070711_100019946 | 3300005439 | Bacteria | 4311 |
| 62 | Ga0070711_100063410 | 3300005439 | Bacteria | 2579 |
| 63 | Ga0070711_100067138 | 3300005439 | Bacteria | 2515 |
| 64 | Ga0070711_100081581 | 3300005439 | Bacteria | 2305 |
| 65 | Ga0070711_100311184 | 3300005439 | Bacteria | 1255 |
| 66 | Ga0070705_100009661 | 3300005440 | Bacteria | 4802 |
| 67 | Ga0070705_100063932 | 3300005440 | Bacteria | 2196 |
| 68 | Ga0070700_100015753 | 3300005441 | Bacteria | 4294 |
| 69 | Ga0070700_100027635 | 3300005441 | Bacteria | 3366 |
| 70 | Ga0070694_100034977 | 3300005444 | Bacteria | 3317 |
| 71 | Ga0070694_100261197 | 3300005444 | Bacteria | 1313 |
| 72 | Ga0070708_100007434 | 3300005445 | Bacteria | 8769 |
| 73 | Ga0070708_100020711 | 3300005445 | Bacteria | 5552 |
| 74 | Ga0070708_100182397 | 3300005445 | Bacteria | 1962 |
| 75 | Ga0070663_100020914 | 3300005455 | Bacteria | 4341 |
| 76 | Ga0070663_100028191 | 3300005455 | Bacteria | 3820 |
| 77 | Ga0070663_100059005 | 3300005455 | Bacteria | 2757 |
| 78 | Ga0070663_100118670 | 3300005455 | Bacteria | 1996 |
| 79 | Ga0070678_100033574 | 3300005456 | Bacteria | 3564 |
| 80 | Ga0070662_100015453 | 3300005457 | Bacteria | 5113 |
| 81 | Ga0068867_100036674 | 3300005459 | Bacteria | 3561 |
| 82 | Ga0070706_100002194 | 3300005467 | Bacteria | 19879 |
| 83 | Ga0070707_100000797 | 3300005468 | Bacteria | 31116 |
| 84 | Ga0070707_100008194 | 3300005468 | Bacteria | 9694 |
| 85 | Ga0070707_100020466 | 3300005468 | Bacteria | 6241 |
| 86 | Ga0070707_100141535 | 3300005468 | Bacteria | 2341 |
| 87 | Ga0070698_100009098 | 3300005471 | Bacteria | 10673 |
| 88 | Ga0070698_100029267 | 3300005471 | Bacteria | 5716 |
| 89 | Ga0070698_100075960 | 3300005471 | Bacteria | 3363 |
| 90 | Ga0070679_100120416 | 3300005530 | Bacteria | 2609 |
| 91 | Ga0070679_100189928 | 3300005530 | Bacteria | 2024 |
| 92 | Ga0070684_100056845 | 3300005535 | Bacteria | 3415 |
| 93 | Ga0070684_100060064 | 3300005535 | Bacteria | 3324 |
| 94 | Ga0068853_100017673 | 3300005539 | Bacteria | 5885 |
| 95 | Ga0068853_100029972 | 3300005539 | Bacteria | 4592 |
| 96 | Ga0068853_100038126 | 3300005539 | Bacteria | 4092 |
| 97 | Ga0068853_100091382 | 3300005539 | Bacteria | 2677 |
| 98 | Ga0068853_100106147 | 3300005539 | Bacteria | 2489 |
| 99 | Ga0070686_100263802 | 3300005544 | Bacteria | 1263 |
| 100 | Ga0070695_100023722 | 3300005545 | Bacteria | 3776 |
| 101 | Ga0070696_100052238 | 3300005546 | Bacteria | 2843 |
| 102 | Ga0070696_100096784 | 3300005546 | Bacteria | 2109 |
| 103 | Ga0070693_100214599 | 3300005547 | Bacteria | 1257 |
| 104 | Ga0070665_100018725 | 3300005548 | Bacteria | 6942 |
| 105 | Ga0070665_100019294 | 3300005548 | Bacteria | 6841 |
| 106 | Ga0070665_100024659 | 3300005548 | Bacteria | 6061 |
| 107 | Ga0070665_100035428 | 3300005548 | Bacteria | 5018 |
| 108 | Ga0070665_100059445 | 3300005548 | Bacteria | 3831 |
| 109 | Ga0070665_100096541 | 3300005548 | Bacteria | 2960 |
| 110 | Ga0070665_100372118 | 3300005548 | Bacteria | 1436 |
| 111 | Ga0070665_100619275 | 3300005548 | Bacteria | 1095 |
| 112 | Ga0070704_100001394 | 3300005549 | Bacteria | 12855 |
| 113 | Ga0070704_100014558 | 3300005549 | Bacteria | 4915 |
| 114 | Ga0068855_100024676 | 3300005563 | Bacteria | 7192 |
| 115 | Ga0068855_100282731 | 3300005563 | Bacteria | 1842 |
| 116 | Ga0068855_100607443 | 3300005563 | Bacteria | 1179 |
| 117 | Ga0070664_100018762 | 3300005564 | Bacteria | 5690 |
| 118 | Ga0068857_100002430 | 3300005577 | Bacteria | 15206 |
| 119 | Ga0068857_100119859 | 3300005577 | Bacteria | 2368 |
| 120 | Ga0068854_100034070 | 3300005578 | Bacteria | 3554 |
| 121 | Ga0068856_100040713 | 3300005614 | Bacteria | 4564 |
| 122 | Ga0068856_100102506 | 3300005614 | Bacteria | 2855 |
| 123 | Ga0068856_100159916 | 3300005614 | Bacteria | 2263 |
| 124 | Ga0070702_100148572 | 3300005615 | Bacteria | 1501 |
| 125 | Ga0068852_100045022 | 3300005616 | Bacteria | 3751 |
| 126 | Ga0068852_100105101 | 3300005616 | Bacteria | 2557 |
| 127 | Ga0068859_100004797 | 3300005617 | Bacteria | 13764 |
| 128 | Ga0068859_100016504 | 3300005617 | Bacteria | 7414 |
| 129 | Ga0068859_100047711 | 3300005617 | Bacteria | 4303 |
| 130 | Ga0068864_100159003 | 3300005618 | Bacteria | 2053 |
| 131 | Ga0068866_10000565 | 3300005718 | Bacteria | 16831 |
| 132 | Ga0068866_10116007 | 3300005718 | Bacteria | 1501 |
| 133 | Ga0068861_100022577 | 3300005719 | Bacteria | 4535 |
| 134 | Ga0068861_100033200 | 3300005719 | Bacteria | 3805 |
| 135 | Ga0068861_100048315 | 3300005719 | Bacteria | 3216 |
| 136 | Ga0068861_100053692 | 3300005719 | Bacteria | 3067 |
| 137 | Ga0068861_100242180 | 3300005719 | Bacteria | 1534 |
| 138 | Ga0068851_10000009 | 3300005834 | Bacteria | 217844 |
| 139 | Ga0068851_10045682 | 3300005834 | Bacteria | 2214 |
| 140 | Ga0068851_10063347 | 3300005834 | Bacteria | 1899 |
| 141 | Ga0068870_10099674 | 3300005840 | Bacteria | 1639 |
| 142 | Ga0068863_100000699 | 3300005841 | Bacteria | 33727 |
| 143 | Ga0068863_100007296 | 3300005841 | Bacteria | 10826 |
| 144 | Ga0068863_100110113 | 3300005841 | Bacteria | 2622 |
| 145 | Ga0068858_100025787 | 3300005842 | Bacteria | 5467 |
| 146 | Ga0068858_100028712 | 3300005842 | Bacteria | 5166 |
| 147 | Ga0068858_100130375 | 3300005842 | Bacteria | 2357 |
| 148 | Ga0068858_100288373 | 3300005842 | Bacteria | 1564 |
| 149 | Ga0068860_100000038 | 3300005843 | Bacteria | 232936 |
| 150 | Ga0068860_100057127 | 3300005843 | Bacteria | 3709 |
| 151 | Ga0068860_100091101 | 3300005843 | Bacteria | 2905 |
| 152 | Ga0068862_100000064 | 3300005844 | Bacteria | 124473 |
| 153 | Ga0068862_100004446 | 3300005844 | Bacteria | 11831 |
| 154 | Ga0068862_100023337 | 3300005844 | Bacteria | 5183 |
| 155 | Ga0081455_10080041 | 3300005937 | Bacteria | 2680 |
| 156 | Ga0070717_10065723 | 3300006028 | Bacteria | 3015 |
| 157 | Ga0070717_10069795 | 3300006028 | Bacteria | 2927 |
| 158 | Ga0070717_10108770 | 3300006028 | Bacteria | 2362 |
| 159 | Ga0075365_10010713 | 3300006038 | Bacteria | 5355 |
| 160 | Ga0075365_10050477 | 3300006038 | Bacteria | 2744 |
| 161 | Ga0075365_10069567 | 3300006038 | Bacteria | 2366 |
| 162 | Ga0075365_10196945 | 3300006038 | Bacteria | 1411 |
| 163 | Ga0075365_10262795 | 3300006038 | Bacteria | 1214 |
| 164 | Ga0075363_100000604 | 3300006048 | Bacteria | 11855 |
| 165 | Ga0075363_100000810 | 3300006048 | Bacteria | 10822 |
| 166 | Ga0075363_100015203 | 3300006048 | Bacteria | 3778 |
| 167 | Ga0075363_100093533 | 3300006048 | Bacteria | 1657 |
| 168 | Ga0075363_100127560 | 3300006048 | Bacteria | 1425 |
| 169 | Ga0075364_10013507 | 3300006051 | Bacteria | 5023 |
| 170 | Ga0075364_10014035 | 3300006051 | Bacteria | 4941 |
| 171 | Ga0075364_10031738 | 3300006051 | Bacteria | 3394 |
| 172 | Ga0075364_10047048 | 3300006051 | Bacteria | 2809 |
| 173 | Ga0075364_10074510 | 3300006051 | Bacteria | 2238 |
| 174 | Ga0075364_10101518 | 3300006051 | Bacteria | 1915 |
| 175 | Ga0075364_10128235 | 3300006051 | Bacteria | 1702 |
| 176 | Ga0070715_10006170 | 3300006163 | Bacteria | 4056 |
| 177 | Ga0070715_10009036 | 3300006163 | Bacteria | 3498 |
| 178 | Ga0070716_100009647 | 3300006173 | Bacteria | 4816 |
| 179 | Ga0070716_100053789 | 3300006173 | Bacteria | 2297 |
| 180 | Ga0070716_100059650 | 3300006173 | Bacteria | 2200 |
| 181 | Ga0070712_100026615 | 3300006175 | Bacteria | 3855 |
| 182 | Ga0070712_100027713 | 3300006175 | Bacteria | 3785 |
| 183 | Ga0070712_100034513 | 3300006175 | Bacteria | 3429 |
| 184 | Ga0075367_10224570 | 3300006178 | Bacteria | 1176 |
| 185 | Ga0075369_10001174 | 3300006186 | Bacteria | 8855 |
| 186 | Ga0075369_10009406 | 3300006186 | Bacteria | 3795 |
| 187 | Ga0075369_10028775 | 3300006186 | Bacteria | 2331 |
| 188 | Ga0075369_10034319 | 3300006186 | Bacteria | 2153 |
| 189 | Ga0075370_10013976 | 3300006353 | Bacteria | 4274 |
| 190 | Ga0075370_10037088 | 3300006353 | Bacteria | 2740 |
| 191 | Ga0068871_100020112 | 3300006358 | Bacteria | 5108 |
| 192 | Ga0068871_100214564 | 3300006358 | Bacteria | 1666 |
| 193 | Ga0075428_100002613 | 3300006844 | Bacteria | 19607 |
| 194 | Ga0075430_100017367 | 3300006846 | Bacteria | 6128 |
| 195 | Ga0075430_100050723 | 3300006846 | Bacteria | 3498 |
| 196 | Ga0068865_100031272 | 3300006881 | Bacteria | 3548 |
| 197 | Ga0068865_100298468 | 3300006881 | Bacteria | 1289 |
| 198 | Ga0097620_100004797 | 3300006931 | Bacteria | 13764 |
| 199 | Ga0097620_100016503 | 3300006931 | Bacteria | 7414 |
| 200 | Ga0097620_100047713 | 3300006931 | Bacteria | 4303 |
| 201 | Ga0105245_10029659 | 3300009098 | Bacteria | 4835 |
| 202 | Ga0105245_10047438 | 3300009098 | Bacteria | 3840 |
| 203 | Ga0105245_10183001 | 3300009098 | Bacteria | 2003 |
| 204 | Ga0105247_10000021 | 3300009101 | Bacteria | 229443 |
| 205 | Ga0105247_10001116 | 3300009101 | Bacteria | 20000 |
| 206 | Ga0105247_10003213 | 3300009101 | Bacteria | 10761 |
| 207 | Ga0105247_10012840 | 3300009101 | Bacteria | 5027 |
| 208 | Ga0105247_10015303 | 3300009101 | Bacteria | 4597 |
| 209 | Ga0105247_10103699 | 3300009101 | Bacteria | 1821 |
| 210 | Ga0114129_10012530 | 3300009147 | Bacteria | 12074 |
| 211 | Ga0105243_10001479 | 3300009148 | Bacteria | 20609 |
| 212 | Ga0105243_10221916 | 3300009148 | Bacteria | 1671 |
| 213 | Ga0105241_10039510 | 3300009174 | Bacteria | 3559 |
| 214 | Ga0105242_10055802 | 3300009176 | Bacteria | 3232 |
| 215 | Ga0105248_10002026 | 3300009177 | Bacteria | 22472 |
| 216 | Ga0105248_10011195 | 3300009177 | Bacteria | 9893 |
| 217 | Ga0105248_10082701 | 3300009177 | Bacteria | 3611 |
| 218 | Ga0105237_10040735 | 3300009545 | Bacteria | 4684 |
| 219 | Ga0105237_10058109 | 3300009545 | Bacteria | 3871 |
| 220 | Ga0105238_10003262 | 3300009551 | Bacteria | 16190 |
| 221 | Ga0105249_10000334 | 3300009553 | Bacteria | 47607 |
| 222 | Ga0105249_10021666 | 3300009553 | Bacteria | 5754 |
| 223 | Ga0105249_10091434 | 3300009553 | Bacteria | 2847 |
| 224 | Ga0105239_10032795 | 3300010375 | Bacteria | 5707 |
| 225 | Ga0105246_10013157 | 3300011119 | Bacteria | 5180 |
| 226 | Ga0105246_10094654 | 3300011119 | Bacteria | 2161 |
| 227 | Ga0105246_10103048 | 3300011119 | Bacteria | 2082 |
| 228 | Ga0105246_10156933 | 3300011119 | Bacteria | 1729 |
| 229 | Ga0157373_10062462 | 3300013100 | Bacteria | 2638 |
| 230 | Ga0157370_10080037 | 3300013104 | Bacteria | 3077 |
| 231 | Ga0157369_10003733 | 3300013105 | Bacteria | 18085 |
| 232 | Ga0157369_10105887 | 3300013105 | Bacteria | 2994 |
| 233 | Ga0157369_10275444 | 3300013105 | Bacteria | 1753 |
| 234 | Ga0157369_10361930 | 3300013105 | Bacteria | 1506 |
| 235 | Ga0157374_10058281 | 3300013296 | Bacteria | 3608 |
| 236 | Ga0157374_10441268 | 3300013296 | Bacteria | 1302 |
| 237 | Ga0157378_10019079 | 3300013297 | Bacteria | 6025 |
| 238 | Ga0157378_10090946 | 3300013297 | Bacteria | 2774 |
| 239 | Ga0163162_10377156 | 3300013306 | Bacteria | 1551 |
| 240 | Ga0157372_10037399 | 3300013307 | Bacteria | 5355 |
| 241 | Ga0157372_10075895 | 3300013307 | Bacteria | 3794 |
| 242 | Ga0163163_10053751 | 3300014325 | Bacteria | 3977 |
| 243 | Ga0163163_10062868 | 3300014325 | Bacteria | 3679 |
| 244 | Ga0163163_10084778 | 3300014325 | Bacteria | 3175 |
| 245 | Ga0163163_10142678 | 3300014325 | Bacteria | 2438 |
| 246 | Ga0157380_10481514 | 3300014326 | Bacteria | 1200 |
| 247 | Ga0157377_10024886 | 3300014745 | Bacteria | 3186 |
| 248 | Ga0157379_10027248 | 3300014968 | Bacteria | 5087 |
| 249 | Ga0157376_10237576 | 3300014969 | Bacteria | 1696 |
| 250 | Ga0163161_10061013 | 3300017792 | Bacteria | 2745 |
| 251 | Ga0163161_10061026 | 3300017792 | Bacteria | 2745 |
| 252 | Ga0163161_10068721 | 3300017792 | Bacteria | 2589 |
| 253 | Ga0163161_10280799 | 3300017792 | Bacteria | 1306 |
| 254 | Ga0206354_10328917 | 3300020081 | Bacteria | 1628 |
| 255 | Ga0213875_10002999 | 3300021388 | Bacteria | 9818 |
| 256 | Ga0224572_1000605 | 3300024225 | Bacteria | 4451 |
| 257 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 258 | Ga0209437_100578 | 3300025233 | Bacteria | 23500 |
| 259 | Ga0209646_1000041 | 3300025246 | Bacteria | 346024 |
| 260 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 261 | Ga0209673_1017156 | 3300025273 | Bacteria | 2676 |
| 262 | Ga0209051_1000237 | 3300025303 | Bacteria | 92688 |
| 263 | Ga0209051_1003846 | 3300025303 | Bacteria | 9608 |
| 264 | Ga0209051_1004986 | 3300025303 | Bacteria | 7925 |
| 265 | Ga0209051_1040505 | 3300025303 | Bacteria | 1669 |
| 266 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 267 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 268 | Ga0207656_10000004 | 3300025321 | Bacteria | 632320 |
| 269 | Ga0207656_10026127 | 3300025321 | Bacteria | 2377 |
| 270 | Ga0207655_1020411 | 3300025728 | Bacteria | 3406 |
| 271 | Ga0207653_10006394 | 3300025885 | Bacteria | 3675 |
| 272 | Ga0207692_10004112 | 3300025898 | Bacteria | 5740 |
| 273 | Ga0207692_10005379 | 3300025898 | Bacteria | 5129 |
| 274 | Ga0207692_10077885 | 3300025898 | Bacteria | 1765 |
| 275 | Ga0207642_10002868 | 3300025899 | Bacteria | 5387 |
| 276 | Ga0207710_10000027 | 3300025900 | Bacteria | 307001 |
| 277 | Ga0207710_10013676 | 3300025900 | Bacteria | 3415 |
| 278 | Ga0207710_10027108 | 3300025900 | Bacteria | 2479 |
| 279 | Ga0207688_10000922 | 3300025901 | Bacteria | 14852 |
| 280 | Ga0207688_10003057 | 3300025901 | Bacteria | 9123 |
| 281 | Ga0207680_10241954 | 3300025903 | Bacteria | 1244 |
| 282 | Ga0207647_10020846 | 3300025904 | Bacteria | 4387 |
| 283 | Ga0207685_10059435 | 3300025905 | Bacteria | 1508 |
| 284 | Ga0207699_10002118 | 3300025906 | Bacteria | 9378 |
| 285 | Ga0207699_10029376 | 3300025906 | Bacteria | 3065 |
| 286 | Ga0207699_10030600 | 3300025906 | Bacteria | 3014 |
| 287 | Ga0207699_10054340 | 3300025906 | Bacteria | 2378 |
| 288 | Ga0207699_10179620 | 3300025906 | Bacteria | 1422 |
| 289 | Ga0207645_10091931 | 3300025907 | Bacteria | 1952 |
| 290 | Ga0207684_10004078 | 3300025910 | Bacteria | 13937 |
| 291 | Ga0207684_10090586 | 3300025910 | Bacteria | 2606 |
| 292 | Ga0207684_10235250 | 3300025910 | Bacteria | 1580 |
| 293 | Ga0207707_10001233 | 3300025912 | Bacteria | 23993 |
| 294 | Ga0207707_10121855 | 3300025912 | Bacteria | 2280 |
| 295 | Ga0207695_10252398 | 3300025913 | Bacteria | 1663 |
| 296 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 297 | Ga0207693_10001596 | 3300025915 | Bacteria | 20037 |
| 298 | Ga0207693_10039485 | 3300025915 | Bacteria | 3717 |
| 299 | Ga0207693_10194033 | 3300025915 | Bacteria | 1598 |
| 300 | Ga0207693_10220849 | 3300025915 | Bacteria | 1489 |
| 301 | Ga0207663_10009087 | 3300025916 | Bacteria | 5237 |
| 302 | Ga0207663_10113362 | 3300025916 | Bacteria | 1843 |
| 303 | Ga0207663_10176184 | 3300025916 | Bacteria | 1523 |
| 304 | Ga0207663_10252700 | 3300025916 | Bacteria | 1298 |
| 305 | Ga0207660_10140091 | 3300025917 | Bacteria | 1849 |
| 306 | Ga0207662_10022056 | 3300025918 | Bacteria | 3645 |
| 307 | Ga0207662_10108415 | 3300025918 | Bacteria | 1729 |
| 308 | Ga0207657_10023227 | 3300025919 | Bacteria | 5779 |
| 309 | Ga0207657_10031119 | 3300025919 | Bacteria | 4838 |
| 310 | Ga0207657_10060693 | 3300025919 | Bacteria | 3244 |
| 311 | Ga0207652_10103837 | 3300025921 | Bacteria | 2513 |
| 312 | Ga0207646_10000388 | 3300025922 | Bacteria | 59041 |
| 313 | Ga0207646_10032085 | 3300025922 | Bacteria | 4753 |
| 314 | Ga0207681_10070177 | 3300025923 | Bacteria | 2439 |
| 315 | Ga0207694_10083028 | 3300025924 | Bacteria | 2519 |
| 316 | Ga0207650_10198634 | 3300025925 | Bacteria | 1605 |
| 317 | Ga0207687_10015909 | 3300025927 | Bacteria | 4936 |
| 318 | Ga0207687_10030610 | 3300025927 | Bacteria | 3630 |
| 319 | Ga0207687_10042236 | 3300025927 | Bacteria | 3136 |
| 320 | Ga0207687_10102836 | 3300025927 | Bacteria | 2106 |
| 321 | Ga0207700_10015175 | 3300025928 | Bacteria | 5069 |
| 322 | Ga0207700_10021101 | 3300025928 | Bacteria | 4440 |
| 323 | Ga0207700_10052340 | 3300025928 | Bacteria | 3052 |
| 324 | Ga0207664_10012165 | 3300025929 | Bacteria | 6148 |
| 325 | Ga0207664_10034251 | 3300025929 | Bacteria | 3910 |
| 326 | Ga0207664_10059246 | 3300025929 | Bacteria | 3048 |
| 327 | Ga0207664_10069122 | 3300025929 | Bacteria | 2839 |
| 328 | Ga0207664_10126118 | 3300025929 | Bacteria | 2149 |
| 329 | Ga0207664_10159812 | 3300025929 | Bacteria | 1921 |
| 330 | Ga0207644_10019771 | 3300025931 | Bacteria | 4572 |
| 331 | Ga0207644_10128527 | 3300025931 | Bacteria | 1937 |
| 332 | Ga0207690_10029858 | 3300025932 | Bacteria | 3471 |
| 333 | Ga0207690_10071197 | 3300025932 | Bacteria | 2397 |
| 334 | Ga0207706_10027634 | 3300025933 | Bacteria | 5072 |
| 335 | Ga0207706_10114659 | 3300025933 | Bacteria | 2370 |
| 336 | Ga0207709_10007028 | 3300025935 | Bacteria | 6293 |
| 337 | Ga0207709_10032046 | 3300025935 | Bacteria | 3075 |
| 338 | Ga0207709_10264526 | 3300025935 | Bacteria | 1263 |
| 339 | Ga0207670_10149624 | 3300025936 | Bacteria | 1731 |
| 340 | Ga0207669_10003219 | 3300025937 | Bacteria | 7057 |
| 341 | Ga0207669_10043311 | 3300025937 | Bacteria | 2636 |
| 342 | Ga0207669_10054244 | 3300025937 | Bacteria | 2420 |
| 343 | Ga0207669_10190042 | 3300025937 | Bacteria | 1480 |
| 344 | Ga0207704_10048508 | 3300025938 | Bacteria | 2546 |
| 345 | Ga0207665_10016340 | 3300025939 | Bacteria | 4873 |
| 346 | Ga0207665_10029532 | 3300025939 | Bacteria | 3623 |
| 347 | Ga0207665_10049646 | 3300025939 | Bacteria | 2820 |
| 348 | Ga0207665_10062015 | 3300025939 | Bacteria | 2536 |
| 349 | Ga0207711_10001437 | 3300025941 | Bacteria | 22270 |
| 350 | Ga0207689_10006927 | 3300025942 | Bacteria | 9970 |
| 351 | Ga0207689_10012303 | 3300025942 | Bacteria | 7323 |
| 352 | Ga0207689_10026243 | 3300025942 | Bacteria | 4878 |
| 353 | Ga0207661_10129681 | 3300025944 | Bacteria | 2158 |
| 354 | Ga0207679_10014500 | 3300025945 | Bacteria | 5184 |
| 355 | Ga0207667_10006383 | 3300025949 | Bacteria | 14295 |
| 356 | Ga0207667_10380504 | 3300025949 | Bacteria | 1438 |
| 357 | Ga0207651_10224550 | 3300025960 | Bacteria | 1521 |
| 358 | Ga0207712_10000282 | 3300025961 | Bacteria | 48535 |
| 359 | Ga0207712_10122550 | 3300025961 | Bacteria | 1969 |
| 360 | Ga0207668_10000676 | 3300025972 | Bacteria | 20961 |
| 361 | Ga0207640_10029516 | 3300025981 | Bacteria | 3367 |
| 362 | Ga0207640_10164446 | 3300025981 | Bacteria | 1646 |
| 363 | Ga0207658_10000716 | 3300025986 | Bacteria | 28697 |
| 364 | Ga0207658_10012804 | 3300025986 | Bacteria | 5728 |
| 365 | Ga0207658_10025959 | 3300025986 | Bacteria | 4104 |
| 366 | Ga0207658_10134872 | 3300025986 | Bacteria | 1989 |
| 367 | Ga0207658_10146244 | 3300025986 | Bacteria | 1920 |
| 368 | Ga0207677_10045644 | 3300026023 | Bacteria | 2927 |
| 369 | Ga0207677_10370676 | 3300026023 | Bacteria | 1205 |
| 370 | Ga0207703_10015313 | 3300026035 | Bacteria | 5982 |
| 371 | Ga0207703_10086482 | 3300026035 | Bacteria | 2626 |
| 372 | Ga0207703_10583677 | 3300026035 | Bacteria | 1056 |
| 373 | Ga0207639_10006233 | 3300026041 | Bacteria | 8103 |
| 374 | Ga0207639_10187907 | 3300026041 | Bacteria | 1762 |
| 375 | Ga0207639_10434399 | 3300026041 | Bacteria | 1189 |
| 376 | Ga0207678_10013423 | 3300026067 | Bacteria | 7191 |
| 377 | Ga0207678_10031803 | 3300026067 | Bacteria | 4601 |
| 378 | Ga0207678_10034759 | 3300026067 | Bacteria | 4390 |
| 379 | Ga0207678_10060056 | 3300026067 | Bacteria | 3271 |
| 380 | Ga0207678_10069407 | 3300026067 | Bacteria | 3022 |
| 381 | Ga0207678_10098328 | 3300026067 | Bacteria | 2500 |
| 382 | Ga0207708_10018119 | 3300026075 | Bacteria | 5299 |
| 383 | Ga0207708_10020792 | 3300026075 | Bacteria | 4951 |
| 384 | Ga0207708_10038560 | 3300026075 | Bacteria | 3639 |
| 385 | Ga0207708_10043918 | 3300026075 | Bacteria | 3406 |
| 386 | Ga0207702_10025122 | 3300026078 | Bacteria | 4942 |
| 387 | Ga0207702_10192713 | 3300026078 | Bacteria | 1884 |
| 388 | Ga0207641_10000162 | 3300026088 | Bacteria | 94111 |
| 389 | Ga0207641_10019863 | 3300026088 | Bacteria | 5512 |
| 390 | Ga0207641_10172973 | 3300026088 | Bacteria | 1973 |
| 391 | Ga0207648_10013316 | 3300026089 | Bacteria | 7658 |
| 392 | Ga0207648_10031243 | 3300026089 | Bacteria | 4708 |
| 393 | Ga0207648_10141307 | 3300026089 | Bacteria | 2122 |
| 394 | Ga0207648_10161045 | 3300026089 | Bacteria | 1982 |
| 395 | Ga0207676_10146585 | 3300026095 | Bacteria | 2028 |
| 396 | Ga0207674_10002645 | 3300026116 | Bacteria | 22384 |
| 397 | Ga0207674_10004411 | 3300026116 | Bacteria | 16954 |
| 398 | Ga0207675_100001865 | 3300026118 | Bacteria | 21103 |
| 399 | Ga0207675_100020258 | 3300026118 | Bacteria | 6201 |
| 400 | Ga0207675_100024098 | 3300026118 | Bacteria | 5658 |
| 401 | Ga0207675_100046925 | 3300026118 | Bacteria | 4035 |
| 402 | Ga0207683_10001241 | 3300026121 | Bacteria | 23130 |
| 403 | Ga0207683_10008352 | 3300026121 | Bacteria | 8855 |
| 404 | Ga0207683_10093339 | 3300026121 | Bacteria | 2682 |
| 405 | Ga0207683_10439482 | 3300026121 | Bacteria | 1202 |
| 406 | Ga0207698_10002468 | 3300026142 | Bacteria | 10969 |
| 407 | Ga0207698_10166665 | 3300026142 | Bacteria | 1934 |
| 408 | Ga0268266_10022876 | 3300028379 | Bacteria | 5319 |
| 409 | Ga0268266_10027973 | 3300028379 | Bacteria | 4794 |
| 410 | Ga0268266_10039795 | 3300028379 | Bacteria | 4005 |
| 411 | Ga0268266_10048967 | 3300028379 | Bacteria | 3622 |
| 412 | Ga0268266_10083616 | 3300028379 | Bacteria | 2786 |
| 413 | Ga0268266_10091557 | 3300028379 | Bacteria | 2666 |
| 414 | Ga0268266_10150250 | 3300028379 | Bacteria | 2099 |
| 415 | Ga0268265_10000028 | 3300028380 | Bacteria | 236467 |
| 416 | Ga0268264_10000092 | 3300028381 | Bacteria | 232950 |
| 417 | Ga0268264_10075912 | 3300028381 | Bacteria | 2859 |
| 418 | Ga0268264_10155019 | 3300028381 | Bacteria | 2058 |
| 419 | Ga0265337_1008139 | 3300028556 | Bacteria | 3843 |
| 420 | Ga0265326_10001409 | 3300028558 | Bacteria | 8463 |
| 421 | Ga0265319_1006104 | 3300028563 | Bacteria | 5639 |
| 422 | Ga0265334_10001883 | 3300028573 | Bacteria | 9960 |
| 423 | Ga0265323_10009658 | 3300028653 | Bacteria | 3930 |
| 424 | Ga0265336_10007199 | 3300028666 | Bacteria | 3971 |
| 425 | Ga0265338_10001519 | 3300028800 | Bacteria | 37467 |
| 426 | Ga0265338_10017078 | 3300028800 | Bacteria | 7843 |
| 427 | Ga0265332_10009991 | 3300031238 | Bacteria | 4227 |
| 428 | Ga0265320_10015573 | 3300031240 | Bacteria | 4293 |
| 429 | Ga0265329_10032895 | 3300031242 | Bacteria | 1679 |
| 430 | Ga0265340_10009267 | 3300031247 | Bacteria | 5287 |
| 431 | Ga0265340_10023771 | 3300031247 | Bacteria | 3121 |
| 432 | Ga0265339_10037623 | 3300031249 | Bacteria | 2704 |
| 433 | Ga0265316_10037167 | 3300031344 | Bacteria | 3933 |
| 434 | Ga0307513_10003355 | 3300031456 | Bacteria | 21745 |
| 435 | Ga0265342_10009280 | 3300031712 | Bacteria | 6948 |
| 436 | Ga0307405_10050783 | 3300031731 | Bacteria | 2570 |
| 437 | Ga0307405_10108608 | 3300031731 | Bacteria | 1875 |
| 438 | Ga0307413_10132531 | 3300031824 | Bacteria | 1708 |
| 439 | Ga0307518_10120711 | 3300031838 | Bacteria | 1855 |
| 440 | Ga0307410_10168617 | 3300031852 | Bacteria | 1647 |
| 441 | Ga0307410_10228907 | 3300031852 | Bacteria | 1434 |
| 442 | Ga0307406_10000084 | 3300031901 | Bacteria | 52931 |
| 443 | Ga0307406_10000462 | 3300031901 | Bacteria | 23513 |
| 444 | Ga0307406_10057378 | 3300031901 | Bacteria | 2497 |
| 445 | Ga0307406_10091403 | 3300031901 | Bacteria | 2050 |
| 446 | Ga0307407_10026016 | 3300031903 | Bacteria | 3094 |
| 447 | Ga0307412_10106985 | 3300031911 | Bacteria | 1990 |
| 448 | Ga0307416_100294501 | 3300032002 | Bacteria | 1609 |
| 449 | Ga0307415_100228548 | 3300032126 | Bacteria | 1497 |
| 450 | Ga0307507_10000024 | 3300033179 | Bacteria | 212340 |
| 451 | Ga0373950_0007108 | 3300034818 | Bacteria | 1729 |
| 452 | Ga0373938_0011598 | 3300034957 | Bacteria | 1641 |
| 453 | Ga0373926_0000308 | 3300035083 | Bacteria | 12100 |
| 454 | Ga0373926_0000572 | 3300035083 | Bacteria | 9910 |
| 455 | Ga0373934_0002402 | 3300035086 | Bacteria | 6894 |
| 456 | Ga0373934_0014375 | 3300035086 | Bacteria | 2999 |
| 457 | Ga0373934_0018534 | 3300035086 | Bacteria | 2664 |
| 458 | Ga0373934_0030783 | 3300035086 | Bacteria | 2099 |
| 459 | Ga0373944_0001289 | 3300035089 | Bacteria | 6304 |
| 460 | Ga0373944_0002647 | 3300035089 | Bacteria | 4561 |
| 461 | Ga0373923_0000037 | 3300035111 | Bacteria | 20215 |
| 462 | Ga0373923_0004663 | 3300035111 | Bacteria | 4569 |
| 463 | Ga0373923_0041955 | 3300035111 | Bacteria | 1888 |
| 464 | Ga0373932_0043171 | 3300035112 | Bacteria | 1310 |
| 465 | Ga0373936_0000921 | 3300035113 | Bacteria | 10503 |
| 466 | Ga0373936_0001261 | 3300035113 | Bacteria | 9145 |
| 467 | Ga0373936_0001862 | 3300035113 | Bacteria | 7781 |
| 468 | Ga0373945_0000101 | 3300035116 | Bacteria | 20325 |
| 469 | Ga0373945_0000452 | 3300035116 | Bacteria | 11540 |
| 470 | Ga0373953_0000140 | 3300035117 | Bacteria | 18157 |
| 471 | Ga0373953_0004506 | 3300035117 | Bacteria | 4447 |
| 472 | Ga0373954_0002617 | 3300035118 | Bacteria | 7572 |
| 473 | Ga0373954_0035972 | 3300035118 | Bacteria | 2297 |
| 474 | Ga0373956_0002157 | 3300035119 | Bacteria | 8132 |
| 475 | Ga0373956_0009951 | 3300035119 | Bacteria | 3878 |
| 476 | Ga0373956_0010810 | 3300035119 | Bacteria | 3748 |
| 477 | Ga0373956_0023376 | 3300035119 | Bacteria | 2652 |
| 478 | Ga0373957_0000138 | 3300035120 | Bacteria | 18132 |
| 479 | Ga0373957_0001974 | 3300035120 | Bacteria | 5722 |
| 480 | Ga0373957_0003438 | 3300035120 | Bacteria | 4680 |
| 481 | Ga0373943_0000883 | 3300035170 | Bacteria | 13196 |
| 482 | Ga0373943_0003303 | 3300035170 | Bacteria | 7326 |
| 483 | Ga0373946_0000138 | 3300035171 | Bacteria | 22000 |
| 484 | Ga0373946_0010368 | 3300035171 | Bacteria | 3447 |
| 485 | Ga0373955_0000415 | 3300035172 | Bacteria | 18168 |
| 486 | Ga0373955_0007386 | 3300035172 | Bacteria | 5050 |
| 487 | Ga0373955_0013813 | 3300035172 | Bacteria | 3917 |
| 488 | Ga0373955_0016657 | 3300035172 | Bacteria | 3621 |
| 489 | Ga0373955_0048523 | 3300035172 | Bacteria | 2303 |
| 490 | Ga0373962_0026856 | 3300035242 | Bacteria | 1554 |
| 491 | Ga0373924_0002394 | 3300035410 | Bacteria | 6310 |
| 492 | Ga0373924_0006229 | 3300035410 | Bacteria | 4266 |
| 493 | Ga0373924_0048114 | 3300035410 | Bacteria | 1760 |
| 494 | Ga0373931_0003677 | 3300035691 | Bacteria | 6937 |
| 495 | Ga0373931_0024198 | 3300035691 | Bacteria | 3074 |
| 496 | Ga0373935_0001284 | 3300035692 | Bacteria | 13839 |
| 497 | Ga0373935_0004857 | 3300035692 | Bacteria | 7896 |
| 498 | Ga0373935_0004930 | 3300035692 | Bacteria | 7845 |
| 499 | Ga0373935_0016881 | 3300035692 | Bacteria | 4420 |
| 500 | Ga0373927_0018145 | 3300035695 | Bacteria | 4627 |
| 501 | Ga0373933_0000901 | 3300035724 | Bacteria | 18165 |
| 502 | Ga0373933_0004119 | 3300035724 | Bacteria | 8013 |
| 503 | Ga0373933_0006224 | 3300035724 | Bacteria | 6494 |
| 504 | Ga0373933_0022301 | 3300035724 | Bacteria | 3604 |
| 505 | Ga0373933_0024095 | 3300035724 | Bacteria | 3484 |
| 506 | Ga0373933_0032598 | 3300035724 | Bacteria | 3028 |
| 507 | Ga0373933_0055111 | 3300035724 | Bacteria | 2384 |
| 508 | Ga0373933_0211598 | 3300035724 | Bacteria | 1242 |
| 509 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 510 | Ga0373947_0000959 | 3300035725 | Bacteria | 17573 |
| 511 | Ga0373947_0036554 | 3300035725 | Bacteria | 2912 |
| 512 | Ga0373947_0194624 | 3300035725 | Bacteria | 1324 |
| 513 | Ga0373937_0003579 | 3300036401 | Bacteria | 13095 |
| 514 | Ga0373937_0027975 | 3300036401 | Bacteria | 5100 |
| 515 | Ga0373937_0042516 | 3300036401 | Bacteria | 4146 |
| 516 | Ga0373937_0049421 | 3300036401 | Bacteria | 3851 |
| 517 | Ga0373937_0055905 | 3300036401 | Bacteria | 3623 |
| 518 | Ga0373937_0060064 | 3300036401 | Bacteria | 3493 |
| 519 | Ga0373937_0097544 | 3300036401 | Bacteria | 2726 |
| 520 | Ga0373937_0243479 | 3300036401 | Bacteria | 1694 |
| 521 | Ga0373937_0251759 | 3300036401 | Bacteria | 1665 |
| 522 | Ga0373937_0309846 | 3300036401 | Bacteria | 1493 |
| 523 | Ga0373937_0409301 | 3300036401 | Bacteria | 1287 |
| 524 | Ga0373925_0000515 | 3300037068 | Bacteria | 38779 |
| 525 | Ga0373925_0009562 | 3300037068 | Bacteria | 7061 |
| 526 | Ga0373925_0010139 | 3300037068 | Bacteria | 6840 |
| 527 | Ga0373925_0160652 | 3300037068 | Bacteria | 1769 |
| 528 | Ga0395898_0156465 | 3300037466 | Bacteria | 2180 |
| 529 | Ga0436364_0209397 | 3300037853 | Bacteria | 1590 |
| 530 | Ga0436364_0262372 | 3300037853 | Bacteria | 9734 |
| 531 | Ga0436365_1192272 | 3300039437 | Bacteria | 6135 |
| 532 | Ga0439466_0002551 | 3300041411 | Bacteria | 7133 |
| 533 | Ga0439466_0007096 | 3300041411 | Bacteria | 4241 |
| 534 | Ga0439465_0005845 | 3300041413 | Bacteria | 3916 |
| 535 | Ga0439465_0007508 | 3300041413 | Bacteria | 3466 |
| 536 | Ga0439465_0010776 | 3300041413 | Bacteria | 2868 |
| 537 | Ga0439465_0018753 | 3300041413 | Bacteria | 2161 |
| 538 | Ga0451795_0736678 | 3300041456 | Bacteria | 1241 |
| 539 | Ga0439431_0005291 | 3300041997 | Bacteria | 2847 |
| 540 | Ga0439445_0001683 | 3300042004 | Bacteria | 4846 |
| 541 | Ga0466972_0137762 | 3300044658 | Bacteria | 1149 |
| 542 | Ga0466965_0002722 | 3300044683 | Bacteria | 7576 |
| 543 | Ga0466961_0126498 | 3300044693 | Bacteria | 1603 |
| 544 | Ga0466968_0008136 | 3300044735 | Bacteria | 4010 |
| 545 | Ga0466968_0033015 | 3300044735 | Bacteria | 2156 |
| 546 | Ga0466970_0000001 | 3300044765 | Bacteria | 252791 |
| 547 | Ga0466970_0003519 | 3300044765 | Bacteria | 7637 |
| 548 | Ga0466970_0025418 | 3300044765 | Bacteria | 3100 |
| 549 | Ga0466970_0025620 | 3300044765 | Bacteria | 3089 |
| 550 | Ga0466970_0086871 | 3300044765 | Bacteria | 1696 |
| 551 | Ga0466970_0126734 | 3300044765 | Bacteria | 1400 |
| 552 | Ga0466960_0000764 | 3300044901 | Bacteria | 11310 |
| 553 | Ga0466959_0098042 | 3300045049 | Bacteria | 2100 |
| 554 | Ga0466959_0129680 | 3300045049 | Bacteria | 1787 |
| 555 | Ga0466958_0102473 | 3300045836 | Bacteria | 1781 |
| 556 | Ga0466967_0032527 | 3300045976 | Bacteria | 4405 |
| 557 | Ga0466967_0185193 | 3300045976 | Bacteria | 1966 |
| 558 | Ga0466967_0195791 | 3300045976 | Bacteria | 1912 |
| 559 | Ga0466967_0403646 | 3300045976 | Bacteria | 1330 |
| 560 | Ga0495627_000659 | 3300046453 | Bacteria | 26624 |
| 561 | Ga0495592_0002459 | 3300046454 | Bacteria | 13075 |
| 562 | Ga0495592_0005659 | 3300046454 | Bacteria | 9238 |
| 563 | Ga0495592_0019916 | 3300046454 | Bacteria | 5101 |
| 564 | Ga0495592_0048698 | 3300046454 | Bacteria | 3151 |
| 565 | Ga0495603_0000386 | 3300046455 | Bacteria | 24112 |
| 566 | Ga0495603_0003339 | 3300046455 | Bacteria | 9561 |
| 567 | Ga0495629_0000993 | 3300046459 | Bacteria | 22718 |
| 568 | Ga0495629_0014583 | 3300046459 | Bacteria | 5656 |
| 569 | Ga0495638_0001564 | 3300046460 | Bacteria | 20515 |
| 570 | Ga0495641_0007841 | 3300046461 | Bacteria | 6604 |
| 571 | Ga0495641_0011655 | 3300046461 | Bacteria | 4986 |
| 572 | Ga0495651_0001480 | 3300046462 | Bacteria | 18165 |
| 573 | Ga0495651_0005039 | 3300046462 | Bacteria | 10087 |
| 574 | Ga0495651_0009362 | 3300046462 | Bacteria | 7519 |
| 575 | Ga0495651_0013521 | 3300046462 | Bacteria | 6311 |
| 576 | Ga0495651_0120059 | 3300046462 | Bacteria | 1932 |
| 577 | Ga0495651_0147603 | 3300046462 | Bacteria | 1698 |
| 578 | Ga0495651_0260227 | 3300046462 | Bacteria | 1181 |
| 579 | Ga0495651_0263301 | 3300046462 | Bacteria | 1172 |
| 580 | Ga0495653_0005583 | 3300046463 | Bacteria | 10257 |
| 581 | Ga0495653_0019124 | 3300046463 | Bacteria | 5557 |
| 582 | Ga0495653_0020151 | 3300046463 | Bacteria | 5406 |
| 583 | Ga0495653_0020504 | 3300046463 | Bacteria | 5358 |
| 584 | Ga0495653_0027159 | 3300046463 | Bacteria | 4581 |
| 585 | Ga0495653_0055363 | 3300046463 | Bacteria | 3027 |
| 586 | Ga0495650_0003801 | 3300046471 | Bacteria | 10754 |
| 587 | Ga0495650_0074096 | 3300046471 | Bacteria | 1328 |
| 588 | Ga0495580_0002013 | 3300046472 | Bacteria | 17896 |
| 589 | Ga0495582_0001105 | 3300046473 | Bacteria | 15140 |
| 590 | Ga0495582_0001321 | 3300046473 | Bacteria | 13893 |
| 591 | Ga0495582_0015162 | 3300046473 | Bacteria | 4240 |
| 592 | Ga0495582_0097596 | 3300046473 | Bacteria | 1643 |
| 593 | Ga0495639_0002021 | 3300046475 | Bacteria | 8978 |
| 594 | Ga0495639_0005485 | 3300046475 | Bacteria | 5461 |
| 595 | Ga0495662_0006075 | 3300046476 | Bacteria | 6033 |
| 596 | Ga0495662_0025253 | 3300046476 | Bacteria | 2868 |
| 597 | Ga0495662_0030506 | 3300046476 | Bacteria | 2603 |
| 598 | Ga0495662_0034278 | 3300046476 | Bacteria | 2451 |
| 599 | Ga0495664_0002354 | 3300046477 | Bacteria | 10119 |
| 600 | Ga0495664_0025265 | 3300046477 | Bacteria | 3457 |
| 601 | Ga0495664_0047512 | 3300046477 | Bacteria | 2547 |
| 602 | Ga0495664_0051186 | 3300046477 | Bacteria | 2452 |
| 603 | Ga0495594_0073313 | 3300046499 | Bacteria | 1905 |
| 604 | Ga0495606_0000519 | 3300046507 | Bacteria | 62313 |
| 605 | Ga0495608_0001229 | 3300046511 | Bacteria | 18165 |
| 606 | Ga0495608_0002878 | 3300046511 | Bacteria | 12324 |
| 607 | Ga0495608_0004816 | 3300046511 | Bacteria | 9643 |
| 608 | Ga0495608_0013379 | 3300046511 | Bacteria | 5690 |
| 609 | Ga0495618_0004262 | 3300046514 | Bacteria | 8820 |
| 610 | Ga0495618_0013760 | 3300046514 | Bacteria | 4922 |
| 611 | Ga0495618_0049379 | 3300046514 | Bacteria | 2657 |
| 612 | Ga0495618_0166457 | 3300046514 | Bacteria | 1404 |
| 613 | Ga0495618_0167462 | 3300046514 | Bacteria | 1399 |
| 614 | Ga0495628_0002081 | 3300046516 | Bacteria | 18158 |
| 615 | Ga0495628_0031477 | 3300046516 | Bacteria | 4291 |
| 616 | Ga0495628_0042575 | 3300046516 | Bacteria | 3621 |
| 617 | Ga0495628_0072784 | 3300046516 | Bacteria | 2678 |
| 618 | Ga0495630_0049166 | 3300046517 | Bacteria | 3155 |
| 619 | Ga0495630_0071586 | 3300046517 | Bacteria | 2609 |
| 620 | Ga0495630_0275571 | 3300046517 | Bacteria | 1285 |
| 621 | Ga0495666_0003500 | 3300046526 | Bacteria | 7924 |
| 622 | Ga0495652_0002697 | 3300046529 | Bacteria | 18037 |
| 623 | Ga0495652_0003338 | 3300046529 | Bacteria | 15924 |
| 624 | Ga0495652_0015786 | 3300046529 | Bacteria | 6760 |
| 625 | Ga0495652_0055561 | 3300046529 | Bacteria | 3366 |
| 626 | Ga0495652_0069855 | 3300046529 | Bacteria | 2938 |
| 627 | Ga0495665_0000676 | 3300046531 | Bacteria | 17463 |
| 628 | Ga0495665_0001805 | 3300046531 | Bacteria | 11530 |
| 629 | Ga0495640_0023234 | 3300046533 | Bacteria | 4524 |
| 630 | Ga0495640_0050600 | 3300046533 | Bacteria | 2862 |
| 631 | Ga0495586_0014221 | 3300046535 | Bacteria | 4229 |
| 632 | Ga0495587_0001054 | 3300046536 | Bacteria | 18152 |
| 633 | Ga0495587_0006078 | 3300046536 | Bacteria | 7879 |
| 634 | Ga0495587_0009946 | 3300046536 | Bacteria | 6071 |
| 635 | Ga0495587_0031736 | 3300046536 | Bacteria | 3196 |
| 636 | Ga0495645_0015811 | 3300046543 | Bacteria | 5373 |
| 637 | Ga0495645_0022367 | 3300046543 | Bacteria | 4573 |
| 638 | Ga0495645_0041923 | 3300046543 | Bacteria | 3337 |
| 639 | Ga0495645_0044858 | 3300046543 | Bacteria | 3224 |
| 640 | Ga0495645_0049307 | 3300046543 | Bacteria | 3066 |
| 641 | Ga0495667_0000555 | 3300046559 | Bacteria | 23895 |
| 642 | Ga0495667_0000804 | 3300046559 | Bacteria | 20210 |
| 643 | Ga0495667_0002742 | 3300046559 | Bacteria | 11773 |
| 644 | Ga0495667_0003305 | 3300046559 | Bacteria | 10802 |
| 645 | Ga0495667_0003357 | 3300046559 | Bacteria | 10715 |
| 646 | Ga0495667_0004804 | 3300046559 | Bacteria | 9135 |
| 647 | Ga0495667_0169056 | 3300046559 | Bacteria | 1405 |
| 648 | Ga0495667_0198478 | 3300046559 | Bacteria | 1284 |
| 649 | Ga0495634_0004918 | 3300046642 | Bacteria | 10341 |
| 650 | Ga0495634_0019930 | 3300046642 | Bacteria | 4759 |
| 651 | Ga0495634_0038372 | 3300046642 | Bacteria | 3267 |
| 652 | Ga0495634_0044903 | 3300046642 | Bacteria | 2989 |
| 653 | Ga0495635_0000896 | 3300046663 | Bacteria | 19529 |
| 654 | Ga0495635_0007084 | 3300046663 | Bacteria | 7838 |
| 655 | Ga0495635_0010854 | 3300046663 | Bacteria | 6382 |
| 656 | Ga0495635_0099706 | 3300046663 | Bacteria | 1985 |
| 657 | Ga0495588_0065485 | 3300046674 | Bacteria | 1885 |
| 658 | Ga0495657_0001832 | 3300046675 | Bacteria | 18165 |
| 659 | Ga0495657_0003562 | 3300046675 | Bacteria | 12676 |
| 660 | Ga0495657_0013962 | 3300046675 | Bacteria | 5900 |
| 661 | Ga0495657_0014053 | 3300046675 | Bacteria | 5880 |
| 662 | Ga0495657_0047136 | 3300046675 | Bacteria | 2915 |
| 663 | Ga0495657_0050962 | 3300046675 | Bacteria | 2781 |
| 664 | Ga0495657_0104559 | 3300046675 | Bacteria | 1800 |
| 665 | Ga0495657_0144958 | 3300046675 | Bacteria | 1478 |
| 666 | Ga0495599_0000769 | 3300046678 | Bacteria | 18045 |
| 667 | Ga0495599_0021710 | 3300046678 | Bacteria | 4006 |
| 668 | Ga0495599_0036429 | 3300046678 | Bacteria | 3089 |
| 669 | Ga0495599_0056494 | 3300046678 | Bacteria | 2456 |
| 670 | Ga0495623_0001121 | 3300046679 | Bacteria | 18078 |
| 671 | Ga0495623_0025410 | 3300046679 | Bacteria | 3816 |
| 672 | Ga0495623_0026261 | 3300046679 | Bacteria | 3749 |
| 673 | Ga0495623_0035865 | 3300046679 | Bacteria | 3178 |
| 674 | Ga0495646_0003679 | 3300046680 | Bacteria | 9567 |
| 675 | Ga0495646_0007293 | 3300046680 | Bacteria | 7023 |
| 676 | Ga0495646_0013073 | 3300046680 | Bacteria | 5276 |
| 677 | Ga0495646_0014836 | 3300046680 | Bacteria | 4949 |
| 678 | Ga0495658_0003893 | 3300046683 | Bacteria | 7390 |
| 679 | Ga0495613_0008226 | 3300046689 | Bacteria | 7745 |
| 680 | Ga0495613_0009745 | 3300046689 | Bacteria | 7139 |
| 681 | Ga0495624_0001916 | 3300046690 | Bacteria | 15840 |
| 682 | Ga0495624_0009187 | 3300046690 | Bacteria | 6854 |
| 683 | Ga0495624_0010818 | 3300046690 | Bacteria | 6288 |
| 684 | Ga0495600_0015195 | 3300046809 | Bacteria | 4863 |
| 685 | Ga0495600_0023090 | 3300046809 | Bacteria | 4000 |
| 686 | Ga0495600_0038487 | 3300046809 | Bacteria | 3112 |
| 687 | Ga0495600_0178382 | 3300046809 | Bacteria | 1369 |
| 688 | Ga0495581_0002013 | 3300047315 | Bacteria | 11420 |
| 689 | Ga0495581_0006111 | 3300047315 | Bacteria | 6979 |
| 690 | Ga0495581_0007135 | 3300047315 | Bacteria | 6471 |
| 691 | Ga0495581_0012048 | 3300047315 | Bacteria | 5003 |
| 692 | Ga0495604_0001688 | 3300047317 | Bacteria | 18161 |
| 693 | Ga0495604_0007314 | 3300047317 | Bacteria | 8744 |
| 694 | Ga0495604_0011501 | 3300047317 | Bacteria | 7030 |
| 695 | Ga0495604_0055873 | 3300047317 | Bacteria | 3041 |
| 696 | Ga0495604_0229159 | 3300047317 | Bacteria | 1275 |
| 697 | Ga0495674_0000239 | 3300047319 | Bacteria | 46557 |
| 698 | Ga0495674_0001543 | 3300047319 | Bacteria | 22531 |
| 699 | Ga0495674_0033979 | 3300047319 | Bacteria | 4614 |
| 700 | Ga0495674_0060234 | 3300047319 | Bacteria | 3313 |
| 701 | Ga0495674_0063206 | 3300047319 | Bacteria | 3220 |
| 702 | Ga0495674_0100851 | 3300047319 | Bacteria | 2456 |
| 703 | Ga0495672_0049782 | 3300047320 | Bacteria | 2478 |
| 704 | Ga0495676_0005648 | 3300047321 | Bacteria | 11468 |
| 705 | Ga0495676_0038871 | 3300047321 | Bacteria | 3947 |
| 706 | Ga0495676_0169449 | 3300047321 | Bacteria | 1538 |
| 707 | Ga0495680_0002131 | 3300047322 | Bacteria | 20548 |
| 708 | Ga0495680_0002643 | 3300047322 | Bacteria | 18163 |
| 709 | Ga0495680_0009363 | 3300047322 | Bacteria | 8817 |
| 710 | Ga0495680_0010169 | 3300047322 | Bacteria | 8407 |
| 711 | Ga0495680_0011106 | 3300047322 | Bacteria | 7994 |
| 712 | Ga0495680_0017642 | 3300047322 | Bacteria | 6084 |
| 713 | Ga0495680_0090600 | 3300047322 | Bacteria | 2293 |
| 714 | Ga0495680_0197724 | 3300047322 | Bacteria | 1444 |
| 715 | Ga0495675_0004571 | 3300047444 | Bacteria | 8394 |
| 716 | Ga0495675_0015543 | 3300047444 | Bacteria | 4813 |
| 717 | Ga0495675_0017671 | 3300047444 | Bacteria | 4522 |
| 718 | Ga0495675_0056300 | 3300047444 | Bacteria | 2493 |
| 719 | Ga0495675_0180843 | 3300047444 | Bacteria | 1291 |
| 720 | Ga0495684_0000873 | 3300047471 | Bacteria | 24506 |
| 721 | Ga0495684_0005728 | 3300047471 | Bacteria | 9663 |
| 722 | Ga0495684_0074370 | 3300047471 | Bacteria | 2581 |
| 723 | Ga0495686_0002683 | 3300047472 | Bacteria | 16376 |
| 724 | Ga0495686_0033239 | 3300047472 | Bacteria | 3332 |
| 725 | Ga0495593_0000574 | 3300047673 | Bacteria | 20889 |
| 726 | Ga0495593_0005468 | 3300047673 | Bacteria | 7500 |
| 727 | Ga0495593_0031391 | 3300047673 | Bacteria | 2902 |
| 728 | Ga0495602_0002692 | 3300048088 | Bacteria | 18152 |
| 729 | Ga0495602_0007350 | 3300048088 | Bacteria | 11535 |
| 730 | Ga0495602_0009753 | 3300048088 | Bacteria | 9975 |
| 731 | Ga0495602_0025572 | 3300048088 | Bacteria | 5711 |
| 732 | Ga0495602_0042486 | 3300048088 | Bacteria | 4141 |
| 733 | Ga0495602_0051241 | 3300048088 | Bacteria | 3678 |
| 734 | Ga0495602_0066910 | 3300048088 | Bacteria | 3093 |
| 735 | Ga0495614_0006062 | 3300048089 | Bacteria | 5433 |
| 736 | Ga0496100_0003285 | 3300048903 | Bacteria | 8408 |
| 737 | Ga0496100_0003723 | 3300048903 | Bacteria | 7987 |
| 738 | Ga0496100_0025263 | 3300048903 | Bacteria | 3632 |
| 739 | Ga0496100_0070051 | 3300048903 | Bacteria | 2337 |
| 740 | Ga0496100_0227268 | 3300048903 | Bacteria | 1372 |
| 741 | Ga0496101_0000620 | 3300048904 | Bacteria | 21636 |
| 742 | Ga0496101_0015505 | 3300048904 | Bacteria | 5139 |
| 743 | Ga0496101_0019861 | 3300048904 | Bacteria | 4594 |
| 744 | Ga0496101_0024596 | 3300048904 | Bacteria | 4169 |
| 745 | Ga0496101_0042441 | 3300048904 | Bacteria | 3247 |
| 746 | Ga0496101_0106966 | 3300048904 | Bacteria | 2101 |
| 747 | Ga0496102_0000458 | 3300048905 | Bacteria | 45701 |
| 748 | Ga0496102_0009161 | 3300048905 | Bacteria | 8491 |
| 749 | Ga0496102_0019400 | 3300048905 | Bacteria | 5990 |
| 750 | Ga0496102_0063338 | 3300048905 | Bacteria | 3385 |
| 751 | Ga0496102_0083238 | 3300048905 | Bacteria | 2952 |
| 752 | Ga0496102_0086104 | 3300048905 | Bacteria | 2902 |
| 753 | Ga0496103_0000466 | 3300048906 | Bacteria | 34185 |
| 754 | Ga0496103_0010715 | 3300048906 | Bacteria | 5424 |
| 755 | Ga0496103_0022667 | 3300048906 | Bacteria | 3781 |
| 756 | Ga0496103_0062286 | 3300048906 | Bacteria | 2322 |
| 757 | Ga0496104_0006336 | 3300048907 | Bacteria | 10408 |
| 758 | Ga0496104_0009998 | 3300048907 | Bacteria | 8469 |
| 759 | Ga0496104_0010338 | 3300048907 | Bacteria | 8333 |
| 760 | Ga0496104_0062216 | 3300048907 | Bacteria | 3539 |
| 761 | Ga0496104_0404637 | 3300048907 | Bacteria | 1277 |
| 762 | Ga0496105_0008149 | 3300048908 | Bacteria | 8146 |
| 763 | Ga0496105_0024016 | 3300048908 | Bacteria | 4951 |
| 764 | Ga0496105_0090970 | 3300048908 | Bacteria | 2520 |
| 765 | Ga0496105_0182859 | 3300048908 | Bacteria | 1716 |
| 766 | Ga0496106_0000592 | 3300048909 | Bacteria | 25928 |
| 767 | Ga0496106_0004806 | 3300048909 | Bacteria | 9995 |
| 768 | Ga0496106_0014595 | 3300048909 | Bacteria | 5804 |
| 769 | Ga0496107_0001235 | 3300048910 | Bacteria | 15615 |
| 770 | Ga0496107_0008974 | 3300048910 | Bacteria | 6930 |
| 771 | Ga0496107_0012670 | 3300048910 | Bacteria | 5887 |
| 772 | Ga0496108_0000457 | 3300048911 | Bacteria | 32650 |
| 773 | Ga0496108_0015973 | 3300048911 | Bacteria | 6119 |
| 774 | Ga0496108_0031709 | 3300048911 | Bacteria | 4387 |
| 775 | Ga0496108_0055463 | 3300048911 | Bacteria | 3327 |
| 776 | Ga0496108_0142841 | 3300048911 | Bacteria | 2062 |
| 777 | Ga0496108_0164008 | 3300048911 | Bacteria | 1921 |
| 778 | Ga0496109_0009119 | 3300048912 | Bacteria | 8449 |
| 779 | Ga0496109_0010428 | 3300048912 | Bacteria | 7936 |
| 780 | Ga0496109_0027087 | 3300048912 | Bacteria | 5115 |
| 781 | Ga0496109_0050077 | 3300048912 | Bacteria | 3804 |
| 782 | Ga0496109_0103315 | 3300048912 | Bacteria | 2645 |
| 783 | Ga0496109_0255818 | 3300048912 | Bacteria | 1649 |
| 784 | Ga0496109_0332787 | 3300048912 | Bacteria | 1434 |
| 785 | Ga0496110_0005900 | 3300048913 | Bacteria | 9641 |
| 786 | Ga0496110_0012624 | 3300048913 | Bacteria | 6949 |
| 787 | Ga0496110_0020634 | 3300048913 | Bacteria | 5566 |
| 788 | Ga0496110_0035703 | 3300048913 | Bacteria | 4314 |
| 789 | Ga0496110_0138339 | 3300048913 | Bacteria | 2201 |
| 790 | Ga0496110_0221299 | 3300048913 | Bacteria | 1721 |
| 791 | Ga0496111_0012381 | 3300048914 | Bacteria | 5773 |
| 792 | Ga0496111_0092861 | 3300048914 | Bacteria | 2212 |
| 793 | Ga0496112_0031602 | 3300048915 | Bacteria | 5136 |
| 794 | Ga0496112_0040147 | 3300048915 | Bacteria | 4575 |
| 795 | Ga0496112_0070457 | 3300048915 | Bacteria | 3455 |
| 796 | Ga0496112_0182663 | 3300048915 | Bacteria | 2061 |
| 797 | Ga0496113_0015130 | 3300048916 | Bacteria | 5290 |
| 798 | Ga0496113_0219238 | 3300048916 | Bacteria | 1516 |
| 799 | Ga0496114_0000175 | 3300048917 | Bacteria | 45344 |
| 800 | Ga0496114_0008791 | 3300048917 | Bacteria | 8003 |
| 801 | Ga0496114_0014341 | 3300048917 | Bacteria | 6357 |
| 802 | Ga0496114_0029407 | 3300048917 | Bacteria | 4516 |
| 803 | Ga0496114_0064031 | 3300048917 | Bacteria | 3079 |
| 804 | Ga0496114_0165342 | 3300048917 | Bacteria | 1926 |
| 805 | Ga0496114_0272667 | 3300048917 | Bacteria | 1491 |
| 806 | Ga0496115_0003687 | 3300048918 | Bacteria | 11024 |
| 807 | Ga0496115_0012317 | 3300048918 | Bacteria | 6431 |
| 808 | Ga0496115_0053484 | 3300048918 | Bacteria | 3240 |
| 809 | Ga0496115_0083354 | 3300048918 | Bacteria | 2606 |
| 810 | Ga0496115_0148301 | 3300048918 | Bacteria | 1936 |
| 811 | Ga0496116_0007005 | 3300048919 | Bacteria | 10094 |
| 812 | Ga0496117_0000607 | 3300048920 | Bacteria | 58422 |
| 813 | Ga0496117_0002843 | 3300048920 | Bacteria | 21063 |
| 814 | Ga0496117_0005412 | 3300048920 | Bacteria | 13429 |
| 815 | Ga0496117_0050975 | 3300048920 | Bacteria | 2930 |
| 816 | Ga0496118_0003349 | 3300048921 | Bacteria | 20290 |
| 817 | Ga0496118_0004676 | 3300048921 | Bacteria | 16044 |
| 818 | Ga0496118_0021365 | 3300048921 | Bacteria | 5699 |
| 819 | Ga0496119_0000600 | 3300048922 | Bacteria | 48758 |
| 820 | Ga0496119_0001062 | 3300048922 | Bacteria | 35053 |
| 821 | Ga0496119_0001501 | 3300048922 | Bacteria | 27887 |
| 822 | Ga0496120_0001468 | 3300048923 | Bacteria | 28087 |
| 823 | Ga0496120_0009678 | 3300048923 | Bacteria | 6802 |
| 824 | Ga0496120_0024867 | 3300048923 | Bacteria | 3727 |
| 825 | Ga0496120_0030264 | 3300048923 | Bacteria | 3293 |
| 826 | Ga0496120_0033202 | 3300048923 | Bacteria | 3103 |
| 827 | Ga0496120_0120535 | 3300048923 | Bacteria | 1357 |
| 828 | Ga0496121_0004532 | 3300048924 | Bacteria | 18593 |
| 829 | Ga0496121_0005081 | 3300048924 | Bacteria | 17169 |
| 830 | Ga0496122_0000022 | 3300048925 | Bacteria | 388704 |
| 831 | Ga0496122_0000095 | 3300048925 | Bacteria | 200509 |
| 832 | Ga0496122_0015661 | 3300048925 | Bacteria | 7233 |
| 833 | Ga0496123_0000016 | 3300048926 | Bacteria | 424330 |
| 834 | Ga0496123_0000100 | 3300048926 | Bacteria | 170019 |
| 835 | Ga0496124_0013426 | 3300048927 | Bacteria | 7994 |
| 836 | Ga0496124_0028795 | 3300048927 | Bacteria | 4961 |
| 837 | Ga0496124_0293127 | 3300048927 | Bacteria | 1179 |
| 838 | Ga0496125_0000326 | 3300048928 | Bacteria | 91890 |
| 839 | Ga0496125_0008550 | 3300048928 | Bacteria | 10695 |
| 840 | Ga0496125_0009139 | 3300048928 | Bacteria | 10252 |
| 841 | Ga0496125_0009156 | 3300048928 | Bacteria | 10233 |
| 842 | Ga0496125_0018028 | 3300048928 | Bacteria | 6710 |
| 843 | Ga0496125_0045796 | 3300048928 | Bacteria | 3676 |
| 844 | Ga0496126_0003871 | 3300048929 | Bacteria | 18451 |
| 845 | Ga0496126_0006488 | 3300048929 | Bacteria | 13022 |
| 846 | Ga0496126_0007096 | 3300048929 | Bacteria | 12340 |
| 847 | Ga0496126_0008872 | 3300048929 | Bacteria | 10774 |
| 848 | Ga0496126_0014353 | 3300048929 | Bacteria | 8011 |
| 849 | Ga0496126_0188175 | 3300048929 | Bacteria | 1750 |
| 850 | Ga0496126_0317884 | 3300048929 | Bacteria | 1280 |
| 851 | Ga0501032_0010760 | 3300049569 | Bacteria | 6586 |
| 852 | Ga0501034_0024193 | 3300049571 | Bacteria | 6177 |
| 853 | Ga0501034_0065853 | 3300049571 | Bacteria | 3637 |
| 854 | Ga0501034_0078831 | 3300049571 | Bacteria | 3297 |
| 855 | Ga0501036_0006542 | 3300049572 | Bacteria | 9466 |
| 856 | Ga0501037_0001807 | 3300049573 | Bacteria | 15538 |
| 857 | Ga0501038_0050802 | 3300049574 | Bacteria | 3581 |
| 858 | Ga0501039_0000820 | 3300049575 | Bacteria | 22383 |
| 859 | Ga0501043_0001927 | 3300049579 | Bacteria | 17763 |
| 860 | Ga0501047_0017179 | 3300049581 | Bacteria | 6925 |
| 861 | Ga0501067_0004199 | 3300049583 | Bacteria | 7952 |
| 862 | Ga0501070_0017639 | 3300049586 | Bacteria | 5993 |
| 863 | Ga0501073_0069076 | 3300049589 | Bacteria | 2462 |
| 864 | Ga0501044_0013917 | 3300049823 | Bacteria | 8694 |
| 865 | nmdc:mga03683_22225_c1 | 3300050489 | Bacteria | 2457 |
| 866 | nmdc:mga03683_60462_c1 | 3300050489 | Bacteria | 1600 |
| 867 | nmdc:mga03n38_14266_c1 | 3300050490 | Bacteria | 3041 |
| 868 | nmdc:mga03n38_68713_c1 | 3300050490 | Bacteria | 1634 |
| 869 | nmdc:mga00v17_134573_c1 | 3300050491 | Bacteria | 1581 |
| 870 | nmdc:mga00v17_2960_c1 | 3300050491 | Bacteria | 8720 |
| 871 | nmdc:mga00v17_5113_c1 | 3300050491 | Bacteria | 6895 |
| 872 | nmdc:mga00v17_7394_c1 | 3300050491 | Bacteria | 5859 |
| 873 | nmdc:mga0yw44_10327_c1 | 3300050492 | Bacteria | 4764 |
| 874 | nmdc:mga0yw44_179736_c1 | 3300050492 | Bacteria | 1392 |
| 875 | nmdc:mga0yw44_19322_c1 | 3300050492 | Bacteria | 3755 |
| 876 | nmdc:mga0yw44_40047_c1 | 3300050492 | Bacteria | 2782 |
| 877 | nmdc:mga0yw44_66186_c1 | 3300050492 | Bacteria | 2229 |
| 878 | nmdc:mga07m45_12208_c1 | 3300050496 | Bacteria | 1732 |
| 879 | nmdc:mga07m45_41255_c1 | 3300050496 | Bacteria | 2584 |
| 880 | nmdc:mga05p37_8977_c1 | 3300050507 | Bacteria | 11822 |
| 881 | nmdc:mga0qj67_98222_c1 | 3300050509 | Bacteria | 2359 |
| 882 | nmdc:mga06r32_65895_c1 | 3300050510 | Bacteria | 3494 |
| 883 | nmdc:mga0sz30_15979_c1 | 3300050516 | Bacteria | 2972 |
| 884 | nmdc:mga0sz30_33985_c1 | 3300050516 | Bacteria | 2121 |
| 885 | nmdc:mga0sz30_77728_c1 | 3300050516 | Bacteria | 1434 |
| 886 | Ga0495601_0006165 | 3300053077 | Bacteria | 6996 |
| 887 | Ga0495601_0025026 | 3300053077 | Bacteria | 3679 |
| 888 | Ga0495612_0003839 | 3300053078 | Bacteria | 6238 |
| 889 | Ga0495612_0038021 | 3300053078 | Bacteria | 1956 |
| 890 | Ga0500610_0047321 | 3300053079 | Bacteria | 2235 |
| 891 | Ga0495595_0002906 | 3300053084 | Bacteria | 6755 |
| 892 | Ga0495595_0002954 | 3300053084 | Bacteria | 6715 |
| 893 | Ga0495619_0009931 | 3300053085 | Bacteria | 5994 |
| 894 | Ga0500643_023165 | 3300053087 | Bacteria | 1987 |
| 895 | Ga0500651_0000214 | 3300053093 | Bacteria | 36274 |
| 896 | Ga0500562_005443 | 3300053108 | Bacteria | 3197 |
| 897 | Ga0500559_0045732 | 3300053136 | Bacteria | 1918 |
| 898 | Ga0500573_0081514 | 3300053140 | Bacteria | 1838 |
| 899 | Ga0500616_0000985 | 3300053153 | Bacteria | 30767 |
| 900 | Ga0500616_0002919 | 3300053153 | Bacteria | 13647 |
| 901 | Ga0500616_0050347 | 3300053153 | Bacteria | 2200 |
| 902 | Ga0500616_0089137 | 3300053153 | Bacteria | 1531 |
| 903 | Ga0500645_000314 | 3300053730 | Bacteria | 34564 |
| 904 | Ga0466962_0021984 | 3300061719 | Bacteria | 3063 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048923 | Ga0496120_0120535 | Ga0496120_0120535_21_932 | 294 |
| 2 | 3300005331 | Ga0070670_100022182 | Ga0070670_1000221822 | 298 |
| 3 | 3300049574 | Ga0501038_0050802 | Ga0501038_0050802_441_1373 | 310 |
| 4 | 3300049575 | Ga0501039_0000820 | Ga0501039_0000820_11369_12301 | 310 |
| 5 | 3300049589 | Ga0501073_0069076 | Ga0501073_0069076_440_1372 | 310 |
| 6 | 3300005355 | Ga0070671_100073068 | Ga0070671_1000730683 | 311 |
| 7 | 3300005436 | Ga0070713_100409465 | Ga0070713_1004094652 | 311 |
| 8 | 3300005548 | Ga0070665_100096541 | Ga0070665_1000965412 | 311 |
| 9 | 3300005840 | Ga0068870_10099674 | Ga0068870_100996742 | 311 |
| 10 | 3300025931 | Ga0207644_10128527 | Ga0207644_101285272 | 311 |
| 11 | 3300026035 | Ga0207703_10583677 | Ga0207703_105836771 | 311 |
| 12 | 3300028379 | Ga0268266_10048967 | Ga0268266_100489672 | 311 |
| 13 | 3300039437 | Ga0436365_1192272 | Ga0436365_1192272_3467_4426 | 311 |
| 14 | 3300048912 | Ga0496109_0255818 | Ga0496109_0255818_304_1263 | 311 |
| 15 | 3300026121 | Ga0207683_10439482 | Ga0207683_104394822 | 312 |
| 16 | 3300006048 | Ga0075363_100000604 | Ga0075363_1000006049 | 313 |
| 17 | 3300050496 | nmdc:mga07m45_41255_c1 | nmdc:mga07m45_41255_c1_1456_2505 | 313 |
| 18 | 3300005530 | Ga0070679_100189928 | Ga0070679_1001899283 | 314 |
| 19 | 3300005343 | Ga0070687_100059429 | Ga0070687_1000594292 | 316 |
| 20 | 3300005347 | Ga0070668_100028219 | Ga0070668_1000282192 | 316 |
| 21 | 3300005356 | Ga0070674_100211709 | Ga0070674_1002117092 | 316 |
| 22 | 3300005614 | Ga0068856_100102506 | Ga0068856_1001025063 | 316 |
| 23 | 3300005844 | Ga0068862_100023337 | Ga0068862_1000233376 | 316 |
| 24 | 3300009101 | Ga0105247_10103699 | Ga0105247_101036992 | 316 |
| 25 | 3300025960 | Ga0207651_10224550 | Ga0207651_102245501 | 316 |
| 26 | 3300026067 | Ga0207678_10034759 | Ga0207678_100347594 | 316 |
| 27 | 3300026089 | Ga0207648_10031243 | Ga0207648_100312435 | 316 |
| 28 | 3300045976 | Ga0466967_0185193 | Ga0466967_0185193_587_1624 | 316 |
| 29 | 3300048911 | Ga0496108_0142841 | Ga0496108_0142841_696_1673 | 316 |
| 30 | 3300005340 | Ga0070689_100031495 | Ga0070689_1000314954 | 317 |
| 31 | 3300005366 | Ga0070659_100053027 | Ga0070659_1000530272 | 317 |
| 32 | 3300005539 | Ga0068853_100106147 | Ga0068853_1001061471 | 317 |
| 33 | 3300005548 | Ga0070665_100619275 | Ga0070665_1006192751 | 317 |
| 34 | 3300005563 | Ga0068855_100282731 | Ga0068855_1002827312 | 317 |
| 35 | 3300005577 | Ga0068857_100119859 | Ga0068857_1001198593 | 317 |
| 36 | 3300005616 | Ga0068852_100045022 | Ga0068852_1000450221 | 317 |
| 37 | 3300005719 | Ga0068861_100033200 | Ga0068861_1000332003 | 317 |
| 38 | 3300005834 | Ga0068851_10063347 | Ga0068851_100633473 | 317 |
| 39 | 3300005842 | Ga0068858_100028712 | Ga0068858_1000287124 | 317 |
| 40 | 3300005843 | Ga0068860_100091101 | Ga0068860_1000911013 | 317 |
| 41 | 3300006881 | Ga0068865_100298468 | Ga0068865_1002984681 | 317 |
| 42 | 3300009098 | Ga0105245_10183001 | Ga0105245_101830012 | 317 |
| 43 | 3300009148 | Ga0105243_10221916 | Ga0105243_102219162 | 317 |
| 44 | 3300013306 | Ga0163162_10377156 | Ga0163162_103771562 | 317 |
| 45 | 3300025918 | Ga0207662_10108415 | Ga0207662_101084151 | 317 |
| 46 | 3300025919 | Ga0207657_10023227 | Ga0207657_100232275 | 317 |
| 47 | 3300025925 | Ga0207650_10198634 | Ga0207650_101986342 | 317 |
| 48 | 3300025927 | Ga0207687_10042236 | Ga0207687_100422364 | 317 |
| 49 | 3300025935 | Ga0207709_10264526 | Ga0207709_102645261 | 317 |
| 50 | 3300025937 | Ga0207669_10043311 | Ga0207669_100433112 | 317 |
| 51 | 3300025942 | Ga0207689_10006927 | Ga0207689_100069277 | 317 |
| 52 | 3300025981 | Ga0207640_10164446 | Ga0207640_101644462 | 317 |
| 53 | 3300026075 | Ga0207708_10020792 | Ga0207708_100207924 | 317 |
| 54 | 3300026088 | Ga0207641_10172973 | Ga0207641_101729732 | 317 |
| 55 | 3300026118 | Ga0207675_100020258 | Ga0207675_1000202585 | 317 |
| 56 | 3300028379 | Ga0268266_10091557 | Ga0268266_100915572 | 317 |
| 57 | 3300028381 | Ga0268264_10155019 | Ga0268264_101550192 | 317 |
| 58 | 3300046471 | Ga0495650_0074096 | Ga0495650_0074096_58_1056 | 317 |
| 59 | 3300048913 | Ga0496110_0035703 | Ga0496110_0035703_2211_3191 | 317 |
| 60 | 3300025986 | Ga0207658_10134872 | Ga0207658_101348721 | 319 |
| 61 | 3300046543 | Ga0495645_0041923 | Ga0495645_0041923_918_1976 | 319 |
| 62 | 3300017792 | Ga0163161_10280799 | Ga0163161_102807991 | 320 |
| 63 | 3300041411 | Ga0439466_0007096 | Ga0439466_0007096_1121_2143 | 322 |
| 64 | 3300048907 | Ga0496104_0404637 | Ga0496104_0404637_55_1047 | 322 |
| 65 | 3300048917 | Ga0496114_0165342 | Ga0496114_0165342_195_1292 | 322 |
| 66 | 3300048929 | Ga0496126_0317884 | Ga0496126_0317884_11_994 | 322 |
| 67 | 3300046462 | Ga0495651_0260227 | Ga0495651_0260227_10_1020 | 327 |
| 68 | 3300046514 | Ga0495618_0167462 | Ga0495618_0167462_221_1243 | 330 |
| 69 | 3300046516 | Ga0495628_0072784 | Ga0495628_0072784_1596_2618 | 330 |
| 70 | 3300031242 | Ga0265329_10032895 | Ga0265329_100328952 | 335 |
| 71 | 3300025910 | Ga0207684_10235250 | Ga0207684_102352502 | 336 |
| 72 | 3300034957 | Ga0373938_0011598 | Ga0373938_0011598_85_1266 | 336 |
| 73 | iso_pu_bacteria | 2902810491 | 2902811530 | 336 |
| 74 | 3300035119 | Ga0373956_0009951 | Ga0373956_0009951_1659_2810 | 337 |
| 75 | 3300035172 | Ga0373955_0013813 | Ga0373955_0013813_1158_2309 | 337 |
| 76 | 3300036401 | Ga0373937_0097544 | Ga0373937_0097544_486_1637 | 337 |
| 77 | 3300046514 | Ga0495618_0166457 | Ga0495618_0166457_190_1341 | 337 |
| 78 | 3300046675 | Ga0495657_0104559 | Ga0495657_0104559_95_1246 | 337 |
| 79 | 3300047322 | Ga0495680_0009363 | Ga0495680_0009363_1586_2737 | 337 |
| 80 | 3300047444 | Ga0495675_0180843 | Ga0495675_0180843_51_1202 | 337 |
| 81 | 3300048088 | Ga0495602_0009753 | Ga0495602_0009753_1650_2801 | 337 |
| 82 | iso_pu_bacteria | 2857733635 | 2857736520 | 337 |
| 83 | 3300005327 | Ga0070658_10021050 | Ga0070658_100210502 | 338 |
| 84 | 3300005329 | Ga0070683_100026326 | Ga0070683_1000263262 | 338 |
| 85 | 3300005336 | Ga0070680_100172615 | Ga0070680_1001726152 | 338 |
| 86 | 3300005339 | Ga0070660_100048372 | Ga0070660_1000483723 | 338 |
| 87 | 3300005439 | Ga0070711_100067138 | Ga0070711_1000671383 | 338 |
| 88 | 3300005530 | Ga0070679_100120416 | Ga0070679_1001204162 | 338 |
| 89 | 3300005535 | Ga0070684_100060064 | Ga0070684_1000600643 | 338 |
| 90 | 3300005548 | Ga0070665_100024659 | Ga0070665_1000246594 | 338 |
| 91 | 3300013104 | Ga0157370_10080037 | Ga0157370_100800373 | 338 |
| 92 | 3300013105 | Ga0157369_10003733 | Ga0157369_100037332 | 338 |
| 93 | 3300013105 | Ga0157369_10275444 | Ga0157369_102754442 | 338 |
| 94 | 3300020081 | Ga0206354_10328917 | Ga0206354_103289171 | 338 |
| 95 | 3300025912 | Ga0207707_10001233 | Ga0207707_1000123316 | 338 |
| 96 | 3300025913 | Ga0207695_10252398 | Ga0207695_102523982 | 338 |
| 97 | 3300025915 | Ga0207693_10220849 | Ga0207693_102208492 | 338 |
| 98 | 3300025917 | Ga0207660_10140091 | Ga0207660_101400912 | 338 |
| 99 | 3300025919 | Ga0207657_10031119 | Ga0207657_100311191 | 338 |
| 100 | 3300025921 | Ga0207652_10103837 | Ga0207652_101038372 | 338 |
| 101 | 3300025939 | Ga0207665_10049646 | Ga0207665_100496463 | 338 |
| 102 | 3300026067 | Ga0207678_10098328 | Ga0207678_100983283 | 338 |
| 103 | 3300037068 | Ga0373925_0000515 | Ga0373925_0000515_35308_36336 | 338 |
| 104 | 3300046462 | Ga0495651_0263301 | Ga0495651_0263301_95_1162 | 338 |
| 105 | 3300048912 | Ga0496109_0332787 | Ga0496109_0332787_365_1393 | 338 |
| 106 | 3300049569 | Ga0501032_0010760 | Ga0501032_0010760_2401_3429 | 338 |
| 107 | 3300049571 | Ga0501034_0024193 | Ga0501034_0024193_4709_5737 | 338 |
| 108 | 3300049572 | Ga0501036_0006542 | Ga0501036_0006542_6026_7054 | 338 |
| 109 | 3300049573 | Ga0501037_0001807 | Ga0501037_0001807_11797_12825 | 338 |
| 110 | 3300049586 | Ga0501070_0017639 | Ga0501070_0017639_2113_3141 | 338 |
| 111 | 3300049823 | Ga0501044_0013917 | Ga0501044_0013917_2433_3461 | 338 |
| 112 | 3300053140 | Ga0500573_0081514 | Ga0500573_0081514_396_1439 | 338 |
| 113 | iso_pu_bacteria | 2643221619 | 2644113529 | 338 |
| 114 | 3300002772 | JGI25164J39214_1000610 | JGI25164J39214_100061011 | 339 |
| 115 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004208 | 339 |
| 116 | 3300005435 | Ga0070714_100008555 | Ga0070714_1000085556 | 339 |
| 117 | 3300006051 | Ga0075364_10047048 | Ga0075364_100470483 | 339 |
| 118 | 3300025231 | Ga0207427_100010 | Ga0207427_100010372 | 339 |
| 119 | 3300025233 | Ga0209437_100578 | Ga0209437_10057821 | 339 |
| 120 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011577 | 339 |
| 121 | 3300028556 | Ga0265337_1008139 | Ga0265337_10081393 | 339 |
| 122 | 3300028558 | Ga0265326_10001409 | Ga0265326_100014098 | 339 |
| 123 | 3300028563 | Ga0265319_1006104 | Ga0265319_10061043 | 339 |
| 124 | 3300028573 | Ga0265334_10001883 | Ga0265334_100018833 | 339 |
| 125 | 3300028653 | Ga0265323_10009658 | Ga0265323_100096583 | 339 |
| 126 | 3300028666 | Ga0265336_10007199 | Ga0265336_100071993 | 339 |
| 127 | 3300028800 | Ga0265338_10001519 | Ga0265338_1000151929 | 339 |
| 128 | 3300028800 | Ga0265338_10017078 | Ga0265338_100170785 | 339 |
| 129 | 3300031238 | Ga0265332_10009991 | Ga0265332_100099913 | 339 |
| 130 | 3300031240 | Ga0265320_10015573 | Ga0265320_100155734 | 339 |
| 131 | 3300031247 | Ga0265340_10009267 | Ga0265340_100092675 | 339 |
| 132 | 3300031249 | Ga0265339_10037623 | Ga0265339_100376232 | 339 |
| 133 | 3300031344 | Ga0265316_10037167 | Ga0265316_100371673 | 339 |
| 134 | 3300031712 | Ga0265342_10009280 | Ga0265342_100092803 | 339 |
| 135 | 3300031731 | Ga0307405_10050783 | Ga0307405_100507833 | 339 |
| 136 | 3300031901 | Ga0307406_10057378 | Ga0307406_100573782 | 339 |
| 137 | 3300031901 | Ga0307406_10091403 | Ga0307406_100914032 | 339 |
| 138 | 3300031911 | Ga0307412_10106985 | Ga0307412_101069852 | 339 |
| 139 | 3300041413 | Ga0439465_0018753 | Ga0439465_0018753_1020_2042 | 339 |
| 140 | 3300042004 | Ga0439445_0001683 | Ga0439445_0001683_892_1914 | 339 |
| 141 | 3300005367 | Ga0070667_100058488 | Ga0070667_1000584883 | 340 |
| 142 | 3300005434 | Ga0070709_10040421 | Ga0070709_100404212 | 340 |
| 143 | 3300005437 | Ga0070710_10036310 | Ga0070710_100363103 | 340 |
| 144 | 3300006051 | Ga0075364_10014035 | Ga0075364_100140358 | 340 |
| 145 | 3300006051 | Ga0075364_10074510 | Ga0075364_100745102 | 340 |
| 146 | 3300006173 | Ga0070716_100009647 | Ga0070716_1000096473 | 340 |
| 147 | 3300006175 | Ga0070712_100026615 | Ga0070712_1000266151 | 340 |
| 148 | 3300006186 | Ga0075369_10034319 | Ga0075369_100343192 | 340 |
| 149 | 3300006353 | Ga0075370_10037088 | Ga0075370_100370882 | 340 |
| 150 | 3300013105 | Ga0157369_10105887 | Ga0157369_101058872 | 340 |
| 151 | 3300025246 | Ga0209646_1000041 | Ga0209646_1000041302 | 340 |
| 152 | 3300025898 | Ga0207692_10077885 | Ga0207692_100778852 | 340 |
| 153 | 3300025916 | Ga0207663_10113362 | Ga0207663_101133621 | 340 |
| 154 | 3300025939 | Ga0207665_10016340 | Ga0207665_100163403 | 340 |
| 155 | 3300025986 | Ga0207658_10146244 | Ga0207658_101462442 | 340 |
| 156 | 3300031731 | Ga0307405_10108608 | Ga0307405_101086082 | 340 |
| 157 | 3300031838 | Ga0307518_10120711 | Ga0307518_101207112 | 340 |
| 158 | 3300031901 | Ga0307406_10000462 | Ga0307406_1000046219 | 340 |
| 159 | 3300044765 | Ga0466970_0126734 | Ga0466970_0126734_325_1377 | 340 |
| 160 | 3300046453 | Ga0495627_000659 | Ga0495627_000659_14002_15093 | 340 |
| 161 | 3300046471 | Ga0495650_0003801 | Ga0495650_0003801_880_1953 | 340 |
| 162 | 3300048905 | Ga0496102_0086104 | Ga0496102_0086104_1423_2454 | 340 |
| 163 | 3300048920 | Ga0496117_0002843 | Ga0496117_0002843_10631_11722 | 340 |
| 164 | 3300048920 | Ga0496117_0050975 | Ga0496117_0050975_231_1337 | 340 |
| 165 | 3300048921 | Ga0496118_0021365 | Ga0496118_0021365_3126_4232 | 340 |
| 166 | 3300048922 | Ga0496119_0001501 | Ga0496119_0001501_3203_4309 | 340 |
| 167 | 3300048923 | Ga0496120_0001468 | Ga0496120_0001468_8098_9204 | 340 |
| 168 | 3300048925 | Ga0496122_0000022 | Ga0496122_0000022_131015_132121 | 340 |
| 169 | 3300048925 | Ga0496122_0015661 | Ga0496122_0015661_206_1297 | 340 |
| 170 | 3300048926 | Ga0496123_0000016 | Ga0496123_0000016_177962_179068 | 340 |
| 171 | 3300048927 | Ga0496124_0028795 | Ga0496124_0028795_359_1465 | 340 |
| 172 | 3300048928 | Ga0496125_0008550 | Ga0496125_0008550_3562_4668 | 340 |
| 173 | 3300048928 | Ga0496125_0009139 | Ga0496125_0009139_356_1447 | 340 |
| 174 | 3300048928 | Ga0496125_0045796 | Ga0496125_0045796_2284_3375 | 340 |
| 175 | 3300048929 | Ga0496126_0008872 | Ga0496126_0008872_471_1577 | 340 |
| 176 | 3300048929 | Ga0496126_0014353 | Ga0496126_0014353_3105_4196 | 340 |
| 177 | 3300049571 | Ga0501034_0078831 | Ga0501034_0078831_1865_2917 | 340 |
| 178 | 3300049579 | Ga0501043_0001927 | Ga0501043_0001927_13730_14812 | 340 |
| 179 | 3300050491 | nmdc:mga00v17_134573_c1 | nmdc:mga00v17_134573_c1_172_1263 | 340 |
| 180 | 3300050491 | nmdc:mga00v17_5113_c1 | nmdc:mga00v17_5113_c1_2577_3668 | 340 |
| 181 | 3300050491 | nmdc:mga00v17_7394_c1 | nmdc:mga00v17_7394_c1_3892_4998 | 340 |
| 182 | 3300050492 | nmdc:mga0yw44_19322_c1 | nmdc:mga0yw44_19322_c1_2660_3715 | 340 |
| 183 | 3300053093 | Ga0500651_0000214 | Ga0500651_0000214_16333_17406 | 340 |
| 184 | iso_pu_bacteria | 2585428157 | 2588108059 | 340 |
| 185 | iso_pu_bacteria | 2643221553 | 2643783650 | 340 |
| 186 | iso_pu_bacteria | 2643221630 | 2644172843 | 340 |
| 187 | iso_pu_bacteria | 2643221724 | 2644679111 | 340 |
| 188 | iso_pu_bacteria | 2728369380 | 2730228609 | 340 |
| 189 | iso_pu_bacteria | 2747842429 | 2747952489 | 340 |
| 190 | iso_pu_bacteria | 2808606447 | 2809228354 | 340 |
| 191 | iso_pu_bacteria | 2852663356 | 2852666063 | 340 |
| 192 | iso_pu_bacteria | 2857723135 | 2857724520 | 340 |
| 193 | iso_pu_bacteria | 2862993130 | 2862993942 | 340 |
| 194 | iso_pu_bacteria | 2945968032 | 2945970674 | 340 |
| 195 | iso_pu_bacteria | 2946041624 | 2946043010 | 340 |
| 196 | iso_pu_bacteria | 2946080515 | 2946081953 | 340 |
| 197 | iso_pu_bacteria | 2977251589 | 2977253213 | 340 |
| 198 | iso_pu_bacteria | 2977264416 | 2977265432 | 340 |
| 199 | iso_pu_bacteria | 8004182704 | 8004183397 | 340 |
| 200 | 3300005355 | Ga0070671_100010086 | Ga0070671_1000100865 | 341 |
| 201 | 3300005367 | Ga0070667_100006910 | Ga0070667_1000069103 | 341 |
| 202 | 3300005367 | Ga0070667_100149497 | Ga0070667_1001494971 | 341 |
| 203 | 3300005548 | Ga0070665_100035428 | Ga0070665_1000354283 | 341 |
| 204 | 3300005618 | Ga0068864_100159003 | Ga0068864_1001590031 | 341 |
| 205 | 3300005841 | Ga0068863_100007296 | Ga0068863_10000729611 | 341 |
| 206 | 3300009553 | Ga0105249_10091434 | Ga0105249_100914342 | 341 |
| 207 | 3300014325 | Ga0163163_10053751 | Ga0163163_100537515 | 341 |
| 208 | 3300014325 | Ga0163163_10142678 | Ga0163163_101426782 | 341 |
| 209 | 3300025931 | Ga0207644_10019771 | Ga0207644_100197714 | 341 |
| 210 | 3300025961 | Ga0207712_10122550 | Ga0207712_101225502 | 341 |
| 211 | 3300025986 | Ga0207658_10012804 | Ga0207658_100128042 | 341 |
| 212 | 3300026088 | Ga0207641_10019863 | Ga0207641_100198633 | 341 |
| 213 | 3300026095 | Ga0207676_10146585 | Ga0207676_101465853 | 341 |
| 214 | 3300028379 | Ga0268266_10022876 | Ga0268266_100228765 | 341 |
| 215 | 3300044735 | Ga0466968_0008136 | Ga0466968_0008136_2015_3049 | 341 |
| 216 | 3300044765 | Ga0466970_0025620 | Ga0466970_0025620_661_1734 | 341 |
| 217 | 3300045049 | Ga0466959_0098042 | Ga0466959_0098042_897_1931 | 341 |
| 218 | 3300048913 | Ga0496110_0012624 | Ga0496110_0012624_5408_6445 | 341 |
| 219 | 3300048913 | Ga0496110_0221299 | Ga0496110_0221299_21_1058 | 341 |
| 220 | 3300048915 | Ga0496112_0040147 | Ga0496112_0040147_675_1712 | 341 |
| 221 | 3300048917 | Ga0496114_0064031 | Ga0496114_0064031_1438_2496 | 341 |
| 222 | 3300048929 | Ga0496126_0188175 | Ga0496126_0188175_67_1146 | 341 |
| 223 | 3300050492 | nmdc:mga0yw44_66186_c1 | nmdc:mga0yw44_66186_c1_465_1502 | 341 |
| 224 | iso_pu_bacteria | 2643221572 | 2643877309 | 341 |
| 225 | iso_pu_bacteria | 2643221669 | 2644384364 | 341 |
| 226 | iso_pu_bacteria | 2643221715 | 2644636841 | 341 |
| 227 | iso_pu_bacteria | 2857720070 | 2857720898 | 341 |
| 228 | iso_pu_bacteria | 2895660088 | 2895661879 | 341 |
| 229 | iso_pu_bacteria | 2919395869 | 2919397785 | 341 |
| 230 | 3300002077 | JGI24744J21845_10000925 | JGI24744J21845_100009257 | 342 |
| 231 | 3300002077 | JGI24744J21845_10002976 | JGI24744J21845_100029763 | 342 |
| 232 | 3300003578 | Ga0006562J51391_1052848 | Ga0006562J51391_10528483 | 342 |
| 233 | 3300003578 | Ga0006562J51391_1052849 | Ga0006562J51391_10528493 | 342 |
| 234 | 3300005330 | Ga0070690_100020140 | Ga0070690_1000201403 | 342 |
| 235 | 3300005337 | Ga0070682_100016863 | Ga0070682_1000168632 | 342 |
| 236 | 3300005338 | Ga0068868_100020559 | Ga0068868_1000205595 | 342 |
| 237 | 3300005340 | Ga0070689_100302899 | Ga0070689_1003028992 | 342 |
| 238 | 3300005341 | Ga0070691_10014414 | Ga0070691_100144144 | 342 |
| 239 | 3300005365 | Ga0070688_100009770 | Ga0070688_1000097703 | 342 |
| 240 | 3300005365 | Ga0070688_100096343 | Ga0070688_1000963432 | 342 |
| 241 | 3300005367 | Ga0070667_100004304 | Ga0070667_10000430410 | 342 |
| 242 | 3300005367 | Ga0070667_100073872 | Ga0070667_1000738724 | 342 |
| 243 | 3300005434 | Ga0070709_10248454 | Ga0070709_102484542 | 342 |
| 244 | 3300005437 | Ga0070710_10001142 | Ga0070710_100011425 | 342 |
| 245 | 3300005437 | Ga0070710_10006248 | Ga0070710_100062482 | 342 |
| 246 | 3300005439 | Ga0070711_100019946 | Ga0070711_1000199464 | 342 |
| 247 | 3300005439 | Ga0070711_100063410 | Ga0070711_1000634103 | 342 |
| 248 | 3300005439 | Ga0070711_100311184 | Ga0070711_1003111841 | 342 |
| 249 | 3300005440 | Ga0070705_100009661 | Ga0070705_1000096612 | 342 |
| 250 | 3300005441 | Ga0070700_100015753 | Ga0070700_1000157533 | 342 |
| 251 | 3300005441 | Ga0070700_100027635 | Ga0070700_1000276351 | 342 |
| 252 | 3300005444 | Ga0070694_100034977 | Ga0070694_1000349772 | 342 |
| 253 | 3300005455 | Ga0070663_100028191 | Ga0070663_1000281912 | 342 |
| 254 | 3300005455 | Ga0070663_100059005 | Ga0070663_1000590052 | 342 |
| 255 | 3300005456 | Ga0070678_100033574 | Ga0070678_1000335744 | 342 |
| 256 | 3300005457 | Ga0070662_100015453 | Ga0070662_1000154533 | 342 |
| 257 | 3300005459 | Ga0068867_100036674 | Ga0068867_1000366742 | 342 |
| 258 | 3300005468 | Ga0070707_100008194 | Ga0070707_1000081946 | 342 |
| 259 | 3300005471 | Ga0070698_100075960 | Ga0070698_1000759602 | 342 |
| 260 | 3300005539 | Ga0068853_100017673 | Ga0068853_1000176736 | 342 |
| 261 | 3300005539 | Ga0068853_100038126 | Ga0068853_1000381262 | 342 |
| 262 | 3300005544 | Ga0070686_100263802 | Ga0070686_1002638021 | 342 |
| 263 | 3300005548 | Ga0070665_100019294 | Ga0070665_1000192945 | 342 |
| 264 | 3300005548 | Ga0070665_100059445 | Ga0070665_1000594452 | 342 |
| 265 | 3300005549 | Ga0070704_100001394 | Ga0070704_1000013948 | 342 |
| 266 | 3300005563 | Ga0068855_100024676 | Ga0068855_1000246762 | 342 |
| 267 | 3300005563 | Ga0068855_100607443 | Ga0068855_1006074431 | 342 |
| 268 | 3300005578 | Ga0068854_100034070 | Ga0068854_1000340704 | 342 |
| 269 | 3300005614 | Ga0068856_100159916 | Ga0068856_1001599162 | 342 |
| 270 | 3300005615 | Ga0070702_100148572 | Ga0070702_1001485722 | 342 |
| 271 | 3300005617 | Ga0068859_100016504 | Ga0068859_1000165047 | 342 |
| 272 | 3300005617 | Ga0068859_100047711 | Ga0068859_1000477112 | 342 |
| 273 | 3300005718 | Ga0068866_10000565 | Ga0068866_1000056514 | 342 |
| 274 | 3300005718 | Ga0068866_10116007 | Ga0068866_101160072 | 342 |
| 275 | 3300005719 | Ga0068861_100022577 | Ga0068861_1000225775 | 342 |
| 276 | 3300005719 | Ga0068861_100048315 | Ga0068861_1000483152 | 342 |
| 277 | 3300005719 | Ga0068861_100053692 | Ga0068861_1000536922 | 342 |
| 278 | 3300005834 | Ga0068851_10045682 | Ga0068851_100456822 | 342 |
| 279 | 3300005842 | Ga0068858_100025787 | Ga0068858_1000257872 | 342 |
| 280 | 3300005843 | Ga0068860_100057127 | Ga0068860_1000571274 | 342 |
| 281 | 3300005844 | Ga0068862_100004446 | Ga0068862_1000044464 | 342 |
| 282 | 3300005937 | Ga0081455_10080041 | Ga0081455_100800413 | 342 |
| 283 | 3300006038 | Ga0075365_10196945 | Ga0075365_101969451 | 342 |
| 284 | 3300006048 | Ga0075363_100000810 | Ga0075363_1000008103 | 342 |
| 285 | 3300006048 | Ga0075363_100093533 | Ga0075363_1000935332 | 342 |
| 286 | 3300006048 | Ga0075363_100127560 | Ga0075363_1001275601 | 342 |
| 287 | 3300006051 | Ga0075364_10101518 | Ga0075364_101015182 | 342 |
| 288 | 3300006051 | Ga0075364_10128235 | Ga0075364_101282352 | 342 |
| 289 | 3300006163 | Ga0070715_10009036 | Ga0070715_100090364 | 342 |
| 290 | 3300006173 | Ga0070716_100053789 | Ga0070716_1000537892 | 342 |
| 291 | 3300006175 | Ga0070712_100027713 | Ga0070712_1000277132 | 342 |
| 292 | 3300006358 | Ga0068871_100214564 | Ga0068871_1002145642 | 342 |
| 293 | 3300006844 | Ga0075428_100002613 | Ga0075428_10000261314 | 342 |
| 294 | 3300006846 | Ga0075430_100050723 | Ga0075430_1000507234 | 342 |
| 295 | 3300006881 | Ga0068865_100031272 | Ga0068865_1000312722 | 342 |
| 296 | 3300006931 | Ga0097620_100016503 | Ga0097620_1000165037 | 342 |
| 297 | 3300006931 | Ga0097620_100047713 | Ga0097620_1000477132 | 342 |
| 298 | 3300009098 | Ga0105245_10029659 | Ga0105245_100296595 | 342 |
| 299 | 3300009098 | Ga0105245_10047438 | Ga0105245_100474381 | 342 |
| 300 | 3300009101 | Ga0105247_10000021 | Ga0105247_1000002147 | 342 |
| 301 | 3300009101 | Ga0105247_10001116 | Ga0105247_100011161 | 342 |
| 302 | 3300009101 | Ga0105247_10003213 | Ga0105247_1000321312 | 342 |
| 303 | 3300009101 | Ga0105247_10015303 | Ga0105247_100153033 | 342 |
| 304 | 3300009147 | Ga0114129_10012530 | Ga0114129_100125304 | 342 |
| 305 | 3300009148 | Ga0105243_10001479 | Ga0105243_100014792 | 342 |
| 306 | 3300009174 | Ga0105241_10039510 | Ga0105241_100395104 | 342 |
| 307 | 3300009176 | Ga0105242_10055802 | Ga0105242_100558023 | 342 |
| 308 | 3300009177 | Ga0105248_10002026 | Ga0105248_100020267 | 342 |
| 309 | 3300009177 | Ga0105248_10011195 | Ga0105248_100111954 | 342 |
| 310 | 3300009177 | Ga0105248_10082701 | Ga0105248_100827012 | 342 |
| 311 | 3300009545 | Ga0105237_10040735 | Ga0105237_100407352 | 342 |
| 312 | 3300009553 | Ga0105249_10000334 | Ga0105249_100003348 | 342 |
| 313 | 3300009553 | Ga0105249_10021666 | Ga0105249_100216662 | 342 |
| 314 | 3300010375 | Ga0105239_10032795 | Ga0105239_100327956 | 342 |
| 315 | 3300011119 | Ga0105246_10156933 | Ga0105246_101569332 | 342 |
| 316 | 3300013296 | Ga0157374_10058281 | Ga0157374_100582813 | 342 |
| 317 | 3300013296 | Ga0157374_10441268 | Ga0157374_104412681 | 342 |
| 318 | 3300013297 | Ga0157378_10019079 | Ga0157378_100190792 | 342 |
| 319 | 3300013307 | Ga0157372_10037399 | Ga0157372_100373992 | 342 |
| 320 | 3300013307 | Ga0157372_10075895 | Ga0157372_100758952 | 342 |
| 321 | 3300014325 | Ga0163163_10062868 | Ga0163163_100628684 | 342 |
| 322 | 3300014325 | Ga0163163_10084778 | Ga0163163_100847784 | 342 |
| 323 | 3300014745 | Ga0157377_10024886 | Ga0157377_100248862 | 342 |
| 324 | 3300014969 | Ga0157376_10237576 | Ga0157376_102375761 | 342 |
| 325 | 3300017792 | Ga0163161_10061013 | Ga0163161_100610132 | 342 |
| 326 | 3300017792 | Ga0163161_10068721 | Ga0163161_100687212 | 342 |
| 327 | 3300025321 | Ga0207656_10026127 | Ga0207656_100261272 | 342 |
| 328 | 3300025898 | Ga0207692_10004112 | Ga0207692_100041122 | 342 |
| 329 | 3300025899 | Ga0207642_10002868 | Ga0207642_100028684 | 342 |
| 330 | 3300025900 | Ga0207710_10013676 | Ga0207710_100136762 | 342 |
| 331 | 3300025900 | Ga0207710_10027108 | Ga0207710_100271083 | 342 |
| 332 | 3300025901 | Ga0207688_10000922 | Ga0207688_1000092212 | 342 |
| 333 | 3300025901 | Ga0207688_10003057 | Ga0207688_100030574 | 342 |
| 334 | 3300025903 | Ga0207680_10241954 | Ga0207680_102419541 | 342 |
| 335 | 3300025904 | Ga0207647_10020846 | Ga0207647_100208463 | 342 |
| 336 | 3300025906 | Ga0207699_10054340 | Ga0207699_100543403 | 342 |
| 337 | 3300025915 | Ga0207693_10001596 | Ga0207693_1000159620 | 342 |
| 338 | 3300025916 | Ga0207663_10176184 | Ga0207663_101761842 | 342 |
| 339 | 3300025918 | Ga0207662_10022056 | Ga0207662_100220563 | 342 |
| 340 | 3300025919 | Ga0207657_10060693 | Ga0207657_100606933 | 342 |
| 341 | 3300025923 | Ga0207681_10070177 | Ga0207681_100701772 | 342 |
| 342 | 3300025927 | Ga0207687_10015909 | Ga0207687_100159092 | 342 |
| 343 | 3300025927 | Ga0207687_10030610 | Ga0207687_100306102 | 342 |
| 344 | 3300025932 | Ga0207690_10029858 | Ga0207690_100298584 | 342 |
| 345 | 3300025933 | Ga0207706_10027634 | Ga0207706_100276345 | 342 |
| 346 | 3300025933 | Ga0207706_10114659 | Ga0207706_101146592 | 342 |
| 347 | 3300025935 | Ga0207709_10007028 | Ga0207709_100070285 | 342 |
| 348 | 3300025936 | Ga0207670_10149624 | Ga0207670_101496242 | 342 |
| 349 | 3300025937 | Ga0207669_10003219 | Ga0207669_100032194 | 342 |
| 350 | 3300025937 | Ga0207669_10190042 | Ga0207669_101900422 | 342 |
| 351 | 3300025938 | Ga0207704_10048508 | Ga0207704_100485082 | 342 |
| 352 | 3300025942 | Ga0207689_10012303 | Ga0207689_100123037 | 342 |
| 353 | 3300025949 | Ga0207667_10006383 | Ga0207667_1000638310 | 342 |
| 354 | 3300025949 | Ga0207667_10380504 | Ga0207667_103805042 | 342 |
| 355 | 3300025981 | Ga0207640_10029516 | Ga0207640_100295164 | 342 |
| 356 | 3300025986 | Ga0207658_10025959 | Ga0207658_100259594 | 342 |
| 357 | 3300026023 | Ga0207677_10045644 | Ga0207677_100456442 | 342 |
| 358 | 3300026023 | Ga0207677_10370676 | Ga0207677_103706761 | 342 |
| 359 | 3300026035 | Ga0207703_10015313 | Ga0207703_100153132 | 342 |
| 360 | 3300026041 | Ga0207639_10006233 | Ga0207639_100062339 | 342 |
| 361 | 3300026041 | Ga0207639_10434399 | Ga0207639_104343991 | 342 |
| 362 | 3300026067 | Ga0207678_10060056 | Ga0207678_100600562 | 342 |
| 363 | 3300026067 | Ga0207678_10069407 | Ga0207678_100694072 | 342 |
| 364 | 3300026075 | Ga0207708_10018119 | Ga0207708_100181193 | 342 |
| 365 | 3300026075 | Ga0207708_10038560 | Ga0207708_100385604 | 342 |
| 366 | 3300026078 | Ga0207702_10192713 | Ga0207702_101927132 | 342 |
| 367 | 3300026089 | Ga0207648_10013316 | Ga0207648_100133164 | 342 |
| 368 | 3300026089 | Ga0207648_10161045 | Ga0207648_101610452 | 342 |
| 369 | 3300026118 | Ga0207675_100001865 | Ga0207675_1000018652 | 342 |
| 370 | 3300026118 | Ga0207675_100024098 | Ga0207675_1000240982 | 342 |
| 371 | 3300026121 | Ga0207683_10001241 | Ga0207683_1000124123 | 342 |
| 372 | 3300026121 | Ga0207683_10093339 | Ga0207683_100933392 | 342 |
| 373 | 3300026142 | Ga0207698_10166665 | Ga0207698_101666652 | 342 |
| 374 | 3300028379 | Ga0268266_10027973 | Ga0268266_100279735 | 342 |
| 375 | 3300028379 | Ga0268266_10039795 | Ga0268266_100397953 | 342 |
| 376 | 3300028381 | Ga0268264_10075912 | Ga0268264_100759123 | 342 |
| 377 | 3300031901 | Ga0307406_10000084 | Ga0307406_1000008426 | 342 |
| 378 | 3300032002 | Ga0307416_100294501 | Ga0307416_1002945011 | 342 |
| 379 | 3300035086 | Ga0373934_0014375 | Ga0373934_0014375_1218_2276 | 342 |
| 380 | 3300035111 | Ga0373923_0004663 | Ga0373923_0004663_3252_4310 | 342 |
| 381 | 3300035112 | Ga0373932_0043171 | Ga0373932_0043171_105_1190 | 342 |
| 382 | 3300035113 | Ga0373936_0001862 | Ga0373936_0001862_2003_3061 | 342 |
| 383 | 3300035117 | Ga0373953_0004506 | Ga0373953_0004506_1381_2439 | 342 |
| 384 | 3300035118 | Ga0373954_0035972 | Ga0373954_0035972_388_1446 | 342 |
| 385 | 3300035119 | Ga0373956_0010810 | Ga0373956_0010810_852_1910 | 342 |
| 386 | 3300035120 | Ga0373957_0001974 | Ga0373957_0001974_851_1909 | 342 |
| 387 | 3300035172 | Ga0373955_0007386 | Ga0373955_0007386_388_1446 | 342 |
| 388 | 3300035242 | Ga0373962_0026856 | Ga0373962_0026856_217_1302 | 342 |
| 389 | 3300035410 | Ga0373924_0002394 | Ga0373924_0002394_1071_2129 | 342 |
| 390 | 3300035691 | Ga0373931_0003677 | Ga0373931_0003677_3616_4701 | 342 |
| 391 | 3300035691 | Ga0373931_0024198 | Ga0373931_0024198_1863_2912 | 342 |
| 392 | 3300035692 | Ga0373935_0004857 | Ga0373935_0004857_1381_2439 | 342 |
| 393 | 3300035724 | Ga0373933_0004119 | Ga0373933_0004119_4351_5409 | 342 |
| 394 | 3300036401 | Ga0373937_0055905 | Ga0373937_0055905_283_1341 | 342 |
| 395 | 3300037068 | Ga0373925_0160652 | Ga0373925_0160652_37_1098 | 342 |
| 396 | 3300037466 | Ga0395898_0156465 | Ga0395898_0156465_1050_2153 | 342 |
| 397 | 3300041411 | Ga0439466_0002551 | Ga0439466_0002551_4376_5425 | 342 |
| 398 | 3300041413 | Ga0439465_0007508 | Ga0439465_0007508_101_1150 | 342 |
| 399 | 3300041997 | Ga0439431_0005291 | Ga0439431_0005291_666_1715 | 342 |
| 400 | 3300044658 | Ga0466972_0137762 | Ga0466972_0137762_27_1055 | 342 |
| 401 | 3300044693 | Ga0466961_0126498 | Ga0466961_0126498_490_1539 | 342 |
| 402 | 3300044765 | Ga0466970_0000001 | Ga0466970_0000001_152669_153769 | 342 |
| 403 | 3300044765 | Ga0466970_0025418 | Ga0466970_0025418_997_2046 | 342 |
| 404 | 3300044765 | Ga0466970_0086871 | Ga0466970_0086871_182_1231 | 342 |
| 405 | 3300045976 | Ga0466967_0195791 | Ga0466967_0195791_674_1723 | 342 |
| 406 | 3300045976 | Ga0466967_0403646 | Ga0466967_0403646_138_1178 | 342 |
| 407 | 3300046454 | Ga0495592_0048698 | Ga0495592_0048698_388_1446 | 342 |
| 408 | 3300046459 | Ga0495629_0000993 | Ga0495629_0000993_6576_7634 | 342 |
| 409 | 3300046462 | Ga0495651_0013521 | Ga0495651_0013521_2971_4029 | 342 |
| 410 | 3300046463 | Ga0495653_0027159 | Ga0495653_0027159_724_1782 | 342 |
| 411 | 3300046473 | Ga0495582_0001321 | Ga0495582_0001321_1692_2750 | 342 |
| 412 | 3300046475 | Ga0495639_0005485 | Ga0495639_0005485_2390_3448 | 342 |
| 413 | 3300046476 | Ga0495662_0025253 | Ga0495662_0025253_851_1909 | 342 |
| 414 | 3300046477 | Ga0495664_0025265 | Ga0495664_0025265_1548_2606 | 342 |
| 415 | 3300046511 | Ga0495608_0013379 | Ga0495608_0013379_1381_2439 | 342 |
| 416 | 3300046514 | Ga0495618_0013760 | Ga0495618_0013760_3605_4663 | 342 |
| 417 | 3300046516 | Ga0495628_0042575 | Ga0495628_0042575_724_1782 | 342 |
| 418 | 3300046517 | Ga0495630_0049166 | Ga0495630_0049166_1838_2896 | 342 |
| 419 | 3300046529 | Ga0495652_0055561 | Ga0495652_0055561_260_1318 | 342 |
| 420 | 3300046531 | Ga0495665_0001805 | Ga0495665_0001805_9749_10807 | 342 |
| 421 | 3300046533 | Ga0495640_0023234 | Ga0495640_0023234_1870_2928 | 342 |
| 422 | 3300046536 | Ga0495587_0031736 | Ga0495587_0031736_1139_2197 | 342 |
| 423 | 3300046543 | Ga0495645_0022367 | Ga0495645_0022367_1677_2735 | 342 |
| 424 | 3300046559 | Ga0495667_0004804 | Ga0495667_0004804_4601_5659 | 342 |
| 425 | 3300046642 | Ga0495634_0019930 | Ga0495634_0019930_3442_4500 | 342 |
| 426 | 3300046663 | Ga0495635_0010854 | Ga0495635_0010854_724_1782 | 342 |
| 427 | 3300046675 | Ga0495657_0014053 | Ga0495657_0014053_1381_2439 | 342 |
| 428 | 3300046678 | Ga0495599_0056494 | Ga0495599_0056494_1139_2197 | 342 |
| 429 | 3300046679 | Ga0495623_0026261 | Ga0495623_0026261_852_1910 | 342 |
| 430 | 3300046680 | Ga0495646_0014836 | Ga0495646_0014836_1218_2276 | 342 |
| 431 | 3300046689 | Ga0495613_0009745 | Ga0495613_0009745_4535_5593 | 342 |
| 432 | 3300046690 | Ga0495624_0010818 | Ga0495624_0010818_1139_2197 | 342 |
| 433 | 3300046809 | Ga0495600_0023090 | Ga0495600_0023090_1975_3033 | 342 |
| 434 | 3300047315 | Ga0495581_0002013 | Ga0495581_0002013_7215_8273 | 342 |
| 435 | 3300047317 | Ga0495604_0055873 | Ga0495604_0055873_1724_2782 | 342 |
| 436 | 3300047319 | Ga0495674_0100851 | Ga0495674_0100851_1139_2197 | 342 |
| 437 | 3300047322 | Ga0495680_0011106 | Ga0495680_0011106_3135_4193 | 342 |
| 438 | 3300047444 | Ga0495675_0004571 | Ga0495675_0004571_4537_5595 | 342 |
| 439 | 3300047471 | Ga0495684_0074370 | Ga0495684_0074370_800_1858 | 342 |
| 440 | 3300047673 | Ga0495593_0005468 | Ga0495593_0005468_3156_4214 | 342 |
| 441 | 3300048088 | Ga0495602_0025572 | Ga0495602_0025572_2605_3663 | 342 |
| 442 | 3300048903 | Ga0496100_0003285 | Ga0496100_0003285_226_1275 | 342 |
| 443 | 3300048903 | Ga0496100_0025263 | Ga0496100_0025263_1873_2958 | 342 |
| 444 | 3300048903 | Ga0496100_0070051 | Ga0496100_0070051_164_1225 | 342 |
| 445 | 3300048904 | Ga0496101_0015505 | Ga0496101_0015505_2050_3099 | 342 |
| 446 | 3300048904 | Ga0496101_0106966 | Ga0496101_0106966_444_1502 | 342 |
| 447 | 3300048905 | Ga0496102_0000458 | Ga0496102_0000458_12362_13390 | 342 |
| 448 | 3300048905 | Ga0496102_0009161 | Ga0496102_0009161_4188_5273 | 342 |
| 449 | 3300048905 | Ga0496102_0063338 | Ga0496102_0063338_1286_2335 | 342 |
| 450 | 3300048906 | Ga0496103_0000466 | Ga0496103_0000466_1500_2528 | 342 |
| 451 | 3300048906 | Ga0496103_0010715 | Ga0496103_0010715_4077_5126 | 342 |
| 452 | 3300048906 | Ga0496103_0022667 | Ga0496103_0022667_1916_3001 | 342 |
| 453 | 3300048907 | Ga0496104_0006336 | Ga0496104_0006336_12_1070 | 342 |
| 454 | 3300048907 | Ga0496104_0062216 | Ga0496104_0062216_111_1160 | 342 |
| 455 | 3300048908 | Ga0496105_0024016 | Ga0496105_0024016_991_2076 | 342 |
| 456 | 3300048908 | Ga0496105_0182859 | Ga0496105_0182859_344_1405 | 342 |
| 457 | 3300048909 | Ga0496106_0000592 | Ga0496106_0000592_18368_19429 | 342 |
| 458 | 3300048909 | Ga0496106_0004806 | Ga0496106_0004806_6103_7188 | 342 |
| 459 | 3300048910 | Ga0496107_0008974 | Ga0496107_0008974_4623_5708 | 342 |
| 460 | 3300048910 | Ga0496107_0012670 | Ga0496107_0012670_2073_3122 | 342 |
| 461 | 3300048911 | Ga0496108_0000457 | Ga0496108_0000457_15146_16195 | 342 |
| 462 | 3300048911 | Ga0496108_0015973 | Ga0496108_0015973_1320_2405 | 342 |
| 463 | 3300048912 | Ga0496109_0010428 | Ga0496109_0010428_2516_3565 | 342 |
| 464 | 3300048912 | Ga0496109_0027087 | Ga0496109_0027087_117_1202 | 342 |
| 465 | 3300048912 | Ga0496109_0050077 | Ga0496109_0050077_1160_2221 | 342 |
| 466 | 3300048912 | Ga0496109_0103315 | Ga0496109_0103315_954_1988 | 342 |
| 467 | 3300048913 | Ga0496110_0020634 | Ga0496110_0020634_1705_2754 | 342 |
| 468 | 3300048913 | Ga0496110_0138339 | Ga0496110_0138339_948_2033 | 342 |
| 469 | 3300048914 | Ga0496111_0012381 | Ga0496111_0012381_2422_3507 | 342 |
| 470 | 3300048914 | Ga0496111_0092861 | Ga0496111_0092861_1035_2096 | 342 |
| 471 | 3300048915 | Ga0496112_0070457 | Ga0496112_0070457_2145_3230 | 342 |
| 472 | 3300048915 | Ga0496112_0182663 | Ga0496112_0182663_717_1778 | 342 |
| 473 | 3300048916 | Ga0496113_0015130 | Ga0496113_0015130_298_1377 | 342 |
| 474 | 3300048917 | Ga0496114_0008791 | Ga0496114_0008791_2578_3627 | 342 |
| 475 | 3300048917 | Ga0496114_0029407 | Ga0496114_0029407_1678_2763 | 342 |
| 476 | 3300048918 | Ga0496115_0148301 | Ga0496115_0148301_744_1829 | 342 |
| 477 | 3300048919 | Ga0496116_0007005 | Ga0496116_0007005_3751_4779 | 342 |
| 478 | 3300048920 | Ga0496117_0000607 | Ga0496117_0000607_35591_36694 | 342 |
| 479 | 3300048920 | Ga0496117_0005412 | Ga0496117_0005412_1373_2401 | 342 |
| 480 | 3300048921 | Ga0496118_0003349 | Ga0496118_0003349_1631_2734 | 342 |
| 481 | 3300048921 | Ga0496118_0004676 | Ga0496118_0004676_3551_4579 | 342 |
| 482 | 3300048922 | Ga0496119_0001062 | Ga0496119_0001062_2129_3232 | 342 |
| 483 | 3300048923 | Ga0496120_0009678 | Ga0496120_0009678_5626_6729 | 342 |
| 484 | 3300048923 | Ga0496120_0030264 | Ga0496120_0030264_1559_2641 | 342 |
| 485 | 3300048925 | Ga0496122_0000095 | Ga0496122_0000095_140909_142012 | 342 |
| 486 | 3300048926 | Ga0496123_0000100 | Ga0496123_0000100_27980_29083 | 342 |
| 487 | 3300048927 | Ga0496124_0013426 | Ga0496124_0013426_4806_5909 | 342 |
| 488 | 3300048927 | Ga0496124_0293127 | Ga0496124_0293127_71_1099 | 342 |
| 489 | 3300048928 | Ga0496125_0000326 | Ga0496125_0000326_17274_18392 | 342 |
| 490 | 3300048928 | Ga0496125_0009156 | Ga0496125_0009156_959_2062 | 342 |
| 491 | 3300049571 | Ga0501034_0065853 | Ga0501034_0065853_1078_2118 | 342 |
| 492 | 3300049583 | Ga0501067_0004199 | Ga0501067_0004199_152_1213 | 342 |
| 493 | 3300050489 | nmdc:mga03683_22225_c1 | nmdc:mga03683_22225_c1_1351_2391 | 342 |
| 494 | 3300050490 | nmdc:mga03n38_68713_c1 | nmdc:mga03n38_68713_c1_582_1622 | 342 |
| 495 | 3300050491 | nmdc:mga00v17_2960_c1 | nmdc:mga00v17_2960_c1_73_1113 | 342 |
| 496 | 3300050496 | nmdc:mga07m45_12208_c1 | nmdc:mga07m45_12208_c1_152_1192 | 342 |
| 497 | 3300050507 | nmdc:mga05p37_8977_c1 | nmdc:mga05p37_8977_c1_1641_2687 | 342 |
| 498 | 3300050509 | nmdc:mga0qj67_98222_c1 | nmdc:mga0qj67_98222_c1_1114_2160 | 342 |
| 499 | 3300050510 | nmdc:mga06r32_65895_c1 | nmdc:mga06r32_65895_c1_1700_2746 | 342 |
| 500 | 3300053077 | Ga0495601_0006165 | Ga0495601_0006165_4156_5214 | 342 |
| 501 | 3300053078 | Ga0495612_0038021 | Ga0495612_0038021_387_1445 | 342 |
| 502 | 3300053079 | Ga0500610_0047321 | Ga0500610_0047321_206_1234 | 342 |
| 503 | 3300053084 | Ga0495595_0002906 | Ga0495595_0002906_3513_4571 | 342 |
| 504 | 3300053085 | Ga0495619_0009931 | Ga0495619_0009931_3098_4156 | 342 |
| 505 | iso_pu_bacteria | 2738541274 | 2738708106 | 342 |
| 506 | iso_pu_bacteria | 2738543028 | 2739334358 | 342 |
| 507 | iso_pu_bacteria | 2773857759 | 2774383021 | 342 |
| 508 | iso_pu_bacteria | 2842134933 | 2842136056 | 342 |
| 509 | 3300005334 | Ga0068869_100021575 | Ga0068869_1000215755 | 343 |
| 510 | 3300005356 | Ga0070674_100071222 | Ga0070674_1000712222 | 343 |
| 511 | 3300005440 | Ga0070705_100063932 | Ga0070705_1000639322 | 343 |
| 512 | 3300005444 | Ga0070694_100261197 | Ga0070694_1002611972 | 343 |
| 513 | 3300005471 | Ga0070698_100029267 | Ga0070698_1000292673 | 343 |
| 514 | 3300005546 | Ga0070696_100096784 | Ga0070696_1000967842 | 343 |
| 515 | 3300005547 | Ga0070693_100214599 | Ga0070693_1002145991 | 343 |
| 516 | 3300005577 | Ga0068857_100002430 | Ga0068857_1000024308 | 343 |
| 517 | 3300005616 | Ga0068852_100105101 | Ga0068852_1001051012 | 343 |
| 518 | 3300005834 | Ga0068851_10000009 | Ga0068851_100000094 | 343 |
| 519 | 3300006028 | Ga0070717_10065723 | Ga0070717_100657232 | 343 |
| 520 | 3300006186 | Ga0075369_10009406 | Ga0075369_100094062 | 343 |
| 521 | 3300006846 | Ga0075430_100017367 | Ga0075430_1000173672 | 343 |
| 522 | 3300009551 | Ga0105238_10003262 | Ga0105238_100032629 | 343 |
| 523 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001525 | 343 |
| 524 | 3300025321 | Ga0207656_10000003 | Ga0207656_10000003631 | 343 |
| 525 | 3300025321 | Ga0207656_10000004 | Ga0207656_10000004488 | 343 |
| 526 | 3300025728 | Ga0207655_1020411 | Ga0207655_10204113 | 343 |
| 527 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001523 | 343 |
| 528 | 3300025915 | Ga0207693_10194033 | Ga0207693_101940332 | 343 |
| 529 | 3300025942 | Ga0207689_10026243 | Ga0207689_100262434 | 343 |
| 530 | 3300026116 | Ga0207674_10002645 | Ga0207674_1000264517 | 343 |
| 531 | 3300026142 | Ga0207698_10002468 | Ga0207698_100024689 | 343 |
| 532 | 3300031456 | Ga0307513_10003355 | Ga0307513_1000335517 | 343 |
| 533 | 3300031824 | Ga0307413_10132531 | Ga0307413_101325312 | 343 |
| 534 | 3300031852 | Ga0307410_10228907 | Ga0307410_102289072 | 343 |
| 535 | 3300032126 | Ga0307415_100228548 | Ga0307415_1002285482 | 343 |
| 536 | 3300033179 | Ga0307507_10000024 | Ga0307507_10000024113 | 343 |
| 537 | 3300035725 | Ga0373947_0194624 | Ga0373947_0194624_51_1097 | 343 |
| 538 | 3300036401 | Ga0373937_0409301 | Ga0373937_0409301_200_1246 | 343 |
| 539 | 3300041413 | Ga0439465_0005845 | Ga0439465_0005845_854_1906 | 343 |
| 540 | 3300041413 | Ga0439465_0010776 | Ga0439465_0010776_1437_2492 | 343 |
| 541 | 3300041456 | Ga0451795_0736678 | Ga0451795_0736678_54_1157 | 343 |
| 542 | 3300044765 | Ga0466970_0003519 | Ga0466970_0003519_6365_7405 | 343 |
| 543 | 3300045049 | Ga0466959_0129680 | Ga0466959_0129680_38_1078 | 343 |
| 544 | 3300046459 | Ga0495629_0014583 | Ga0495629_0014583_4119_5165 | 343 |
| 545 | 3300046473 | Ga0495582_0015162 | Ga0495582_0015162_78_1124 | 343 |
| 546 | 3300046476 | Ga0495662_0030506 | Ga0495662_0030506_54_1100 | 343 |
| 547 | 3300046517 | Ga0495630_0275571 | Ga0495630_0275571_95_1141 | 343 |
| 548 | 3300046533 | Ga0495640_0050600 | Ga0495640_0050600_1096_2142 | 343 |
| 549 | 3300047315 | Ga0495581_0007135 | Ga0495581_0007135_5205_6251 | 343 |
| 550 | 3300047319 | Ga0495674_0060234 | Ga0495674_0060234_763_1809 | 343 |
| 551 | 3300048904 | Ga0496101_0042441 | Ga0496101_0042441_796_1848 | 343 |
| 552 | 3300048905 | Ga0496102_0019400 | Ga0496102_0019400_3015_4067 | 343 |
| 553 | 3300048918 | Ga0496115_0012317 | Ga0496115_0012317_1331_2410 | 343 |
| 554 | 3300048918 | Ga0496115_0083354 | Ga0496115_0083354_1451_2503 | 343 |
| 555 | 3300050516 | nmdc:mga0sz30_15979_c1 | nmdc:mga0sz30_15979_c1_746_1798 | 343 |
| 556 | 3300053136 | Ga0500559_0045732 | Ga0500559_0045732_344_1381 | 343 |
| 557 | 3300053153 | Ga0500616_0000985 | Ga0500616_0000985_22978_24075 | 343 |
| 558 | 3300053153 | Ga0500616_0089137 | Ga0500616_0089137_388_1482 | 343 |
| 559 | 3300053730 | Ga0500645_000314 | Ga0500645_000314_23240_24277 | 343 |
| 560 | 3300061719 | Ga0466962_0021984 | Ga0466962_0021984_75_1115 | 343 |
| 561 | iso_pu_bacteria | 2818991458 | 2819667160 | 343 |
| 562 | iso_pu_bacteria | 2929212328 | 2929212934 | 343 |
| 563 | iso_pu_bacteria | 2939582691 | 2939583119 | 343 |
| 564 | 3300005334 | Ga0068869_100032335 | Ga0068869_1000323354 | 344 |
| 565 | 3300005347 | Ga0070668_100334812 | Ga0070668_1003348122 | 344 |
| 566 | 3300005364 | Ga0070673_100128577 | Ga0070673_1001285772 | 344 |
| 567 | 3300005436 | Ga0070713_100019191 | Ga0070713_1000191915 | 344 |
| 568 | 3300005436 | Ga0070713_100299752 | Ga0070713_1002997521 | 344 |
| 569 | 3300005455 | Ga0070663_100020914 | Ga0070663_1000209144 | 344 |
| 570 | 3300005564 | Ga0070664_100018762 | Ga0070664_1000187626 | 344 |
| 571 | 3300005841 | Ga0068863_100110113 | Ga0068863_1001101131 | 344 |
| 572 | 3300006038 | Ga0075365_10010713 | Ga0075365_100107135 | 344 |
| 573 | 3300006038 | Ga0075365_10050477 | Ga0075365_100504772 | 344 |
| 574 | 3300006048 | Ga0075363_100015203 | Ga0075363_1000152033 | 344 |
| 575 | 3300006051 | Ga0075364_10013507 | Ga0075364_100135072 | 344 |
| 576 | 3300006051 | Ga0075364_10031738 | Ga0075364_100317384 | 344 |
| 577 | 3300006178 | Ga0075367_10224570 | Ga0075367_102245702 | 344 |
| 578 | 3300006186 | Ga0075369_10001174 | Ga0075369_100011742 | 344 |
| 579 | 3300006186 | Ga0075369_10028775 | Ga0075369_100287753 | 344 |
| 580 | 3300006353 | Ga0075370_10013976 | Ga0075370_100139763 | 344 |
| 581 | 3300011119 | Ga0105246_10013157 | Ga0105246_100131572 | 344 |
| 582 | 3300011119 | Ga0105246_10094654 | Ga0105246_100946542 | 344 |
| 583 | 3300013297 | Ga0157378_10090946 | Ga0157378_100909461 | 344 |
| 584 | 3300025906 | Ga0207699_10179620 | Ga0207699_101796201 | 344 |
| 585 | 3300025928 | Ga0207700_10021101 | Ga0207700_100211014 | 344 |
| 586 | 3300025929 | Ga0207664_10069122 | Ga0207664_100691222 | 344 |
| 587 | 3300025929 | Ga0207664_10126118 | Ga0207664_101261182 | 344 |
| 588 | 3300025945 | Ga0207679_10014500 | Ga0207679_100145005 | 344 |
| 589 | 3300026067 | Ga0207678_10031803 | Ga0207678_100318034 | 344 |
| 590 | 3300026118 | Ga0207675_100046925 | Ga0207675_1000469253 | 344 |
| 591 | 3300031852 | Ga0307410_10168617 | Ga0307410_101686172 | 344 |
| 592 | 3300031903 | Ga0307407_10026016 | Ga0307407_100260161 | 344 |
| 593 | 3300035083 | Ga0373926_0000308 | Ga0373926_0000308_9101_10177 | 344 |
| 594 | 3300035086 | Ga0373934_0018534 | Ga0373934_0018534_1438_2508 | 344 |
| 595 | 3300035089 | Ga0373944_0001289 | Ga0373944_0001289_2646_3722 | 344 |
| 596 | 3300035111 | Ga0373923_0041955 | Ga0373923_0041955_643_1719 | 344 |
| 597 | 3300035113 | Ga0373936_0000921 | Ga0373936_0000921_1705_2781 | 344 |
| 598 | 3300035116 | Ga0373945_0000101 | Ga0373945_0000101_11140_12216 | 344 |
| 599 | 3300035170 | Ga0373943_0000883 | Ga0373943_0000883_10786_11862 | 344 |
| 600 | 3300035171 | Ga0373946_0000138 | Ga0373946_0000138_16403_17479 | 344 |
| 601 | 3300035692 | Ga0373935_0001284 | Ga0373935_0001284_4654_5730 | 344 |
| 602 | 3300035695 | Ga0373927_0018145 | Ga0373927_0018145_1335_2411 | 344 |
| 603 | 3300035724 | Ga0373933_0022301 | Ga0373933_0022301_2239_3309 | 344 |
| 604 | 3300035724 | Ga0373933_0211598 | Ga0373933_0211598_16_1086 | 344 |
| 605 | 3300035725 | Ga0373947_0000959 | Ga0373947_0000959_616_1692 | 344 |
| 606 | 3300036401 | Ga0373937_0027975 | Ga0373937_0027975_2156_3226 | 344 |
| 607 | 3300036401 | Ga0373937_0251759 | Ga0373937_0251759_313_1389 | 344 |
| 608 | 3300037068 | Ga0373925_0009562 | Ga0373925_0009562_1332_2408 | 344 |
| 609 | 3300044683 | Ga0466965_0002722 | Ga0466965_0002722_622_1674 | 344 |
| 610 | 3300044901 | Ga0466960_0000764 | Ga0466960_0000764_5651_6703 | 344 |
| 611 | 3300045976 | Ga0466967_0032527 | Ga0466967_0032527_1758_2834 | 344 |
| 612 | 3300046461 | Ga0495641_0011655 | Ga0495641_0011655_1772_2848 | 344 |
| 613 | 3300046462 | Ga0495651_0147603 | Ga0495651_0147603_248_1324 | 344 |
| 614 | 3300046463 | Ga0495653_0005583 | Ga0495653_0005583_7834_8910 | 344 |
| 615 | 3300046473 | Ga0495582_0097596 | Ga0495582_0097596_419_1495 | 344 |
| 616 | 3300046477 | Ga0495664_0002354 | Ga0495664_0002354_7944_9020 | 344 |
| 617 | 3300046514 | Ga0495618_0004262 | Ga0495618_0004262_357_1433 | 344 |
| 618 | 3300046517 | Ga0495630_0071586 | Ga0495630_0071586_1146_2222 | 344 |
| 619 | 3300046529 | Ga0495652_0015786 | Ga0495652_0015786_243_1319 | 344 |
| 620 | 3300046559 | Ga0495667_0000804 | Ga0495667_0000804_8074_9144 | 344 |
| 621 | 3300046559 | Ga0495667_0002742 | Ga0495667_0002742_2107_3183 | 344 |
| 622 | 3300046642 | Ga0495634_0044903 | Ga0495634_0044903_199_1269 | 344 |
| 623 | 3300046663 | Ga0495635_0000896 | Ga0495635_0000896_9015_10091 | 344 |
| 624 | 3300046675 | Ga0495657_0013962 | Ga0495657_0013962_680_1756 | 344 |
| 625 | 3300046678 | Ga0495599_0021710 | Ga0495599_0021710_1221_2297 | 344 |
| 626 | 3300046690 | Ga0495624_0001916 | Ga0495624_0001916_10815_11891 | 344 |
| 627 | 3300046809 | Ga0495600_0178382 | Ga0495600_0178382_168_1244 | 344 |
| 628 | 3300047315 | Ga0495581_0012048 | Ga0495581_0012048_222_1298 | 344 |
| 629 | 3300047317 | Ga0495604_0229159 | Ga0495604_0229159_159_1235 | 344 |
| 630 | 3300047319 | Ga0495674_0000239 | Ga0495674_0000239_26672_27748 | 344 |
| 631 | 3300047320 | Ga0495672_0049782 | Ga0495672_0049782_156_1196 | 344 |
| 632 | 3300047321 | Ga0495676_0005648 | Ga0495676_0005648_8286_9362 | 344 |
| 633 | 3300047322 | Ga0495680_0002131 | Ga0495680_0002131_4052_5128 | 344 |
| 634 | 3300047322 | Ga0495680_0197724 | Ga0495680_0197724_332_1420 | 344 |
| 635 | 3300047471 | Ga0495684_0000873 | Ga0495684_0000873_993_2069 | 344 |
| 636 | 3300047673 | Ga0495593_0031391 | Ga0495593_0031391_433_1509 | 344 |
| 637 | 3300048904 | Ga0496101_0024596 | Ga0496101_0024596_3020_4111 | 344 |
| 638 | 3300048929 | Ga0496126_0003871 | Ga0496126_0003871_4617_5678 | 344 |
| 639 | 3300048929 | Ga0496126_0006488 | Ga0496126_0006488_340_1401 | 344 |
| 640 | 3300049581 | Ga0501047_0017179 | Ga0501047_0017179_1794_2906 | 344 |
| 641 | 3300050489 | nmdc:mga03683_60462_c1 | nmdc:mga03683_60462_c1_277_1326 | 344 |
| 642 | 3300050490 | nmdc:mga03n38_14266_c1 | nmdc:mga03n38_14266_c1_464_1513 | 344 |
| 643 | 3300050492 | nmdc:mga0yw44_10327_c1 | nmdc:mga0yw44_10327_c1_1587_2654 | 344 |
| 644 | 3300050492 | nmdc:mga0yw44_40047_c1 | nmdc:mga0yw44_40047_c1_1486_2535 | 344 |
| 645 | 3300053087 | Ga0500643_023165 | Ga0500643_023165_857_1897 | 344 |
| 646 | iso_pu_bacteria | 2513237101 | 2513693617 | 344 |
| 647 | iso_pu_bacteria | 2721755755 | 2723847517 | 344 |
| 648 | iso_pu_bacteria | 8006994254 | 8006994503 | 344 |
| 649 | 3300011119 | Ga0105246_10103048 | Ga0105246_101030483 | 345 |
| 650 | 3300017792 | Ga0163161_10061026 | Ga0163161_100610261 | 345 |
| 651 | 3300034818 | Ga0373950_0007108 | Ga0373950_0007108_208_1302 | 345 |
| 652 | 3300048908 | Ga0496105_0090970 | Ga0496105_0090970_155_1204 | 345 |
| 653 | 3300048911 | Ga0496108_0031709 | Ga0496108_0031709_3288_4340 | 345 |
| 654 | 3300048911 | Ga0496108_0164008 | Ga0496108_0164008_113_1162 | 345 |
| 655 | 3300048913 | Ga0496110_0005900 | Ga0496110_0005900_1159_2208 | 345 |
| 656 | 3300048917 | Ga0496114_0014341 | Ga0496114_0014341_2565_3614 | 345 |
| 657 | 3300048917 | Ga0496114_0272667 | Ga0496114_0272667_331_1368 | 345 |
| 658 | 3300053153 | Ga0500616_0050347 | Ga0500616_0050347_640_1677 | 345 |
| 659 | iso_pu_bacteria | 2675903059 | 2676479776 | 345 |
| 660 | iso_pu_bacteria | 2808606365 | 2808875274 | 345 |
| 661 | 3300005353 | Ga0070669_100054081 | Ga0070669_1000540813 | 346 |
| 662 | 3300005356 | Ga0070674_100039668 | Ga0070674_1000396683 | 346 |
| 663 | 3300005367 | Ga0070667_100000022 | Ga0070667_10000002215 | 346 |
| 664 | 3300005539 | Ga0068853_100091382 | Ga0068853_1000913822 | 346 |
| 665 | 3300005548 | Ga0070665_100018725 | Ga0070665_1000187257 | 346 |
| 666 | 3300005617 | Ga0068859_100004797 | Ga0068859_1000047976 | 346 |
| 667 | 3300005841 | Ga0068863_100000699 | Ga0068863_10000069914 | 346 |
| 668 | 3300005842 | Ga0068858_100288373 | Ga0068858_1002883732 | 346 |
| 669 | 3300005843 | Ga0068860_100000038 | Ga0068860_100000038215 | 346 |
| 670 | 3300005844 | Ga0068862_100000064 | Ga0068862_10000006493 | 346 |
| 671 | 3300006931 | Ga0097620_100004797 | Ga0097620_1000047976 | 346 |
| 672 | 3300014326 | Ga0157380_10481514 | Ga0157380_104815141 | 346 |
| 673 | 3300025303 | Ga0209051_1040505 | Ga0209051_10405052 | 346 |
| 674 | 3300025900 | Ga0207710_10000027 | Ga0207710_1000002747 | 346 |
| 675 | 3300025910 | Ga0207684_10090586 | Ga0207684_100905862 | 346 |
| 676 | 3300025932 | Ga0207690_10071197 | Ga0207690_100711973 | 346 |
| 677 | 3300025937 | Ga0207669_10054244 | Ga0207669_100542442 | 346 |
| 678 | 3300025941 | Ga0207711_10001437 | Ga0207711_1000143718 | 346 |
| 679 | 3300025961 | Ga0207712_10000282 | Ga0207712_1000028248 | 346 |
| 680 | 3300025972 | Ga0207668_10000676 | Ga0207668_1000067611 | 346 |
| 681 | 3300025986 | Ga0207658_10000716 | Ga0207658_1000071630 | 346 |
| 682 | 3300026041 | Ga0207639_10187907 | Ga0207639_101879072 | 346 |
| 683 | 3300026088 | Ga0207641_10000162 | Ga0207641_10000162100 | 346 |
| 684 | 3300028380 | Ga0268265_10000028 | Ga0268265_10000028219 | 346 |
| 685 | 3300028381 | Ga0268264_10000092 | Ga0268264_1000009248 | 346 |
| 686 | 3300035083 | Ga0373926_0000572 | Ga0373926_0000572_3800_4915 | 346 |
| 687 | 3300035086 | Ga0373934_0030783 | Ga0373934_0030783_584_1699 | 346 |
| 688 | 3300035089 | Ga0373944_0002647 | Ga0373944_0002647_24_1139 | 346 |
| 689 | 3300035111 | Ga0373923_0000037 | Ga0373923_0000037_10988_12103 | 346 |
| 690 | 3300035113 | Ga0373936_0001261 | Ga0373936_0001261_4346_5461 | 346 |
| 691 | 3300035116 | Ga0373945_0000452 | Ga0373945_0000452_3976_5091 | 346 |
| 692 | 3300035119 | Ga0373956_0023376 | Ga0373956_0023376_1363_2502 | 346 |
| 693 | 3300035120 | Ga0373957_0003438 | Ga0373957_0003438_224_1339 | 346 |
| 694 | 3300035170 | Ga0373943_0003303 | Ga0373943_0003303_422_1537 | 346 |
| 695 | 3300035171 | Ga0373946_0010368 | Ga0373946_0010368_23_1138 | 346 |
| 696 | 3300035172 | Ga0373955_0016657 | Ga0373955_0016657_132_1247 | 346 |
| 697 | 3300035410 | Ga0373924_0048114 | Ga0373924_0048114_256_1371 | 346 |
| 698 | 3300035692 | Ga0373935_0016881 | Ga0373935_0016881_2375_3490 | 346 |
| 699 | 3300035724 | Ga0373933_0006224 | Ga0373933_0006224_1556_2671 | 346 |
| 700 | 3300035725 | Ga0373947_0036554 | Ga0373947_0036554_1044_2159 | 346 |
| 701 | 3300036401 | Ga0373937_0243479 | Ga0373937_0243479_190_1305 | 346 |
| 702 | 3300046454 | Ga0495592_0019916 | Ga0495592_0019916_3230_4345 | 346 |
| 703 | 3300046455 | Ga0495603_0000386 | Ga0495603_0000386_19544_20659 | 346 |
| 704 | 3300046460 | Ga0495638_0001564 | Ga0495638_0001564_12053_13093 | 346 |
| 705 | 3300046461 | Ga0495641_0007841 | Ga0495641_0007841_4861_5976 | 346 |
| 706 | 3300046462 | Ga0495651_0120059 | Ga0495651_0120059_165_1304 | 346 |
| 707 | 3300046463 | Ga0495653_0019124 | Ga0495653_0019124_3686_4801 | 346 |
| 708 | 3300046472 | Ga0495580_0002013 | Ga0495580_0002013_7725_8840 | 346 |
| 709 | 3300046473 | Ga0495582_0001105 | Ga0495582_0001105_2375_3490 | 346 |
| 710 | 3300046475 | Ga0495639_0002021 | Ga0495639_0002021_1946_3061 | 346 |
| 711 | 3300046476 | Ga0495662_0006075 | Ga0495662_0006075_4566_5681 | 346 |
| 712 | 3300046477 | Ga0495664_0051186 | Ga0495664_0051186_1044_2159 | 346 |
| 713 | 3300046499 | Ga0495594_0073313 | Ga0495594_0073313_216_1331 | 346 |
| 714 | 3300046511 | Ga0495608_0002878 | Ga0495608_0002878_353_1468 | 346 |
| 715 | 3300046526 | Ga0495666_0003500 | Ga0495666_0003500_6054_7169 | 346 |
| 716 | 3300046531 | Ga0495665_0000676 | Ga0495665_0000676_5492_6607 | 346 |
| 717 | 3300046535 | Ga0495586_0014221 | Ga0495586_0014221_117_1232 | 346 |
| 718 | 3300046536 | Ga0495587_0009946 | Ga0495587_0009946_1607_2722 | 346 |
| 719 | 3300046543 | Ga0495645_0049307 | Ga0495645_0049307_1269_2384 | 346 |
| 720 | 3300046559 | Ga0495667_0003305 | Ga0495667_0003305_1717_2832 | 346 |
| 721 | 3300046559 | Ga0495667_0198478 | Ga0495667_0198478_113_1228 | 346 |
| 722 | 3300046642 | Ga0495634_0004918 | Ga0495634_0004918_7605_8720 | 346 |
| 723 | 3300046663 | Ga0495635_0007084 | Ga0495635_0007084_6174_7289 | 346 |
| 724 | 3300046674 | Ga0495588_0065485 | Ga0495588_0065485_193_1308 | 346 |
| 725 | 3300046675 | Ga0495657_0047136 | Ga0495657_0047136_1044_2159 | 346 |
| 726 | 3300046678 | Ga0495599_0036429 | Ga0495599_0036429_1044_2159 | 346 |
| 727 | 3300046679 | Ga0495623_0035865 | Ga0495623_0035865_595_1710 | 346 |
| 728 | 3300046680 | Ga0495646_0007293 | Ga0495646_0007293_5322_6437 | 346 |
| 729 | 3300046683 | Ga0495658_0003893 | Ga0495658_0003893_5759_6874 | 346 |
| 730 | 3300046689 | Ga0495613_0008226 | Ga0495613_0008226_5874_6989 | 346 |
| 731 | 3300046690 | Ga0495624_0009187 | Ga0495624_0009187_5153_6268 | 346 |
| 732 | 3300047315 | Ga0495581_0006111 | Ga0495581_0006111_1606_2721 | 346 |
| 733 | 3300047317 | Ga0495604_0007314 | Ga0495604_0007314_5763_6878 | 346 |
| 734 | 3300047319 | Ga0495674_0063206 | Ga0495674_0063206_550_1665 | 346 |
| 735 | 3300047321 | Ga0495676_0038871 | Ga0495676_0038871_2246_3361 | 346 |
| 736 | 3300047322 | Ga0495680_0090600 | Ga0495680_0090600_422_1537 | 346 |
| 737 | 3300047444 | Ga0495675_0017671 | Ga0495675_0017671_2375_3490 | 346 |
| 738 | 3300047471 | Ga0495684_0005728 | Ga0495684_0005728_1107_2222 | 346 |
| 739 | 3300047472 | Ga0495686_0002683 | Ga0495686_0002683_4419_5462 | 346 |
| 740 | 3300047673 | Ga0495593_0000574 | Ga0495593_0000574_1924_3039 | 346 |
| 741 | 3300048088 | Ga0495602_0042486 | Ga0495602_0042486_324_1439 | 346 |
| 742 | 3300048089 | Ga0495614_0006062 | Ga0495614_0006062_3003_4118 | 346 |
| 743 | 3300048903 | Ga0496100_0003723 | Ga0496100_0003723_1646_2686 | 346 |
| 744 | 3300048904 | Ga0496101_0000620 | Ga0496101_0000620_7983_9047 | 346 |
| 745 | 3300048904 | Ga0496101_0019861 | Ga0496101_0019861_2303_3343 | 346 |
| 746 | 3300048907 | Ga0496104_0009998 | Ga0496104_0009998_911_1975 | 346 |
| 747 | 3300048909 | Ga0496106_0014595 | Ga0496106_0014595_3797_4861 | 346 |
| 748 | 3300048910 | Ga0496107_0001235 | Ga0496107_0001235_6539_7603 | 346 |
| 749 | 3300048917 | Ga0496114_0000175 | Ga0496114_0000175_27698_28762 | 346 |
| 750 | 3300048918 | Ga0496115_0003687 | Ga0496115_0003687_1889_2953 | 346 |
| 751 | 3300048923 | Ga0496120_0024867 | Ga0496120_0024867_620_1660 | 346 |
| 752 | 3300048924 | Ga0496121_0004532 | Ga0496121_0004532_7885_8925 | 346 |
| 753 | 3300048928 | Ga0496125_0018028 | Ga0496125_0018028_809_1849 | 346 |
| 754 | 3300048929 | Ga0496126_0007096 | Ga0496126_0007096_3151_4191 | 346 |
| 755 | 3300050516 | nmdc:mga0sz30_33985_c1 | nmdc:mga0sz30_33985_c1_54_1157 | 346 |
| 756 | 3300053077 | Ga0495601_0025026 | Ga0495601_0025026_511_1626 | 346 |
| 757 | 3300053078 | Ga0495612_0003839 | Ga0495612_0003839_626_1741 | 346 |
| 758 | 3300053108 | Ga0500562_005443 | Ga0500562_005443_1574_2614 | 346 |
| 759 | iso_pu_bacteria | 2643221679 | 2644444463 | 346 |
| 760 | iso_pu_bacteria | 2902837492 | 2902841303 | 346 |
| 761 | 3300003792 | Ga0055540_1000690 | Ga0055540_10006903 | 347 |
| 762 | 3300006038 | Ga0075365_10069567 | Ga0075365_100695673 | 347 |
| 763 | 3300024225 | Ga0224572_1000605 | Ga0224572_10006053 | 347 |
| 764 | 3300025273 | Ga0209673_1017156 | Ga0209673_10171562 | 347 |
| 765 | 3300025303 | Ga0209051_1004986 | Ga0209051_10049865 | 347 |
| 766 | 3300031247 | Ga0265340_10023771 | Ga0265340_100237712 | 347 |
| 767 | 3300035692 | Ga0373935_0004930 | Ga0373935_0004930_3767_4918 | 347 |
| 768 | 3300035724 | Ga0373933_0024095 | Ga0373933_0024095_276_1421 | 347 |
| 769 | 3300035725 | Ga0373947_0000009 | Ga0373947_0000009_156253_157404 | 347 |
| 770 | 3300036401 | Ga0373937_0309846 | Ga0373937_0309846_57_1181 | 347 |
| 771 | 3300045836 | Ga0466958_0102473 | Ga0466958_0102473_79_1167 | 347 |
| 772 | 3300046462 | Ga0495651_0009362 | Ga0495651_0009362_6194_7339 | 347 |
| 773 | 3300046463 | Ga0495653_0055363 | Ga0495653_0055363_1584_2729 | 347 |
| 774 | 3300046477 | Ga0495664_0047512 | Ga0495664_0047512_1132_2277 | 347 |
| 775 | 3300046507 | Ga0495606_0000519 | Ga0495606_0000519_27889_28974 | 347 |
| 776 | 3300046529 | Ga0495652_0069855 | Ga0495652_0069855_1499_2644 | 347 |
| 777 | 3300046559 | Ga0495667_0169056 | Ga0495667_0169056_27_1145 | 347 |
| 778 | 3300046663 | Ga0495635_0099706 | Ga0495635_0099706_601_1746 | 347 |
| 779 | 3300046675 | Ga0495657_0050962 | Ga0495657_0050962_170_1315 | 347 |
| 780 | 3300046675 | Ga0495657_0144958 | Ga0495657_0144958_30_1148 | 347 |
| 781 | 3300047322 | Ga0495680_0017642 | Ga0495680_0017642_299_1444 | 347 |
| 782 | 3300048088 | Ga0495602_0066910 | Ga0495602_0066910_197_1342 | 347 |
| 783 | 3300048903 | Ga0496100_0227268 | Ga0496100_0227268_105_1190 | 347 |
| 784 | 3300048906 | Ga0496103_0062286 | Ga0496103_0062286_263_1309 | 347 |
| 785 | 3300048916 | Ga0496113_0219238 | Ga0496113_0219238_262_1308 | 347 |
| 786 | 3300048924 | Ga0496121_0005081 | Ga0496121_0005081_14019_15104 | 347 |
| 787 | 3300050492 | nmdc:mga0yw44_179736_c1 | nmdc:mga0yw44_179736_c1_76_1128 | 347 |
| 788 | 3300050516 | nmdc:mga0sz30_77728_c1 | nmdc:mga0sz30_77728_c1_322_1374 | 347 |
| 789 | iso_pu_bacteria | 2643221687 | 2644488214 | 347 |
| 790 | 3300003792 | Ga0055540_1003313 | Ga0055540_10033131 | 348 |
| 791 | 3300003792 | Ga0055540_1009062 | Ga0055540_10090622 | 348 |
| 792 | 3300005329 | Ga0070683_100130030 | Ga0070683_1001300302 | 348 |
| 793 | 3300005337 | Ga0070682_100011661 | Ga0070682_1000116614 | 348 |
| 794 | 3300005340 | Ga0070689_100061758 | Ga0070689_1000617582 | 348 |
| 795 | 3300005365 | Ga0070688_100145437 | Ga0070688_1001454372 | 348 |
| 796 | 3300005366 | Ga0070659_100036709 | Ga0070659_1000367091 | 348 |
| 797 | 3300005434 | Ga0070709_10063463 | Ga0070709_100634632 | 348 |
| 798 | 3300005435 | Ga0070714_100131613 | Ga0070714_1001316132 | 348 |
| 799 | 3300005436 | Ga0070713_100037066 | Ga0070713_1000370663 | 348 |
| 800 | 3300005437 | Ga0070710_10019748 | Ga0070710_100197483 | 348 |
| 801 | 3300005439 | Ga0070711_100081581 | Ga0070711_1000815812 | 348 |
| 802 | 3300005445 | Ga0070708_100007434 | Ga0070708_1000074347 | 348 |
| 803 | 3300005445 | Ga0070708_100020711 | Ga0070708_1000207115 | 348 |
| 804 | 3300005445 | Ga0070708_100182397 | Ga0070708_1001823971 | 348 |
| 805 | 3300005455 | Ga0070663_100118670 | Ga0070663_1001186702 | 348 |
| 806 | 3300005467 | Ga0070706_100002194 | Ga0070706_10000219422 | 348 |
| 807 | 3300005468 | Ga0070707_100000797 | Ga0070707_10000079732 | 348 |
| 808 | 3300005468 | Ga0070707_100020466 | Ga0070707_1000204664 | 348 |
| 809 | 3300005468 | Ga0070707_100141535 | Ga0070707_1001415353 | 348 |
| 810 | 3300005471 | Ga0070698_100009098 | Ga0070698_10000909810 | 348 |
| 811 | 3300005535 | Ga0070684_100056845 | Ga0070684_1000568452 | 348 |
| 812 | 3300005539 | Ga0068853_100029972 | Ga0068853_1000299721 | 348 |
| 813 | 3300005545 | Ga0070695_100023722 | Ga0070695_1000237224 | 348 |
| 814 | 3300005546 | Ga0070696_100052238 | Ga0070696_1000522383 | 348 |
| 815 | 3300005548 | Ga0070665_100372118 | Ga0070665_1003721182 | 348 |
| 816 | 3300005549 | Ga0070704_100014558 | Ga0070704_1000145585 | 348 |
| 817 | 3300005614 | Ga0068856_100040713 | Ga0068856_1000407134 | 348 |
| 818 | 3300005719 | Ga0068861_100242180 | Ga0068861_1002421802 | 348 |
| 819 | 3300005842 | Ga0068858_100130375 | Ga0068858_1001303753 | 348 |
| 820 | 3300006028 | Ga0070717_10069795 | Ga0070717_100697952 | 348 |
| 821 | 3300006028 | Ga0070717_10108770 | Ga0070717_101087702 | 348 |
| 822 | 3300006163 | Ga0070715_10006170 | Ga0070715_100061702 | 348 |
| 823 | 3300006173 | Ga0070716_100059650 | Ga0070716_1000596502 | 348 |
| 824 | 3300006175 | Ga0070712_100034513 | Ga0070712_1000345133 | 348 |
| 825 | 3300006358 | Ga0068871_100020112 | Ga0068871_1000201124 | 348 |
| 826 | 3300009101 | Ga0105247_10012840 | Ga0105247_100128405 | 348 |
| 827 | 3300009545 | Ga0105237_10058109 | Ga0105237_100581092 | 348 |
| 828 | 3300013100 | Ga0157373_10062462 | Ga0157373_100624622 | 348 |
| 829 | 3300013105 | Ga0157369_10361930 | Ga0157369_103619302 | 348 |
| 830 | 3300014968 | Ga0157379_10027248 | Ga0157379_100272482 | 348 |
| 831 | 3300021388 | Ga0213875_10002999 | Ga0213875_100029996 | 348 |
| 832 | 3300025303 | Ga0209051_1000237 | Ga0209051_100023773 | 348 |
| 833 | 3300025303 | Ga0209051_1003846 | Ga0209051_10038464 | 348 |
| 834 | 3300025885 | Ga0207653_10006394 | Ga0207653_100063942 | 348 |
| 835 | 3300025898 | Ga0207692_10005379 | Ga0207692_100053792 | 348 |
| 836 | 3300025905 | Ga0207685_10059435 | Ga0207685_100594352 | 348 |
| 837 | 3300025906 | Ga0207699_10002118 | Ga0207699_100021188 | 348 |
| 838 | 3300025906 | Ga0207699_10029376 | Ga0207699_100293762 | 348 |
| 839 | 3300025906 | Ga0207699_10030600 | Ga0207699_100306002 | 348 |
| 840 | 3300025907 | Ga0207645_10091931 | Ga0207645_100919312 | 348 |
| 841 | 3300025910 | Ga0207684_10004078 | Ga0207684_100040782 | 348 |
| 842 | 3300025912 | Ga0207707_10121855 | Ga0207707_101218552 | 348 |
| 843 | 3300025915 | Ga0207693_10039485 | Ga0207693_100394853 | 348 |
| 844 | 3300025916 | Ga0207663_10009087 | Ga0207663_100090875 | 348 |
| 845 | 3300025916 | Ga0207663_10252700 | Ga0207663_102527001 | 348 |
| 846 | 3300025922 | Ga0207646_10000388 | Ga0207646_1000038835 | 348 |
| 847 | 3300025922 | Ga0207646_10032085 | Ga0207646_100320854 | 348 |
| 848 | 3300025924 | Ga0207694_10083028 | Ga0207694_100830283 | 348 |
| 849 | 3300025927 | Ga0207687_10102836 | Ga0207687_101028361 | 348 |
| 850 | 3300025928 | Ga0207700_10015175 | Ga0207700_100151755 | 348 |
| 851 | 3300025928 | Ga0207700_10052340 | Ga0207700_100523402 | 348 |
| 852 | 3300025929 | Ga0207664_10012165 | Ga0207664_100121655 | 348 |
| 853 | 3300025929 | Ga0207664_10034251 | Ga0207664_100342513 | 348 |
| 854 | 3300025929 | Ga0207664_10059246 | Ga0207664_100592462 | 348 |
| 855 | 3300025929 | Ga0207664_10159812 | Ga0207664_101598122 | 348 |
| 856 | 3300025935 | Ga0207709_10032046 | Ga0207709_100320463 | 348 |
| 857 | 3300025939 | Ga0207665_10029532 | Ga0207665_100295322 | 348 |
| 858 | 3300025939 | Ga0207665_10062015 | Ga0207665_100620151 | 348 |
| 859 | 3300025944 | Ga0207661_10129681 | Ga0207661_101296812 | 348 |
| 860 | 3300026035 | Ga0207703_10086482 | Ga0207703_100864822 | 348 |
| 861 | 3300026067 | Ga0207678_10013423 | Ga0207678_100134234 | 348 |
| 862 | 3300026078 | Ga0207702_10025122 | Ga0207702_100251222 | 348 |
| 863 | 3300026089 | Ga0207648_10141307 | Ga0207648_101413072 | 348 |
| 864 | 3300026116 | Ga0207674_10004411 | Ga0207674_1000441115 | 348 |
| 865 | 3300026121 | Ga0207683_10008352 | Ga0207683_100083523 | 348 |
| 866 | 3300028379 | Ga0268266_10083616 | Ga0268266_100836162 | 348 |
| 867 | 3300028379 | Ga0268266_10150250 | Ga0268266_101502502 | 348 |
| 868 | 3300035086 | Ga0373934_0002402 | Ga0373934_0002402_2698_3852 | 348 |
| 869 | 3300035117 | Ga0373953_0000140 | Ga0373953_0000140_13956_15110 | 348 |
| 870 | 3300035118 | Ga0373954_0002617 | Ga0373954_0002617_736_1890 | 348 |
| 871 | 3300035119 | Ga0373956_0002157 | Ga0373956_0002157_3008_4162 | 348 |
| 872 | 3300035120 | Ga0373957_0000138 | Ga0373957_0000138_3053_4207 | 348 |
| 873 | 3300035172 | Ga0373955_0000415 | Ga0373955_0000415_3061_4215 | 348 |
| 874 | 3300035172 | Ga0373955_0048523 | Ga0373955_0048523_1093_2202 | 348 |
| 875 | 3300035410 | Ga0373924_0006229 | Ga0373924_0006229_1479_2633 | 348 |
| 876 | 3300035724 | Ga0373933_0000901 | Ga0373933_0000901_3058_4212 | 348 |
| 877 | 3300035724 | Ga0373933_0032598 | Ga0373933_0032598_1170_2279 | 348 |
| 878 | 3300035724 | Ga0373933_0055111 | Ga0373933_0055111_172_1284 | 348 |
| 879 | 3300036401 | Ga0373937_0003579 | Ga0373937_0003579_8884_10038 | 348 |
| 880 | 3300036401 | Ga0373937_0042516 | Ga0373937_0042516_2233_3345 | 348 |
| 881 | 3300036401 | Ga0373937_0049421 | Ga0373937_0049421_188_1288 | 348 |
| 882 | 3300036401 | Ga0373937_0060064 | Ga0373937_0060064_1259_2368 | 348 |
| 883 | 3300037068 | Ga0373925_0010139 | Ga0373925_0010139_1699_2808 | 348 |
| 884 | 3300037853 | Ga0436364_0209397 | Ga0436364_0209397_320_1498 | 348 |
| 885 | 3300037853 | Ga0436364_0262372 | Ga0436364_0262372_5084_6208 | 348 |
| 886 | 3300044735 | Ga0466968_0033015 | Ga0466968_0033015_398_1510 | 348 |
| 887 | 3300046454 | Ga0495592_0002459 | Ga0495592_0002459_8884_10038 | 348 |
| 888 | 3300046454 | Ga0495592_0005659 | Ga0495592_0005659_4105_5214 | 348 |
| 889 | 3300046455 | Ga0495603_0003339 | Ga0495603_0003339_760_1896 | 348 |
| 890 | 3300046462 | Ga0495651_0001480 | Ga0495651_0001480_3058_4212 | 348 |
| 891 | 3300046462 | Ga0495651_0005039 | Ga0495651_0005039_4542_5651 | 348 |
| 892 | 3300046463 | Ga0495653_0020151 | Ga0495653_0020151_1249_2403 | 348 |
| 893 | 3300046463 | Ga0495653_0020504 | Ga0495653_0020504_3566_4672 | 348 |
| 894 | 3300046476 | Ga0495662_0034278 | Ga0495662_0034278_1030_2136 | 348 |
| 895 | 3300046511 | Ga0495608_0001229 | Ga0495608_0001229_3058_4212 | 348 |
| 896 | 3300046511 | Ga0495608_0004816 | Ga0495608_0004816_4391_5500 | 348 |
| 897 | 3300046514 | Ga0495618_0049379 | Ga0495618_0049379_106_1215 | 348 |
| 898 | 3300046516 | Ga0495628_0002081 | Ga0495628_0002081_13954_15108 | 348 |
| 899 | 3300046516 | Ga0495628_0031477 | Ga0495628_0031477_1692_2801 | 348 |
| 900 | 3300046529 | Ga0495652_0002697 | Ga0495652_0002697_13941_15095 | 348 |
| 901 | 3300046529 | Ga0495652_0003338 | Ga0495652_0003338_14525_15634 | 348 |
| 902 | 3300046536 | Ga0495587_0001054 | Ga0495587_0001054_3061_4215 | 348 |
| 903 | 3300046536 | Ga0495587_0006078 | Ga0495587_0006078_525_1634 | 348 |
| 904 | 3300046543 | Ga0495645_0015811 | Ga0495645_0015811_790_1899 | 348 |
| 905 | 3300046543 | Ga0495645_0044858 | Ga0495645_0044858_156_1262 | 348 |
| 906 | 3300046559 | Ga0495667_0000555 | Ga0495667_0000555_16649_17758 | 348 |
| 907 | 3300046559 | Ga0495667_0003357 | Ga0495667_0003357_6501_7655 | 348 |
| 908 | 3300046642 | Ga0495634_0038372 | Ga0495634_0038372_457_1566 | 348 |
| 909 | 3300046675 | Ga0495657_0001832 | Ga0495657_0001832_3058_4212 | 348 |
| 910 | 3300046675 | Ga0495657_0003562 | Ga0495657_0003562_3495_4604 | 348 |
| 911 | 3300046678 | Ga0495599_0000769 | Ga0495599_0000769_2938_4092 | 348 |
| 912 | 3300046679 | Ga0495623_0001121 | Ga0495623_0001121_3012_4166 | 348 |
| 913 | 3300046679 | Ga0495623_0025410 | Ga0495623_0025410_684_1793 | 348 |
| 914 | 3300046680 | Ga0495646_0003679 | Ga0495646_0003679_3562_4671 | 348 |
| 915 | 3300046680 | Ga0495646_0013073 | Ga0495646_0013073_1082_2236 | 348 |
| 916 | 3300046809 | Ga0495600_0015195 | Ga0495600_0015195_779_1888 | 348 |
| 917 | 3300046809 | Ga0495600_0038487 | Ga0495600_0038487_1480_2634 | 348 |
| 918 | 3300047317 | Ga0495604_0001688 | Ga0495604_0001688_3058_4212 | 348 |
| 919 | 3300047317 | Ga0495604_0011501 | Ga0495604_0011501_4458_5567 | 348 |
| 920 | 3300047319 | Ga0495674_0001543 | Ga0495674_0001543_3268_4374 | 348 |
| 921 | 3300047319 | Ga0495674_0033979 | Ga0495674_0033979_1430_2539 | 348 |
| 922 | 3300047321 | Ga0495676_0169449 | Ga0495676_0169449_53_1159 | 348 |
| 923 | 3300047322 | Ga0495680_0002643 | Ga0495680_0002643_3057_4211 | 348 |
| 924 | 3300047322 | Ga0495680_0010169 | Ga0495680_0010169_4483_5592 | 348 |
| 925 | 3300047444 | Ga0495675_0015543 | Ga0495675_0015543_3017_4171 | 348 |
| 926 | 3300047444 | Ga0495675_0056300 | Ga0495675_0056300_1192_2301 | 348 |
| 927 | 3300048088 | Ga0495602_0002692 | Ga0495602_0002692_13954_15108 | 348 |
| 928 | 3300048088 | Ga0495602_0007350 | Ga0495602_0007350_6262_7371 | 348 |
| 929 | 3300048088 | Ga0495602_0051241 | Ga0495602_0051241_1077_2177 | 348 |
| 930 | 3300048905 | Ga0496102_0083238 | Ga0496102_0083238_703_1800 | 348 |
| 931 | 3300048907 | Ga0496104_0010338 | Ga0496104_0010338_1889_2986 | 348 |
| 932 | 3300048908 | Ga0496105_0008149 | Ga0496105_0008149_4330_5427 | 348 |
| 933 | 3300048911 | Ga0496108_0055463 | Ga0496108_0055463_531_1628 | 348 |
| 934 | 3300048912 | Ga0496109_0009119 | Ga0496109_0009119_234_1331 | 348 |
| 935 | 3300048915 | Ga0496112_0031602 | Ga0496112_0031602_600_1697 | 348 |
| 936 | 3300048918 | Ga0496115_0053484 | Ga0496115_0053484_715_1812 | 348 |
| 937 | 3300053084 | Ga0495595_0002954 | Ga0495595_0002954_3033_4187 | 348 |
| 938 | iso_pu_bacteria | 8057575449 | 8057577224 | 348 |
| 939 | 3300000546 | LJNas_1002939 | LJNas_10029393 | 349 |
| 940 | 3300006038 | Ga0075365_10262795 | Ga0075365_102627951 | 349 |
| 941 | 3300026075 | Ga0207708_10043918 | Ga0207708_100439182 | 349 |
| 942 | 3300047472 | Ga0495686_0033239 | Ga0495686_0033239_1557_2630 | 349 |
| 943 | 3300048922 | Ga0496119_0000600 | Ga0496119_0000600_39313_40449 | 349 |
| 944 | 3300048923 | Ga0496120_0033202 | Ga0496120_0033202_767_1903 | 349 |
| 945 | 3300053153 | Ga0500616_0002919 | Ga0500616_0002919_3436_4485 | 349 |
| 946 | iso_pu_bacteria | 2643221567 | 2643852820 | 349 |
| 947 | iso_pu_bacteria | 2643221624 | 2644135329 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9463 | 5 | 220 |
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9443 | 7 | 237 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9414 | 6 | 237 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9403 | 7 | 237 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9397 | 7 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9689 | 6 | 218 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.968 | 7 | 238 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 1 | 219 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9639 | 7 | 240 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.962 | 7 | 236 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9DFL4-F1-model_v4 | ABC transporter domain-containing protein | 0.9739 | 7 | 162 |
GO:0005524
GO:0016887 |
| AF-A0A661S1Z9-F1-model_v4 | Iron ABC transporter ATP-binding protein | 0.9729 | 7 | 237 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A528M0S6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9666 | 1 | 200 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A661KN18-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.9624 | 78 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A528M0S6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9619 | 1 | 200 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar