F486493

General Info

Members Datasets Scaffolds Average Seq Length
947 403 904 356

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0209397|Ga0436364_0209397_320_1498
Length 387
Sequence LAAAAVAGDEVPPVTSSPLTGTRAPRTAVEVRLEDLSRRYGPVIALDHLDLTMEPGELVALLGPSGCGKTTTLRLLAGLEDADTGRITVAGRDLTRVSANKRDMGMVFQAYSLFPHMTVRQNVAFGLRLRRVGSAERDRKALDMLDLVSLSAQADRYPHQLSGGQQQRVALARALAIEPQVLLLDEPLSALDAKVRAQLRDEIRRIQLEVGITTLFVTHDQEEALAIADRVGVMRDGKLEQLAPPTEVYSRPATSFVAEFVGLSNRLPGEVSGGQVVVRGTALPLVDRQTADGSAIALVRPEAVSLASPGTDGAAGAGPLTGTVIAVTFLGATSRVSVDLGDVTVLAQLPTSEATVLSAGSRVTLAIRPDPVLVAASTEPPATGDEV

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221619 Agromyces sp. Root81 Isolate Unclassified
7 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
10 2643221679 Angustibacter sp. Root456 Isolate Unclassified
11 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
12 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
13 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
14 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
17 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
18 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
19 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
20 2773857759 Microbacterium sp. 1294 Isolate Unclassified
21 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
22 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
23 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
24 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
25 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
26 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
27 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
28 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
29 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
30 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
31 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
32 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
33 2919395869 Microbacterium resistens 2980 Isolate Unclassified
34 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
35 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
36 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
37 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
38 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
39 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
40 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
41 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
223 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
224 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
225 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
226 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
227 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
278 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
279 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
280 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
379 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
380 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
394 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
395 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
401 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
402 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
403 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 0.32
Isolates 4.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.97
Nodule 0.53
Rhizoplane 8.03
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002939 3300000546 Bacteria 2001
2 JGI24744J21845_10000925 3300002077 Bacteria 5566
3 JGI24744J21845_10002976 3300002077 Bacteria 3470
4 JGI25164J39214_1000610 3300002772 Bacteria 15259
5 JGI25165J46597_1000004 3300003214 Bacteria 667510
6 Ga0006562J51391_1052848 3300003578 Bacteria 4730
7 Ga0006562J51391_1052849 3300003578 Bacteria 3880
8 Ga0055540_1000690 3300003792 Bacteria 23282
9 Ga0055540_1003313 3300003792 Bacteria 7856
10 Ga0055540_1009062 3300003792 Bacteria 3495
11 Ga0070658_10021050 3300005327 Bacteria 5224
12 Ga0070683_100026326 3300005329 Bacteria 5236
13 Ga0070683_100130030 3300005329 Bacteria 2383
14 Ga0070690_100020140 3300005330 Bacteria 4061
15 Ga0070670_100022182 3300005331 Bacteria 5464
16 Ga0068869_100021575 3300005334 Bacteria 4432
17 Ga0068869_100032335 3300005334 Bacteria 3686
18 Ga0070680_100172615 3300005336 Bacteria 1820
19 Ga0070682_100011661 3300005337 Bacteria 5026
20 Ga0070682_100016863 3300005337 Bacteria 4251
21 Ga0068868_100020559 3300005338 Bacteria 4963
22 Ga0070660_100048372 3300005339 Bacteria 3266
23 Ga0070689_100031495 3300005340 Bacteria 4030
24 Ga0070689_100061758 3300005340 Bacteria 2915
25 Ga0070689_100302899 3300005340 Bacteria 1331
26 Ga0070691_10014414 3300005341 Bacteria 3626
27 Ga0070687_100059429 3300005343 Bacteria 2013
28 Ga0070668_100028219 3300005347 Bacteria 4261
29 Ga0070668_100334812 3300005347 Bacteria 1277
30 Ga0070669_100054081 3300005353 Bacteria 2940
31 Ga0070671_100010086 3300005355 Bacteria 7587
32 Ga0070671_100073068 3300005355 Bacteria 2865
33 Ga0070674_100039668 3300005356 Bacteria 3181
34 Ga0070674_100071222 3300005356 Bacteria 2458
35 Ga0070674_100211709 3300005356 Bacteria 1503
36 Ga0070673_100128577 3300005364 Bacteria 2122
37 Ga0070688_100009770 3300005365 Bacteria 5268
38 Ga0070688_100096343 3300005365 Bacteria 1943
39 Ga0070688_100145437 3300005365 Bacteria 1615
40 Ga0070659_100036709 3300005366 Bacteria 3820
41 Ga0070659_100053027 3300005366 Bacteria 3191
42 Ga0070667_100000022 3300005367 Bacteria 204861
43 Ga0070667_100004304 3300005367 Bacteria 12014
44 Ga0070667_100006910 3300005367 Bacteria 9428
45 Ga0070667_100058488 3300005367 Bacteria 3259
46 Ga0070667_100073872 3300005367 Bacteria 2908
47 Ga0070667_100149497 3300005367 Bacteria 2051
48 Ga0070709_10040421 3300005434 Bacteria 2867
49 Ga0070709_10063463 3300005434 Bacteria 2359
50 Ga0070709_10248454 3300005434 Bacteria 1280
51 Ga0070714_100008555 3300005435 Bacteria 8002
52 Ga0070714_100131613 3300005435 Bacteria 2236
53 Ga0070713_100019191 3300005436 Bacteria 5213
54 Ga0070713_100037066 3300005436 Bacteria 3940
55 Ga0070713_100299752 3300005436 Bacteria 1479
56 Ga0070713_100409465 3300005436 Bacteria 1268
57 Ga0070710_10001142 3300005437 Bacteria 12591
58 Ga0070710_10006248 3300005437 Bacteria 5707
59 Ga0070710_10019748 3300005437 Bacteria 3487
60 Ga0070710_10036310 3300005437 Bacteria 2694
61 Ga0070711_100019946 3300005439 Bacteria 4311
62 Ga0070711_100063410 3300005439 Bacteria 2579
63 Ga0070711_100067138 3300005439 Bacteria 2515
64 Ga0070711_100081581 3300005439 Bacteria 2305
65 Ga0070711_100311184 3300005439 Bacteria 1255
66 Ga0070705_100009661 3300005440 Bacteria 4802
67 Ga0070705_100063932 3300005440 Bacteria 2196
68 Ga0070700_100015753 3300005441 Bacteria 4294
69 Ga0070700_100027635 3300005441 Bacteria 3366
70 Ga0070694_100034977 3300005444 Bacteria 3317
71 Ga0070694_100261197 3300005444 Bacteria 1313
72 Ga0070708_100007434 3300005445 Bacteria 8769
73 Ga0070708_100020711 3300005445 Bacteria 5552
74 Ga0070708_100182397 3300005445 Bacteria 1962
75 Ga0070663_100020914 3300005455 Bacteria 4341
76 Ga0070663_100028191 3300005455 Bacteria 3820
77 Ga0070663_100059005 3300005455 Bacteria 2757
78 Ga0070663_100118670 3300005455 Bacteria 1996
79 Ga0070678_100033574 3300005456 Bacteria 3564
80 Ga0070662_100015453 3300005457 Bacteria 5113
81 Ga0068867_100036674 3300005459 Bacteria 3561
82 Ga0070706_100002194 3300005467 Bacteria 19879
83 Ga0070707_100000797 3300005468 Bacteria 31116
84 Ga0070707_100008194 3300005468 Bacteria 9694
85 Ga0070707_100020466 3300005468 Bacteria 6241
86 Ga0070707_100141535 3300005468 Bacteria 2341
87 Ga0070698_100009098 3300005471 Bacteria 10673
88 Ga0070698_100029267 3300005471 Bacteria 5716
89 Ga0070698_100075960 3300005471 Bacteria 3363
90 Ga0070679_100120416 3300005530 Bacteria 2609
91 Ga0070679_100189928 3300005530 Bacteria 2024
92 Ga0070684_100056845 3300005535 Bacteria 3415
93 Ga0070684_100060064 3300005535 Bacteria 3324
94 Ga0068853_100017673 3300005539 Bacteria 5885
95 Ga0068853_100029972 3300005539 Bacteria 4592
96 Ga0068853_100038126 3300005539 Bacteria 4092
97 Ga0068853_100091382 3300005539 Bacteria 2677
98 Ga0068853_100106147 3300005539 Bacteria 2489
99 Ga0070686_100263802 3300005544 Bacteria 1263
100 Ga0070695_100023722 3300005545 Bacteria 3776
101 Ga0070696_100052238 3300005546 Bacteria 2843
102 Ga0070696_100096784 3300005546 Bacteria 2109
103 Ga0070693_100214599 3300005547 Bacteria 1257
104 Ga0070665_100018725 3300005548 Bacteria 6942
105 Ga0070665_100019294 3300005548 Bacteria 6841
106 Ga0070665_100024659 3300005548 Bacteria 6061
107 Ga0070665_100035428 3300005548 Bacteria 5018
108 Ga0070665_100059445 3300005548 Bacteria 3831
109 Ga0070665_100096541 3300005548 Bacteria 2960
110 Ga0070665_100372118 3300005548 Bacteria 1436
111 Ga0070665_100619275 3300005548 Bacteria 1095
112 Ga0070704_100001394 3300005549 Bacteria 12855
113 Ga0070704_100014558 3300005549 Bacteria 4915
114 Ga0068855_100024676 3300005563 Bacteria 7192
115 Ga0068855_100282731 3300005563 Bacteria 1842
116 Ga0068855_100607443 3300005563 Bacteria 1179
117 Ga0070664_100018762 3300005564 Bacteria 5690
118 Ga0068857_100002430 3300005577 Bacteria 15206
119 Ga0068857_100119859 3300005577 Bacteria 2368
120 Ga0068854_100034070 3300005578 Bacteria 3554
121 Ga0068856_100040713 3300005614 Bacteria 4564
122 Ga0068856_100102506 3300005614 Bacteria 2855
123 Ga0068856_100159916 3300005614 Bacteria 2263
124 Ga0070702_100148572 3300005615 Bacteria 1501
125 Ga0068852_100045022 3300005616 Bacteria 3751
126 Ga0068852_100105101 3300005616 Bacteria 2557
127 Ga0068859_100004797 3300005617 Bacteria 13764
128 Ga0068859_100016504 3300005617 Bacteria 7414
129 Ga0068859_100047711 3300005617 Bacteria 4303
130 Ga0068864_100159003 3300005618 Bacteria 2053
131 Ga0068866_10000565 3300005718 Bacteria 16831
132 Ga0068866_10116007 3300005718 Bacteria 1501
133 Ga0068861_100022577 3300005719 Bacteria 4535
134 Ga0068861_100033200 3300005719 Bacteria 3805
135 Ga0068861_100048315 3300005719 Bacteria 3216
136 Ga0068861_100053692 3300005719 Bacteria 3067
137 Ga0068861_100242180 3300005719 Bacteria 1534
138 Ga0068851_10000009 3300005834 Bacteria 217844
139 Ga0068851_10045682 3300005834 Bacteria 2214
140 Ga0068851_10063347 3300005834 Bacteria 1899
141 Ga0068870_10099674 3300005840 Bacteria 1639
142 Ga0068863_100000699 3300005841 Bacteria 33727
143 Ga0068863_100007296 3300005841 Bacteria 10826
144 Ga0068863_100110113 3300005841 Bacteria 2622
145 Ga0068858_100025787 3300005842 Bacteria 5467
146 Ga0068858_100028712 3300005842 Bacteria 5166
147 Ga0068858_100130375 3300005842 Bacteria 2357
148 Ga0068858_100288373 3300005842 Bacteria 1564
149 Ga0068860_100000038 3300005843 Bacteria 232936
150 Ga0068860_100057127 3300005843 Bacteria 3709
151 Ga0068860_100091101 3300005843 Bacteria 2905
152 Ga0068862_100000064 3300005844 Bacteria 124473
153 Ga0068862_100004446 3300005844 Bacteria 11831
154 Ga0068862_100023337 3300005844 Bacteria 5183
155 Ga0081455_10080041 3300005937 Bacteria 2680
156 Ga0070717_10065723 3300006028 Bacteria 3015
157 Ga0070717_10069795 3300006028 Bacteria 2927
158 Ga0070717_10108770 3300006028 Bacteria 2362
159 Ga0075365_10010713 3300006038 Bacteria 5355
160 Ga0075365_10050477 3300006038 Bacteria 2744
161 Ga0075365_10069567 3300006038 Bacteria 2366
162 Ga0075365_10196945 3300006038 Bacteria 1411
163 Ga0075365_10262795 3300006038 Bacteria 1214
164 Ga0075363_100000604 3300006048 Bacteria 11855
165 Ga0075363_100000810 3300006048 Bacteria 10822
166 Ga0075363_100015203 3300006048 Bacteria 3778
167 Ga0075363_100093533 3300006048 Bacteria 1657
168 Ga0075363_100127560 3300006048 Bacteria 1425
169 Ga0075364_10013507 3300006051 Bacteria 5023
170 Ga0075364_10014035 3300006051 Bacteria 4941
171 Ga0075364_10031738 3300006051 Bacteria 3394
172 Ga0075364_10047048 3300006051 Bacteria 2809
173 Ga0075364_10074510 3300006051 Bacteria 2238
174 Ga0075364_10101518 3300006051 Bacteria 1915
175 Ga0075364_10128235 3300006051 Bacteria 1702
176 Ga0070715_10006170 3300006163 Bacteria 4056
177 Ga0070715_10009036 3300006163 Bacteria 3498
178 Ga0070716_100009647 3300006173 Bacteria 4816
179 Ga0070716_100053789 3300006173 Bacteria 2297
180 Ga0070716_100059650 3300006173 Bacteria 2200
181 Ga0070712_100026615 3300006175 Bacteria 3855
182 Ga0070712_100027713 3300006175 Bacteria 3785
183 Ga0070712_100034513 3300006175 Bacteria 3429
184 Ga0075367_10224570 3300006178 Bacteria 1176
185 Ga0075369_10001174 3300006186 Bacteria 8855
186 Ga0075369_10009406 3300006186 Bacteria 3795
187 Ga0075369_10028775 3300006186 Bacteria 2331
188 Ga0075369_10034319 3300006186 Bacteria 2153
189 Ga0075370_10013976 3300006353 Bacteria 4274
190 Ga0075370_10037088 3300006353 Bacteria 2740
191 Ga0068871_100020112 3300006358 Bacteria 5108
192 Ga0068871_100214564 3300006358 Bacteria 1666
193 Ga0075428_100002613 3300006844 Bacteria 19607
194 Ga0075430_100017367 3300006846 Bacteria 6128
195 Ga0075430_100050723 3300006846 Bacteria 3498
196 Ga0068865_100031272 3300006881 Bacteria 3548
197 Ga0068865_100298468 3300006881 Bacteria 1289
198 Ga0097620_100004797 3300006931 Bacteria 13764
199 Ga0097620_100016503 3300006931 Bacteria 7414
200 Ga0097620_100047713 3300006931 Bacteria 4303
201 Ga0105245_10029659 3300009098 Bacteria 4835
202 Ga0105245_10047438 3300009098 Bacteria 3840
203 Ga0105245_10183001 3300009098 Bacteria 2003
204 Ga0105247_10000021 3300009101 Bacteria 229443
205 Ga0105247_10001116 3300009101 Bacteria 20000
206 Ga0105247_10003213 3300009101 Bacteria 10761
207 Ga0105247_10012840 3300009101 Bacteria 5027
208 Ga0105247_10015303 3300009101 Bacteria 4597
209 Ga0105247_10103699 3300009101 Bacteria 1821
210 Ga0114129_10012530 3300009147 Bacteria 12074
211 Ga0105243_10001479 3300009148 Bacteria 20609
212 Ga0105243_10221916 3300009148 Bacteria 1671
213 Ga0105241_10039510 3300009174 Bacteria 3559
214 Ga0105242_10055802 3300009176 Bacteria 3232
215 Ga0105248_10002026 3300009177 Bacteria 22472
216 Ga0105248_10011195 3300009177 Bacteria 9893
217 Ga0105248_10082701 3300009177 Bacteria 3611
218 Ga0105237_10040735 3300009545 Bacteria 4684
219 Ga0105237_10058109 3300009545 Bacteria 3871
220 Ga0105238_10003262 3300009551 Bacteria 16190
221 Ga0105249_10000334 3300009553 Bacteria 47607
222 Ga0105249_10021666 3300009553 Bacteria 5754
223 Ga0105249_10091434 3300009553 Bacteria 2847
224 Ga0105239_10032795 3300010375 Bacteria 5707
225 Ga0105246_10013157 3300011119 Bacteria 5180
226 Ga0105246_10094654 3300011119 Bacteria 2161
227 Ga0105246_10103048 3300011119 Bacteria 2082
228 Ga0105246_10156933 3300011119 Bacteria 1729
229 Ga0157373_10062462 3300013100 Bacteria 2638
230 Ga0157370_10080037 3300013104 Bacteria 3077
231 Ga0157369_10003733 3300013105 Bacteria 18085
232 Ga0157369_10105887 3300013105 Bacteria 2994
233 Ga0157369_10275444 3300013105 Bacteria 1753
234 Ga0157369_10361930 3300013105 Bacteria 1506
235 Ga0157374_10058281 3300013296 Bacteria 3608
236 Ga0157374_10441268 3300013296 Bacteria 1302
237 Ga0157378_10019079 3300013297 Bacteria 6025
238 Ga0157378_10090946 3300013297 Bacteria 2774
239 Ga0163162_10377156 3300013306 Bacteria 1551
240 Ga0157372_10037399 3300013307 Bacteria 5355
241 Ga0157372_10075895 3300013307 Bacteria 3794
242 Ga0163163_10053751 3300014325 Bacteria 3977
243 Ga0163163_10062868 3300014325 Bacteria 3679
244 Ga0163163_10084778 3300014325 Bacteria 3175
245 Ga0163163_10142678 3300014325 Bacteria 2438
246 Ga0157380_10481514 3300014326 Bacteria 1200
247 Ga0157377_10024886 3300014745 Bacteria 3186
248 Ga0157379_10027248 3300014968 Bacteria 5087
249 Ga0157376_10237576 3300014969 Bacteria 1696
250 Ga0163161_10061013 3300017792 Bacteria 2745
251 Ga0163161_10061026 3300017792 Bacteria 2745
252 Ga0163161_10068721 3300017792 Bacteria 2589
253 Ga0163161_10280799 3300017792 Bacteria 1306
254 Ga0206354_10328917 3300020081 Bacteria 1628
255 Ga0213875_10002999 3300021388 Bacteria 9818
256 Ga0224572_1000605 3300024225 Bacteria 4451
257 Ga0207427_100010 3300025231 Bacteria 648610
258 Ga0209437_100578 3300025233 Bacteria 23500
259 Ga0209646_1000041 3300025246 Bacteria 346024
260 Ga0209233_1000001 3300025261 Bacteria 2992747
261 Ga0209673_1017156 3300025273 Bacteria 2676
262 Ga0209051_1000237 3300025303 Bacteria 92688
263 Ga0209051_1003846 3300025303 Bacteria 9608
264 Ga0209051_1004986 3300025303 Bacteria 7925
265 Ga0209051_1040505 3300025303 Bacteria 1669
266 Ga0207656_10000001 3300025321 Bacteria 1323684
267 Ga0207656_10000003 3300025321 Bacteria 771644
268 Ga0207656_10000004 3300025321 Bacteria 632320
269 Ga0207656_10026127 3300025321 Bacteria 2377
270 Ga0207655_1020411 3300025728 Bacteria 3406
271 Ga0207653_10006394 3300025885 Bacteria 3675
272 Ga0207692_10004112 3300025898 Bacteria 5740
273 Ga0207692_10005379 3300025898 Bacteria 5129
274 Ga0207692_10077885 3300025898 Bacteria 1765
275 Ga0207642_10002868 3300025899 Bacteria 5387
276 Ga0207710_10000027 3300025900 Bacteria 307001
277 Ga0207710_10013676 3300025900 Bacteria 3415
278 Ga0207710_10027108 3300025900 Bacteria 2479
279 Ga0207688_10000922 3300025901 Bacteria 14852
280 Ga0207688_10003057 3300025901 Bacteria 9123
281 Ga0207680_10241954 3300025903 Bacteria 1244
282 Ga0207647_10020846 3300025904 Bacteria 4387
283 Ga0207685_10059435 3300025905 Bacteria 1508
284 Ga0207699_10002118 3300025906 Bacteria 9378
285 Ga0207699_10029376 3300025906 Bacteria 3065
286 Ga0207699_10030600 3300025906 Bacteria 3014
287 Ga0207699_10054340 3300025906 Bacteria 2378
288 Ga0207699_10179620 3300025906 Bacteria 1422
289 Ga0207645_10091931 3300025907 Bacteria 1952
290 Ga0207684_10004078 3300025910 Bacteria 13937
291 Ga0207684_10090586 3300025910 Bacteria 2606
292 Ga0207684_10235250 3300025910 Bacteria 1580
293 Ga0207707_10001233 3300025912 Bacteria 23993
294 Ga0207707_10121855 3300025912 Bacteria 2280
295 Ga0207695_10252398 3300025913 Bacteria 1663
296 Ga0207671_10000001 3300025914 Bacteria 1318881
297 Ga0207693_10001596 3300025915 Bacteria 20037
298 Ga0207693_10039485 3300025915 Bacteria 3717
299 Ga0207693_10194033 3300025915 Bacteria 1598
300 Ga0207693_10220849 3300025915 Bacteria 1489
301 Ga0207663_10009087 3300025916 Bacteria 5237
302 Ga0207663_10113362 3300025916 Bacteria 1843
303 Ga0207663_10176184 3300025916 Bacteria 1523
304 Ga0207663_10252700 3300025916 Bacteria 1298
305 Ga0207660_10140091 3300025917 Bacteria 1849
306 Ga0207662_10022056 3300025918 Bacteria 3645
307 Ga0207662_10108415 3300025918 Bacteria 1729
308 Ga0207657_10023227 3300025919 Bacteria 5779
309 Ga0207657_10031119 3300025919 Bacteria 4838
310 Ga0207657_10060693 3300025919 Bacteria 3244
311 Ga0207652_10103837 3300025921 Bacteria 2513
312 Ga0207646_10000388 3300025922 Bacteria 59041
313 Ga0207646_10032085 3300025922 Bacteria 4753
314 Ga0207681_10070177 3300025923 Bacteria 2439
315 Ga0207694_10083028 3300025924 Bacteria 2519
316 Ga0207650_10198634 3300025925 Bacteria 1605
317 Ga0207687_10015909 3300025927 Bacteria 4936
318 Ga0207687_10030610 3300025927 Bacteria 3630
319 Ga0207687_10042236 3300025927 Bacteria 3136
320 Ga0207687_10102836 3300025927 Bacteria 2106
321 Ga0207700_10015175 3300025928 Bacteria 5069
322 Ga0207700_10021101 3300025928 Bacteria 4440
323 Ga0207700_10052340 3300025928 Bacteria 3052
324 Ga0207664_10012165 3300025929 Bacteria 6148
325 Ga0207664_10034251 3300025929 Bacteria 3910
326 Ga0207664_10059246 3300025929 Bacteria 3048
327 Ga0207664_10069122 3300025929 Bacteria 2839
328 Ga0207664_10126118 3300025929 Bacteria 2149
329 Ga0207664_10159812 3300025929 Bacteria 1921
330 Ga0207644_10019771 3300025931 Bacteria 4572
331 Ga0207644_10128527 3300025931 Bacteria 1937
332 Ga0207690_10029858 3300025932 Bacteria 3471
333 Ga0207690_10071197 3300025932 Bacteria 2397
334 Ga0207706_10027634 3300025933 Bacteria 5072
335 Ga0207706_10114659 3300025933 Bacteria 2370
336 Ga0207709_10007028 3300025935 Bacteria 6293
337 Ga0207709_10032046 3300025935 Bacteria 3075
338 Ga0207709_10264526 3300025935 Bacteria 1263
339 Ga0207670_10149624 3300025936 Bacteria 1731
340 Ga0207669_10003219 3300025937 Bacteria 7057
341 Ga0207669_10043311 3300025937 Bacteria 2636
342 Ga0207669_10054244 3300025937 Bacteria 2420
343 Ga0207669_10190042 3300025937 Bacteria 1480
344 Ga0207704_10048508 3300025938 Bacteria 2546
345 Ga0207665_10016340 3300025939 Bacteria 4873
346 Ga0207665_10029532 3300025939 Bacteria 3623
347 Ga0207665_10049646 3300025939 Bacteria 2820
348 Ga0207665_10062015 3300025939 Bacteria 2536
349 Ga0207711_10001437 3300025941 Bacteria 22270
350 Ga0207689_10006927 3300025942 Bacteria 9970
351 Ga0207689_10012303 3300025942 Bacteria 7323
352 Ga0207689_10026243 3300025942 Bacteria 4878
353 Ga0207661_10129681 3300025944 Bacteria 2158
354 Ga0207679_10014500 3300025945 Bacteria 5184
355 Ga0207667_10006383 3300025949 Bacteria 14295
356 Ga0207667_10380504 3300025949 Bacteria 1438
357 Ga0207651_10224550 3300025960 Bacteria 1521
358 Ga0207712_10000282 3300025961 Bacteria 48535
359 Ga0207712_10122550 3300025961 Bacteria 1969
360 Ga0207668_10000676 3300025972 Bacteria 20961
361 Ga0207640_10029516 3300025981 Bacteria 3367
362 Ga0207640_10164446 3300025981 Bacteria 1646
363 Ga0207658_10000716 3300025986 Bacteria 28697
364 Ga0207658_10012804 3300025986 Bacteria 5728
365 Ga0207658_10025959 3300025986 Bacteria 4104
366 Ga0207658_10134872 3300025986 Bacteria 1989
367 Ga0207658_10146244 3300025986 Bacteria 1920
368 Ga0207677_10045644 3300026023 Bacteria 2927
369 Ga0207677_10370676 3300026023 Bacteria 1205
370 Ga0207703_10015313 3300026035 Bacteria 5982
371 Ga0207703_10086482 3300026035 Bacteria 2626
372 Ga0207703_10583677 3300026035 Bacteria 1056
373 Ga0207639_10006233 3300026041 Bacteria 8103
374 Ga0207639_10187907 3300026041 Bacteria 1762
375 Ga0207639_10434399 3300026041 Bacteria 1189
376 Ga0207678_10013423 3300026067 Bacteria 7191
377 Ga0207678_10031803 3300026067 Bacteria 4601
378 Ga0207678_10034759 3300026067 Bacteria 4390
379 Ga0207678_10060056 3300026067 Bacteria 3271
380 Ga0207678_10069407 3300026067 Bacteria 3022
381 Ga0207678_10098328 3300026067 Bacteria 2500
382 Ga0207708_10018119 3300026075 Bacteria 5299
383 Ga0207708_10020792 3300026075 Bacteria 4951
384 Ga0207708_10038560 3300026075 Bacteria 3639
385 Ga0207708_10043918 3300026075 Bacteria 3406
386 Ga0207702_10025122 3300026078 Bacteria 4942
387 Ga0207702_10192713 3300026078 Bacteria 1884
388 Ga0207641_10000162 3300026088 Bacteria 94111
389 Ga0207641_10019863 3300026088 Bacteria 5512
390 Ga0207641_10172973 3300026088 Bacteria 1973
391 Ga0207648_10013316 3300026089 Bacteria 7658
392 Ga0207648_10031243 3300026089 Bacteria 4708
393 Ga0207648_10141307 3300026089 Bacteria 2122
394 Ga0207648_10161045 3300026089 Bacteria 1982
395 Ga0207676_10146585 3300026095 Bacteria 2028
396 Ga0207674_10002645 3300026116 Bacteria 22384
397 Ga0207674_10004411 3300026116 Bacteria 16954
398 Ga0207675_100001865 3300026118 Bacteria 21103
399 Ga0207675_100020258 3300026118 Bacteria 6201
400 Ga0207675_100024098 3300026118 Bacteria 5658
401 Ga0207675_100046925 3300026118 Bacteria 4035
402 Ga0207683_10001241 3300026121 Bacteria 23130
403 Ga0207683_10008352 3300026121 Bacteria 8855
404 Ga0207683_10093339 3300026121 Bacteria 2682
405 Ga0207683_10439482 3300026121 Bacteria 1202
406 Ga0207698_10002468 3300026142 Bacteria 10969
407 Ga0207698_10166665 3300026142 Bacteria 1934
408 Ga0268266_10022876 3300028379 Bacteria 5319
409 Ga0268266_10027973 3300028379 Bacteria 4794
410 Ga0268266_10039795 3300028379 Bacteria 4005
411 Ga0268266_10048967 3300028379 Bacteria 3622
412 Ga0268266_10083616 3300028379 Bacteria 2786
413 Ga0268266_10091557 3300028379 Bacteria 2666
414 Ga0268266_10150250 3300028379 Bacteria 2099
415 Ga0268265_10000028 3300028380 Bacteria 236467
416 Ga0268264_10000092 3300028381 Bacteria 232950
417 Ga0268264_10075912 3300028381 Bacteria 2859
418 Ga0268264_10155019 3300028381 Bacteria 2058
419 Ga0265337_1008139 3300028556 Bacteria 3843
420 Ga0265326_10001409 3300028558 Bacteria 8463
421 Ga0265319_1006104 3300028563 Bacteria 5639
422 Ga0265334_10001883 3300028573 Bacteria 9960
423 Ga0265323_10009658 3300028653 Bacteria 3930
424 Ga0265336_10007199 3300028666 Bacteria 3971
425 Ga0265338_10001519 3300028800 Bacteria 37467
426 Ga0265338_10017078 3300028800 Bacteria 7843
427 Ga0265332_10009991 3300031238 Bacteria 4227
428 Ga0265320_10015573 3300031240 Bacteria 4293
429 Ga0265329_10032895 3300031242 Bacteria 1679
430 Ga0265340_10009267 3300031247 Bacteria 5287
431 Ga0265340_10023771 3300031247 Bacteria 3121
432 Ga0265339_10037623 3300031249 Bacteria 2704
433 Ga0265316_10037167 3300031344 Bacteria 3933
434 Ga0307513_10003355 3300031456 Bacteria 21745
435 Ga0265342_10009280 3300031712 Bacteria 6948
436 Ga0307405_10050783 3300031731 Bacteria 2570
437 Ga0307405_10108608 3300031731 Bacteria 1875
438 Ga0307413_10132531 3300031824 Bacteria 1708
439 Ga0307518_10120711 3300031838 Bacteria 1855
440 Ga0307410_10168617 3300031852 Bacteria 1647
441 Ga0307410_10228907 3300031852 Bacteria 1434
442 Ga0307406_10000084 3300031901 Bacteria 52931
443 Ga0307406_10000462 3300031901 Bacteria 23513
444 Ga0307406_10057378 3300031901 Bacteria 2497
445 Ga0307406_10091403 3300031901 Bacteria 2050
446 Ga0307407_10026016 3300031903 Bacteria 3094
447 Ga0307412_10106985 3300031911 Bacteria 1990
448 Ga0307416_100294501 3300032002 Bacteria 1609
449 Ga0307415_100228548 3300032126 Bacteria 1497
450 Ga0307507_10000024 3300033179 Bacteria 212340
451 Ga0373950_0007108 3300034818 Bacteria 1729
452 Ga0373938_0011598 3300034957 Bacteria 1641
453 Ga0373926_0000308 3300035083 Bacteria 12100
454 Ga0373926_0000572 3300035083 Bacteria 9910
455 Ga0373934_0002402 3300035086 Bacteria 6894
456 Ga0373934_0014375 3300035086 Bacteria 2999
457 Ga0373934_0018534 3300035086 Bacteria 2664
458 Ga0373934_0030783 3300035086 Bacteria 2099
459 Ga0373944_0001289 3300035089 Bacteria 6304
460 Ga0373944_0002647 3300035089 Bacteria 4561
461 Ga0373923_0000037 3300035111 Bacteria 20215
462 Ga0373923_0004663 3300035111 Bacteria 4569
463 Ga0373923_0041955 3300035111 Bacteria 1888
464 Ga0373932_0043171 3300035112 Bacteria 1310
465 Ga0373936_0000921 3300035113 Bacteria 10503
466 Ga0373936_0001261 3300035113 Bacteria 9145
467 Ga0373936_0001862 3300035113 Bacteria 7781
468 Ga0373945_0000101 3300035116 Bacteria 20325
469 Ga0373945_0000452 3300035116 Bacteria 11540
470 Ga0373953_0000140 3300035117 Bacteria 18157
471 Ga0373953_0004506 3300035117 Bacteria 4447
472 Ga0373954_0002617 3300035118 Bacteria 7572
473 Ga0373954_0035972 3300035118 Bacteria 2297
474 Ga0373956_0002157 3300035119 Bacteria 8132
475 Ga0373956_0009951 3300035119 Bacteria 3878
476 Ga0373956_0010810 3300035119 Bacteria 3748
477 Ga0373956_0023376 3300035119 Bacteria 2652
478 Ga0373957_0000138 3300035120 Bacteria 18132
479 Ga0373957_0001974 3300035120 Bacteria 5722
480 Ga0373957_0003438 3300035120 Bacteria 4680
481 Ga0373943_0000883 3300035170 Bacteria 13196
482 Ga0373943_0003303 3300035170 Bacteria 7326
483 Ga0373946_0000138 3300035171 Bacteria 22000
484 Ga0373946_0010368 3300035171 Bacteria 3447
485 Ga0373955_0000415 3300035172 Bacteria 18168
486 Ga0373955_0007386 3300035172 Bacteria 5050
487 Ga0373955_0013813 3300035172 Bacteria 3917
488 Ga0373955_0016657 3300035172 Bacteria 3621
489 Ga0373955_0048523 3300035172 Bacteria 2303
490 Ga0373962_0026856 3300035242 Bacteria 1554
491 Ga0373924_0002394 3300035410 Bacteria 6310
492 Ga0373924_0006229 3300035410 Bacteria 4266
493 Ga0373924_0048114 3300035410 Bacteria 1760
494 Ga0373931_0003677 3300035691 Bacteria 6937
495 Ga0373931_0024198 3300035691 Bacteria 3074
496 Ga0373935_0001284 3300035692 Bacteria 13839
497 Ga0373935_0004857 3300035692 Bacteria 7896
498 Ga0373935_0004930 3300035692 Bacteria 7845
499 Ga0373935_0016881 3300035692 Bacteria 4420
500 Ga0373927_0018145 3300035695 Bacteria 4627
501 Ga0373933_0000901 3300035724 Bacteria 18165
502 Ga0373933_0004119 3300035724 Bacteria 8013
503 Ga0373933_0006224 3300035724 Bacteria 6494
504 Ga0373933_0022301 3300035724 Bacteria 3604
505 Ga0373933_0024095 3300035724 Bacteria 3484
506 Ga0373933_0032598 3300035724 Bacteria 3028
507 Ga0373933_0055111 3300035724 Bacteria 2384
508 Ga0373933_0211598 3300035724 Bacteria 1242
509 Ga0373947_0000009 3300035725 Bacteria 172751
510 Ga0373947_0000959 3300035725 Bacteria 17573
511 Ga0373947_0036554 3300035725 Bacteria 2912
512 Ga0373947_0194624 3300035725 Bacteria 1324
513 Ga0373937_0003579 3300036401 Bacteria 13095
514 Ga0373937_0027975 3300036401 Bacteria 5100
515 Ga0373937_0042516 3300036401 Bacteria 4146
516 Ga0373937_0049421 3300036401 Bacteria 3851
517 Ga0373937_0055905 3300036401 Bacteria 3623
518 Ga0373937_0060064 3300036401 Bacteria 3493
519 Ga0373937_0097544 3300036401 Bacteria 2726
520 Ga0373937_0243479 3300036401 Bacteria 1694
521 Ga0373937_0251759 3300036401 Bacteria 1665
522 Ga0373937_0309846 3300036401 Bacteria 1493
523 Ga0373937_0409301 3300036401 Bacteria 1287
524 Ga0373925_0000515 3300037068 Bacteria 38779
525 Ga0373925_0009562 3300037068 Bacteria 7061
526 Ga0373925_0010139 3300037068 Bacteria 6840
527 Ga0373925_0160652 3300037068 Bacteria 1769
528 Ga0395898_0156465 3300037466 Bacteria 2180
529 Ga0436364_0209397 3300037853 Bacteria 1590
530 Ga0436364_0262372 3300037853 Bacteria 9734
531 Ga0436365_1192272 3300039437 Bacteria 6135
532 Ga0439466_0002551 3300041411 Bacteria 7133
533 Ga0439466_0007096 3300041411 Bacteria 4241
534 Ga0439465_0005845 3300041413 Bacteria 3916
535 Ga0439465_0007508 3300041413 Bacteria 3466
536 Ga0439465_0010776 3300041413 Bacteria 2868
537 Ga0439465_0018753 3300041413 Bacteria 2161
538 Ga0451795_0736678 3300041456 Bacteria 1241
539 Ga0439431_0005291 3300041997 Bacteria 2847
540 Ga0439445_0001683 3300042004 Bacteria 4846
541 Ga0466972_0137762 3300044658 Bacteria 1149
542 Ga0466965_0002722 3300044683 Bacteria 7576
543 Ga0466961_0126498 3300044693 Bacteria 1603
544 Ga0466968_0008136 3300044735 Bacteria 4010
545 Ga0466968_0033015 3300044735 Bacteria 2156
546 Ga0466970_0000001 3300044765 Bacteria 252791
547 Ga0466970_0003519 3300044765 Bacteria 7637
548 Ga0466970_0025418 3300044765 Bacteria 3100
549 Ga0466970_0025620 3300044765 Bacteria 3089
550 Ga0466970_0086871 3300044765 Bacteria 1696
551 Ga0466970_0126734 3300044765 Bacteria 1400
552 Ga0466960_0000764 3300044901 Bacteria 11310
553 Ga0466959_0098042 3300045049 Bacteria 2100
554 Ga0466959_0129680 3300045049 Bacteria 1787
555 Ga0466958_0102473 3300045836 Bacteria 1781
556 Ga0466967_0032527 3300045976 Bacteria 4405
557 Ga0466967_0185193 3300045976 Bacteria 1966
558 Ga0466967_0195791 3300045976 Bacteria 1912
559 Ga0466967_0403646 3300045976 Bacteria 1330
560 Ga0495627_000659 3300046453 Bacteria 26624
561 Ga0495592_0002459 3300046454 Bacteria 13075
562 Ga0495592_0005659 3300046454 Bacteria 9238
563 Ga0495592_0019916 3300046454 Bacteria 5101
564 Ga0495592_0048698 3300046454 Bacteria 3151
565 Ga0495603_0000386 3300046455 Bacteria 24112
566 Ga0495603_0003339 3300046455 Bacteria 9561
567 Ga0495629_0000993 3300046459 Bacteria 22718
568 Ga0495629_0014583 3300046459 Bacteria 5656
569 Ga0495638_0001564 3300046460 Bacteria 20515
570 Ga0495641_0007841 3300046461 Bacteria 6604
571 Ga0495641_0011655 3300046461 Bacteria 4986
572 Ga0495651_0001480 3300046462 Bacteria 18165
573 Ga0495651_0005039 3300046462 Bacteria 10087
574 Ga0495651_0009362 3300046462 Bacteria 7519
575 Ga0495651_0013521 3300046462 Bacteria 6311
576 Ga0495651_0120059 3300046462 Bacteria 1932
577 Ga0495651_0147603 3300046462 Bacteria 1698
578 Ga0495651_0260227 3300046462 Bacteria 1181
579 Ga0495651_0263301 3300046462 Bacteria 1172
580 Ga0495653_0005583 3300046463 Bacteria 10257
581 Ga0495653_0019124 3300046463 Bacteria 5557
582 Ga0495653_0020151 3300046463 Bacteria 5406
583 Ga0495653_0020504 3300046463 Bacteria 5358
584 Ga0495653_0027159 3300046463 Bacteria 4581
585 Ga0495653_0055363 3300046463 Bacteria 3027
586 Ga0495650_0003801 3300046471 Bacteria 10754
587 Ga0495650_0074096 3300046471 Bacteria 1328
588 Ga0495580_0002013 3300046472 Bacteria 17896
589 Ga0495582_0001105 3300046473 Bacteria 15140
590 Ga0495582_0001321 3300046473 Bacteria 13893
591 Ga0495582_0015162 3300046473 Bacteria 4240
592 Ga0495582_0097596 3300046473 Bacteria 1643
593 Ga0495639_0002021 3300046475 Bacteria 8978
594 Ga0495639_0005485 3300046475 Bacteria 5461
595 Ga0495662_0006075 3300046476 Bacteria 6033
596 Ga0495662_0025253 3300046476 Bacteria 2868
597 Ga0495662_0030506 3300046476 Bacteria 2603
598 Ga0495662_0034278 3300046476 Bacteria 2451
599 Ga0495664_0002354 3300046477 Bacteria 10119
600 Ga0495664_0025265 3300046477 Bacteria 3457
601 Ga0495664_0047512 3300046477 Bacteria 2547
602 Ga0495664_0051186 3300046477 Bacteria 2452
603 Ga0495594_0073313 3300046499 Bacteria 1905
604 Ga0495606_0000519 3300046507 Bacteria 62313
605 Ga0495608_0001229 3300046511 Bacteria 18165
606 Ga0495608_0002878 3300046511 Bacteria 12324
607 Ga0495608_0004816 3300046511 Bacteria 9643
608 Ga0495608_0013379 3300046511 Bacteria 5690
609 Ga0495618_0004262 3300046514 Bacteria 8820
610 Ga0495618_0013760 3300046514 Bacteria 4922
611 Ga0495618_0049379 3300046514 Bacteria 2657
612 Ga0495618_0166457 3300046514 Bacteria 1404
613 Ga0495618_0167462 3300046514 Bacteria 1399
614 Ga0495628_0002081 3300046516 Bacteria 18158
615 Ga0495628_0031477 3300046516 Bacteria 4291
616 Ga0495628_0042575 3300046516 Bacteria 3621
617 Ga0495628_0072784 3300046516 Bacteria 2678
618 Ga0495630_0049166 3300046517 Bacteria 3155
619 Ga0495630_0071586 3300046517 Bacteria 2609
620 Ga0495630_0275571 3300046517 Bacteria 1285
621 Ga0495666_0003500 3300046526 Bacteria 7924
622 Ga0495652_0002697 3300046529 Bacteria 18037
623 Ga0495652_0003338 3300046529 Bacteria 15924
624 Ga0495652_0015786 3300046529 Bacteria 6760
625 Ga0495652_0055561 3300046529 Bacteria 3366
626 Ga0495652_0069855 3300046529 Bacteria 2938
627 Ga0495665_0000676 3300046531 Bacteria 17463
628 Ga0495665_0001805 3300046531 Bacteria 11530
629 Ga0495640_0023234 3300046533 Bacteria 4524
630 Ga0495640_0050600 3300046533 Bacteria 2862
631 Ga0495586_0014221 3300046535 Bacteria 4229
632 Ga0495587_0001054 3300046536 Bacteria 18152
633 Ga0495587_0006078 3300046536 Bacteria 7879
634 Ga0495587_0009946 3300046536 Bacteria 6071
635 Ga0495587_0031736 3300046536 Bacteria 3196
636 Ga0495645_0015811 3300046543 Bacteria 5373
637 Ga0495645_0022367 3300046543 Bacteria 4573
638 Ga0495645_0041923 3300046543 Bacteria 3337
639 Ga0495645_0044858 3300046543 Bacteria 3224
640 Ga0495645_0049307 3300046543 Bacteria 3066
641 Ga0495667_0000555 3300046559 Bacteria 23895
642 Ga0495667_0000804 3300046559 Bacteria 20210
643 Ga0495667_0002742 3300046559 Bacteria 11773
644 Ga0495667_0003305 3300046559 Bacteria 10802
645 Ga0495667_0003357 3300046559 Bacteria 10715
646 Ga0495667_0004804 3300046559 Bacteria 9135
647 Ga0495667_0169056 3300046559 Bacteria 1405
648 Ga0495667_0198478 3300046559 Bacteria 1284
649 Ga0495634_0004918 3300046642 Bacteria 10341
650 Ga0495634_0019930 3300046642 Bacteria 4759
651 Ga0495634_0038372 3300046642 Bacteria 3267
652 Ga0495634_0044903 3300046642 Bacteria 2989
653 Ga0495635_0000896 3300046663 Bacteria 19529
654 Ga0495635_0007084 3300046663 Bacteria 7838
655 Ga0495635_0010854 3300046663 Bacteria 6382
656 Ga0495635_0099706 3300046663 Bacteria 1985
657 Ga0495588_0065485 3300046674 Bacteria 1885
658 Ga0495657_0001832 3300046675 Bacteria 18165
659 Ga0495657_0003562 3300046675 Bacteria 12676
660 Ga0495657_0013962 3300046675 Bacteria 5900
661 Ga0495657_0014053 3300046675 Bacteria 5880
662 Ga0495657_0047136 3300046675 Bacteria 2915
663 Ga0495657_0050962 3300046675 Bacteria 2781
664 Ga0495657_0104559 3300046675 Bacteria 1800
665 Ga0495657_0144958 3300046675 Bacteria 1478
666 Ga0495599_0000769 3300046678 Bacteria 18045
667 Ga0495599_0021710 3300046678 Bacteria 4006
668 Ga0495599_0036429 3300046678 Bacteria 3089
669 Ga0495599_0056494 3300046678 Bacteria 2456
670 Ga0495623_0001121 3300046679 Bacteria 18078
671 Ga0495623_0025410 3300046679 Bacteria 3816
672 Ga0495623_0026261 3300046679 Bacteria 3749
673 Ga0495623_0035865 3300046679 Bacteria 3178
674 Ga0495646_0003679 3300046680 Bacteria 9567
675 Ga0495646_0007293 3300046680 Bacteria 7023
676 Ga0495646_0013073 3300046680 Bacteria 5276
677 Ga0495646_0014836 3300046680 Bacteria 4949
678 Ga0495658_0003893 3300046683 Bacteria 7390
679 Ga0495613_0008226 3300046689 Bacteria 7745
680 Ga0495613_0009745 3300046689 Bacteria 7139
681 Ga0495624_0001916 3300046690 Bacteria 15840
682 Ga0495624_0009187 3300046690 Bacteria 6854
683 Ga0495624_0010818 3300046690 Bacteria 6288
684 Ga0495600_0015195 3300046809 Bacteria 4863
685 Ga0495600_0023090 3300046809 Bacteria 4000
686 Ga0495600_0038487 3300046809 Bacteria 3112
687 Ga0495600_0178382 3300046809 Bacteria 1369
688 Ga0495581_0002013 3300047315 Bacteria 11420
689 Ga0495581_0006111 3300047315 Bacteria 6979
690 Ga0495581_0007135 3300047315 Bacteria 6471
691 Ga0495581_0012048 3300047315 Bacteria 5003
692 Ga0495604_0001688 3300047317 Bacteria 18161
693 Ga0495604_0007314 3300047317 Bacteria 8744
694 Ga0495604_0011501 3300047317 Bacteria 7030
695 Ga0495604_0055873 3300047317 Bacteria 3041
696 Ga0495604_0229159 3300047317 Bacteria 1275
697 Ga0495674_0000239 3300047319 Bacteria 46557
698 Ga0495674_0001543 3300047319 Bacteria 22531
699 Ga0495674_0033979 3300047319 Bacteria 4614
700 Ga0495674_0060234 3300047319 Bacteria 3313
701 Ga0495674_0063206 3300047319 Bacteria 3220
702 Ga0495674_0100851 3300047319 Bacteria 2456
703 Ga0495672_0049782 3300047320 Bacteria 2478
704 Ga0495676_0005648 3300047321 Bacteria 11468
705 Ga0495676_0038871 3300047321 Bacteria 3947
706 Ga0495676_0169449 3300047321 Bacteria 1538
707 Ga0495680_0002131 3300047322 Bacteria 20548
708 Ga0495680_0002643 3300047322 Bacteria 18163
709 Ga0495680_0009363 3300047322 Bacteria 8817
710 Ga0495680_0010169 3300047322 Bacteria 8407
711 Ga0495680_0011106 3300047322 Bacteria 7994
712 Ga0495680_0017642 3300047322 Bacteria 6084
713 Ga0495680_0090600 3300047322 Bacteria 2293
714 Ga0495680_0197724 3300047322 Bacteria 1444
715 Ga0495675_0004571 3300047444 Bacteria 8394
716 Ga0495675_0015543 3300047444 Bacteria 4813
717 Ga0495675_0017671 3300047444 Bacteria 4522
718 Ga0495675_0056300 3300047444 Bacteria 2493
719 Ga0495675_0180843 3300047444 Bacteria 1291
720 Ga0495684_0000873 3300047471 Bacteria 24506
721 Ga0495684_0005728 3300047471 Bacteria 9663
722 Ga0495684_0074370 3300047471 Bacteria 2581
723 Ga0495686_0002683 3300047472 Bacteria 16376
724 Ga0495686_0033239 3300047472 Bacteria 3332
725 Ga0495593_0000574 3300047673 Bacteria 20889
726 Ga0495593_0005468 3300047673 Bacteria 7500
727 Ga0495593_0031391 3300047673 Bacteria 2902
728 Ga0495602_0002692 3300048088 Bacteria 18152
729 Ga0495602_0007350 3300048088 Bacteria 11535
730 Ga0495602_0009753 3300048088 Bacteria 9975
731 Ga0495602_0025572 3300048088 Bacteria 5711
732 Ga0495602_0042486 3300048088 Bacteria 4141
733 Ga0495602_0051241 3300048088 Bacteria 3678
734 Ga0495602_0066910 3300048088 Bacteria 3093
735 Ga0495614_0006062 3300048089 Bacteria 5433
736 Ga0496100_0003285 3300048903 Bacteria 8408
737 Ga0496100_0003723 3300048903 Bacteria 7987
738 Ga0496100_0025263 3300048903 Bacteria 3632
739 Ga0496100_0070051 3300048903 Bacteria 2337
740 Ga0496100_0227268 3300048903 Bacteria 1372
741 Ga0496101_0000620 3300048904 Bacteria 21636
742 Ga0496101_0015505 3300048904 Bacteria 5139
743 Ga0496101_0019861 3300048904 Bacteria 4594
744 Ga0496101_0024596 3300048904 Bacteria 4169
745 Ga0496101_0042441 3300048904 Bacteria 3247
746 Ga0496101_0106966 3300048904 Bacteria 2101
747 Ga0496102_0000458 3300048905 Bacteria 45701
748 Ga0496102_0009161 3300048905 Bacteria 8491
749 Ga0496102_0019400 3300048905 Bacteria 5990
750 Ga0496102_0063338 3300048905 Bacteria 3385
751 Ga0496102_0083238 3300048905 Bacteria 2952
752 Ga0496102_0086104 3300048905 Bacteria 2902
753 Ga0496103_0000466 3300048906 Bacteria 34185
754 Ga0496103_0010715 3300048906 Bacteria 5424
755 Ga0496103_0022667 3300048906 Bacteria 3781
756 Ga0496103_0062286 3300048906 Bacteria 2322
757 Ga0496104_0006336 3300048907 Bacteria 10408
758 Ga0496104_0009998 3300048907 Bacteria 8469
759 Ga0496104_0010338 3300048907 Bacteria 8333
760 Ga0496104_0062216 3300048907 Bacteria 3539
761 Ga0496104_0404637 3300048907 Bacteria 1277
762 Ga0496105_0008149 3300048908 Bacteria 8146
763 Ga0496105_0024016 3300048908 Bacteria 4951
764 Ga0496105_0090970 3300048908 Bacteria 2520
765 Ga0496105_0182859 3300048908 Bacteria 1716
766 Ga0496106_0000592 3300048909 Bacteria 25928
767 Ga0496106_0004806 3300048909 Bacteria 9995
768 Ga0496106_0014595 3300048909 Bacteria 5804
769 Ga0496107_0001235 3300048910 Bacteria 15615
770 Ga0496107_0008974 3300048910 Bacteria 6930
771 Ga0496107_0012670 3300048910 Bacteria 5887
772 Ga0496108_0000457 3300048911 Bacteria 32650
773 Ga0496108_0015973 3300048911 Bacteria 6119
774 Ga0496108_0031709 3300048911 Bacteria 4387
775 Ga0496108_0055463 3300048911 Bacteria 3327
776 Ga0496108_0142841 3300048911 Bacteria 2062
777 Ga0496108_0164008 3300048911 Bacteria 1921
778 Ga0496109_0009119 3300048912 Bacteria 8449
779 Ga0496109_0010428 3300048912 Bacteria 7936
780 Ga0496109_0027087 3300048912 Bacteria 5115
781 Ga0496109_0050077 3300048912 Bacteria 3804
782 Ga0496109_0103315 3300048912 Bacteria 2645
783 Ga0496109_0255818 3300048912 Bacteria 1649
784 Ga0496109_0332787 3300048912 Bacteria 1434
785 Ga0496110_0005900 3300048913 Bacteria 9641
786 Ga0496110_0012624 3300048913 Bacteria 6949
787 Ga0496110_0020634 3300048913 Bacteria 5566
788 Ga0496110_0035703 3300048913 Bacteria 4314
789 Ga0496110_0138339 3300048913 Bacteria 2201
790 Ga0496110_0221299 3300048913 Bacteria 1721
791 Ga0496111_0012381 3300048914 Bacteria 5773
792 Ga0496111_0092861 3300048914 Bacteria 2212
793 Ga0496112_0031602 3300048915 Bacteria 5136
794 Ga0496112_0040147 3300048915 Bacteria 4575
795 Ga0496112_0070457 3300048915 Bacteria 3455
796 Ga0496112_0182663 3300048915 Bacteria 2061
797 Ga0496113_0015130 3300048916 Bacteria 5290
798 Ga0496113_0219238 3300048916 Bacteria 1516
799 Ga0496114_0000175 3300048917 Bacteria 45344
800 Ga0496114_0008791 3300048917 Bacteria 8003
801 Ga0496114_0014341 3300048917 Bacteria 6357
802 Ga0496114_0029407 3300048917 Bacteria 4516
803 Ga0496114_0064031 3300048917 Bacteria 3079
804 Ga0496114_0165342 3300048917 Bacteria 1926
805 Ga0496114_0272667 3300048917 Bacteria 1491
806 Ga0496115_0003687 3300048918 Bacteria 11024
807 Ga0496115_0012317 3300048918 Bacteria 6431
808 Ga0496115_0053484 3300048918 Bacteria 3240
809 Ga0496115_0083354 3300048918 Bacteria 2606
810 Ga0496115_0148301 3300048918 Bacteria 1936
811 Ga0496116_0007005 3300048919 Bacteria 10094
812 Ga0496117_0000607 3300048920 Bacteria 58422
813 Ga0496117_0002843 3300048920 Bacteria 21063
814 Ga0496117_0005412 3300048920 Bacteria 13429
815 Ga0496117_0050975 3300048920 Bacteria 2930
816 Ga0496118_0003349 3300048921 Bacteria 20290
817 Ga0496118_0004676 3300048921 Bacteria 16044
818 Ga0496118_0021365 3300048921 Bacteria 5699
819 Ga0496119_0000600 3300048922 Bacteria 48758
820 Ga0496119_0001062 3300048922 Bacteria 35053
821 Ga0496119_0001501 3300048922 Bacteria 27887
822 Ga0496120_0001468 3300048923 Bacteria 28087
823 Ga0496120_0009678 3300048923 Bacteria 6802
824 Ga0496120_0024867 3300048923 Bacteria 3727
825 Ga0496120_0030264 3300048923 Bacteria 3293
826 Ga0496120_0033202 3300048923 Bacteria 3103
827 Ga0496120_0120535 3300048923 Bacteria 1357
828 Ga0496121_0004532 3300048924 Bacteria 18593
829 Ga0496121_0005081 3300048924 Bacteria 17169
830 Ga0496122_0000022 3300048925 Bacteria 388704
831 Ga0496122_0000095 3300048925 Bacteria 200509
832 Ga0496122_0015661 3300048925 Bacteria 7233
833 Ga0496123_0000016 3300048926 Bacteria 424330
834 Ga0496123_0000100 3300048926 Bacteria 170019
835 Ga0496124_0013426 3300048927 Bacteria 7994
836 Ga0496124_0028795 3300048927 Bacteria 4961
837 Ga0496124_0293127 3300048927 Bacteria 1179
838 Ga0496125_0000326 3300048928 Bacteria 91890
839 Ga0496125_0008550 3300048928 Bacteria 10695
840 Ga0496125_0009139 3300048928 Bacteria 10252
841 Ga0496125_0009156 3300048928 Bacteria 10233
842 Ga0496125_0018028 3300048928 Bacteria 6710
843 Ga0496125_0045796 3300048928 Bacteria 3676
844 Ga0496126_0003871 3300048929 Bacteria 18451
845 Ga0496126_0006488 3300048929 Bacteria 13022
846 Ga0496126_0007096 3300048929 Bacteria 12340
847 Ga0496126_0008872 3300048929 Bacteria 10774
848 Ga0496126_0014353 3300048929 Bacteria 8011
849 Ga0496126_0188175 3300048929 Bacteria 1750
850 Ga0496126_0317884 3300048929 Bacteria 1280
851 Ga0501032_0010760 3300049569 Bacteria 6586
852 Ga0501034_0024193 3300049571 Bacteria 6177
853 Ga0501034_0065853 3300049571 Bacteria 3637
854 Ga0501034_0078831 3300049571 Bacteria 3297
855 Ga0501036_0006542 3300049572 Bacteria 9466
856 Ga0501037_0001807 3300049573 Bacteria 15538
857 Ga0501038_0050802 3300049574 Bacteria 3581
858 Ga0501039_0000820 3300049575 Bacteria 22383
859 Ga0501043_0001927 3300049579 Bacteria 17763
860 Ga0501047_0017179 3300049581 Bacteria 6925
861 Ga0501067_0004199 3300049583 Bacteria 7952
862 Ga0501070_0017639 3300049586 Bacteria 5993
863 Ga0501073_0069076 3300049589 Bacteria 2462
864 Ga0501044_0013917 3300049823 Bacteria 8694
865 nmdc:mga03683_22225_c1 3300050489 Bacteria 2457
866 nmdc:mga03683_60462_c1 3300050489 Bacteria 1600
867 nmdc:mga03n38_14266_c1 3300050490 Bacteria 3041
868 nmdc:mga03n38_68713_c1 3300050490 Bacteria 1634
869 nmdc:mga00v17_134573_c1 3300050491 Bacteria 1581
870 nmdc:mga00v17_2960_c1 3300050491 Bacteria 8720
871 nmdc:mga00v17_5113_c1 3300050491 Bacteria 6895
872 nmdc:mga00v17_7394_c1 3300050491 Bacteria 5859
873 nmdc:mga0yw44_10327_c1 3300050492 Bacteria 4764
874 nmdc:mga0yw44_179736_c1 3300050492 Bacteria 1392
875 nmdc:mga0yw44_19322_c1 3300050492 Bacteria 3755
876 nmdc:mga0yw44_40047_c1 3300050492 Bacteria 2782
877 nmdc:mga0yw44_66186_c1 3300050492 Bacteria 2229
878 nmdc:mga07m45_12208_c1 3300050496 Bacteria 1732
879 nmdc:mga07m45_41255_c1 3300050496 Bacteria 2584
880 nmdc:mga05p37_8977_c1 3300050507 Bacteria 11822
881 nmdc:mga0qj67_98222_c1 3300050509 Bacteria 2359
882 nmdc:mga06r32_65895_c1 3300050510 Bacteria 3494
883 nmdc:mga0sz30_15979_c1 3300050516 Bacteria 2972
884 nmdc:mga0sz30_33985_c1 3300050516 Bacteria 2121
885 nmdc:mga0sz30_77728_c1 3300050516 Bacteria 1434
886 Ga0495601_0006165 3300053077 Bacteria 6996
887 Ga0495601_0025026 3300053077 Bacteria 3679
888 Ga0495612_0003839 3300053078 Bacteria 6238
889 Ga0495612_0038021 3300053078 Bacteria 1956
890 Ga0500610_0047321 3300053079 Bacteria 2235
891 Ga0495595_0002906 3300053084 Bacteria 6755
892 Ga0495595_0002954 3300053084 Bacteria 6715
893 Ga0495619_0009931 3300053085 Bacteria 5994
894 Ga0500643_023165 3300053087 Bacteria 1987
895 Ga0500651_0000214 3300053093 Bacteria 36274
896 Ga0500562_005443 3300053108 Bacteria 3197
897 Ga0500559_0045732 3300053136 Bacteria 1918
898 Ga0500573_0081514 3300053140 Bacteria 1838
899 Ga0500616_0000985 3300053153 Bacteria 30767
900 Ga0500616_0002919 3300053153 Bacteria 13647
901 Ga0500616_0050347 3300053153 Bacteria 2200
902 Ga0500616_0089137 3300053153 Bacteria 1531
903 Ga0500645_000314 3300053730 Bacteria 34564
904 Ga0466962_0021984 3300061719 Bacteria 3063

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048923 Ga0496120_0120535 Ga0496120_0120535_21_932 294
2 3300005331 Ga0070670_100022182 Ga0070670_1000221822 298
3 3300049574 Ga0501038_0050802 Ga0501038_0050802_441_1373 310
4 3300049575 Ga0501039_0000820 Ga0501039_0000820_11369_12301 310
5 3300049589 Ga0501073_0069076 Ga0501073_0069076_440_1372 310
6 3300005355 Ga0070671_100073068 Ga0070671_1000730683 311
7 3300005436 Ga0070713_100409465 Ga0070713_1004094652 311
8 3300005548 Ga0070665_100096541 Ga0070665_1000965412 311
9 3300005840 Ga0068870_10099674 Ga0068870_100996742 311
10 3300025931 Ga0207644_10128527 Ga0207644_101285272 311
11 3300026035 Ga0207703_10583677 Ga0207703_105836771 311
12 3300028379 Ga0268266_10048967 Ga0268266_100489672 311
13 3300039437 Ga0436365_1192272 Ga0436365_1192272_3467_4426 311
14 3300048912 Ga0496109_0255818 Ga0496109_0255818_304_1263 311
15 3300026121 Ga0207683_10439482 Ga0207683_104394822 312
16 3300006048 Ga0075363_100000604 Ga0075363_1000006049 313
17 3300050496 nmdc:mga07m45_41255_c1 nmdc:mga07m45_41255_c1_1456_2505 313
18 3300005530 Ga0070679_100189928 Ga0070679_1001899283 314
19 3300005343 Ga0070687_100059429 Ga0070687_1000594292 316
20 3300005347 Ga0070668_100028219 Ga0070668_1000282192 316
21 3300005356 Ga0070674_100211709 Ga0070674_1002117092 316
22 3300005614 Ga0068856_100102506 Ga0068856_1001025063 316
23 3300005844 Ga0068862_100023337 Ga0068862_1000233376 316
24 3300009101 Ga0105247_10103699 Ga0105247_101036992 316
25 3300025960 Ga0207651_10224550 Ga0207651_102245501 316
26 3300026067 Ga0207678_10034759 Ga0207678_100347594 316
27 3300026089 Ga0207648_10031243 Ga0207648_100312435 316
28 3300045976 Ga0466967_0185193 Ga0466967_0185193_587_1624 316
29 3300048911 Ga0496108_0142841 Ga0496108_0142841_696_1673 316
30 3300005340 Ga0070689_100031495 Ga0070689_1000314954 317
31 3300005366 Ga0070659_100053027 Ga0070659_1000530272 317
32 3300005539 Ga0068853_100106147 Ga0068853_1001061471 317
33 3300005548 Ga0070665_100619275 Ga0070665_1006192751 317
34 3300005563 Ga0068855_100282731 Ga0068855_1002827312 317
35 3300005577 Ga0068857_100119859 Ga0068857_1001198593 317
36 3300005616 Ga0068852_100045022 Ga0068852_1000450221 317
37 3300005719 Ga0068861_100033200 Ga0068861_1000332003 317
38 3300005834 Ga0068851_10063347 Ga0068851_100633473 317
39 3300005842 Ga0068858_100028712 Ga0068858_1000287124 317
40 3300005843 Ga0068860_100091101 Ga0068860_1000911013 317
41 3300006881 Ga0068865_100298468 Ga0068865_1002984681 317
42 3300009098 Ga0105245_10183001 Ga0105245_101830012 317
43 3300009148 Ga0105243_10221916 Ga0105243_102219162 317
44 3300013306 Ga0163162_10377156 Ga0163162_103771562 317
45 3300025918 Ga0207662_10108415 Ga0207662_101084151 317
46 3300025919 Ga0207657_10023227 Ga0207657_100232275 317
47 3300025925 Ga0207650_10198634 Ga0207650_101986342 317
48 3300025927 Ga0207687_10042236 Ga0207687_100422364 317
49 3300025935 Ga0207709_10264526 Ga0207709_102645261 317
50 3300025937 Ga0207669_10043311 Ga0207669_100433112 317
51 3300025942 Ga0207689_10006927 Ga0207689_100069277 317
52 3300025981 Ga0207640_10164446 Ga0207640_101644462 317
53 3300026075 Ga0207708_10020792 Ga0207708_100207924 317
54 3300026088 Ga0207641_10172973 Ga0207641_101729732 317
55 3300026118 Ga0207675_100020258 Ga0207675_1000202585 317
56 3300028379 Ga0268266_10091557 Ga0268266_100915572 317
57 3300028381 Ga0268264_10155019 Ga0268264_101550192 317
58 3300046471 Ga0495650_0074096 Ga0495650_0074096_58_1056 317
59 3300048913 Ga0496110_0035703 Ga0496110_0035703_2211_3191 317
60 3300025986 Ga0207658_10134872 Ga0207658_101348721 319
61 3300046543 Ga0495645_0041923 Ga0495645_0041923_918_1976 319
62 3300017792 Ga0163161_10280799 Ga0163161_102807991 320
63 3300041411 Ga0439466_0007096 Ga0439466_0007096_1121_2143 322
64 3300048907 Ga0496104_0404637 Ga0496104_0404637_55_1047 322
65 3300048917 Ga0496114_0165342 Ga0496114_0165342_195_1292 322
66 3300048929 Ga0496126_0317884 Ga0496126_0317884_11_994 322
67 3300046462 Ga0495651_0260227 Ga0495651_0260227_10_1020 327
68 3300046514 Ga0495618_0167462 Ga0495618_0167462_221_1243 330
69 3300046516 Ga0495628_0072784 Ga0495628_0072784_1596_2618 330
70 3300031242 Ga0265329_10032895 Ga0265329_100328952 335
71 3300025910 Ga0207684_10235250 Ga0207684_102352502 336
72 3300034957 Ga0373938_0011598 Ga0373938_0011598_85_1266 336
73 iso_pu_bacteria 2902810491 2902811530 336
74 3300035119 Ga0373956_0009951 Ga0373956_0009951_1659_2810 337
75 3300035172 Ga0373955_0013813 Ga0373955_0013813_1158_2309 337
76 3300036401 Ga0373937_0097544 Ga0373937_0097544_486_1637 337
77 3300046514 Ga0495618_0166457 Ga0495618_0166457_190_1341 337
78 3300046675 Ga0495657_0104559 Ga0495657_0104559_95_1246 337
79 3300047322 Ga0495680_0009363 Ga0495680_0009363_1586_2737 337
80 3300047444 Ga0495675_0180843 Ga0495675_0180843_51_1202 337
81 3300048088 Ga0495602_0009753 Ga0495602_0009753_1650_2801 337
82 iso_pu_bacteria 2857733635 2857736520 337
83 3300005327 Ga0070658_10021050 Ga0070658_100210502 338
84 3300005329 Ga0070683_100026326 Ga0070683_1000263262 338
85 3300005336 Ga0070680_100172615 Ga0070680_1001726152 338
86 3300005339 Ga0070660_100048372 Ga0070660_1000483723 338
87 3300005439 Ga0070711_100067138 Ga0070711_1000671383 338
88 3300005530 Ga0070679_100120416 Ga0070679_1001204162 338
89 3300005535 Ga0070684_100060064 Ga0070684_1000600643 338
90 3300005548 Ga0070665_100024659 Ga0070665_1000246594 338
91 3300013104 Ga0157370_10080037 Ga0157370_100800373 338
92 3300013105 Ga0157369_10003733 Ga0157369_100037332 338
93 3300013105 Ga0157369_10275444 Ga0157369_102754442 338
94 3300020081 Ga0206354_10328917 Ga0206354_103289171 338
95 3300025912 Ga0207707_10001233 Ga0207707_1000123316 338
96 3300025913 Ga0207695_10252398 Ga0207695_102523982 338
97 3300025915 Ga0207693_10220849 Ga0207693_102208492 338
98 3300025917 Ga0207660_10140091 Ga0207660_101400912 338
99 3300025919 Ga0207657_10031119 Ga0207657_100311191 338
100 3300025921 Ga0207652_10103837 Ga0207652_101038372 338
101 3300025939 Ga0207665_10049646 Ga0207665_100496463 338
102 3300026067 Ga0207678_10098328 Ga0207678_100983283 338
103 3300037068 Ga0373925_0000515 Ga0373925_0000515_35308_36336 338
104 3300046462 Ga0495651_0263301 Ga0495651_0263301_95_1162 338
105 3300048912 Ga0496109_0332787 Ga0496109_0332787_365_1393 338
106 3300049569 Ga0501032_0010760 Ga0501032_0010760_2401_3429 338
107 3300049571 Ga0501034_0024193 Ga0501034_0024193_4709_5737 338
108 3300049572 Ga0501036_0006542 Ga0501036_0006542_6026_7054 338
109 3300049573 Ga0501037_0001807 Ga0501037_0001807_11797_12825 338
110 3300049586 Ga0501070_0017639 Ga0501070_0017639_2113_3141 338
111 3300049823 Ga0501044_0013917 Ga0501044_0013917_2433_3461 338
112 3300053140 Ga0500573_0081514 Ga0500573_0081514_396_1439 338
113 iso_pu_bacteria 2643221619 2644113529 338
114 3300002772 JGI25164J39214_1000610 JGI25164J39214_100061011 339
115 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004208 339
116 3300005435 Ga0070714_100008555 Ga0070714_1000085556 339
117 3300006051 Ga0075364_10047048 Ga0075364_100470483 339
118 3300025231 Ga0207427_100010 Ga0207427_100010372 339
119 3300025233 Ga0209437_100578 Ga0209437_10057821 339
120 3300025261 Ga0209233_1000001 Ga0209233_10000011577 339
121 3300028556 Ga0265337_1008139 Ga0265337_10081393 339
122 3300028558 Ga0265326_10001409 Ga0265326_100014098 339
123 3300028563 Ga0265319_1006104 Ga0265319_10061043 339
124 3300028573 Ga0265334_10001883 Ga0265334_100018833 339
125 3300028653 Ga0265323_10009658 Ga0265323_100096583 339
126 3300028666 Ga0265336_10007199 Ga0265336_100071993 339
127 3300028800 Ga0265338_10001519 Ga0265338_1000151929 339
128 3300028800 Ga0265338_10017078 Ga0265338_100170785 339
129 3300031238 Ga0265332_10009991 Ga0265332_100099913 339
130 3300031240 Ga0265320_10015573 Ga0265320_100155734 339
131 3300031247 Ga0265340_10009267 Ga0265340_100092675 339
132 3300031249 Ga0265339_10037623 Ga0265339_100376232 339
133 3300031344 Ga0265316_10037167 Ga0265316_100371673 339
134 3300031712 Ga0265342_10009280 Ga0265342_100092803 339
135 3300031731 Ga0307405_10050783 Ga0307405_100507833 339
136 3300031901 Ga0307406_10057378 Ga0307406_100573782 339
137 3300031901 Ga0307406_10091403 Ga0307406_100914032 339
138 3300031911 Ga0307412_10106985 Ga0307412_101069852 339
139 3300041413 Ga0439465_0018753 Ga0439465_0018753_1020_2042 339
140 3300042004 Ga0439445_0001683 Ga0439445_0001683_892_1914 339
141 3300005367 Ga0070667_100058488 Ga0070667_1000584883 340
142 3300005434 Ga0070709_10040421 Ga0070709_100404212 340
143 3300005437 Ga0070710_10036310 Ga0070710_100363103 340
144 3300006051 Ga0075364_10014035 Ga0075364_100140358 340
145 3300006051 Ga0075364_10074510 Ga0075364_100745102 340
146 3300006173 Ga0070716_100009647 Ga0070716_1000096473 340
147 3300006175 Ga0070712_100026615 Ga0070712_1000266151 340
148 3300006186 Ga0075369_10034319 Ga0075369_100343192 340
149 3300006353 Ga0075370_10037088 Ga0075370_100370882 340
150 3300013105 Ga0157369_10105887 Ga0157369_101058872 340
151 3300025246 Ga0209646_1000041 Ga0209646_1000041302 340
152 3300025898 Ga0207692_10077885 Ga0207692_100778852 340
153 3300025916 Ga0207663_10113362 Ga0207663_101133621 340
154 3300025939 Ga0207665_10016340 Ga0207665_100163403 340
155 3300025986 Ga0207658_10146244 Ga0207658_101462442 340
156 3300031731 Ga0307405_10108608 Ga0307405_101086082 340
157 3300031838 Ga0307518_10120711 Ga0307518_101207112 340
158 3300031901 Ga0307406_10000462 Ga0307406_1000046219 340
159 3300044765 Ga0466970_0126734 Ga0466970_0126734_325_1377 340
160 3300046453 Ga0495627_000659 Ga0495627_000659_14002_15093 340
161 3300046471 Ga0495650_0003801 Ga0495650_0003801_880_1953 340
162 3300048905 Ga0496102_0086104 Ga0496102_0086104_1423_2454 340
163 3300048920 Ga0496117_0002843 Ga0496117_0002843_10631_11722 340
164 3300048920 Ga0496117_0050975 Ga0496117_0050975_231_1337 340
165 3300048921 Ga0496118_0021365 Ga0496118_0021365_3126_4232 340
166 3300048922 Ga0496119_0001501 Ga0496119_0001501_3203_4309 340
167 3300048923 Ga0496120_0001468 Ga0496120_0001468_8098_9204 340
168 3300048925 Ga0496122_0000022 Ga0496122_0000022_131015_132121 340
169 3300048925 Ga0496122_0015661 Ga0496122_0015661_206_1297 340
170 3300048926 Ga0496123_0000016 Ga0496123_0000016_177962_179068 340
171 3300048927 Ga0496124_0028795 Ga0496124_0028795_359_1465 340
172 3300048928 Ga0496125_0008550 Ga0496125_0008550_3562_4668 340
173 3300048928 Ga0496125_0009139 Ga0496125_0009139_356_1447 340
174 3300048928 Ga0496125_0045796 Ga0496125_0045796_2284_3375 340
175 3300048929 Ga0496126_0008872 Ga0496126_0008872_471_1577 340
176 3300048929 Ga0496126_0014353 Ga0496126_0014353_3105_4196 340
177 3300049571 Ga0501034_0078831 Ga0501034_0078831_1865_2917 340
178 3300049579 Ga0501043_0001927 Ga0501043_0001927_13730_14812 340
179 3300050491 nmdc:mga00v17_134573_c1 nmdc:mga00v17_134573_c1_172_1263 340
180 3300050491 nmdc:mga00v17_5113_c1 nmdc:mga00v17_5113_c1_2577_3668 340
181 3300050491 nmdc:mga00v17_7394_c1 nmdc:mga00v17_7394_c1_3892_4998 340
182 3300050492 nmdc:mga0yw44_19322_c1 nmdc:mga0yw44_19322_c1_2660_3715 340
183 3300053093 Ga0500651_0000214 Ga0500651_0000214_16333_17406 340
184 iso_pu_bacteria 2585428157 2588108059 340
185 iso_pu_bacteria 2643221553 2643783650 340
186 iso_pu_bacteria 2643221630 2644172843 340
187 iso_pu_bacteria 2643221724 2644679111 340
188 iso_pu_bacteria 2728369380 2730228609 340
189 iso_pu_bacteria 2747842429 2747952489 340
190 iso_pu_bacteria 2808606447 2809228354 340
191 iso_pu_bacteria 2852663356 2852666063 340
192 iso_pu_bacteria 2857723135 2857724520 340
193 iso_pu_bacteria 2862993130 2862993942 340
194 iso_pu_bacteria 2945968032 2945970674 340
195 iso_pu_bacteria 2946041624 2946043010 340
196 iso_pu_bacteria 2946080515 2946081953 340
197 iso_pu_bacteria 2977251589 2977253213 340
198 iso_pu_bacteria 2977264416 2977265432 340
199 iso_pu_bacteria 8004182704 8004183397 340
200 3300005355 Ga0070671_100010086 Ga0070671_1000100865 341
201 3300005367 Ga0070667_100006910 Ga0070667_1000069103 341
202 3300005367 Ga0070667_100149497 Ga0070667_1001494971 341
203 3300005548 Ga0070665_100035428 Ga0070665_1000354283 341
204 3300005618 Ga0068864_100159003 Ga0068864_1001590031 341
205 3300005841 Ga0068863_100007296 Ga0068863_10000729611 341
206 3300009553 Ga0105249_10091434 Ga0105249_100914342 341
207 3300014325 Ga0163163_10053751 Ga0163163_100537515 341
208 3300014325 Ga0163163_10142678 Ga0163163_101426782 341
209 3300025931 Ga0207644_10019771 Ga0207644_100197714 341
210 3300025961 Ga0207712_10122550 Ga0207712_101225502 341
211 3300025986 Ga0207658_10012804 Ga0207658_100128042 341
212 3300026088 Ga0207641_10019863 Ga0207641_100198633 341
213 3300026095 Ga0207676_10146585 Ga0207676_101465853 341
214 3300028379 Ga0268266_10022876 Ga0268266_100228765 341
215 3300044735 Ga0466968_0008136 Ga0466968_0008136_2015_3049 341
216 3300044765 Ga0466970_0025620 Ga0466970_0025620_661_1734 341
217 3300045049 Ga0466959_0098042 Ga0466959_0098042_897_1931 341
218 3300048913 Ga0496110_0012624 Ga0496110_0012624_5408_6445 341
219 3300048913 Ga0496110_0221299 Ga0496110_0221299_21_1058 341
220 3300048915 Ga0496112_0040147 Ga0496112_0040147_675_1712 341
221 3300048917 Ga0496114_0064031 Ga0496114_0064031_1438_2496 341
222 3300048929 Ga0496126_0188175 Ga0496126_0188175_67_1146 341
223 3300050492 nmdc:mga0yw44_66186_c1 nmdc:mga0yw44_66186_c1_465_1502 341
224 iso_pu_bacteria 2643221572 2643877309 341
225 iso_pu_bacteria 2643221669 2644384364 341
226 iso_pu_bacteria 2643221715 2644636841 341
227 iso_pu_bacteria 2857720070 2857720898 341
228 iso_pu_bacteria 2895660088 2895661879 341
229 iso_pu_bacteria 2919395869 2919397785 341
230 3300002077 JGI24744J21845_10000925 JGI24744J21845_100009257 342
231 3300002077 JGI24744J21845_10002976 JGI24744J21845_100029763 342
232 3300003578 Ga0006562J51391_1052848 Ga0006562J51391_10528483 342
233 3300003578 Ga0006562J51391_1052849 Ga0006562J51391_10528493 342
234 3300005330 Ga0070690_100020140 Ga0070690_1000201403 342
235 3300005337 Ga0070682_100016863 Ga0070682_1000168632 342
236 3300005338 Ga0068868_100020559 Ga0068868_1000205595 342
237 3300005340 Ga0070689_100302899 Ga0070689_1003028992 342
238 3300005341 Ga0070691_10014414 Ga0070691_100144144 342
239 3300005365 Ga0070688_100009770 Ga0070688_1000097703 342
240 3300005365 Ga0070688_100096343 Ga0070688_1000963432 342
241 3300005367 Ga0070667_100004304 Ga0070667_10000430410 342
242 3300005367 Ga0070667_100073872 Ga0070667_1000738724 342
243 3300005434 Ga0070709_10248454 Ga0070709_102484542 342
244 3300005437 Ga0070710_10001142 Ga0070710_100011425 342
245 3300005437 Ga0070710_10006248 Ga0070710_100062482 342
246 3300005439 Ga0070711_100019946 Ga0070711_1000199464 342
247 3300005439 Ga0070711_100063410 Ga0070711_1000634103 342
248 3300005439 Ga0070711_100311184 Ga0070711_1003111841 342
249 3300005440 Ga0070705_100009661 Ga0070705_1000096612 342
250 3300005441 Ga0070700_100015753 Ga0070700_1000157533 342
251 3300005441 Ga0070700_100027635 Ga0070700_1000276351 342
252 3300005444 Ga0070694_100034977 Ga0070694_1000349772 342
253 3300005455 Ga0070663_100028191 Ga0070663_1000281912 342
254 3300005455 Ga0070663_100059005 Ga0070663_1000590052 342
255 3300005456 Ga0070678_100033574 Ga0070678_1000335744 342
256 3300005457 Ga0070662_100015453 Ga0070662_1000154533 342
257 3300005459 Ga0068867_100036674 Ga0068867_1000366742 342
258 3300005468 Ga0070707_100008194 Ga0070707_1000081946 342
259 3300005471 Ga0070698_100075960 Ga0070698_1000759602 342
260 3300005539 Ga0068853_100017673 Ga0068853_1000176736 342
261 3300005539 Ga0068853_100038126 Ga0068853_1000381262 342
262 3300005544 Ga0070686_100263802 Ga0070686_1002638021 342
263 3300005548 Ga0070665_100019294 Ga0070665_1000192945 342
264 3300005548 Ga0070665_100059445 Ga0070665_1000594452 342
265 3300005549 Ga0070704_100001394 Ga0070704_1000013948 342
266 3300005563 Ga0068855_100024676 Ga0068855_1000246762 342
267 3300005563 Ga0068855_100607443 Ga0068855_1006074431 342
268 3300005578 Ga0068854_100034070 Ga0068854_1000340704 342
269 3300005614 Ga0068856_100159916 Ga0068856_1001599162 342
270 3300005615 Ga0070702_100148572 Ga0070702_1001485722 342
271 3300005617 Ga0068859_100016504 Ga0068859_1000165047 342
272 3300005617 Ga0068859_100047711 Ga0068859_1000477112 342
273 3300005718 Ga0068866_10000565 Ga0068866_1000056514 342
274 3300005718 Ga0068866_10116007 Ga0068866_101160072 342
275 3300005719 Ga0068861_100022577 Ga0068861_1000225775 342
276 3300005719 Ga0068861_100048315 Ga0068861_1000483152 342
277 3300005719 Ga0068861_100053692 Ga0068861_1000536922 342
278 3300005834 Ga0068851_10045682 Ga0068851_100456822 342
279 3300005842 Ga0068858_100025787 Ga0068858_1000257872 342
280 3300005843 Ga0068860_100057127 Ga0068860_1000571274 342
281 3300005844 Ga0068862_100004446 Ga0068862_1000044464 342
282 3300005937 Ga0081455_10080041 Ga0081455_100800413 342
283 3300006038 Ga0075365_10196945 Ga0075365_101969451 342
284 3300006048 Ga0075363_100000810 Ga0075363_1000008103 342
285 3300006048 Ga0075363_100093533 Ga0075363_1000935332 342
286 3300006048 Ga0075363_100127560 Ga0075363_1001275601 342
287 3300006051 Ga0075364_10101518 Ga0075364_101015182 342
288 3300006051 Ga0075364_10128235 Ga0075364_101282352 342
289 3300006163 Ga0070715_10009036 Ga0070715_100090364 342
290 3300006173 Ga0070716_100053789 Ga0070716_1000537892 342
291 3300006175 Ga0070712_100027713 Ga0070712_1000277132 342
292 3300006358 Ga0068871_100214564 Ga0068871_1002145642 342
293 3300006844 Ga0075428_100002613 Ga0075428_10000261314 342
294 3300006846 Ga0075430_100050723 Ga0075430_1000507234 342
295 3300006881 Ga0068865_100031272 Ga0068865_1000312722 342
296 3300006931 Ga0097620_100016503 Ga0097620_1000165037 342
297 3300006931 Ga0097620_100047713 Ga0097620_1000477132 342
298 3300009098 Ga0105245_10029659 Ga0105245_100296595 342
299 3300009098 Ga0105245_10047438 Ga0105245_100474381 342
300 3300009101 Ga0105247_10000021 Ga0105247_1000002147 342
301 3300009101 Ga0105247_10001116 Ga0105247_100011161 342
302 3300009101 Ga0105247_10003213 Ga0105247_1000321312 342
303 3300009101 Ga0105247_10015303 Ga0105247_100153033 342
304 3300009147 Ga0114129_10012530 Ga0114129_100125304 342
305 3300009148 Ga0105243_10001479 Ga0105243_100014792 342
306 3300009174 Ga0105241_10039510 Ga0105241_100395104 342
307 3300009176 Ga0105242_10055802 Ga0105242_100558023 342
308 3300009177 Ga0105248_10002026 Ga0105248_100020267 342
309 3300009177 Ga0105248_10011195 Ga0105248_100111954 342
310 3300009177 Ga0105248_10082701 Ga0105248_100827012 342
311 3300009545 Ga0105237_10040735 Ga0105237_100407352 342
312 3300009553 Ga0105249_10000334 Ga0105249_100003348 342
313 3300009553 Ga0105249_10021666 Ga0105249_100216662 342
314 3300010375 Ga0105239_10032795 Ga0105239_100327956 342
315 3300011119 Ga0105246_10156933 Ga0105246_101569332 342
316 3300013296 Ga0157374_10058281 Ga0157374_100582813 342
317 3300013296 Ga0157374_10441268 Ga0157374_104412681 342
318 3300013297 Ga0157378_10019079 Ga0157378_100190792 342
319 3300013307 Ga0157372_10037399 Ga0157372_100373992 342
320 3300013307 Ga0157372_10075895 Ga0157372_100758952 342
321 3300014325 Ga0163163_10062868 Ga0163163_100628684 342
322 3300014325 Ga0163163_10084778 Ga0163163_100847784 342
323 3300014745 Ga0157377_10024886 Ga0157377_100248862 342
324 3300014969 Ga0157376_10237576 Ga0157376_102375761 342
325 3300017792 Ga0163161_10061013 Ga0163161_100610132 342
326 3300017792 Ga0163161_10068721 Ga0163161_100687212 342
327 3300025321 Ga0207656_10026127 Ga0207656_100261272 342
328 3300025898 Ga0207692_10004112 Ga0207692_100041122 342
329 3300025899 Ga0207642_10002868 Ga0207642_100028684 342
330 3300025900 Ga0207710_10013676 Ga0207710_100136762 342
331 3300025900 Ga0207710_10027108 Ga0207710_100271083 342
332 3300025901 Ga0207688_10000922 Ga0207688_1000092212 342
333 3300025901 Ga0207688_10003057 Ga0207688_100030574 342
334 3300025903 Ga0207680_10241954 Ga0207680_102419541 342
335 3300025904 Ga0207647_10020846 Ga0207647_100208463 342
336 3300025906 Ga0207699_10054340 Ga0207699_100543403 342
337 3300025915 Ga0207693_10001596 Ga0207693_1000159620 342
338 3300025916 Ga0207663_10176184 Ga0207663_101761842 342
339 3300025918 Ga0207662_10022056 Ga0207662_100220563 342
340 3300025919 Ga0207657_10060693 Ga0207657_100606933 342
341 3300025923 Ga0207681_10070177 Ga0207681_100701772 342
342 3300025927 Ga0207687_10015909 Ga0207687_100159092 342
343 3300025927 Ga0207687_10030610 Ga0207687_100306102 342
344 3300025932 Ga0207690_10029858 Ga0207690_100298584 342
345 3300025933 Ga0207706_10027634 Ga0207706_100276345 342
346 3300025933 Ga0207706_10114659 Ga0207706_101146592 342
347 3300025935 Ga0207709_10007028 Ga0207709_100070285 342
348 3300025936 Ga0207670_10149624 Ga0207670_101496242 342
349 3300025937 Ga0207669_10003219 Ga0207669_100032194 342
350 3300025937 Ga0207669_10190042 Ga0207669_101900422 342
351 3300025938 Ga0207704_10048508 Ga0207704_100485082 342
352 3300025942 Ga0207689_10012303 Ga0207689_100123037 342
353 3300025949 Ga0207667_10006383 Ga0207667_1000638310 342
354 3300025949 Ga0207667_10380504 Ga0207667_103805042 342
355 3300025981 Ga0207640_10029516 Ga0207640_100295164 342
356 3300025986 Ga0207658_10025959 Ga0207658_100259594 342
357 3300026023 Ga0207677_10045644 Ga0207677_100456442 342
358 3300026023 Ga0207677_10370676 Ga0207677_103706761 342
359 3300026035 Ga0207703_10015313 Ga0207703_100153132 342
360 3300026041 Ga0207639_10006233 Ga0207639_100062339 342
361 3300026041 Ga0207639_10434399 Ga0207639_104343991 342
362 3300026067 Ga0207678_10060056 Ga0207678_100600562 342
363 3300026067 Ga0207678_10069407 Ga0207678_100694072 342
364 3300026075 Ga0207708_10018119 Ga0207708_100181193 342
365 3300026075 Ga0207708_10038560 Ga0207708_100385604 342
366 3300026078 Ga0207702_10192713 Ga0207702_101927132 342
367 3300026089 Ga0207648_10013316 Ga0207648_100133164 342
368 3300026089 Ga0207648_10161045 Ga0207648_101610452 342
369 3300026118 Ga0207675_100001865 Ga0207675_1000018652 342
370 3300026118 Ga0207675_100024098 Ga0207675_1000240982 342
371 3300026121 Ga0207683_10001241 Ga0207683_1000124123 342
372 3300026121 Ga0207683_10093339 Ga0207683_100933392 342
373 3300026142 Ga0207698_10166665 Ga0207698_101666652 342
374 3300028379 Ga0268266_10027973 Ga0268266_100279735 342
375 3300028379 Ga0268266_10039795 Ga0268266_100397953 342
376 3300028381 Ga0268264_10075912 Ga0268264_100759123 342
377 3300031901 Ga0307406_10000084 Ga0307406_1000008426 342
378 3300032002 Ga0307416_100294501 Ga0307416_1002945011 342
379 3300035086 Ga0373934_0014375 Ga0373934_0014375_1218_2276 342
380 3300035111 Ga0373923_0004663 Ga0373923_0004663_3252_4310 342
381 3300035112 Ga0373932_0043171 Ga0373932_0043171_105_1190 342
382 3300035113 Ga0373936_0001862 Ga0373936_0001862_2003_3061 342
383 3300035117 Ga0373953_0004506 Ga0373953_0004506_1381_2439 342
384 3300035118 Ga0373954_0035972 Ga0373954_0035972_388_1446 342
385 3300035119 Ga0373956_0010810 Ga0373956_0010810_852_1910 342
386 3300035120 Ga0373957_0001974 Ga0373957_0001974_851_1909 342
387 3300035172 Ga0373955_0007386 Ga0373955_0007386_388_1446 342
388 3300035242 Ga0373962_0026856 Ga0373962_0026856_217_1302 342
389 3300035410 Ga0373924_0002394 Ga0373924_0002394_1071_2129 342
390 3300035691 Ga0373931_0003677 Ga0373931_0003677_3616_4701 342
391 3300035691 Ga0373931_0024198 Ga0373931_0024198_1863_2912 342
392 3300035692 Ga0373935_0004857 Ga0373935_0004857_1381_2439 342
393 3300035724 Ga0373933_0004119 Ga0373933_0004119_4351_5409 342
394 3300036401 Ga0373937_0055905 Ga0373937_0055905_283_1341 342
395 3300037068 Ga0373925_0160652 Ga0373925_0160652_37_1098 342
396 3300037466 Ga0395898_0156465 Ga0395898_0156465_1050_2153 342
397 3300041411 Ga0439466_0002551 Ga0439466_0002551_4376_5425 342
398 3300041413 Ga0439465_0007508 Ga0439465_0007508_101_1150 342
399 3300041997 Ga0439431_0005291 Ga0439431_0005291_666_1715 342
400 3300044658 Ga0466972_0137762 Ga0466972_0137762_27_1055 342
401 3300044693 Ga0466961_0126498 Ga0466961_0126498_490_1539 342
402 3300044765 Ga0466970_0000001 Ga0466970_0000001_152669_153769 342
403 3300044765 Ga0466970_0025418 Ga0466970_0025418_997_2046 342
404 3300044765 Ga0466970_0086871 Ga0466970_0086871_182_1231 342
405 3300045976 Ga0466967_0195791 Ga0466967_0195791_674_1723 342
406 3300045976 Ga0466967_0403646 Ga0466967_0403646_138_1178 342
407 3300046454 Ga0495592_0048698 Ga0495592_0048698_388_1446 342
408 3300046459 Ga0495629_0000993 Ga0495629_0000993_6576_7634 342
409 3300046462 Ga0495651_0013521 Ga0495651_0013521_2971_4029 342
410 3300046463 Ga0495653_0027159 Ga0495653_0027159_724_1782 342
411 3300046473 Ga0495582_0001321 Ga0495582_0001321_1692_2750 342
412 3300046475 Ga0495639_0005485 Ga0495639_0005485_2390_3448 342
413 3300046476 Ga0495662_0025253 Ga0495662_0025253_851_1909 342
414 3300046477 Ga0495664_0025265 Ga0495664_0025265_1548_2606 342
415 3300046511 Ga0495608_0013379 Ga0495608_0013379_1381_2439 342
416 3300046514 Ga0495618_0013760 Ga0495618_0013760_3605_4663 342
417 3300046516 Ga0495628_0042575 Ga0495628_0042575_724_1782 342
418 3300046517 Ga0495630_0049166 Ga0495630_0049166_1838_2896 342
419 3300046529 Ga0495652_0055561 Ga0495652_0055561_260_1318 342
420 3300046531 Ga0495665_0001805 Ga0495665_0001805_9749_10807 342
421 3300046533 Ga0495640_0023234 Ga0495640_0023234_1870_2928 342
422 3300046536 Ga0495587_0031736 Ga0495587_0031736_1139_2197 342
423 3300046543 Ga0495645_0022367 Ga0495645_0022367_1677_2735 342
424 3300046559 Ga0495667_0004804 Ga0495667_0004804_4601_5659 342
425 3300046642 Ga0495634_0019930 Ga0495634_0019930_3442_4500 342
426 3300046663 Ga0495635_0010854 Ga0495635_0010854_724_1782 342
427 3300046675 Ga0495657_0014053 Ga0495657_0014053_1381_2439 342
428 3300046678 Ga0495599_0056494 Ga0495599_0056494_1139_2197 342
429 3300046679 Ga0495623_0026261 Ga0495623_0026261_852_1910 342
430 3300046680 Ga0495646_0014836 Ga0495646_0014836_1218_2276 342
431 3300046689 Ga0495613_0009745 Ga0495613_0009745_4535_5593 342
432 3300046690 Ga0495624_0010818 Ga0495624_0010818_1139_2197 342
433 3300046809 Ga0495600_0023090 Ga0495600_0023090_1975_3033 342
434 3300047315 Ga0495581_0002013 Ga0495581_0002013_7215_8273 342
435 3300047317 Ga0495604_0055873 Ga0495604_0055873_1724_2782 342
436 3300047319 Ga0495674_0100851 Ga0495674_0100851_1139_2197 342
437 3300047322 Ga0495680_0011106 Ga0495680_0011106_3135_4193 342
438 3300047444 Ga0495675_0004571 Ga0495675_0004571_4537_5595 342
439 3300047471 Ga0495684_0074370 Ga0495684_0074370_800_1858 342
440 3300047673 Ga0495593_0005468 Ga0495593_0005468_3156_4214 342
441 3300048088 Ga0495602_0025572 Ga0495602_0025572_2605_3663 342
442 3300048903 Ga0496100_0003285 Ga0496100_0003285_226_1275 342
443 3300048903 Ga0496100_0025263 Ga0496100_0025263_1873_2958 342
444 3300048903 Ga0496100_0070051 Ga0496100_0070051_164_1225 342
445 3300048904 Ga0496101_0015505 Ga0496101_0015505_2050_3099 342
446 3300048904 Ga0496101_0106966 Ga0496101_0106966_444_1502 342
447 3300048905 Ga0496102_0000458 Ga0496102_0000458_12362_13390 342
448 3300048905 Ga0496102_0009161 Ga0496102_0009161_4188_5273 342
449 3300048905 Ga0496102_0063338 Ga0496102_0063338_1286_2335 342
450 3300048906 Ga0496103_0000466 Ga0496103_0000466_1500_2528 342
451 3300048906 Ga0496103_0010715 Ga0496103_0010715_4077_5126 342
452 3300048906 Ga0496103_0022667 Ga0496103_0022667_1916_3001 342
453 3300048907 Ga0496104_0006336 Ga0496104_0006336_12_1070 342
454 3300048907 Ga0496104_0062216 Ga0496104_0062216_111_1160 342
455 3300048908 Ga0496105_0024016 Ga0496105_0024016_991_2076 342
456 3300048908 Ga0496105_0182859 Ga0496105_0182859_344_1405 342
457 3300048909 Ga0496106_0000592 Ga0496106_0000592_18368_19429 342
458 3300048909 Ga0496106_0004806 Ga0496106_0004806_6103_7188 342
459 3300048910 Ga0496107_0008974 Ga0496107_0008974_4623_5708 342
460 3300048910 Ga0496107_0012670 Ga0496107_0012670_2073_3122 342
461 3300048911 Ga0496108_0000457 Ga0496108_0000457_15146_16195 342
462 3300048911 Ga0496108_0015973 Ga0496108_0015973_1320_2405 342
463 3300048912 Ga0496109_0010428 Ga0496109_0010428_2516_3565 342
464 3300048912 Ga0496109_0027087 Ga0496109_0027087_117_1202 342
465 3300048912 Ga0496109_0050077 Ga0496109_0050077_1160_2221 342
466 3300048912 Ga0496109_0103315 Ga0496109_0103315_954_1988 342
467 3300048913 Ga0496110_0020634 Ga0496110_0020634_1705_2754 342
468 3300048913 Ga0496110_0138339 Ga0496110_0138339_948_2033 342
469 3300048914 Ga0496111_0012381 Ga0496111_0012381_2422_3507 342
470 3300048914 Ga0496111_0092861 Ga0496111_0092861_1035_2096 342
471 3300048915 Ga0496112_0070457 Ga0496112_0070457_2145_3230 342
472 3300048915 Ga0496112_0182663 Ga0496112_0182663_717_1778 342
473 3300048916 Ga0496113_0015130 Ga0496113_0015130_298_1377 342
474 3300048917 Ga0496114_0008791 Ga0496114_0008791_2578_3627 342
475 3300048917 Ga0496114_0029407 Ga0496114_0029407_1678_2763 342
476 3300048918 Ga0496115_0148301 Ga0496115_0148301_744_1829 342
477 3300048919 Ga0496116_0007005 Ga0496116_0007005_3751_4779 342
478 3300048920 Ga0496117_0000607 Ga0496117_0000607_35591_36694 342
479 3300048920 Ga0496117_0005412 Ga0496117_0005412_1373_2401 342
480 3300048921 Ga0496118_0003349 Ga0496118_0003349_1631_2734 342
481 3300048921 Ga0496118_0004676 Ga0496118_0004676_3551_4579 342
482 3300048922 Ga0496119_0001062 Ga0496119_0001062_2129_3232 342
483 3300048923 Ga0496120_0009678 Ga0496120_0009678_5626_6729 342
484 3300048923 Ga0496120_0030264 Ga0496120_0030264_1559_2641 342
485 3300048925 Ga0496122_0000095 Ga0496122_0000095_140909_142012 342
486 3300048926 Ga0496123_0000100 Ga0496123_0000100_27980_29083 342
487 3300048927 Ga0496124_0013426 Ga0496124_0013426_4806_5909 342
488 3300048927 Ga0496124_0293127 Ga0496124_0293127_71_1099 342
489 3300048928 Ga0496125_0000326 Ga0496125_0000326_17274_18392 342
490 3300048928 Ga0496125_0009156 Ga0496125_0009156_959_2062 342
491 3300049571 Ga0501034_0065853 Ga0501034_0065853_1078_2118 342
492 3300049583 Ga0501067_0004199 Ga0501067_0004199_152_1213 342
493 3300050489 nmdc:mga03683_22225_c1 nmdc:mga03683_22225_c1_1351_2391 342
494 3300050490 nmdc:mga03n38_68713_c1 nmdc:mga03n38_68713_c1_582_1622 342
495 3300050491 nmdc:mga00v17_2960_c1 nmdc:mga00v17_2960_c1_73_1113 342
496 3300050496 nmdc:mga07m45_12208_c1 nmdc:mga07m45_12208_c1_152_1192 342
497 3300050507 nmdc:mga05p37_8977_c1 nmdc:mga05p37_8977_c1_1641_2687 342
498 3300050509 nmdc:mga0qj67_98222_c1 nmdc:mga0qj67_98222_c1_1114_2160 342
499 3300050510 nmdc:mga06r32_65895_c1 nmdc:mga06r32_65895_c1_1700_2746 342
500 3300053077 Ga0495601_0006165 Ga0495601_0006165_4156_5214 342
501 3300053078 Ga0495612_0038021 Ga0495612_0038021_387_1445 342
502 3300053079 Ga0500610_0047321 Ga0500610_0047321_206_1234 342
503 3300053084 Ga0495595_0002906 Ga0495595_0002906_3513_4571 342
504 3300053085 Ga0495619_0009931 Ga0495619_0009931_3098_4156 342
505 iso_pu_bacteria 2738541274 2738708106 342
506 iso_pu_bacteria 2738543028 2739334358 342
507 iso_pu_bacteria 2773857759 2774383021 342
508 iso_pu_bacteria 2842134933 2842136056 342
509 3300005334 Ga0068869_100021575 Ga0068869_1000215755 343
510 3300005356 Ga0070674_100071222 Ga0070674_1000712222 343
511 3300005440 Ga0070705_100063932 Ga0070705_1000639322 343
512 3300005444 Ga0070694_100261197 Ga0070694_1002611972 343
513 3300005471 Ga0070698_100029267 Ga0070698_1000292673 343
514 3300005546 Ga0070696_100096784 Ga0070696_1000967842 343
515 3300005547 Ga0070693_100214599 Ga0070693_1002145991 343
516 3300005577 Ga0068857_100002430 Ga0068857_1000024308 343
517 3300005616 Ga0068852_100105101 Ga0068852_1001051012 343
518 3300005834 Ga0068851_10000009 Ga0068851_100000094 343
519 3300006028 Ga0070717_10065723 Ga0070717_100657232 343
520 3300006186 Ga0075369_10009406 Ga0075369_100094062 343
521 3300006846 Ga0075430_100017367 Ga0075430_1000173672 343
522 3300009551 Ga0105238_10003262 Ga0105238_100032629 343
523 3300025321 Ga0207656_10000001 Ga0207656_10000001525 343
524 3300025321 Ga0207656_10000003 Ga0207656_10000003631 343
525 3300025321 Ga0207656_10000004 Ga0207656_10000004488 343
526 3300025728 Ga0207655_1020411 Ga0207655_10204113 343
527 3300025914 Ga0207671_10000001 Ga0207671_10000001523 343
528 3300025915 Ga0207693_10194033 Ga0207693_101940332 343
529 3300025942 Ga0207689_10026243 Ga0207689_100262434 343
530 3300026116 Ga0207674_10002645 Ga0207674_1000264517 343
531 3300026142 Ga0207698_10002468 Ga0207698_100024689 343
532 3300031456 Ga0307513_10003355 Ga0307513_1000335517 343
533 3300031824 Ga0307413_10132531 Ga0307413_101325312 343
534 3300031852 Ga0307410_10228907 Ga0307410_102289072 343
535 3300032126 Ga0307415_100228548 Ga0307415_1002285482 343
536 3300033179 Ga0307507_10000024 Ga0307507_10000024113 343
537 3300035725 Ga0373947_0194624 Ga0373947_0194624_51_1097 343
538 3300036401 Ga0373937_0409301 Ga0373937_0409301_200_1246 343
539 3300041413 Ga0439465_0005845 Ga0439465_0005845_854_1906 343
540 3300041413 Ga0439465_0010776 Ga0439465_0010776_1437_2492 343
541 3300041456 Ga0451795_0736678 Ga0451795_0736678_54_1157 343
542 3300044765 Ga0466970_0003519 Ga0466970_0003519_6365_7405 343
543 3300045049 Ga0466959_0129680 Ga0466959_0129680_38_1078 343
544 3300046459 Ga0495629_0014583 Ga0495629_0014583_4119_5165 343
545 3300046473 Ga0495582_0015162 Ga0495582_0015162_78_1124 343
546 3300046476 Ga0495662_0030506 Ga0495662_0030506_54_1100 343
547 3300046517 Ga0495630_0275571 Ga0495630_0275571_95_1141 343
548 3300046533 Ga0495640_0050600 Ga0495640_0050600_1096_2142 343
549 3300047315 Ga0495581_0007135 Ga0495581_0007135_5205_6251 343
550 3300047319 Ga0495674_0060234 Ga0495674_0060234_763_1809 343
551 3300048904 Ga0496101_0042441 Ga0496101_0042441_796_1848 343
552 3300048905 Ga0496102_0019400 Ga0496102_0019400_3015_4067 343
553 3300048918 Ga0496115_0012317 Ga0496115_0012317_1331_2410 343
554 3300048918 Ga0496115_0083354 Ga0496115_0083354_1451_2503 343
555 3300050516 nmdc:mga0sz30_15979_c1 nmdc:mga0sz30_15979_c1_746_1798 343
556 3300053136 Ga0500559_0045732 Ga0500559_0045732_344_1381 343
557 3300053153 Ga0500616_0000985 Ga0500616_0000985_22978_24075 343
558 3300053153 Ga0500616_0089137 Ga0500616_0089137_388_1482 343
559 3300053730 Ga0500645_000314 Ga0500645_000314_23240_24277 343
560 3300061719 Ga0466962_0021984 Ga0466962_0021984_75_1115 343
561 iso_pu_bacteria 2818991458 2819667160 343
562 iso_pu_bacteria 2929212328 2929212934 343
563 iso_pu_bacteria 2939582691 2939583119 343
564 3300005334 Ga0068869_100032335 Ga0068869_1000323354 344
565 3300005347 Ga0070668_100334812 Ga0070668_1003348122 344
566 3300005364 Ga0070673_100128577 Ga0070673_1001285772 344
567 3300005436 Ga0070713_100019191 Ga0070713_1000191915 344
568 3300005436 Ga0070713_100299752 Ga0070713_1002997521 344
569 3300005455 Ga0070663_100020914 Ga0070663_1000209144 344
570 3300005564 Ga0070664_100018762 Ga0070664_1000187626 344
571 3300005841 Ga0068863_100110113 Ga0068863_1001101131 344
572 3300006038 Ga0075365_10010713 Ga0075365_100107135 344
573 3300006038 Ga0075365_10050477 Ga0075365_100504772 344
574 3300006048 Ga0075363_100015203 Ga0075363_1000152033 344
575 3300006051 Ga0075364_10013507 Ga0075364_100135072 344
576 3300006051 Ga0075364_10031738 Ga0075364_100317384 344
577 3300006178 Ga0075367_10224570 Ga0075367_102245702 344
578 3300006186 Ga0075369_10001174 Ga0075369_100011742 344
579 3300006186 Ga0075369_10028775 Ga0075369_100287753 344
580 3300006353 Ga0075370_10013976 Ga0075370_100139763 344
581 3300011119 Ga0105246_10013157 Ga0105246_100131572 344
582 3300011119 Ga0105246_10094654 Ga0105246_100946542 344
583 3300013297 Ga0157378_10090946 Ga0157378_100909461 344
584 3300025906 Ga0207699_10179620 Ga0207699_101796201 344
585 3300025928 Ga0207700_10021101 Ga0207700_100211014 344
586 3300025929 Ga0207664_10069122 Ga0207664_100691222 344
587 3300025929 Ga0207664_10126118 Ga0207664_101261182 344
588 3300025945 Ga0207679_10014500 Ga0207679_100145005 344
589 3300026067 Ga0207678_10031803 Ga0207678_100318034 344
590 3300026118 Ga0207675_100046925 Ga0207675_1000469253 344
591 3300031852 Ga0307410_10168617 Ga0307410_101686172 344
592 3300031903 Ga0307407_10026016 Ga0307407_100260161 344
593 3300035083 Ga0373926_0000308 Ga0373926_0000308_9101_10177 344
594 3300035086 Ga0373934_0018534 Ga0373934_0018534_1438_2508 344
595 3300035089 Ga0373944_0001289 Ga0373944_0001289_2646_3722 344
596 3300035111 Ga0373923_0041955 Ga0373923_0041955_643_1719 344
597 3300035113 Ga0373936_0000921 Ga0373936_0000921_1705_2781 344
598 3300035116 Ga0373945_0000101 Ga0373945_0000101_11140_12216 344
599 3300035170 Ga0373943_0000883 Ga0373943_0000883_10786_11862 344
600 3300035171 Ga0373946_0000138 Ga0373946_0000138_16403_17479 344
601 3300035692 Ga0373935_0001284 Ga0373935_0001284_4654_5730 344
602 3300035695 Ga0373927_0018145 Ga0373927_0018145_1335_2411 344
603 3300035724 Ga0373933_0022301 Ga0373933_0022301_2239_3309 344
604 3300035724 Ga0373933_0211598 Ga0373933_0211598_16_1086 344
605 3300035725 Ga0373947_0000959 Ga0373947_0000959_616_1692 344
606 3300036401 Ga0373937_0027975 Ga0373937_0027975_2156_3226 344
607 3300036401 Ga0373937_0251759 Ga0373937_0251759_313_1389 344
608 3300037068 Ga0373925_0009562 Ga0373925_0009562_1332_2408 344
609 3300044683 Ga0466965_0002722 Ga0466965_0002722_622_1674 344
610 3300044901 Ga0466960_0000764 Ga0466960_0000764_5651_6703 344
611 3300045976 Ga0466967_0032527 Ga0466967_0032527_1758_2834 344
612 3300046461 Ga0495641_0011655 Ga0495641_0011655_1772_2848 344
613 3300046462 Ga0495651_0147603 Ga0495651_0147603_248_1324 344
614 3300046463 Ga0495653_0005583 Ga0495653_0005583_7834_8910 344
615 3300046473 Ga0495582_0097596 Ga0495582_0097596_419_1495 344
616 3300046477 Ga0495664_0002354 Ga0495664_0002354_7944_9020 344
617 3300046514 Ga0495618_0004262 Ga0495618_0004262_357_1433 344
618 3300046517 Ga0495630_0071586 Ga0495630_0071586_1146_2222 344
619 3300046529 Ga0495652_0015786 Ga0495652_0015786_243_1319 344
620 3300046559 Ga0495667_0000804 Ga0495667_0000804_8074_9144 344
621 3300046559 Ga0495667_0002742 Ga0495667_0002742_2107_3183 344
622 3300046642 Ga0495634_0044903 Ga0495634_0044903_199_1269 344
623 3300046663 Ga0495635_0000896 Ga0495635_0000896_9015_10091 344
624 3300046675 Ga0495657_0013962 Ga0495657_0013962_680_1756 344
625 3300046678 Ga0495599_0021710 Ga0495599_0021710_1221_2297 344
626 3300046690 Ga0495624_0001916 Ga0495624_0001916_10815_11891 344
627 3300046809 Ga0495600_0178382 Ga0495600_0178382_168_1244 344
628 3300047315 Ga0495581_0012048 Ga0495581_0012048_222_1298 344
629 3300047317 Ga0495604_0229159 Ga0495604_0229159_159_1235 344
630 3300047319 Ga0495674_0000239 Ga0495674_0000239_26672_27748 344
631 3300047320 Ga0495672_0049782 Ga0495672_0049782_156_1196 344
632 3300047321 Ga0495676_0005648 Ga0495676_0005648_8286_9362 344
633 3300047322 Ga0495680_0002131 Ga0495680_0002131_4052_5128 344
634 3300047322 Ga0495680_0197724 Ga0495680_0197724_332_1420 344
635 3300047471 Ga0495684_0000873 Ga0495684_0000873_993_2069 344
636 3300047673 Ga0495593_0031391 Ga0495593_0031391_433_1509 344
637 3300048904 Ga0496101_0024596 Ga0496101_0024596_3020_4111 344
638 3300048929 Ga0496126_0003871 Ga0496126_0003871_4617_5678 344
639 3300048929 Ga0496126_0006488 Ga0496126_0006488_340_1401 344
640 3300049581 Ga0501047_0017179 Ga0501047_0017179_1794_2906 344
641 3300050489 nmdc:mga03683_60462_c1 nmdc:mga03683_60462_c1_277_1326 344
642 3300050490 nmdc:mga03n38_14266_c1 nmdc:mga03n38_14266_c1_464_1513 344
643 3300050492 nmdc:mga0yw44_10327_c1 nmdc:mga0yw44_10327_c1_1587_2654 344
644 3300050492 nmdc:mga0yw44_40047_c1 nmdc:mga0yw44_40047_c1_1486_2535 344
645 3300053087 Ga0500643_023165 Ga0500643_023165_857_1897 344
646 iso_pu_bacteria 2513237101 2513693617 344
647 iso_pu_bacteria 2721755755 2723847517 344
648 iso_pu_bacteria 8006994254 8006994503 344
649 3300011119 Ga0105246_10103048 Ga0105246_101030483 345
650 3300017792 Ga0163161_10061026 Ga0163161_100610261 345
651 3300034818 Ga0373950_0007108 Ga0373950_0007108_208_1302 345
652 3300048908 Ga0496105_0090970 Ga0496105_0090970_155_1204 345
653 3300048911 Ga0496108_0031709 Ga0496108_0031709_3288_4340 345
654 3300048911 Ga0496108_0164008 Ga0496108_0164008_113_1162 345
655 3300048913 Ga0496110_0005900 Ga0496110_0005900_1159_2208 345
656 3300048917 Ga0496114_0014341 Ga0496114_0014341_2565_3614 345
657 3300048917 Ga0496114_0272667 Ga0496114_0272667_331_1368 345
658 3300053153 Ga0500616_0050347 Ga0500616_0050347_640_1677 345
659 iso_pu_bacteria 2675903059 2676479776 345
660 iso_pu_bacteria 2808606365 2808875274 345
661 3300005353 Ga0070669_100054081 Ga0070669_1000540813 346
662 3300005356 Ga0070674_100039668 Ga0070674_1000396683 346
663 3300005367 Ga0070667_100000022 Ga0070667_10000002215 346
664 3300005539 Ga0068853_100091382 Ga0068853_1000913822 346
665 3300005548 Ga0070665_100018725 Ga0070665_1000187257 346
666 3300005617 Ga0068859_100004797 Ga0068859_1000047976 346
667 3300005841 Ga0068863_100000699 Ga0068863_10000069914 346
668 3300005842 Ga0068858_100288373 Ga0068858_1002883732 346
669 3300005843 Ga0068860_100000038 Ga0068860_100000038215 346
670 3300005844 Ga0068862_100000064 Ga0068862_10000006493 346
671 3300006931 Ga0097620_100004797 Ga0097620_1000047976 346
672 3300014326 Ga0157380_10481514 Ga0157380_104815141 346
673 3300025303 Ga0209051_1040505 Ga0209051_10405052 346
674 3300025900 Ga0207710_10000027 Ga0207710_1000002747 346
675 3300025910 Ga0207684_10090586 Ga0207684_100905862 346
676 3300025932 Ga0207690_10071197 Ga0207690_100711973 346
677 3300025937 Ga0207669_10054244 Ga0207669_100542442 346
678 3300025941 Ga0207711_10001437 Ga0207711_1000143718 346
679 3300025961 Ga0207712_10000282 Ga0207712_1000028248 346
680 3300025972 Ga0207668_10000676 Ga0207668_1000067611 346
681 3300025986 Ga0207658_10000716 Ga0207658_1000071630 346
682 3300026041 Ga0207639_10187907 Ga0207639_101879072 346
683 3300026088 Ga0207641_10000162 Ga0207641_10000162100 346
684 3300028380 Ga0268265_10000028 Ga0268265_10000028219 346
685 3300028381 Ga0268264_10000092 Ga0268264_1000009248 346
686 3300035083 Ga0373926_0000572 Ga0373926_0000572_3800_4915 346
687 3300035086 Ga0373934_0030783 Ga0373934_0030783_584_1699 346
688 3300035089 Ga0373944_0002647 Ga0373944_0002647_24_1139 346
689 3300035111 Ga0373923_0000037 Ga0373923_0000037_10988_12103 346
690 3300035113 Ga0373936_0001261 Ga0373936_0001261_4346_5461 346
691 3300035116 Ga0373945_0000452 Ga0373945_0000452_3976_5091 346
692 3300035119 Ga0373956_0023376 Ga0373956_0023376_1363_2502 346
693 3300035120 Ga0373957_0003438 Ga0373957_0003438_224_1339 346
694 3300035170 Ga0373943_0003303 Ga0373943_0003303_422_1537 346
695 3300035171 Ga0373946_0010368 Ga0373946_0010368_23_1138 346
696 3300035172 Ga0373955_0016657 Ga0373955_0016657_132_1247 346
697 3300035410 Ga0373924_0048114 Ga0373924_0048114_256_1371 346
698 3300035692 Ga0373935_0016881 Ga0373935_0016881_2375_3490 346
699 3300035724 Ga0373933_0006224 Ga0373933_0006224_1556_2671 346
700 3300035725 Ga0373947_0036554 Ga0373947_0036554_1044_2159 346
701 3300036401 Ga0373937_0243479 Ga0373937_0243479_190_1305 346
702 3300046454 Ga0495592_0019916 Ga0495592_0019916_3230_4345 346
703 3300046455 Ga0495603_0000386 Ga0495603_0000386_19544_20659 346
704 3300046460 Ga0495638_0001564 Ga0495638_0001564_12053_13093 346
705 3300046461 Ga0495641_0007841 Ga0495641_0007841_4861_5976 346
706 3300046462 Ga0495651_0120059 Ga0495651_0120059_165_1304 346
707 3300046463 Ga0495653_0019124 Ga0495653_0019124_3686_4801 346
708 3300046472 Ga0495580_0002013 Ga0495580_0002013_7725_8840 346
709 3300046473 Ga0495582_0001105 Ga0495582_0001105_2375_3490 346
710 3300046475 Ga0495639_0002021 Ga0495639_0002021_1946_3061 346
711 3300046476 Ga0495662_0006075 Ga0495662_0006075_4566_5681 346
712 3300046477 Ga0495664_0051186 Ga0495664_0051186_1044_2159 346
713 3300046499 Ga0495594_0073313 Ga0495594_0073313_216_1331 346
714 3300046511 Ga0495608_0002878 Ga0495608_0002878_353_1468 346
715 3300046526 Ga0495666_0003500 Ga0495666_0003500_6054_7169 346
716 3300046531 Ga0495665_0000676 Ga0495665_0000676_5492_6607 346
717 3300046535 Ga0495586_0014221 Ga0495586_0014221_117_1232 346
718 3300046536 Ga0495587_0009946 Ga0495587_0009946_1607_2722 346
719 3300046543 Ga0495645_0049307 Ga0495645_0049307_1269_2384 346
720 3300046559 Ga0495667_0003305 Ga0495667_0003305_1717_2832 346
721 3300046559 Ga0495667_0198478 Ga0495667_0198478_113_1228 346
722 3300046642 Ga0495634_0004918 Ga0495634_0004918_7605_8720 346
723 3300046663 Ga0495635_0007084 Ga0495635_0007084_6174_7289 346
724 3300046674 Ga0495588_0065485 Ga0495588_0065485_193_1308 346
725 3300046675 Ga0495657_0047136 Ga0495657_0047136_1044_2159 346
726 3300046678 Ga0495599_0036429 Ga0495599_0036429_1044_2159 346
727 3300046679 Ga0495623_0035865 Ga0495623_0035865_595_1710 346
728 3300046680 Ga0495646_0007293 Ga0495646_0007293_5322_6437 346
729 3300046683 Ga0495658_0003893 Ga0495658_0003893_5759_6874 346
730 3300046689 Ga0495613_0008226 Ga0495613_0008226_5874_6989 346
731 3300046690 Ga0495624_0009187 Ga0495624_0009187_5153_6268 346
732 3300047315 Ga0495581_0006111 Ga0495581_0006111_1606_2721 346
733 3300047317 Ga0495604_0007314 Ga0495604_0007314_5763_6878 346
734 3300047319 Ga0495674_0063206 Ga0495674_0063206_550_1665 346
735 3300047321 Ga0495676_0038871 Ga0495676_0038871_2246_3361 346
736 3300047322 Ga0495680_0090600 Ga0495680_0090600_422_1537 346
737 3300047444 Ga0495675_0017671 Ga0495675_0017671_2375_3490 346
738 3300047471 Ga0495684_0005728 Ga0495684_0005728_1107_2222 346
739 3300047472 Ga0495686_0002683 Ga0495686_0002683_4419_5462 346
740 3300047673 Ga0495593_0000574 Ga0495593_0000574_1924_3039 346
741 3300048088 Ga0495602_0042486 Ga0495602_0042486_324_1439 346
742 3300048089 Ga0495614_0006062 Ga0495614_0006062_3003_4118 346
743 3300048903 Ga0496100_0003723 Ga0496100_0003723_1646_2686 346
744 3300048904 Ga0496101_0000620 Ga0496101_0000620_7983_9047 346
745 3300048904 Ga0496101_0019861 Ga0496101_0019861_2303_3343 346
746 3300048907 Ga0496104_0009998 Ga0496104_0009998_911_1975 346
747 3300048909 Ga0496106_0014595 Ga0496106_0014595_3797_4861 346
748 3300048910 Ga0496107_0001235 Ga0496107_0001235_6539_7603 346
749 3300048917 Ga0496114_0000175 Ga0496114_0000175_27698_28762 346
750 3300048918 Ga0496115_0003687 Ga0496115_0003687_1889_2953 346
751 3300048923 Ga0496120_0024867 Ga0496120_0024867_620_1660 346
752 3300048924 Ga0496121_0004532 Ga0496121_0004532_7885_8925 346
753 3300048928 Ga0496125_0018028 Ga0496125_0018028_809_1849 346
754 3300048929 Ga0496126_0007096 Ga0496126_0007096_3151_4191 346
755 3300050516 nmdc:mga0sz30_33985_c1 nmdc:mga0sz30_33985_c1_54_1157 346
756 3300053077 Ga0495601_0025026 Ga0495601_0025026_511_1626 346
757 3300053078 Ga0495612_0003839 Ga0495612_0003839_626_1741 346
758 3300053108 Ga0500562_005443 Ga0500562_005443_1574_2614 346
759 iso_pu_bacteria 2643221679 2644444463 346
760 iso_pu_bacteria 2902837492 2902841303 346
761 3300003792 Ga0055540_1000690 Ga0055540_10006903 347
762 3300006038 Ga0075365_10069567 Ga0075365_100695673 347
763 3300024225 Ga0224572_1000605 Ga0224572_10006053 347
764 3300025273 Ga0209673_1017156 Ga0209673_10171562 347
765 3300025303 Ga0209051_1004986 Ga0209051_10049865 347
766 3300031247 Ga0265340_10023771 Ga0265340_100237712 347
767 3300035692 Ga0373935_0004930 Ga0373935_0004930_3767_4918 347
768 3300035724 Ga0373933_0024095 Ga0373933_0024095_276_1421 347
769 3300035725 Ga0373947_0000009 Ga0373947_0000009_156253_157404 347
770 3300036401 Ga0373937_0309846 Ga0373937_0309846_57_1181 347
771 3300045836 Ga0466958_0102473 Ga0466958_0102473_79_1167 347
772 3300046462 Ga0495651_0009362 Ga0495651_0009362_6194_7339 347
773 3300046463 Ga0495653_0055363 Ga0495653_0055363_1584_2729 347
774 3300046477 Ga0495664_0047512 Ga0495664_0047512_1132_2277 347
775 3300046507 Ga0495606_0000519 Ga0495606_0000519_27889_28974 347
776 3300046529 Ga0495652_0069855 Ga0495652_0069855_1499_2644 347
777 3300046559 Ga0495667_0169056 Ga0495667_0169056_27_1145 347
778 3300046663 Ga0495635_0099706 Ga0495635_0099706_601_1746 347
779 3300046675 Ga0495657_0050962 Ga0495657_0050962_170_1315 347
780 3300046675 Ga0495657_0144958 Ga0495657_0144958_30_1148 347
781 3300047322 Ga0495680_0017642 Ga0495680_0017642_299_1444 347
782 3300048088 Ga0495602_0066910 Ga0495602_0066910_197_1342 347
783 3300048903 Ga0496100_0227268 Ga0496100_0227268_105_1190 347
784 3300048906 Ga0496103_0062286 Ga0496103_0062286_263_1309 347
785 3300048916 Ga0496113_0219238 Ga0496113_0219238_262_1308 347
786 3300048924 Ga0496121_0005081 Ga0496121_0005081_14019_15104 347
787 3300050492 nmdc:mga0yw44_179736_c1 nmdc:mga0yw44_179736_c1_76_1128 347
788 3300050516 nmdc:mga0sz30_77728_c1 nmdc:mga0sz30_77728_c1_322_1374 347
789 iso_pu_bacteria 2643221687 2644488214 347
790 3300003792 Ga0055540_1003313 Ga0055540_10033131 348
791 3300003792 Ga0055540_1009062 Ga0055540_10090622 348
792 3300005329 Ga0070683_100130030 Ga0070683_1001300302 348
793 3300005337 Ga0070682_100011661 Ga0070682_1000116614 348
794 3300005340 Ga0070689_100061758 Ga0070689_1000617582 348
795 3300005365 Ga0070688_100145437 Ga0070688_1001454372 348
796 3300005366 Ga0070659_100036709 Ga0070659_1000367091 348
797 3300005434 Ga0070709_10063463 Ga0070709_100634632 348
798 3300005435 Ga0070714_100131613 Ga0070714_1001316132 348
799 3300005436 Ga0070713_100037066 Ga0070713_1000370663 348
800 3300005437 Ga0070710_10019748 Ga0070710_100197483 348
801 3300005439 Ga0070711_100081581 Ga0070711_1000815812 348
802 3300005445 Ga0070708_100007434 Ga0070708_1000074347 348
803 3300005445 Ga0070708_100020711 Ga0070708_1000207115 348
804 3300005445 Ga0070708_100182397 Ga0070708_1001823971 348
805 3300005455 Ga0070663_100118670 Ga0070663_1001186702 348
806 3300005467 Ga0070706_100002194 Ga0070706_10000219422 348
807 3300005468 Ga0070707_100000797 Ga0070707_10000079732 348
808 3300005468 Ga0070707_100020466 Ga0070707_1000204664 348
809 3300005468 Ga0070707_100141535 Ga0070707_1001415353 348
810 3300005471 Ga0070698_100009098 Ga0070698_10000909810 348
811 3300005535 Ga0070684_100056845 Ga0070684_1000568452 348
812 3300005539 Ga0068853_100029972 Ga0068853_1000299721 348
813 3300005545 Ga0070695_100023722 Ga0070695_1000237224 348
814 3300005546 Ga0070696_100052238 Ga0070696_1000522383 348
815 3300005548 Ga0070665_100372118 Ga0070665_1003721182 348
816 3300005549 Ga0070704_100014558 Ga0070704_1000145585 348
817 3300005614 Ga0068856_100040713 Ga0068856_1000407134 348
818 3300005719 Ga0068861_100242180 Ga0068861_1002421802 348
819 3300005842 Ga0068858_100130375 Ga0068858_1001303753 348
820 3300006028 Ga0070717_10069795 Ga0070717_100697952 348
821 3300006028 Ga0070717_10108770 Ga0070717_101087702 348
822 3300006163 Ga0070715_10006170 Ga0070715_100061702 348
823 3300006173 Ga0070716_100059650 Ga0070716_1000596502 348
824 3300006175 Ga0070712_100034513 Ga0070712_1000345133 348
825 3300006358 Ga0068871_100020112 Ga0068871_1000201124 348
826 3300009101 Ga0105247_10012840 Ga0105247_100128405 348
827 3300009545 Ga0105237_10058109 Ga0105237_100581092 348
828 3300013100 Ga0157373_10062462 Ga0157373_100624622 348
829 3300013105 Ga0157369_10361930 Ga0157369_103619302 348
830 3300014968 Ga0157379_10027248 Ga0157379_100272482 348
831 3300021388 Ga0213875_10002999 Ga0213875_100029996 348
832 3300025303 Ga0209051_1000237 Ga0209051_100023773 348
833 3300025303 Ga0209051_1003846 Ga0209051_10038464 348
834 3300025885 Ga0207653_10006394 Ga0207653_100063942 348
835 3300025898 Ga0207692_10005379 Ga0207692_100053792 348
836 3300025905 Ga0207685_10059435 Ga0207685_100594352 348
837 3300025906 Ga0207699_10002118 Ga0207699_100021188 348
838 3300025906 Ga0207699_10029376 Ga0207699_100293762 348
839 3300025906 Ga0207699_10030600 Ga0207699_100306002 348
840 3300025907 Ga0207645_10091931 Ga0207645_100919312 348
841 3300025910 Ga0207684_10004078 Ga0207684_100040782 348
842 3300025912 Ga0207707_10121855 Ga0207707_101218552 348
843 3300025915 Ga0207693_10039485 Ga0207693_100394853 348
844 3300025916 Ga0207663_10009087 Ga0207663_100090875 348
845 3300025916 Ga0207663_10252700 Ga0207663_102527001 348
846 3300025922 Ga0207646_10000388 Ga0207646_1000038835 348
847 3300025922 Ga0207646_10032085 Ga0207646_100320854 348
848 3300025924 Ga0207694_10083028 Ga0207694_100830283 348
849 3300025927 Ga0207687_10102836 Ga0207687_101028361 348
850 3300025928 Ga0207700_10015175 Ga0207700_100151755 348
851 3300025928 Ga0207700_10052340 Ga0207700_100523402 348
852 3300025929 Ga0207664_10012165 Ga0207664_100121655 348
853 3300025929 Ga0207664_10034251 Ga0207664_100342513 348
854 3300025929 Ga0207664_10059246 Ga0207664_100592462 348
855 3300025929 Ga0207664_10159812 Ga0207664_101598122 348
856 3300025935 Ga0207709_10032046 Ga0207709_100320463 348
857 3300025939 Ga0207665_10029532 Ga0207665_100295322 348
858 3300025939 Ga0207665_10062015 Ga0207665_100620151 348
859 3300025944 Ga0207661_10129681 Ga0207661_101296812 348
860 3300026035 Ga0207703_10086482 Ga0207703_100864822 348
861 3300026067 Ga0207678_10013423 Ga0207678_100134234 348
862 3300026078 Ga0207702_10025122 Ga0207702_100251222 348
863 3300026089 Ga0207648_10141307 Ga0207648_101413072 348
864 3300026116 Ga0207674_10004411 Ga0207674_1000441115 348
865 3300026121 Ga0207683_10008352 Ga0207683_100083523 348
866 3300028379 Ga0268266_10083616 Ga0268266_100836162 348
867 3300028379 Ga0268266_10150250 Ga0268266_101502502 348
868 3300035086 Ga0373934_0002402 Ga0373934_0002402_2698_3852 348
869 3300035117 Ga0373953_0000140 Ga0373953_0000140_13956_15110 348
870 3300035118 Ga0373954_0002617 Ga0373954_0002617_736_1890 348
871 3300035119 Ga0373956_0002157 Ga0373956_0002157_3008_4162 348
872 3300035120 Ga0373957_0000138 Ga0373957_0000138_3053_4207 348
873 3300035172 Ga0373955_0000415 Ga0373955_0000415_3061_4215 348
874 3300035172 Ga0373955_0048523 Ga0373955_0048523_1093_2202 348
875 3300035410 Ga0373924_0006229 Ga0373924_0006229_1479_2633 348
876 3300035724 Ga0373933_0000901 Ga0373933_0000901_3058_4212 348
877 3300035724 Ga0373933_0032598 Ga0373933_0032598_1170_2279 348
878 3300035724 Ga0373933_0055111 Ga0373933_0055111_172_1284 348
879 3300036401 Ga0373937_0003579 Ga0373937_0003579_8884_10038 348
880 3300036401 Ga0373937_0042516 Ga0373937_0042516_2233_3345 348
881 3300036401 Ga0373937_0049421 Ga0373937_0049421_188_1288 348
882 3300036401 Ga0373937_0060064 Ga0373937_0060064_1259_2368 348
883 3300037068 Ga0373925_0010139 Ga0373925_0010139_1699_2808 348
884 3300037853 Ga0436364_0209397 Ga0436364_0209397_320_1498 348
885 3300037853 Ga0436364_0262372 Ga0436364_0262372_5084_6208 348
886 3300044735 Ga0466968_0033015 Ga0466968_0033015_398_1510 348
887 3300046454 Ga0495592_0002459 Ga0495592_0002459_8884_10038 348
888 3300046454 Ga0495592_0005659 Ga0495592_0005659_4105_5214 348
889 3300046455 Ga0495603_0003339 Ga0495603_0003339_760_1896 348
890 3300046462 Ga0495651_0001480 Ga0495651_0001480_3058_4212 348
891 3300046462 Ga0495651_0005039 Ga0495651_0005039_4542_5651 348
892 3300046463 Ga0495653_0020151 Ga0495653_0020151_1249_2403 348
893 3300046463 Ga0495653_0020504 Ga0495653_0020504_3566_4672 348
894 3300046476 Ga0495662_0034278 Ga0495662_0034278_1030_2136 348
895 3300046511 Ga0495608_0001229 Ga0495608_0001229_3058_4212 348
896 3300046511 Ga0495608_0004816 Ga0495608_0004816_4391_5500 348
897 3300046514 Ga0495618_0049379 Ga0495618_0049379_106_1215 348
898 3300046516 Ga0495628_0002081 Ga0495628_0002081_13954_15108 348
899 3300046516 Ga0495628_0031477 Ga0495628_0031477_1692_2801 348
900 3300046529 Ga0495652_0002697 Ga0495652_0002697_13941_15095 348
901 3300046529 Ga0495652_0003338 Ga0495652_0003338_14525_15634 348
902 3300046536 Ga0495587_0001054 Ga0495587_0001054_3061_4215 348
903 3300046536 Ga0495587_0006078 Ga0495587_0006078_525_1634 348
904 3300046543 Ga0495645_0015811 Ga0495645_0015811_790_1899 348
905 3300046543 Ga0495645_0044858 Ga0495645_0044858_156_1262 348
906 3300046559 Ga0495667_0000555 Ga0495667_0000555_16649_17758 348
907 3300046559 Ga0495667_0003357 Ga0495667_0003357_6501_7655 348
908 3300046642 Ga0495634_0038372 Ga0495634_0038372_457_1566 348
909 3300046675 Ga0495657_0001832 Ga0495657_0001832_3058_4212 348
910 3300046675 Ga0495657_0003562 Ga0495657_0003562_3495_4604 348
911 3300046678 Ga0495599_0000769 Ga0495599_0000769_2938_4092 348
912 3300046679 Ga0495623_0001121 Ga0495623_0001121_3012_4166 348
913 3300046679 Ga0495623_0025410 Ga0495623_0025410_684_1793 348
914 3300046680 Ga0495646_0003679 Ga0495646_0003679_3562_4671 348
915 3300046680 Ga0495646_0013073 Ga0495646_0013073_1082_2236 348
916 3300046809 Ga0495600_0015195 Ga0495600_0015195_779_1888 348
917 3300046809 Ga0495600_0038487 Ga0495600_0038487_1480_2634 348
918 3300047317 Ga0495604_0001688 Ga0495604_0001688_3058_4212 348
919 3300047317 Ga0495604_0011501 Ga0495604_0011501_4458_5567 348
920 3300047319 Ga0495674_0001543 Ga0495674_0001543_3268_4374 348
921 3300047319 Ga0495674_0033979 Ga0495674_0033979_1430_2539 348
922 3300047321 Ga0495676_0169449 Ga0495676_0169449_53_1159 348
923 3300047322 Ga0495680_0002643 Ga0495680_0002643_3057_4211 348
924 3300047322 Ga0495680_0010169 Ga0495680_0010169_4483_5592 348
925 3300047444 Ga0495675_0015543 Ga0495675_0015543_3017_4171 348
926 3300047444 Ga0495675_0056300 Ga0495675_0056300_1192_2301 348
927 3300048088 Ga0495602_0002692 Ga0495602_0002692_13954_15108 348
928 3300048088 Ga0495602_0007350 Ga0495602_0007350_6262_7371 348
929 3300048088 Ga0495602_0051241 Ga0495602_0051241_1077_2177 348
930 3300048905 Ga0496102_0083238 Ga0496102_0083238_703_1800 348
931 3300048907 Ga0496104_0010338 Ga0496104_0010338_1889_2986 348
932 3300048908 Ga0496105_0008149 Ga0496105_0008149_4330_5427 348
933 3300048911 Ga0496108_0055463 Ga0496108_0055463_531_1628 348
934 3300048912 Ga0496109_0009119 Ga0496109_0009119_234_1331 348
935 3300048915 Ga0496112_0031602 Ga0496112_0031602_600_1697 348
936 3300048918 Ga0496115_0053484 Ga0496115_0053484_715_1812 348
937 3300053084 Ga0495595_0002954 Ga0495595_0002954_3033_4187 348
938 iso_pu_bacteria 8057575449 8057577224 348
939 3300000546 LJNas_1002939 LJNas_10029393 349
940 3300006038 Ga0075365_10262795 Ga0075365_102627951 349
941 3300026075 Ga0207708_10043918 Ga0207708_100439182 349
942 3300047472 Ga0495686_0033239 Ga0495686_0033239_1557_2630 349
943 3300048922 Ga0496119_0000600 Ga0496119_0000600_39313_40449 349
944 3300048923 Ga0496120_0033202 Ga0496120_0033202_767_1903 349
945 3300053153 Ga0500616_0002919 Ga0500616_0002919_3436_4485 349
946 iso_pu_bacteria 2643221567 2643852820 349
947 iso_pu_bacteria 2643221624 2644135329 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

189

0.94

PF08402

TOBE_2

TOBE domain

297

375

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9463 5 220
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9443 7 237
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9414 6 237
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9403 7 237
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9397 7 221
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 6 218 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.968 7 238 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 1 219 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9639 7 240 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 7 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9739 7 162 GO:0005524
GO:0016887
AF-A0A661S1Z9-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9729 7 237 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A528M0S6-F1-model_v4 ABC transporter ATP-binding protein 0.9666 1 200 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A661KN18-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9624 78 215 GO:0005524
GO:0016887
AF-A0A528M0S6-F1-model_v4 ABC transporter ATP-binding protein 0.9619 1 200 GO:0005524
GO:0005886
GO:0015408
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.69 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map