F486519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 948 | 280 | 948 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0929913|Ga0501070_0929913_175_606 |
| Length | 143 |
| Sequence | VSERIQNRRIALVMALLAGCLAFNSASTFAHHSFAAEFDINKPVELHGTVTKVELINPHSWIHLEVADKDGNKESWMIEGGSPNQLLRKGFTKNSLPVGTEIVAIGYQARDGSKRAVGRTLKLANGSTLFFEATTTTTPEASH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 204 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 206 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 207 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 211 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 98.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1258267 | 2162886007 | Unclassified | 1840 |
| 2 | rootH1_10332194 | 3300003323 | Bacteria | 1504 |
| 3 | Ga0058859_11236937 | 3300004798 | Unclassified | 594 |
| 4 | Ga0058859_11334503 | 3300004798 | Bacteria | 1028 |
| 5 | Ga0058860_12103558 | 3300004801 | Bacteria | 885 |
| 6 | Ga0065704_10012427 | 3300005289 | Bacteria | 2672 |
| 7 | Ga0065704_10017203 | 3300005289 | Bacteria | 1515 |
| 8 | Ga0065704_10090174 | 3300005289 | Bacteria | 2807 |
| 9 | Ga0065712_10068024 | 3300005290 | Bacteria | 16849 |
| 10 | Ga0065712_10114113 | 3300005290 | Bacteria | 1772 |
| 11 | Ga0065712_10310957 | 3300005290 | Bacteria | 844 |
| 12 | Ga0065712_10373566 | 3300005290 | Unclassified | 760 |
| 13 | Ga0065715_10000766 | 3300005293 | Bacteria | 8488 |
| 14 | Ga0065715_10004374 | 3300005293 | Bacteria | 5206 |
| 15 | Ga0065715_10011502 | 3300005293 | Bacteria | 2405 |
| 16 | Ga0065715_10113264 | 3300005293 | Bacteria | 2497 |
| 17 | Ga0065707_10001773 | 3300005295 | Bacteria | 7292 |
| 18 | Ga0065707_10004206 | 3300005295 | Bacteria | 6464 |
| 19 | Ga0065707_10088576 | 3300005295 | Bacteria | 4576 |
| 20 | Ga0065707_10190209 | 3300005295 | Bacteria | 1365 |
| 21 | Ga0065707_10222241 | 3300005295 | Bacteria | 1214 |
| 22 | Ga0065707_10421871 | 3300005295 | Bacteria | 830 |
| 23 | Ga0065707_10990295 | 3300005295 | Unclassified | 542 |
| 24 | Ga0070676_10002130 | 3300005328 | Bacteria | 10080 |
| 25 | Ga0070676_10008509 | 3300005328 | Bacteria | 5532 |
| 26 | Ga0070676_10196921 | 3300005328 | Bacteria | 1319 |
| 27 | Ga0070676_10277113 | 3300005328 | Bacteria | 1129 |
| 28 | Ga0070676_10448111 | 3300005328 | Bacteria | 907 |
| 29 | Ga0070676_10774466 | 3300005328 | Bacteria | 706 |
| 30 | Ga0070676_11174988 | 3300005328 | Unclassified | 582 |
| 31 | Ga0070690_100006833 | 3300005330 | Bacteria | 6490 |
| 32 | Ga0070690_100019611 | 3300005330 | Bacteria | 4109 |
| 33 | Ga0070690_100035456 | 3300005330 | Unclassified | 3130 |
| 34 | Ga0070670_100006214 | 3300005331 | Bacteria | 10102 |
| 35 | Ga0070670_100019553 | 3300005331 | Bacteria | 5813 |
| 36 | Ga0070677_10004228 | 3300005333 | Unclassified | 4679 |
| 37 | Ga0068869_100004349 | 3300005334 | Bacteria | 8794 |
| 38 | Ga0068869_100006944 | 3300005334 | Bacteria | 7206 |
| 39 | Ga0068869_100188677 | 3300005334 | Bacteria | 1620 |
| 40 | Ga0068869_100369038 | 3300005334 | Bacteria | 1174 |
| 41 | Ga0068869_100523565 | 3300005334 | Bacteria | 993 |
| 42 | Ga0068869_100657405 | 3300005334 | Bacteria | 890 |
| 43 | Ga0068869_101189490 | 3300005334 | Bacteria | 670 |
| 44 | Ga0068869_101203171 | 3300005334 | Bacteria | 666 |
| 45 | Ga0068869_101696026 | 3300005334 | Bacteria | 564 |
| 46 | Ga0068869_102054456 | 3300005334 | Bacteria | 513 |
| 47 | Ga0070666_10004014 | 3300005335 | Bacteria | 8934 |
| 48 | Ga0070666_10257807 | 3300005335 | Bacteria | 1236 |
| 49 | Ga0070666_10940536 | 3300005335 | Unclassified | 640 |
| 50 | Ga0070666_11337239 | 3300005335 | Unclassified | 535 |
| 51 | Ga0070680_100266524 | 3300005336 | Unclassified | 1450 |
| 52 | Ga0070680_100438756 | 3300005336 | Bacteria | 1115 |
| 53 | Ga0070680_100754069 | 3300005336 | Unclassified | 838 |
| 54 | Ga0068868_100122031 | 3300005338 | Unclassified | 2126 |
| 55 | Ga0068868_100219482 | 3300005338 | Bacteria | 1591 |
| 56 | Ga0070689_100007401 | 3300005340 | Bacteria | 7673 |
| 57 | Ga0070689_100009672 | 3300005340 | Bacteria | 6840 |
| 58 | Ga0070689_100013527 | 3300005340 | Bacteria | 5909 |
| 59 | Ga0070689_100084397 | 3300005340 | Bacteria | 2496 |
| 60 | Ga0070689_100179522 | 3300005340 | Bacteria | 1719 |
| 61 | Ga0070689_100317711 | 3300005340 | Bacteria | 1300 |
| 62 | Ga0070689_100486255 | 3300005340 | Bacteria | 1055 |
| 63 | Ga0070689_101751131 | 3300005340 | Unclassified | 566 |
| 64 | Ga0070691_10883709 | 3300005341 | Bacteria | 550 |
| 65 | Ga0070687_100105926 | 3300005343 | Bacteria | 1583 |
| 66 | Ga0070687_100204337 | 3300005343 | Bacteria | 1199 |
| 67 | Ga0070661_100009957 | 3300005344 | Bacteria | 6593 |
| 68 | Ga0070661_101390405 | 3300005344 | Bacteria | 590 |
| 69 | Ga0070692_10016485 | 3300005345 | Bacteria | 3515 |
| 70 | Ga0070692_10189938 | 3300005345 | Unclassified | 1196 |
| 71 | Ga0070692_10578511 | 3300005345 | Bacteria | 740 |
| 72 | Ga0070668_100045307 | 3300005347 | Unclassified | 3375 |
| 73 | Ga0070668_100072618 | 3300005347 | Bacteria | 2681 |
| 74 | Ga0070668_100205989 | 3300005347 | Bacteria | 1616 |
| 75 | Ga0070668_101509747 | 3300005347 | Bacteria | 614 |
| 76 | Ga0070669_100011599 | 3300005353 | Bacteria | 6251 |
| 77 | Ga0070669_100014609 | 3300005353 | Bacteria | 5589 |
| 78 | Ga0070669_100046196 | 3300005353 | Bacteria | 3175 |
| 79 | Ga0070669_100049163 | 3300005353 | Bacteria | 3079 |
| 80 | Ga0070669_100096307 | 3300005353 | Bacteria | 2226 |
| 81 | Ga0070669_100468997 | 3300005353 | Bacteria | 1040 |
| 82 | Ga0070669_100716712 | 3300005353 | Bacteria | 846 |
| 83 | Ga0070669_101382842 | 3300005353 | Bacteria | 611 |
| 84 | Ga0070675_100002265 | 3300005354 | Bacteria | 14278 |
| 85 | Ga0070675_100002427 | 3300005354 | Bacteria | 13909 |
| 86 | Ga0070675_100004043 | 3300005354 | Bacteria | 11135 |
| 87 | Ga0070675_100006488 | 3300005354 | Bacteria | 8983 |
| 88 | Ga0070675_100020169 | 3300005354 | Bacteria | 5319 |
| 89 | Ga0070675_100049358 | 3300005354 | Bacteria | 3454 |
| 90 | Ga0070675_100098495 | 3300005354 | Bacteria | 2460 |
| 91 | Ga0070675_100122555 | 3300005354 | Bacteria | 2210 |
| 92 | Ga0070675_100158624 | 3300005354 | Bacteria | 1944 |
| 93 | Ga0070675_100168290 | 3300005354 | Bacteria | 1889 |
| 94 | Ga0070675_100492599 | 3300005354 | Bacteria | 1104 |
| 95 | Ga0070675_100558615 | 3300005354 | Bacteria | 1036 |
| 96 | Ga0070675_101138543 | 3300005354 | Bacteria | 718 |
| 97 | Ga0070671_100008742 | 3300005355 | Bacteria | 8124 |
| 98 | Ga0070671_100052868 | 3300005355 | Bacteria | 3377 |
| 99 | Ga0070671_100059946 | 3300005355 | Bacteria | 3168 |
| 100 | Ga0070671_100412497 | 3300005355 | Bacteria | 1156 |
| 101 | Ga0070671_101463564 | 3300005355 | Bacteria | 604 |
| 102 | Ga0070674_100008366 | 3300005356 | Bacteria | 6159 |
| 103 | Ga0070674_100028325 | 3300005356 | Bacteria | 3679 |
| 104 | Ga0070674_100076325 | 3300005356 | Bacteria | 2382 |
| 105 | Ga0070674_100208657 | 3300005356 | Bacteria | 1513 |
| 106 | Ga0070674_100370335 | 3300005356 | Bacteria | 1162 |
| 107 | Ga0070674_100557676 | 3300005356 | Bacteria | 962 |
| 108 | Ga0070674_100912380 | 3300005356 | Bacteria | 766 |
| 109 | Ga0070674_100962441 | 3300005356 | Bacteria | 747 |
| 110 | Ga0070674_101670553 | 3300005356 | Bacteria | 575 |
| 111 | Ga0070673_100013101 | 3300005364 | Bacteria | 5722 |
| 112 | Ga0070673_100019662 | 3300005364 | Bacteria | 4853 |
| 113 | Ga0070673_100024386 | 3300005364 | Bacteria | 4435 |
| 114 | Ga0070673_100072817 | 3300005364 | Unclassified | 2764 |
| 115 | Ga0070673_100268772 | 3300005364 | Bacteria | 1492 |
| 116 | Ga0070673_100514080 | 3300005364 | Bacteria | 1084 |
| 117 | Ga0070673_100663185 | 3300005364 | Bacteria | 956 |
| 118 | Ga0070688_100004251 | 3300005365 | Bacteria | 7447 |
| 119 | Ga0070688_100030597 | 3300005365 | Bacteria | 3232 |
| 120 | Ga0070688_100284249 | 3300005365 | Bacteria | 1190 |
| 121 | Ga0070688_100577600 | 3300005365 | Bacteria | 858 |
| 122 | Ga0070688_101637661 | 3300005365 | Bacteria | 526 |
| 123 | Ga0070659_100821726 | 3300005366 | Unclassified | 809 |
| 124 | Ga0070659_101199680 | 3300005366 | Unclassified | 671 |
| 125 | Ga0070667_100021283 | 3300005367 | Bacteria | 5387 |
| 126 | Ga0070709_10697928 | 3300005434 | Bacteria | 789 |
| 127 | Ga0070714_100006277 | 3300005435 | Bacteria | 9160 |
| 128 | Ga0070713_100001089 | 3300005436 | Bacteria | 17388 |
| 129 | Ga0070710_10409248 | 3300005437 | Bacteria | 911 |
| 130 | Ga0070701_10007994 | 3300005438 | Bacteria | 4549 |
| 131 | Ga0070701_10011952 | 3300005438 | Bacteria | 3900 |
| 132 | Ga0070701_10052800 | 3300005438 | Unclassified | 2113 |
| 133 | Ga0070701_10149205 | 3300005438 | Bacteria | 1345 |
| 134 | Ga0070701_11337489 | 3300005438 | Unclassified | 513 |
| 135 | Ga0070711_100030198 | 3300005439 | Unclassified | 3585 |
| 136 | Ga0070711_100763122 | 3300005439 | Bacteria | 818 |
| 137 | Ga0070705_100002851 | 3300005440 | Bacteria | 8619 |
| 138 | Ga0070705_100011812 | 3300005440 | Bacteria | 4420 |
| 139 | Ga0070705_100065077 | 3300005440 | Unclassified | 2181 |
| 140 | Ga0070700_100002700 | 3300005441 | Bacteria | 9054 |
| 141 | Ga0070700_100008474 | 3300005441 | Bacteria | 5598 |
| 142 | Ga0070700_100075791 | 3300005441 | Bacteria | 2158 |
| 143 | Ga0070700_100109781 | 3300005441 | Bacteria | 1832 |
| 144 | Ga0070700_100572546 | 3300005441 | Bacteria | 881 |
| 145 | Ga0070700_100591406 | 3300005441 | Bacteria | 868 |
| 146 | Ga0070700_101055032 | 3300005441 | Bacteria | 671 |
| 147 | Ga0070694_100001762 | 3300005444 | Bacteria | 12791 |
| 148 | Ga0070694_100005154 | 3300005444 | Bacteria | 7879 |
| 149 | Ga0070694_100029352 | 3300005444 | Bacteria | 3589 |
| 150 | Ga0070694_100221530 | 3300005444 | Unclassified | 1419 |
| 151 | Ga0070694_100222347 | 3300005444 | Bacteria | 1417 |
| 152 | Ga0070694_100260206 | 3300005444 | Bacteria | 1316 |
| 153 | Ga0070694_100281438 | 3300005444 | Unclassified | 1268 |
| 154 | Ga0070694_100613499 | 3300005444 | Bacteria | 877 |
| 155 | Ga0070694_100756998 | 3300005444 | Unclassified | 794 |
| 156 | Ga0070708_100059084 | 3300005445 | Bacteria | 3418 |
| 157 | Ga0070708_100585494 | 3300005445 | Unclassified | 1052 |
| 158 | Ga0070663_100467382 | 3300005455 | Bacteria | 1042 |
| 159 | Ga0070663_100602495 | 3300005455 | Bacteria | 924 |
| 160 | Ga0070663_100800391 | 3300005455 | Bacteria | 808 |
| 161 | Ga0070678_100004885 | 3300005456 | Bacteria | 7664 |
| 162 | Ga0070678_100094772 | 3300005456 | Unclassified | 2299 |
| 163 | Ga0070678_100224186 | 3300005456 | Bacteria | 1564 |
| 164 | Ga0070662_100046881 | 3300005457 | Unclassified | 3106 |
| 165 | Ga0070662_100061885 | 3300005457 | Bacteria | 2733 |
| 166 | Ga0070662_100363014 | 3300005457 | Bacteria | 1189 |
| 167 | Ga0070662_100366535 | 3300005457 | Unclassified | 1183 |
| 168 | Ga0070681_11464175 | 3300005458 | Unclassified | 607 |
| 169 | Ga0068867_100000229 | 3300005459 | Bacteria | 36660 |
| 170 | Ga0068867_100002574 | 3300005459 | Bacteria | 12784 |
| 171 | Ga0068867_100100152 | 3300005459 | Bacteria | 2212 |
| 172 | Ga0068867_100471483 | 3300005459 | Bacteria | 1074 |
| 173 | Ga0068867_101561603 | 3300005459 | Unclassified | 616 |
| 174 | Ga0070685_10004167 | 3300005466 | Bacteria | 7292 |
| 175 | Ga0070685_10059731 | 3300005466 | Bacteria | 2227 |
| 176 | Ga0070685_10340581 | 3300005466 | Bacteria | 1022 |
| 177 | Ga0070685_10443497 | 3300005466 | Bacteria | 908 |
| 178 | Ga0070706_100939545 | 3300005467 | Unclassified | 798 |
| 179 | Ga0070707_100015672 | 3300005468 | Bacteria | 7116 |
| 180 | Ga0070707_100071294 | 3300005468 | Unclassified | 3348 |
| 181 | Ga0070707_100157196 | 3300005468 | Bacteria | 2215 |
| 182 | Ga0070707_100755647 | 3300005468 | Bacteria | 936 |
| 183 | Ga0070707_100782439 | 3300005468 | Unclassified | 918 |
| 184 | Ga0070698_100001553 | 3300005471 | Bacteria | 25481 |
| 185 | Ga0070698_100003210 | 3300005471 | Bacteria | 18008 |
| 186 | Ga0070698_100144917 | 3300005471 | Bacteria | 2325 |
| 187 | Ga0070698_100486693 | 3300005471 | Unclassified | 1171 |
| 188 | Ga0070698_100514760 | 3300005471 | Bacteria | 1135 |
| 189 | Ga0070698_100518941 | 3300005471 | Bacteria | 1130 |
| 190 | Ga0070698_101141623 | 3300005471 | Bacteria | 728 |
| 191 | Ga0070698_101502185 | 3300005471 | Unclassified | 625 |
| 192 | Ga0070699_100000567 | 3300005518 | Bacteria | 34941 |
| 193 | Ga0070699_100014400 | 3300005518 | Bacteria | 6799 |
| 194 | Ga0070699_100094291 | 3300005518 | Bacteria | 2620 |
| 195 | Ga0070699_100946025 | 3300005518 | Unclassified | 789 |
| 196 | Ga0070679_101787458 | 3300005530 | Bacteria | 563 |
| 197 | Ga0070684_100162112 | 3300005535 | Bacteria | 2029 |
| 198 | Ga0070697_100072873 | 3300005536 | Bacteria | 2819 |
| 199 | Ga0070697_100114816 | 3300005536 | Bacteria | 2248 |
| 200 | Ga0070697_100208335 | 3300005536 | Bacteria | 1664 |
| 201 | Ga0070697_101925381 | 3300005536 | Unclassified | 529 |
| 202 | Ga0068853_101925889 | 3300005539 | Unclassified | 573 |
| 203 | Ga0068853_102229572 | 3300005539 | Bacteria | 531 |
| 204 | Ga0070672_100002796 | 3300005543 | Bacteria | 11178 |
| 205 | Ga0070672_100059499 | 3300005543 | Bacteria | 3006 |
| 206 | Ga0070672_100075045 | 3300005543 | Unclassified | 2699 |
| 207 | Ga0070672_100184472 | 3300005543 | Bacteria | 1740 |
| 208 | Ga0070672_100199416 | 3300005543 | Bacteria | 1673 |
| 209 | Ga0070672_100273278 | 3300005543 | Bacteria | 1427 |
| 210 | Ga0070672_100314422 | 3300005543 | Bacteria | 1330 |
| 211 | Ga0070672_100506553 | 3300005543 | Bacteria | 1045 |
| 212 | Ga0070686_100008216 | 3300005544 | Bacteria | 5842 |
| 213 | Ga0070686_100019208 | 3300005544 | Bacteria | 4023 |
| 214 | Ga0070686_100419797 | 3300005544 | Bacteria | 1022 |
| 215 | Ga0070686_100488134 | 3300005544 | Bacteria | 954 |
| 216 | Ga0070695_100000224 | 3300005545 | Bacteria | 27792 |
| 217 | Ga0070695_100047411 | 3300005545 | Bacteria | 2744 |
| 218 | Ga0070695_100152944 | 3300005545 | Unclassified | 1612 |
| 219 | Ga0070695_100530372 | 3300005545 | Bacteria | 915 |
| 220 | Ga0070696_100005480 | 3300005546 | Bacteria | 8467 |
| 221 | Ga0070696_100043739 | 3300005546 | Bacteria | 3099 |
| 222 | Ga0070696_100073242 | 3300005546 | Bacteria | 2413 |
| 223 | Ga0070696_100129190 | 3300005546 | Bacteria | 1837 |
| 224 | Ga0070696_100433849 | 3300005546 | Unclassified | 1034 |
| 225 | Ga0070696_101495916 | 3300005546 | Unclassified | 578 |
| 226 | Ga0070665_101268475 | 3300005548 | Bacteria | 747 |
| 227 | Ga0070704_100002482 | 3300005549 | Bacteria | 10363 |
| 228 | Ga0070704_100010762 | 3300005549 | Bacteria | 5576 |
| 229 | Ga0070704_100030713 | 3300005549 | Bacteria | 3603 |
| 230 | Ga0070704_100097976 | 3300005549 | Bacteria | 2202 |
| 231 | Ga0070704_100173574 | 3300005549 | Bacteria | 1717 |
| 232 | Ga0070664_100005747 | 3300005564 | Bacteria | 10003 |
| 233 | Ga0070664_100221993 | 3300005564 | Bacteria | 1691 |
| 234 | Ga0070664_100228242 | 3300005564 | Bacteria | 1668 |
| 235 | Ga0070664_100313440 | 3300005564 | Unclassified | 1420 |
| 236 | Ga0068857_100626726 | 3300005577 | Bacteria | 1018 |
| 237 | Ga0068857_100759174 | 3300005577 | Bacteria | 924 |
| 238 | Ga0068857_100797550 | 3300005577 | Bacteria | 902 |
| 239 | Ga0068854_100101312 | 3300005578 | Bacteria | 2159 |
| 240 | Ga0068854_100368821 | 3300005578 | Bacteria | 1180 |
| 241 | Ga0068854_101272929 | 3300005578 | Unclassified | 661 |
| 242 | Ga0070702_100042808 | 3300005615 | Unclassified | 2548 |
| 243 | Ga0070702_100068238 | 3300005615 | Unclassified | 2092 |
| 244 | Ga0070702_100080722 | 3300005615 | Bacteria | 1947 |
| 245 | Ga0070702_100138402 | 3300005615 | Bacteria | 1548 |
| 246 | Ga0068852_100115953 | 3300005616 | Bacteria | 2443 |
| 247 | Ga0068859_100002873 | 3300005617 | Bacteria | 17487 |
| 248 | Ga0068859_100003933 | 3300005617 | Bacteria | 15174 |
| 249 | Ga0068859_100022071 | 3300005617 | Bacteria | 6382 |
| 250 | Ga0068859_100029033 | 3300005617 | Bacteria | 5549 |
| 251 | Ga0068859_100064345 | 3300005617 | Bacteria | 3700 |
| 252 | Ga0068859_100134284 | 3300005617 | Unclassified | 2546 |
| 253 | Ga0068859_100925841 | 3300005617 | Bacteria | 956 |
| 254 | Ga0068859_101403914 | 3300005617 | Bacteria | 770 |
| 255 | Ga0068864_100029090 | 3300005618 | Bacteria | 4675 |
| 256 | Ga0068864_100051552 | 3300005618 | Bacteria | 3546 |
| 257 | Ga0068864_100244655 | 3300005618 | Bacteria | 1663 |
| 258 | Ga0068864_100262786 | 3300005618 | Bacteria | 1606 |
| 259 | Ga0068864_100430938 | 3300005618 | Bacteria | 1258 |
| 260 | Ga0068864_100647179 | 3300005618 | Bacteria | 1029 |
| 261 | Ga0068864_100921521 | 3300005618 | Bacteria | 864 |
| 262 | Ga0068864_101191076 | 3300005618 | Unclassified | 760 |
| 263 | Ga0068866_10154852 | 3300005718 | Bacteria | 1331 |
| 264 | Ga0068861_100005161 | 3300005719 | Bacteria | 8811 |
| 265 | Ga0068861_100017323 | 3300005719 | Bacteria | 5113 |
| 266 | Ga0068861_100139134 | 3300005719 | Bacteria | 1979 |
| 267 | Ga0068861_101167301 | 3300005719 | Unclassified | 743 |
| 268 | Ga0068861_102282927 | 3300005719 | Unclassified | 543 |
| 269 | Ga0068870_10000872 | 3300005840 | Bacteria | 11786 |
| 270 | Ga0068870_10004262 | 3300005840 | Bacteria | 6147 |
| 271 | Ga0068870_10076281 | 3300005840 | Bacteria | 1841 |
| 272 | Ga0068870_10184558 | 3300005840 | Bacteria | 1255 |
| 273 | Ga0068870_10244299 | 3300005840 | Bacteria | 1110 |
| 274 | Ga0068870_10313683 | 3300005840 | Bacteria | 994 |
| 275 | Ga0068870_10916190 | 3300005840 | Unclassified | 620 |
| 276 | Ga0068863_100002061 | 3300005841 | Bacteria | 19922 |
| 277 | Ga0068863_100052741 | 3300005841 | Bacteria | 3854 |
| 278 | Ga0068863_100178488 | 3300005841 | Bacteria | 2038 |
| 279 | Ga0068863_100333889 | 3300005841 | Bacteria | 1474 |
| 280 | Ga0068863_100440924 | 3300005841 | Bacteria | 1277 |
| 281 | Ga0068863_100810502 | 3300005841 | Bacteria | 934 |
| 282 | Ga0068863_100875398 | 3300005841 | Bacteria | 898 |
| 283 | Ga0068863_101580293 | 3300005841 | Bacteria | 665 |
| 284 | Ga0068858_100008740 | 3300005842 | Bacteria | 9718 |
| 285 | Ga0068858_100026137 | 3300005842 | Bacteria | 5428 |
| 286 | Ga0068858_100178835 | 3300005842 | Bacteria | 2002 |
| 287 | Ga0068858_100336001 | 3300005842 | Bacteria | 1445 |
| 288 | Ga0068858_100643993 | 3300005842 | Bacteria | 1030 |
| 289 | Ga0068860_100005513 | 3300005843 | Bacteria | 12809 |
| 290 | Ga0068860_100038517 | 3300005843 | Bacteria | 4574 |
| 291 | Ga0068860_100152118 | 3300005843 | Bacteria | 2228 |
| 292 | Ga0068860_100226513 | 3300005843 | Bacteria | 1816 |
| 293 | Ga0068860_100336732 | 3300005843 | Bacteria | 1483 |
| 294 | Ga0068862_100003220 | 3300005844 | Bacteria | 14137 |
| 295 | Ga0068862_100012749 | 3300005844 | Bacteria | 6957 |
| 296 | Ga0068862_100118584 | 3300005844 | Bacteria | 2330 |
| 297 | Ga0068862_101054733 | 3300005844 | Bacteria | 806 |
| 298 | Ga0068862_101676820 | 3300005844 | Unclassified | 644 |
| 299 | Ga0081455_10059130 | 3300005937 | Bacteria | 3238 |
| 300 | Ga0070717_10008001 | 3300006028 | Bacteria | 7876 |
| 301 | Ga0075432_10035274 | 3300006058 | Bacteria | 1738 |
| 302 | Ga0070716_100142241 | 3300006173 | Bacteria | 1531 |
| 303 | Ga0070716_100257184 | 3300006173 | Unclassified | 1193 |
| 304 | Ga0097621_100065519 | 3300006237 | Bacteria | 2990 |
| 305 | Ga0097621_100085250 | 3300006237 | Bacteria | 2634 |
| 306 | Ga0097621_100231621 | 3300006237 | Bacteria | 1613 |
| 307 | Ga0097621_100535913 | 3300006237 | Unclassified | 1064 |
| 308 | Ga0097621_100976154 | 3300006237 | Bacteria | 792 |
| 309 | Ga0068871_100079486 | 3300006358 | Unclassified | 2713 |
| 310 | Ga0068871_100114530 | 3300006358 | Bacteria | 2272 |
| 311 | Ga0068871_100118180 | 3300006358 | Bacteria | 2237 |
| 312 | Ga0068871_101238524 | 3300006358 | Bacteria | 701 |
| 313 | Ga0075428_100002730 | 3300006844 | Bacteria | 19206 |
| 314 | Ga0075428_100015139 | 3300006844 | Bacteria | 8561 |
| 315 | Ga0075428_100018622 | 3300006844 | Bacteria | 7674 |
| 316 | Ga0075428_100072319 | 3300006844 | Bacteria | 3767 |
| 317 | Ga0075428_100172891 | 3300006844 | Unclassified | 2341 |
| 318 | Ga0075428_100379377 | 3300006844 | Unclassified | 1516 |
| 319 | Ga0075428_100406631 | 3300006844 | Unclassified | 1458 |
| 320 | Ga0075428_100876024 | 3300006844 | Bacteria | 953 |
| 321 | Ga0075428_101640986 | 3300006844 | Bacteria | 672 |
| 322 | Ga0075430_100003769 | 3300006846 | Bacteria | 12738 |
| 323 | Ga0075430_100010183 | 3300006846 | Bacteria | 7962 |
| 324 | Ga0075430_100035401 | 3300006846 | Bacteria | 4236 |
| 325 | Ga0075430_100268119 | 3300006846 | Bacteria | 1413 |
| 326 | Ga0075430_100297882 | 3300006846 | Unclassified | 1334 |
| 327 | Ga0075430_100342591 | 3300006846 | Unclassified | 1235 |
| 328 | Ga0075431_100021013 | 3300006847 | Bacteria | 6670 |
| 329 | Ga0075431_100071107 | 3300006847 | Bacteria | 3589 |
| 330 | Ga0075431_100114967 | 3300006847 | Bacteria | 2778 |
| 331 | Ga0075431_100129847 | 3300006847 | Unclassified | 2600 |
| 332 | Ga0075431_100564519 | 3300006847 | Bacteria | 1124 |
| 333 | Ga0075431_100776865 | 3300006847 | Bacteria | 932 |
| 334 | Ga0075433_10000616 | 3300006852 | Bacteria | 23761 |
| 335 | Ga0075433_10002662 | 3300006852 | Bacteria | 13632 |
| 336 | Ga0075433_10051543 | 3300006852 | Bacteria | 3584 |
| 337 | Ga0075433_10158910 | 3300006852 | Bacteria | 2011 |
| 338 | Ga0075433_10167183 | 3300006852 | Bacteria | 1957 |
| 339 | Ga0075433_10387116 | 3300006852 | Bacteria | 1234 |
| 340 | Ga0075433_10551605 | 3300006852 | Bacteria | 1013 |
| 341 | Ga0075434_100000950 | 3300006871 | Bacteria | 23336 |
| 342 | Ga0075434_100007177 | 3300006871 | Bacteria | 10302 |
| 343 | Ga0075434_100024688 | 3300006871 | Bacteria | 5878 |
| 344 | Ga0075434_100085384 | 3300006871 | Unclassified | 3155 |
| 345 | Ga0075434_100086271 | 3300006871 | Bacteria | 3139 |
| 346 | Ga0075434_100175032 | 3300006871 | Bacteria | 2166 |
| 347 | Ga0075434_100520716 | 3300006871 | Unclassified | 1209 |
| 348 | Ga0075434_100935801 | 3300006871 | Bacteria | 881 |
| 349 | Ga0075429_100011117 | 3300006880 | Bacteria | 7792 |
| 350 | Ga0075429_100049770 | 3300006880 | Unclassified | 3645 |
| 351 | Ga0075429_100050986 | 3300006880 | Bacteria | 3601 |
| 352 | Ga0075429_100051448 | 3300006880 | Bacteria | 3585 |
| 353 | Ga0075429_100089006 | 3300006880 | Unclassified | 2691 |
| 354 | Ga0075429_100123682 | 3300006880 | Bacteria | 2262 |
| 355 | Ga0075429_100180591 | 3300006880 | Bacteria | 1849 |
| 356 | Ga0075429_100187792 | 3300006880 | Unclassified | 1811 |
| 357 | Ga0075429_100277802 | 3300006880 | Bacteria | 1467 |
| 358 | Ga0068865_100063384 | 3300006881 | Bacteria | 2598 |
| 359 | Ga0068865_100363506 | 3300006881 | Bacteria | 1176 |
| 360 | Ga0068865_101404781 | 3300006881 | Bacteria | 623 |
| 361 | Ga0075436_100274172 | 3300006914 | Bacteria | 1205 |
| 362 | Ga0097620_100002872 | 3300006931 | Bacteria | 17487 |
| 363 | Ga0097620_100003934 | 3300006931 | Bacteria | 15174 |
| 364 | Ga0097620_100022068 | 3300006931 | Bacteria | 6382 |
| 365 | Ga0097620_100029033 | 3300006931 | Bacteria | 5549 |
| 366 | Ga0097620_100064346 | 3300006931 | Bacteria | 3700 |
| 367 | Ga0097620_100134279 | 3300006931 | Unclassified | 2546 |
| 368 | Ga0097620_100925855 | 3300006931 | Bacteria | 956 |
| 369 | Ga0097620_101403901 | 3300006931 | Bacteria | 770 |
| 370 | Ga0075435_100004577 | 3300007076 | Bacteria | 9520 |
| 371 | Ga0075435_100143599 | 3300007076 | Bacteria | 2004 |
| 372 | Ga0075435_100471944 | 3300007076 | Bacteria | 1083 |
| 373 | Ga0075435_100621010 | 3300007076 | Unclassified | 938 |
| 374 | Ga0075435_100825078 | 3300007076 | Bacteria | 808 |
| 375 | Ga0099794_10029184 | 3300007265 | Bacteria | 2569 |
| 376 | Ga0099794_10575416 | 3300007265 | Unclassified | 595 |
| 377 | Ga0111539_10001555 | 3300009094 | Bacteria | 30549 |
| 378 | Ga0111539_10013990 | 3300009094 | Bacteria | 10027 |
| 379 | Ga0111539_10014413 | 3300009094 | Bacteria | 9867 |
| 380 | Ga0111539_10044634 | 3300009094 | Bacteria | 5309 |
| 381 | Ga0111539_10097812 | 3300009094 | Bacteria | 3448 |
| 382 | Ga0111539_10136151 | 3300009094 | Bacteria | 2876 |
| 383 | Ga0111539_10160393 | 3300009094 | Unclassified | 2630 |
| 384 | Ga0111539_10175430 | 3300009094 | Bacteria | 2504 |
| 385 | Ga0111539_10502944 | 3300009094 | Bacteria | 1412 |
| 386 | Ga0105245_10706665 | 3300009098 | Bacteria | 1042 |
| 387 | Ga0105247_10183276 | 3300009101 | Bacteria | 1398 |
| 388 | Ga0105247_10266704 | 3300009101 | Bacteria | 1176 |
| 389 | Ga0105247_11141394 | 3300009101 | Unclassified | 617 |
| 390 | Ga0114129_10003246 | 3300009147 | Bacteria | 22822 |
| 391 | Ga0114129_10014347 | 3300009147 | Bacteria | 11294 |
| 392 | Ga0114129_10021698 | 3300009147 | Bacteria | 9113 |
| 393 | Ga0114129_10043065 | 3300009147 | Bacteria | 6354 |
| 394 | Ga0114129_10073691 | 3300009147 | Bacteria | 4757 |
| 395 | Ga0114129_10074301 | 3300009147 | Bacteria | 4735 |
| 396 | Ga0114129_10260538 | 3300009147 | Bacteria | 2324 |
| 397 | Ga0114129_10667655 | 3300009147 | Unclassified | 1340 |
| 398 | Ga0114129_10684241 | 3300009147 | Bacteria | 1320 |
| 399 | Ga0114129_10931193 | 3300009147 | Bacteria | 1099 |
| 400 | Ga0114129_11082329 | 3300009147 | Unclassified | 1005 |
| 401 | Ga0114129_11112217 | 3300009147 | Bacteria | 989 |
| 402 | Ga0114129_11674873 | 3300009147 | Bacteria | 777 |
| 403 | Ga0114129_11865571 | 3300009147 | Unclassified | 730 |
| 404 | Ga0114129_12056535 | 3300009147 | Bacteria | 690 |
| 405 | Ga0114129_12411585 | 3300009147 | Bacteria | 630 |
| 406 | Ga0114129_12546883 | 3300009147 | Bacteria | 611 |
| 407 | Ga0105243_10006639 | 3300009148 | Bacteria | 8933 |
| 408 | Ga0105243_10014126 | 3300009148 | Bacteria | 6040 |
| 409 | Ga0105243_10356263 | 3300009148 | Bacteria | 1345 |
| 410 | Ga0105243_10542055 | 3300009148 | Unclassified | 1110 |
| 411 | Ga0105243_12158790 | 3300009148 | Unclassified | 593 |
| 412 | Ga0105242_10022994 | 3300009176 | Bacteria | 4911 |
| 413 | Ga0105242_10278753 | 3300009176 | Bacteria | 1518 |
| 414 | Ga0105248_10188467 | 3300009177 | Bacteria | 2324 |
| 415 | Ga0105248_10197798 | 3300009177 | Unclassified | 2265 |
| 416 | Ga0105248_10353015 | 3300009177 | Bacteria | 1655 |
| 417 | Ga0105248_10666924 | 3300009177 | Bacteria | 1173 |
| 418 | Ga0105248_11720186 | 3300009177 | Bacteria | 711 |
| 419 | Ga0105248_12143128 | 3300009177 | Unclassified | 636 |
| 420 | Ga0105238_11571696 | 3300009551 | Bacteria | 687 |
| 421 | Ga0105249_10001517 | 3300009553 | Bacteria | 20379 |
| 422 | Ga0105249_10020569 | 3300009553 | Bacteria | 5902 |
| 423 | Ga0105249_10271962 | 3300009553 | Bacteria | 1688 |
| 424 | Ga0105249_11741905 | 3300009553 | Bacteria | 696 |
| 425 | Ga0099796_10291993 | 3300010159 | Bacteria | 688 |
| 426 | Ga0105246_10006946 | 3300011119 | Bacteria | 6924 |
| 427 | Ga0105246_10164281 | 3300011119 | Bacteria | 1694 |
| 428 | Ga0105246_11405743 | 3300011119 | Bacteria | 651 |
| 429 | Ga0157339_1012642 | 3300012505 | Unclassified | 796 |
| 430 | Ga0157371_10179565 | 3300013102 | Bacteria | 1514 |
| 431 | Ga0157371_10379373 | 3300013102 | Bacteria | 1032 |
| 432 | Ga0157374_10151079 | 3300013296 | Bacteria | 2258 |
| 433 | Ga0157374_11013834 | 3300013296 | Unclassified | 849 |
| 434 | Ga0157378_10249635 | 3300013297 | Bacteria | 1698 |
| 435 | Ga0163162_10007906 | 3300013306 | Bacteria | 10363 |
| 436 | Ga0163162_10228874 | 3300013306 | Bacteria | 1989 |
| 437 | Ga0163162_10682927 | 3300013306 | Bacteria | 1149 |
| 438 | Ga0163162_11331845 | 3300013306 | Bacteria | 816 |
| 439 | Ga0157375_10073966 | 3300013308 | Bacteria | 3428 |
| 440 | Ga0157375_10075434 | 3300013308 | Bacteria | 3397 |
| 441 | Ga0157375_10101653 | 3300013308 | Unclassified | 2958 |
| 442 | Ga0157375_10632570 | 3300013308 | Bacteria | 1227 |
| 443 | Ga0157375_10706593 | 3300013308 | Bacteria | 1161 |
| 444 | Ga0157375_10881249 | 3300013308 | Bacteria | 1040 |
| 445 | Ga0163163_10008085 | 3300014325 | Bacteria | 9320 |
| 446 | Ga0163163_10251832 | 3300014325 | Bacteria | 1816 |
| 447 | Ga0163163_11826753 | 3300014325 | Bacteria | 668 |
| 448 | Ga0163163_12027724 | 3300014325 | Bacteria | 635 |
| 449 | Ga0163163_12040609 | 3300014325 | Bacteria | 633 |
| 450 | Ga0157380_10012213 | 3300014326 | Bacteria | 6222 |
| 451 | Ga0157380_10031871 | 3300014326 | Bacteria | 4049 |
| 452 | Ga0157380_10033205 | 3300014326 | Unclassified | 3973 |
| 453 | Ga0157380_10035075 | 3300014326 | Bacteria | 3873 |
| 454 | Ga0157380_10054889 | 3300014326 | Bacteria | 3163 |
| 455 | Ga0157380_10193539 | 3300014326 | Bacteria | 1798 |
| 456 | Ga0157380_10318601 | 3300014326 | Unclassified | 1441 |
| 457 | Ga0157380_10398774 | 3300014326 | Unclassified | 1305 |
| 458 | Ga0157380_10470117 | 3300014326 | Bacteria | 1213 |
| 459 | Ga0157380_10565883 | 3300014326 | Bacteria | 1118 |
| 460 | Ga0157377_10016086 | 3300014745 | Bacteria | 3842 |
| 461 | Ga0157377_10022423 | 3300014745 | Bacteria | 3334 |
| 462 | Ga0157377_10140341 | 3300014745 | Unclassified | 1484 |
| 463 | Ga0157377_10462394 | 3300014745 | Bacteria | 878 |
| 464 | Ga0157379_10060936 | 3300014968 | Bacteria | 3374 |
| 465 | Ga0157379_10095254 | 3300014968 | Bacteria | 2671 |
| 466 | Ga0157376_10161608 | 3300014969 | Bacteria | 2031 |
| 467 | Ga0157376_10480838 | 3300014969 | Bacteria | 1217 |
| 468 | Ga0157376_10573489 | 3300014969 | Bacteria | 1120 |
| 469 | Ga0163161_10094497 | 3300017792 | Bacteria | 2216 |
| 470 | Ga0163161_10102008 | 3300017792 | Bacteria | 2137 |
| 471 | Ga0163161_10222906 | 3300017792 | Bacteria | 1461 |
| 472 | Ga0207673_1016061 | 3300025290 | Unclassified | 994 |
| 473 | Ga0207697_10001790 | 3300025315 | Bacteria | 11496 |
| 474 | Ga0207653_10070835 | 3300025885 | Unclassified | 1191 |
| 475 | Ga0207653_10246993 | 3300025885 | Bacteria | 683 |
| 476 | Ga0207682_10003881 | 3300025893 | Bacteria | 6393 |
| 477 | Ga0207682_10054946 | 3300025893 | Bacteria | 1655 |
| 478 | Ga0207682_10116478 | 3300025893 | Bacteria | 1181 |
| 479 | Ga0207642_10027565 | 3300025899 | Bacteria | 2327 |
| 480 | Ga0207642_10194821 | 3300025899 | Bacteria | 1115 |
| 481 | Ga0207710_10115735 | 3300025900 | Unclassified | 1276 |
| 482 | Ga0207688_10002313 | 3300025901 | Bacteria | 10244 |
| 483 | Ga0207688_10136178 | 3300025901 | Bacteria | 1442 |
| 484 | Ga0207688_10248161 | 3300025901 | Bacteria | 1078 |
| 485 | Ga0207688_11020213 | 3300025901 | Bacteria | 523 |
| 486 | Ga0207680_10148511 | 3300025903 | Bacteria | 1561 |
| 487 | Ga0207680_10602821 | 3300025903 | Bacteria | 786 |
| 488 | Ga0207647_10126430 | 3300025904 | Bacteria | 1504 |
| 489 | Ga0207647_10209673 | 3300025904 | Bacteria | 1125 |
| 490 | Ga0207699_10403318 | 3300025906 | Bacteria | 974 |
| 491 | Ga0207645_10004825 | 3300025907 | Bacteria | 9904 |
| 492 | Ga0207645_10012089 | 3300025907 | Bacteria | 5867 |
| 493 | Ga0207645_10378167 | 3300025907 | Bacteria | 950 |
| 494 | Ga0207645_10590991 | 3300025907 | Bacteria | 754 |
| 495 | Ga0207645_10936653 | 3300025907 | Unclassified | 588 |
| 496 | Ga0207643_10000719 | 3300025908 | Bacteria | 20342 |
| 497 | Ga0207643_10008512 | 3300025908 | Bacteria | 5502 |
| 498 | Ga0207643_10009042 | 3300025908 | Bacteria | 5350 |
| 499 | Ga0207643_10057012 | 3300025908 | Bacteria | 2223 |
| 500 | Ga0207643_10075341 | 3300025908 | Bacteria | 1947 |
| 501 | Ga0207643_10180727 | 3300025908 | Bacteria | 1276 |
| 502 | Ga0207643_10445792 | 3300025908 | Bacteria | 823 |
| 503 | Ga0207684_10372795 | 3300025910 | Bacteria | 1228 |
| 504 | Ga0207684_10677807 | 3300025910 | Bacteria | 877 |
| 505 | Ga0207707_10566181 | 3300025912 | Bacteria | 964 |
| 506 | Ga0207693_10138989 | 3300025915 | Bacteria | 1910 |
| 507 | Ga0207663_10101275 | 3300025916 | Bacteria | 1935 |
| 508 | Ga0207660_10298477 | 3300025917 | Bacteria | 1282 |
| 509 | Ga0207660_10408746 | 3300025917 | Unclassified | 1094 |
| 510 | Ga0207660_10495486 | 3300025917 | Unclassified | 991 |
| 511 | Ga0207662_10004573 | 3300025918 | Bacteria | 7292 |
| 512 | Ga0207662_10023004 | 3300025918 | Bacteria | 3576 |
| 513 | Ga0207662_10055153 | 3300025918 | Bacteria | 2371 |
| 514 | Ga0207649_10091822 | 3300025920 | Bacteria | 1989 |
| 515 | Ga0207649_10387496 | 3300025920 | Bacteria | 1043 |
| 516 | Ga0207649_10914034 | 3300025920 | Bacteria | 688 |
| 517 | Ga0207646_10017561 | 3300025922 | Bacteria | 6689 |
| 518 | Ga0207646_10036524 | 3300025922 | Unclassified | 4435 |
| 519 | Ga0207646_10236938 | 3300025922 | Bacteria | 1649 |
| 520 | Ga0207646_10321953 | 3300025922 | Bacteria | 1397 |
| 521 | Ga0207646_10653006 | 3300025922 | Bacteria | 942 |
| 522 | Ga0207681_10094096 | 3300025923 | Bacteria | 2146 |
| 523 | Ga0207681_10156446 | 3300025923 | Bacteria | 1713 |
| 524 | Ga0207681_10219731 | 3300025923 | Unclassified | 1469 |
| 525 | Ga0207681_10259349 | 3300025923 | Bacteria | 1360 |
| 526 | Ga0207681_10608425 | 3300025923 | Bacteria | 903 |
| 527 | Ga0207681_10638965 | 3300025923 | Unclassified | 882 |
| 528 | Ga0207681_10661638 | 3300025923 | Bacteria | 866 |
| 529 | Ga0207650_10013492 | 3300025925 | Bacteria | 5661 |
| 530 | Ga0207650_10169500 | 3300025925 | Bacteria | 1734 |
| 531 | Ga0207650_10598234 | 3300025925 | Bacteria | 927 |
| 532 | Ga0207659_10001109 | 3300025926 | Bacteria | 15962 |
| 533 | Ga0207659_10003073 | 3300025926 | Bacteria | 9962 |
| 534 | Ga0207659_10007393 | 3300025926 | Bacteria | 6751 |
| 535 | Ga0207659_10008078 | 3300025926 | Bacteria | 6514 |
| 536 | Ga0207659_10020702 | 3300025926 | Bacteria | 4353 |
| 537 | Ga0207659_10061735 | 3300025926 | Bacteria | 2702 |
| 538 | Ga0207659_10084112 | 3300025926 | Bacteria | 2360 |
| 539 | Ga0207659_10141838 | 3300025926 | Bacteria | 1866 |
| 540 | Ga0207659_10277468 | 3300025926 | Bacteria | 1369 |
| 541 | Ga0207659_10969471 | 3300025926 | Bacteria | 731 |
| 542 | Ga0207659_11304652 | 3300025926 | Bacteria | 623 |
| 543 | Ga0207700_10003418 | 3300025928 | Bacteria | 9223 |
| 544 | Ga0207664_10123930 | 3300025929 | Unclassified | 2167 |
| 545 | Ga0207644_10023063 | 3300025931 | Bacteria | 4258 |
| 546 | Ga0207644_10102964 | 3300025931 | Unclassified | 2148 |
| 547 | Ga0207644_10214290 | 3300025931 | Bacteria | 1524 |
| 548 | Ga0207644_10356650 | 3300025931 | Bacteria | 1188 |
| 549 | Ga0207644_11080554 | 3300025931 | Bacteria | 674 |
| 550 | Ga0207690_11459947 | 3300025932 | Bacteria | 572 |
| 551 | Ga0207706_10009301 | 3300025933 | Bacteria | 9023 |
| 552 | Ga0207706_10028229 | 3300025933 | Bacteria | 5012 |
| 553 | Ga0207706_10137157 | 3300025933 | Bacteria | 2152 |
| 554 | Ga0207706_10218950 | 3300025933 | Bacteria | 1667 |
| 555 | Ga0207706_10234833 | 3300025933 | Unclassified | 1603 |
| 556 | Ga0207686_10065287 | 3300025934 | Bacteria | 2320 |
| 557 | Ga0207686_10649522 | 3300025934 | Bacteria | 834 |
| 558 | Ga0207709_10006480 | 3300025935 | Bacteria | 6573 |
| 559 | Ga0207709_10046532 | 3300025935 | Bacteria | 2633 |
| 560 | Ga0207709_10289190 | 3300025935 | Bacteria | 1214 |
| 561 | Ga0207709_10372004 | 3300025935 | Bacteria | 1085 |
| 562 | Ga0207709_10622979 | 3300025935 | Archaea | 856 |
| 563 | Ga0207670_10009697 | 3300025936 | Bacteria | 5508 |
| 564 | Ga0207670_10080284 | 3300025936 | Bacteria | 2280 |
| 565 | Ga0207670_10103355 | 3300025936 | Bacteria | 2039 |
| 566 | Ga0207670_10364726 | 3300025936 | Bacteria | 1147 |
| 567 | Ga0207670_10408426 | 3300025936 | Bacteria | 1087 |
| 568 | Ga0207669_10244386 | 3300025937 | Bacteria | 1332 |
| 569 | Ga0207669_10757789 | 3300025937 | Bacteria | 802 |
| 570 | Ga0207669_11017080 | 3300025937 | Bacteria | 697 |
| 571 | Ga0207669_11253302 | 3300025937 | Bacteria | 629 |
| 572 | Ga0207704_10127595 | 3300025938 | Bacteria | 1755 |
| 573 | Ga0207704_10319149 | 3300025938 | Bacteria | 1198 |
| 574 | Ga0207704_10621973 | 3300025938 | Bacteria | 886 |
| 575 | Ga0207665_10159792 | 3300025939 | Bacteria | 1620 |
| 576 | Ga0207691_10043684 | 3300025940 | Bacteria | 4129 |
| 577 | Ga0207691_10055697 | 3300025940 | Bacteria | 3603 |
| 578 | Ga0207691_10063098 | 3300025940 | Bacteria | 3361 |
| 579 | Ga0207691_10063756 | 3300025940 | Unclassified | 3342 |
| 580 | Ga0207691_10145578 | 3300025940 | Bacteria | 2086 |
| 581 | Ga0207691_10483483 | 3300025940 | Bacteria | 1052 |
| 582 | Ga0207691_10489508 | 3300025940 | Bacteria | 1045 |
| 583 | Ga0207711_10200732 | 3300025941 | Bacteria | 1820 |
| 584 | Ga0207711_10508680 | 3300025941 | Bacteria | 1123 |
| 585 | Ga0207711_11041091 | 3300025941 | Bacteria | 758 |
| 586 | Ga0207689_10001069 | 3300025942 | Bacteria | 26389 |
| 587 | Ga0207689_10009664 | 3300025942 | Bacteria | 8311 |
| 588 | Ga0207689_10195850 | 3300025942 | Bacteria | 1668 |
| 589 | Ga0207689_10348301 | 3300025942 | Bacteria | 1231 |
| 590 | Ga0207689_11058466 | 3300025942 | Bacteria | 684 |
| 591 | Ga0207689_11323075 | 3300025942 | Bacteria | 605 |
| 592 | Ga0207689_11772148 | 3300025942 | Bacteria | 510 |
| 593 | Ga0207661_10579930 | 3300025944 | Bacteria | 1029 |
| 594 | Ga0207679_10021882 | 3300025945 | Bacteria | 4344 |
| 595 | Ga0207679_10024068 | 3300025945 | Unclassified | 4172 |
| 596 | Ga0207679_10220677 | 3300025945 | Unclassified | 1595 |
| 597 | Ga0207651_10012062 | 3300025960 | Bacteria | 4868 |
| 598 | Ga0207651_10042607 | 3300025960 | Bacteria | 3023 |
| 599 | Ga0207651_10080713 | 3300025960 | Unclassified | 2342 |
| 600 | Ga0207651_10100576 | 3300025960 | Unclassified | 2143 |
| 601 | Ga0207651_10110987 | 3300025960 | Bacteria | 2059 |
| 602 | Ga0207651_10476122 | 3300025960 | Bacteria | 1075 |
| 603 | Ga0207651_10632920 | 3300025960 | Bacteria | 938 |
| 604 | Ga0207712_10060348 | 3300025961 | Bacteria | 2688 |
| 605 | Ga0207712_10067200 | 3300025961 | Bacteria | 2565 |
| 606 | Ga0207712_10594295 | 3300025961 | Bacteria | 957 |
| 607 | Ga0207668_10111199 | 3300025972 | Bacteria | 2056 |
| 608 | Ga0207668_10143846 | 3300025972 | Bacteria | 1837 |
| 609 | Ga0207668_10938308 | 3300025972 | Unclassified | 771 |
| 610 | Ga0207668_11175777 | 3300025972 | Bacteria | 689 |
| 611 | Ga0207640_10323796 | 3300025981 | Bacteria | 1228 |
| 612 | Ga0207640_10618966 | 3300025981 | Bacteria | 919 |
| 613 | Ga0207658_10247569 | 3300025986 | Bacteria | 1513 |
| 614 | Ga0207658_10756704 | 3300025986 | Bacteria | 880 |
| 615 | Ga0207658_11029403 | 3300025986 | Unclassified | 751 |
| 616 | Ga0207658_11036730 | 3300025986 | Bacteria | 749 |
| 617 | Ga0207677_10087334 | 3300026023 | Unclassified | 2257 |
| 618 | Ga0207677_10464752 | 3300026023 | Bacteria | 1087 |
| 619 | Ga0207677_11192386 | 3300026023 | Bacteria | 697 |
| 620 | Ga0207677_11949181 | 3300026023 | Bacteria | 546 |
| 621 | Ga0207703_10018309 | 3300026035 | Bacteria | 5470 |
| 622 | Ga0207703_10488712 | 3300026035 | Bacteria | 1154 |
| 623 | Ga0207703_10847568 | 3300026035 | Unclassified | 874 |
| 624 | Ga0207703_11007335 | 3300026035 | Bacteria | 799 |
| 625 | Ga0207639_12213150 | 3300026041 | Bacteria | 511 |
| 626 | Ga0207678_10187933 | 3300026067 | Bacteria | 1765 |
| 627 | Ga0207678_10566822 | 3300026067 | Bacteria | 994 |
| 628 | Ga0207708_10003724 | 3300026075 | Bacteria | 11248 |
| 629 | Ga0207708_10044031 | 3300026075 | Bacteria | 3401 |
| 630 | Ga0207708_10069374 | 3300026075 | Bacteria | 2699 |
| 631 | Ga0207708_10098955 | 3300026075 | Bacteria | 2255 |
| 632 | Ga0207708_10282953 | 3300026075 | Unclassified | 1344 |
| 633 | Ga0207641_10026606 | 3300026088 | Bacteria | 4776 |
| 634 | Ga0207641_10075679 | 3300026088 | Unclassified | 2907 |
| 635 | Ga0207641_10119671 | 3300026088 | Bacteria | 2348 |
| 636 | Ga0207641_10309673 | 3300026088 | Bacteria | 1494 |
| 637 | Ga0207641_10390122 | 3300026088 | Bacteria | 1335 |
| 638 | Ga0207648_10000144 | 3300026089 | Bacteria | 70822 |
| 639 | Ga0207648_10004637 | 3300026089 | Bacteria | 14075 |
| 640 | Ga0207648_10464668 | 3300026089 | Bacteria | 1154 |
| 641 | Ga0207676_10034387 | 3300026095 | Bacteria | 3837 |
| 642 | Ga0207676_10040361 | 3300026095 | Bacteria | 3577 |
| 643 | Ga0207676_10059474 | 3300026095 | Unclassified | 3018 |
| 644 | Ga0207676_10167195 | 3300026095 | Bacteria | 1912 |
| 645 | Ga0207676_10685681 | 3300026095 | Bacteria | 991 |
| 646 | Ga0207674_10014747 | 3300026116 | Bacteria | 8622 |
| 647 | Ga0207674_10041866 | 3300026116 | Bacteria | 4735 |
| 648 | Ga0207674_10208078 | 3300026116 | Bacteria | 1905 |
| 649 | Ga0207674_10486169 | 3300026116 | Bacteria | 1193 |
| 650 | Ga0207674_10542407 | 3300026116 | Bacteria | 1124 |
| 651 | Ga0207674_10773236 | 3300026116 | Bacteria | 927 |
| 652 | Ga0207675_100009291 | 3300026118 | Bacteria | 9219 |
| 653 | Ga0207675_100010261 | 3300026118 | Bacteria | 8777 |
| 654 | Ga0207675_100017102 | 3300026118 | Bacteria | 6772 |
| 655 | Ga0207675_100058080 | 3300026118 | Bacteria | 3610 |
| 656 | Ga0207675_100188058 | 3300026118 | Bacteria | 1980 |
| 657 | Ga0207675_100434274 | 3300026118 | Bacteria | 1299 |
| 658 | Ga0207675_101391273 | 3300026118 | Unclassified | 722 |
| 659 | Ga0207675_101987432 | 3300026118 | Bacteria | 599 |
| 660 | Ga0207683_10009184 | 3300026121 | Bacteria | 8424 |
| 661 | Ga0207683_10164565 | 3300026121 | Bacteria | 2007 |
| 662 | Ga0207683_10184875 | 3300026121 | Bacteria | 1890 |
| 663 | Ga0207683_10571601 | 3300026121 | Bacteria | 1045 |
| 664 | Ga0207683_10619596 | 3300026121 | Bacteria | 1002 |
| 665 | Ga0207698_10030727 | 3300026142 | Unclassified | 3868 |
| 666 | Ga0209969_1054366 | 3300027360 | Bacteria | 630 |
| 667 | Ga0209970_1074382 | 3300027614 | Bacteria | 633 |
| 668 | Ga0209588_1089989 | 3300027671 | Unclassified | 989 |
| 669 | Ga0209998_10026186 | 3300027717 | Bacteria | 1273 |
| 670 | Ga0209974_10228929 | 3300027876 | Bacteria | 694 |
| 671 | Ga0207428_10001961 | 3300027907 | Bacteria | 20884 |
| 672 | Ga0207428_10002268 | 3300027907 | Bacteria | 19313 |
| 673 | Ga0207428_10004387 | 3300027907 | Bacteria | 13451 |
| 674 | Ga0207428_10007206 | 3300027907 | Bacteria | 10171 |
| 675 | Ga0207428_10139775 | 3300027907 | Bacteria | 1849 |
| 676 | Ga0207428_10537066 | 3300027907 | Bacteria | 847 |
| 677 | Ga0207428_11055285 | 3300027907 | Bacteria | 569 |
| 678 | Ga0268266_10015337 | 3300028379 | Bacteria | 6576 |
| 679 | Ga0268266_10274382 | 3300028379 | Unclassified | 1566 |
| 680 | Ga0268266_11065712 | 3300028379 | Bacteria | 782 |
| 681 | Ga0268265_10001826 | 3300028380 | Bacteria | 17008 |
| 682 | Ga0268265_10034431 | 3300028380 | Bacteria | 3692 |
| 683 | Ga0268265_10133598 | 3300028380 | Bacteria | 2066 |
| 684 | Ga0268265_10263578 | 3300028380 | Unclassified | 1533 |
| 685 | Ga0268265_11713865 | 3300028380 | Bacteria | 634 |
| 686 | Ga0268265_11754080 | 3300028380 | Unclassified | 627 |
| 687 | Ga0268264_10005474 | 3300028381 | Bacteria | 10766 |
| 688 | Ga0268264_10022129 | 3300028381 | Bacteria | 5189 |
| 689 | Ga0268264_10241352 | 3300028381 | Bacteria | 1674 |
| 690 | Ga0268264_10314169 | 3300028381 | Bacteria | 1479 |
| 691 | Ga0268264_10417955 | 3300028381 | Bacteria | 1292 |
| 692 | Ga0268264_10795990 | 3300028381 | Bacteria | 944 |
| 693 | Ga0307412_10323481 | 3300031911 | Bacteria | 1228 |
| 694 | Ga0307409_100154617 | 3300031995 | Unclassified | 1997 |
| 695 | Ga0307416_100445012 | 3300032002 | Archaea | 1347 |
| 696 | Ga0307416_100544760 | 3300032002 | Bacteria | 1233 |
| 697 | Ga0307416_100713528 | 3300032002 | Bacteria | 1093 |
| 698 | Ga0307416_100836611 | 3300032002 | Unclassified | 1018 |
| 699 | Ga0307416_101341763 | 3300032002 | Unclassified | 821 |
| 700 | Ga0307411_10496295 | 3300032005 | Bacteria | 1031 |
| 701 | Ga0373948_0132751 | 3300034817 | Bacteria | 610 |
| 702 | Ga0373950_0097878 | 3300034818 | Unclassified | 629 |
| 703 | Ga0373958_0091664 | 3300034819 | Bacteria | 702 |
| 704 | Ga0373959_0029708 | 3300034820 | Bacteria | 1098 |
| 705 | Ga0373926_0014533 | 3300035083 | Unclassified | 2677 |
| 706 | Ga0373928_0101492 | 3300035084 | Bacteria | 751 |
| 707 | Ga0373951_0017699 | 3300035091 | Bacteria | 1614 |
| 708 | Ga0373932_0003263 | 3300035112 | Unclassified | 3924 |
| 709 | Ga0373939_0096588 | 3300035114 | Bacteria | 1007 |
| 710 | Ga0373939_0173588 | 3300035114 | Bacteria | 799 |
| 711 | Ga0373941_0229246 | 3300035115 | Bacteria | 717 |
| 712 | Ga0373943_0023444 | 3300035170 | Unclassified | 2870 |
| 713 | Ga0373942_0193580 | 3300035207 | Bacteria | 671 |
| 714 | Ga0373962_0034641 | 3300035242 | Bacteria | 1399 |
| 715 | Ga0373962_0124364 | 3300035242 | Unclassified | 825 |
| 716 | Ga0373931_0141943 | 3300035691 | Bacteria | 1392 |
| 717 | Ga0373931_0232460 | 3300035691 | Bacteria | 1114 |
| 718 | Ga0373927_0002388 | 3300035695 | Bacteria | 13687 |
| 719 | Ga0373947_0002666 | 3300035725 | Bacteria | 10725 |
| 720 | Ga0373947_0140107 | 3300035725 | Bacteria | 1551 |
| 721 | Ga0373947_0392198 | 3300035725 | Bacteria | 936 |
| 722 | Ga0373925_0000143 | 3300037068 | Bacteria | 76104 |
| 723 | Ga0373925_0345256 | 3300037068 | Bacteria | 1208 |
| 724 | Ga0373925_1559459 | 3300037068 | Unclassified | 540 |
| 725 | Ga0242420_039954 | 3300038996 | Unclassified | 894 |
| 726 | Ga0436362_0306081 | 3300039453 | Unclassified | 764 |
| 727 | Ga0436362_1282180 | 3300039453 | Unclassified | 1152 |
| 728 | Ga0439453_0035315 | 3300041408 | Unclassified | 963 |
| 729 | Ga0439453_0102205 | 3300041408 | Bacteria | 640 |
| 730 | Ga0451804_0268028 | 3300041463 | Bacteria | 584 |
| 731 | Ga0451853_2251524 | 3300041512 | Bacteria | 794 |
| 732 | Ga0439451_084656 | 3300042009 | Unclassified | 638 |
| 733 | Ga0450923_070569 | 3300042125 | Bacteria | 774 |
| 734 | Ga0439446_0169923 | 3300042156 | Unclassified | 725 |
| 735 | Ga0439434_0188127 | 3300042435 | Bacteria | 693 |
| 736 | Ga0439435_0001066 | 3300042436 | Bacteria | 4855 |
| 737 | Ga0439435_0324014 | 3300042436 | Unclassified | 531 |
| 738 | Ga0439459_0081592 | 3300042438 | Unclassified | 764 |
| 739 | Ga0439460_0050049 | 3300042461 | Unclassified | 1251 |
| 740 | Ga0439440_0095765 | 3300042993 | Bacteria | 802 |
| 741 | Ga0451576_0015029 | 3300045051 | Bacteria | 8599 |
| 742 | Ga0451576_0020117 | 3300045051 | Bacteria | 7274 |
| 743 | Ga0451576_0539471 | 3300045051 | Bacteria | 1225 |
| 744 | Ga0451576_2651233 | 3300045051 | Unclassified | 511 |
| 745 | Ga0495580_0011821 | 3300046472 | Bacteria | 6737 |
| 746 | Ga0495580_0349385 | 3300046472 | Bacteria | 1002 |
| 747 | Ga0495605_0365963 | 3300046474 | Unclassified | 603 |
| 748 | Ga0495585_0546136 | 3300046492 | Unclassified | 548 |
| 749 | Ga0495665_0435234 | 3300046531 | Unclassified | 664 |
| 750 | Ga0495586_0077918 | 3300046535 | Bacteria | 1818 |
| 751 | Ga0495598_0010836 | 3300046537 | Unclassified | 2195 |
| 752 | Ga0495598_0161158 | 3300046537 | Bacteria | 789 |
| 753 | Ga0495598_0461479 | 3300046537 | Unclassified | 504 |
| 754 | Ga0495609_0128037 | 3300046538 | Bacteria | 1089 |
| 755 | Ga0495609_0210896 | 3300046538 | Bacteria | 809 |
| 756 | Ga0495621_0003642 | 3300046539 | Bacteria | 4254 |
| 757 | Ga0495621_0090163 | 3300046539 | Unclassified | 1155 |
| 758 | Ga0495621_0107379 | 3300046539 | Bacteria | 1068 |
| 759 | Ga0495656_0191522 | 3300046615 | Bacteria | 1010 |
| 760 | Ga0495656_0294992 | 3300046615 | Bacteria | 830 |
| 761 | Ga0495656_0455625 | 3300046615 | Unclassified | 674 |
| 762 | Ga0495659_0003235 | 3300046664 | Bacteria | 5220 |
| 763 | Ga0495659_0025672 | 3300046664 | Bacteria | 2018 |
| 764 | Ga0495659_0028645 | 3300046664 | Unclassified | 1929 |
| 765 | Ga0495659_0162825 | 3300046664 | Bacteria | 901 |
| 766 | Ga0495658_0178801 | 3300046683 | Unclassified | 1316 |
| 767 | Ga0495669_0055259 | 3300046684 | Bacteria | 1788 |
| 768 | Ga0495669_0083038 | 3300046684 | Unclassified | 1472 |
| 769 | Ga0495669_0363686 | 3300046684 | Bacteria | 700 |
| 770 | Ga0495669_0428566 | 3300046684 | Unclassified | 642 |
| 771 | Ga0495636_0050818 | 3300047318 | Bacteria | 1736 |
| 772 | Ga0495636_0052349 | 3300047318 | Bacteria | 1712 |
| 773 | Ga0495677_0056686 | 3300047445 | Bacteria | 1448 |
| 774 | Ga0495677_0260137 | 3300047445 | Bacteria | 679 |
| 775 | Ga0495685_013084 | 3300047447 | Unclassified | 2814 |
| 776 | Ga0496102_0735853 | 3300048905 | Unclassified | 909 |
| 777 | Ga0496104_0210665 | 3300048907 | Bacteria | 1855 |
| 778 | Ga0496106_0324898 | 3300048909 | Bacteria | 1235 |
| 779 | Ga0496109_0304390 | 3300048912 | Bacteria | 1503 |
| 780 | Ga0496110_0785149 | 3300048913 | Unclassified | 856 |
| 781 | Ga0496112_0405482 | 3300048915 | Bacteria | 1303 |
| 782 | Ga0496113_0085577 | 3300048916 | Bacteria | 2422 |
| 783 | Ga0496114_0543142 | 3300048917 | Bacteria | 1027 |
| 784 | Ga0501031_0316041 | 3300049568 | Unclassified | 1012 |
| 785 | Ga0501033_0135580 | 3300049570 | Bacteria | 1781 |
| 786 | Ga0501033_0560909 | 3300049570 | Unclassified | 786 |
| 787 | Ga0501033_0718541 | 3300049570 | Bacteria | 679 |
| 788 | Ga0501034_1284720 | 3300049571 | Unclassified | 609 |
| 789 | Ga0501036_0006517 | 3300049572 | Bacteria | 9484 |
| 790 | Ga0501036_0015546 | 3300049572 | Bacteria | 6359 |
| 791 | Ga0501036_0043039 | 3300049572 | Bacteria | 3824 |
| 792 | Ga0501037_0053504 | 3300049573 | Bacteria | 2953 |
| 793 | Ga0501037_0377162 | 3300049573 | Unclassified | 975 |
| 794 | Ga0501038_0415818 | 3300049574 | Bacteria | 1038 |
| 795 | Ga0501039_0012801 | 3300049575 | Bacteria | 6413 |
| 796 | Ga0501039_0168201 | 3300049575 | Bacteria | 1723 |
| 797 | Ga0501039_1217611 | 3300049575 | Bacteria | 582 |
| 798 | Ga0501040_0011449 | 3300049576 | Bacteria | 5808 |
| 799 | Ga0501040_0012271 | 3300049576 | Bacteria | 5613 |
| 800 | Ga0501040_0012274 | 3300049576 | Bacteria | 5612 |
| 801 | Ga0501040_0026883 | 3300049576 | Unclassified | 3872 |
| 802 | Ga0501041_0005678 | 3300049577 | Bacteria | 7292 |
| 803 | Ga0501041_0005712 | 3300049577 | Bacteria | 7269 |
| 804 | Ga0501041_0212142 | 3300049577 | Unclassified | 1214 |
| 805 | Ga0501041_0482548 | 3300049577 | Bacteria | 788 |
| 806 | Ga0501042_0001586 | 3300049578 | Bacteria | 13496 |
| 807 | Ga0501042_0007901 | 3300049578 | Bacteria | 6997 |
| 808 | Ga0501042_0014823 | 3300049578 | Bacteria | 5325 |
| 809 | Ga0501042_0048198 | 3300049578 | Unclassified | 3038 |
| 810 | Ga0501042_0984645 | 3300049578 | Bacteria | 614 |
| 811 | Ga0501043_0036253 | 3300049579 | Bacteria | 3879 |
| 812 | Ga0501043_0165115 | 3300049579 | Unclassified | 1729 |
| 813 | Ga0501043_0353426 | 3300049579 | Unclassified | 1116 |
| 814 | Ga0501046_0022494 | 3300049580 | Bacteria | 5194 |
| 815 | Ga0501046_0034854 | 3300049580 | Bacteria | 4059 |
| 816 | Ga0501046_0071352 | 3300049580 | Unclassified | 2699 |
| 817 | Ga0501046_0235541 | 3300049580 | Bacteria | 1351 |
| 818 | Ga0501048_0013516 | 3300049582 | Bacteria | 6057 |
| 819 | Ga0501048_0045174 | 3300049582 | Bacteria | 3148 |
| 820 | Ga0501067_0132290 | 3300049583 | Bacteria | 1389 |
| 821 | Ga0501068_0022396 | 3300049584 | Bacteria | 3695 |
| 822 | Ga0501070_0295328 | 3300049586 | Bacteria | 1321 |
| 823 | Ga0501070_0929913 | 3300049586 | Unclassified | 677 |
| 824 | Ga0501071_0010264 | 3300049587 | Bacteria | 6268 |
| 825 | Ga0501071_0016080 | 3300049587 | Bacteria | 5143 |
| 826 | Ga0501071_0561499 | 3300049587 | Unclassified | 877 |
| 827 | Ga0501072_0014626 | 3300049588 | Bacteria | 6015 |
| 828 | Ga0501072_0029045 | 3300049588 | Bacteria | 4317 |
| 829 | Ga0501072_0905690 | 3300049588 | Bacteria | 689 |
| 830 | Ga0501074_0069889 | 3300049590 | Bacteria | 2525 |
| 831 | Ga0501074_0192198 | 3300049590 | Bacteria | 1455 |
| 832 | Ga0501075_0000268 | 3300049591 | Bacteria | 28521 |
| 833 | Ga0501075_0013423 | 3300049591 | Bacteria | 5844 |
| 834 | Ga0501075_0077307 | 3300049591 | Unclassified | 2519 |
| 835 | Ga0501075_0177902 | 3300049591 | Unclassified | 1623 |
| 836 | Ga0501075_0807668 | 3300049591 | Bacteria | 714 |
| 837 | Ga0501075_1114980 | 3300049591 | Unclassified | 599 |
| 838 | Ga0501076_0004709 | 3300049592 | Bacteria | 9731 |
| 839 | Ga0501076_0005998 | 3300049592 | Bacteria | 8776 |
| 840 | Ga0501076_0256407 | 3300049592 | Bacteria | 1432 |
| 841 | Ga0501077_0044953 | 3300049593 | Bacteria | 2805 |
| 842 | Ga0501077_0384800 | 3300049593 | Unclassified | 896 |
| 843 | Ga0501077_0482293 | 3300049593 | Bacteria | 795 |
| 844 | Ga0501249_045699 | 3300049679 | Bacteria | 999 |
| 845 | Ga0501245_004579 | 3300049708 | Bacteria | 1900 |
| 846 | Ga0501079_0000628 | 3300049741 | Bacteria | 23440 |
| 847 | Ga0501079_0002955 | 3300049741 | Bacteria | 12428 |
| 848 | Ga0501079_0043815 | 3300049741 | Bacteria | 3454 |
| 849 | Ga0501079_0388428 | 3300049741 | Unclassified | 1094 |
| 850 | Ga0501079_1550035 | 3300049741 | Unclassified | 521 |
| 851 | Ga0501080_0057691 | 3300049742 | Bacteria | 3615 |
| 852 | Ga0501080_0084132 | 3300049742 | Bacteria | 2956 |
| 853 | Ga0501080_1061816 | 3300049742 | Unclassified | 700 |
| 854 | Ga0501081_0006126 | 3300049743 | Bacteria | 7795 |
| 855 | Ga0501081_0021904 | 3300049743 | Unclassified | 4270 |
| 856 | Ga0501081_0023491 | 3300049743 | Bacteria | 4132 |
| 857 | Ga0501081_0482947 | 3300049743 | Bacteria | 922 |
| 858 | Ga0501083_0383693 | 3300049744 | Unclassified | 914 |
| 859 | Ga0501083_0488705 | 3300049744 | Unclassified | 801 |
| 860 | Ga0501083_0986879 | 3300049744 | Bacteria | 548 |
| 861 | Ga0501268_031902 | 3300049765 | Bacteria | 958 |
| 862 | Ga0501283_012208 | 3300049779 | Bacteria | 1288 |
| 863 | Ga0501045_0013214 | 3300049824 | Bacteria | 5824 |
| 864 | Ga0501045_0013639 | 3300049824 | Bacteria | 5744 |
| 865 | Ga0501045_0045171 | 3300049824 | Unclassified | 3208 |
| 866 | Ga0501045_0113015 | 3300049824 | Bacteria | 2014 |
| 867 | nmdc:mga05p37_1039442_c1 | 3300050507 | Bacteria | 865 |
| 868 | nmdc:mga05p37_1081459_c1 | 3300050507 | Unclassified | 842 |
| 869 | nmdc:mga05p37_1098_c1 | 3300050507 | Bacteria | 31079 |
| 870 | nmdc:mga05p37_1321194_c1 | 3300050507 | Bacteria | 733 |
| 871 | nmdc:mga05p37_173071_c1 | 3300050507 | Bacteria | 2632 |
| 872 | nmdc:mga05p37_1800084_c1 | 3300050507 | Unclassified | 591 |
| 873 | nmdc:mga05p37_182714_c1 | 3300050507 | Bacteria | 2551 |
| 874 | nmdc:mga05p37_20113_c1 | 3300050507 | Bacteria | 8079 |
| 875 | nmdc:mga05p37_217986_c1 | 3300050507 | Bacteria | 2304 |
| 876 | nmdc:mga05p37_263869_c1 | 3300050507 | Bacteria | 2060 |
| 877 | nmdc:mga05p37_31490_c2 | 3300050507 | Bacteria | 3729 |
| 878 | nmdc:mga05p37_331663_c1 | 3300050507 | Unclassified | 1797 |
| 879 | nmdc:mga05p37_339747_c1 | 3300050507 | Bacteria | 1771 |
| 880 | nmdc:mga05p37_41099_c1 | 3300050507 | Bacteria | 5678 |
| 881 | nmdc:mga05p37_967463_c1 | 3300050507 | Bacteria | 909 |
| 882 | nmdc:mga09592_119986_c1 | 3300050508 | Bacteria | 2258 |
| 883 | nmdc:mga09592_223441_c1 | 3300050508 | Unclassified | 1631 |
| 884 | nmdc:mga09592_410769_c1 | 3300050508 | Bacteria | 1170 |
| 885 | nmdc:mga09592_45067_c1 | 3300050508 | Bacteria | 3715 |
| 886 | nmdc:mga09592_47639_c1 | 3300050508 | Bacteria | 3613 |
| 887 | nmdc:mga09592_61465_c1 | 3300050508 | Bacteria | 3177 |
| 888 | nmdc:mga09592_69703_c1 | 3300050508 | Unclassified | 2983 |
| 889 | nmdc:mga09592_717546_c1 | 3300050508 | Bacteria | 850 |
| 890 | nmdc:mga09592_898607_c1 | 3300050508 | Bacteria | 745 |
| 891 | nmdc:mga09592_9774_c1 | 3300050508 | Bacteria | 7795 |
| 892 | nmdc:mga0qj67_1031_c1 | 3300050509 | Bacteria | 19266 |
| 893 | nmdc:mga0qj67_1147687_c1 | 3300050509 | Unclassified | 606 |
| 894 | nmdc:mga0qj67_119828_c1 | 3300050509 | Bacteria | 2128 |
| 895 | nmdc:mga0qj67_127418_c1 | 3300050509 | Bacteria | 2060 |
| 896 | nmdc:mga0qj67_165669_c1 | 3300050509 | Bacteria | 1794 |
| 897 | nmdc:mga0qj67_199896_c1 | 3300050509 | Bacteria | 1624 |
| 898 | nmdc:mga0qj67_207300_c1 | 3300050509 | Bacteria | 1592 |
| 899 | nmdc:mga0qj67_390648_c1 | 3300050509 | Unclassified | 1123 |
| 900 | nmdc:mga0qj67_74329_c1 | 3300050509 | Bacteria | 2716 |
| 901 | nmdc:mga06r32_102480_c1 | 3300050510 | Bacteria | 2810 |
| 902 | nmdc:mga06r32_11151_c1 | 3300050510 | Bacteria | 8094 |
| 903 | nmdc:mga06r32_42494_c1 | 3300050510 | Bacteria | 4322 |
| 904 | nmdc:mga06r32_456738_c1 | 3300050510 | Bacteria | 1257 |
| 905 | nmdc:mga06r32_558096_c1 | 3300050510 | Bacteria | 1119 |
| 906 | nmdc:mga06r32_648885_c1 | 3300050510 | Bacteria | 1024 |
| 907 | nmdc:mga06r32_92505_c1 | 3300050510 | Unclassified | 2957 |
| 908 | nmdc:mga08y16_12159_c1 | 3300050511 | Bacteria | 9048 |
| 909 | nmdc:mga08y16_148435_c1 | 3300050511 | Unclassified | 2437 |
| 910 | nmdc:mga08y16_1686052_c1 | 3300050511 | Bacteria | 589 |
| 911 | nmdc:mga08y16_207037_c1 | 3300050511 | Bacteria | 2032 |
| 912 | nmdc:mga08y16_232851_c1 | 3300050511 | Bacteria | 1905 |
| 913 | nmdc:mga08y16_244481_c1 | 3300050511 | Unclassified | 1854 |
| 914 | nmdc:mga08y16_31440_c1 | 3300050511 | Bacteria | 5583 |
| 915 | nmdc:mga08y16_503107_c1 | 3300050511 | Bacteria | 1231 |
| 916 | nmdc:mga08y16_670_c1 | 3300050511 | Bacteria | 32365 |
| 917 | nmdc:mga08y16_6941_c1 | 3300050511 | Bacteria | 11870 |
| 918 | nmdc:mga08y16_80156_c1 | 3300050511 | Bacteria | 3404 |
| 919 | nmdc:mga0n895_201838_c1 | 3300050512 | Bacteria | 2019 |
| 920 | nmdc:mga0n895_25280_c1 | 3300050512 | Bacteria | 5609 |
| 921 | nmdc:mga0n895_284128_c1 | 3300050512 | Bacteria | 1678 |
| 922 | nmdc:mga0n895_429_c1 | 3300050512 | Bacteria | 28206 |
| 923 | nmdc:mga0n895_589694_c1 | 3300050512 | Unclassified | 1115 |
| 924 | nmdc:mga0rr50_1117497_c1 | 3300050513 | Unclassified | 670 |
| 925 | nmdc:mga0rr50_210315_c1 | 3300050513 | Bacteria | 1602 |
| 926 | nmdc:mga0rr50_42396_c1 | 3300050513 | Bacteria | 3323 |
| 927 | nmdc:mga0rr50_77440_c1 | 3300050513 | Bacteria | 2555 |
| 928 | nmdc:mga08x19_278354_c1 | 3300050514 | Bacteria | 1159 |
| 929 | nmdc:mga08x19_373327_c1 | 3300050514 | Unclassified | 998 |
| 930 | nmdc:mga0a205_1627_c1 | 3300050515 | Bacteria | 19317 |
| 931 | nmdc:mga0a205_546922_c1 | 3300050515 | Bacteria | 1013 |
| 932 | nmdc:mga0a205_84831_c1 | 3300050515 | Bacteria | 3060 |
| 933 | nmdc:mga0a205_867_c1 | 3300050515 | Bacteria | 24788 |
| 934 | nmdc:mga0a205_8857_c1 | 3300050515 | Bacteria | 9169 |
| 935 | nmdc:mga0a205_928371_c1 | 3300050515 | Unclassified | 717 |
| 936 | Ga0501084_0010418 | 3300054114 | Bacteria | 7688 |
| 937 | Ga0501084_0017927 | 3300054114 | Bacteria | 5895 |
| 938 | Ga0501084_0018490 | 3300054114 | Bacteria | 5801 |
| 939 | Ga0501084_0068690 | 3300054114 | Bacteria | 2966 |
| 940 | Ga0501084_0551773 | 3300054114 | Unclassified | 974 |
| 941 | Ga0501084_0818812 | 3300054114 | Unclassified | 784 |
| 942 | Ga0501082_0002583 | 3300060353 | Bacteria | 15835 |
| 943 | Ga0501082_0012187 | 3300060353 | Bacteria | 7387 |
| 944 | Ga0501082_0049473 | 3300060353 | Bacteria | 3625 |
| 945 | Ga0501082_0137506 | 3300060353 | Unclassified | 2120 |
| 946 | Ga0530510_0000557 | 3300061734 | Bacteria | 24044 |
| 947 | Ga0530510_0075231 | 3300061734 | Unclassified | 2452 |
| 948 | Ga0530510_0128788 | 3300061734 | Archaea | 1861 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100657405 | Ga0068869_1006574051 | 127 |
| 2 | 3300009177 | Ga0105248_12143128 | Ga0105248_121431281 | 127 |
| 3 | 3300025942 | Ga0207689_11772148 | Ga0207689_117721481 | 127 |
| 4 | 3300026121 | Ga0207683_10619596 | Ga0207683_106195962 | 127 |
| 5 | 3300031995 | Ga0307409_100154617 | Ga0307409_1001546173 | 127 |
| 6 | 3300003323 | rootH1_10332194 | rootH1_103321942 | 129 |
| 7 | 3300046683 | Ga0495658_0178801 | Ga0495658_0178801_181_570 | 129 |
| 8 | 3300005293 | Ga0065715_10004374 | Ga0065715_100043742 | 130 |
| 9 | 3300005331 | Ga0070670_100019553 | Ga0070670_1000195532 | 130 |
| 10 | 3300005340 | Ga0070689_100179522 | Ga0070689_1001795222 | 130 |
| 11 | 3300005353 | Ga0070669_100046196 | Ga0070669_1000461961 | 130 |
| 12 | 3300005354 | Ga0070675_100049358 | Ga0070675_1000493584 | 130 |
| 13 | 3300005356 | Ga0070674_100370335 | Ga0070674_1003703352 | 130 |
| 14 | 3300005364 | Ga0070673_100013101 | Ga0070673_1000131017 | 130 |
| 15 | 3300005365 | Ga0070688_101637661 | Ga0070688_1016376611 | 130 |
| 16 | 3300005543 | Ga0070672_100273278 | Ga0070672_1002732782 | 130 |
| 17 | 3300005545 | Ga0070695_100047411 | Ga0070695_1000474113 | 130 |
| 18 | 3300005618 | Ga0068864_101191076 | Ga0068864_1011910762 | 130 |
| 19 | 3300005718 | Ga0068866_10154852 | Ga0068866_101548522 | 130 |
| 20 | 3300005844 | Ga0068862_101054733 | Ga0068862_1010547331 | 130 |
| 21 | 3300006237 | Ga0097621_100976154 | Ga0097621_1009761542 | 130 |
| 22 | 3300013306 | Ga0163162_11331845 | Ga0163162_113318452 | 130 |
| 23 | 3300013308 | Ga0157375_10073966 | Ga0157375_100739665 | 130 |
| 24 | 3300014325 | Ga0163163_10251832 | Ga0163163_102518322 | 130 |
| 25 | 3300014326 | Ga0157380_10035075 | Ga0157380_100350754 | 130 |
| 26 | 3300017792 | Ga0163161_10102008 | Ga0163161_101020082 | 130 |
| 27 | 3300025899 | Ga0207642_10194821 | Ga0207642_101948212 | 130 |
| 28 | 3300025908 | Ga0207643_10445792 | Ga0207643_104457921 | 130 |
| 29 | 3300025923 | Ga0207681_10608425 | Ga0207681_106084251 | 130 |
| 30 | 3300025925 | Ga0207650_10598234 | Ga0207650_105982341 | 130 |
| 31 | 3300025926 | Ga0207659_10277468 | Ga0207659_102774682 | 130 |
| 32 | 3300025936 | Ga0207670_10103355 | Ga0207670_101033551 | 130 |
| 33 | 3300025937 | Ga0207669_10244386 | Ga0207669_102443862 | 130 |
| 34 | 3300025940 | Ga0207691_10055697 | Ga0207691_100556974 | 130 |
| 35 | 3300025960 | Ga0207651_10476122 | Ga0207651_104761222 | 130 |
| 36 | 3300026118 | Ga0207675_100058080 | Ga0207675_1000580803 | 130 |
| 37 | 3300028380 | Ga0268265_11713865 | Ga0268265_117138652 | 130 |
| 38 | 3300041512 | Ga0451853_2251524 | Ga0451853_2251524_371_766 | 130 |
| 39 | 3300049679 | Ga0501249_045699 | Ga0501249_045699_285_689 | 130 |
| 40 | 3300049708 | Ga0501245_004579 | Ga0501245_004579_770_1174 | 130 |
| 41 | 3300049765 | Ga0501268_031902 | Ga0501268_031902_344_748 | 130 |
| 42 | 3300049779 | Ga0501283_012208 | Ga0501283_012208_303_707 | 130 |
| 43 | 3300014325 | Ga0163163_11826753 | Ga0163163_118267532 | 131 |
| 44 | 3300005577 | Ga0068857_100759174 | Ga0068857_1007591742 | 132 |
| 45 | 3300005842 | Ga0068858_100643993 | Ga0068858_1006439931 | 132 |
| 46 | 3300005937 | Ga0081455_10059130 | Ga0081455_100591302 | 132 |
| 47 | 3300009177 | Ga0105248_11720186 | Ga0105248_117201862 | 132 |
| 48 | 3300013308 | Ga0157375_10632570 | Ga0157375_106325702 | 132 |
| 49 | 3300014325 | Ga0163163_12040609 | Ga0163163_120406092 | 132 |
| 50 | 3300026035 | Ga0207703_11007335 | Ga0207703_110073352 | 132 |
| 51 | 3300026116 | Ga0207674_10486169 | Ga0207674_104861692 | 132 |
| 52 | 3300028380 | Ga0268265_10034431 | Ga0268265_100344312 | 132 |
| 53 | 3300035114 | Ga0373939_0173588 | Ga0373939_0173588_219_626 | 132 |
| 54 | 3300035691 | Ga0373931_0232460 | Ga0373931_0232460_257_664 | 132 |
| 55 | 3300039453 | Ga0436362_0306081 | Ga0436362_0306081_275_685 | 132 |
| 56 | 3300046537 | Ga0495598_0161158 | Ga0495598_0161158_294_695 | 132 |
| 57 | 3300049586 | Ga0501070_0929913 | Ga0501070_0929913_175_606 | 132 |
| 58 | 3300005334 | Ga0068869_101189490 | Ga0068869_1011894901 | 133 |
| 59 | 3300005618 | Ga0068864_100647179 | Ga0068864_1006471792 | 133 |
| 60 | 3300006844 | Ga0075428_101640986 | Ga0075428_1016409862 | 133 |
| 61 | 3300007265 | Ga0099794_10575416 | Ga0099794_105754162 | 133 |
| 62 | 3300009553 | Ga0105249_10271962 | Ga0105249_102719622 | 133 |
| 63 | 3300025961 | Ga0207712_10594295 | Ga0207712_105942952 | 133 |
| 64 | 3300028381 | Ga0268264_10022129 | Ga0268264_100221292 | 133 |
| 65 | 3300046615 | Ga0495656_0191522 | Ga0495656_0191522_444_845 | 133 |
| 66 | 3300050512 | nmdc:mga0n895_429_c1 | nmdc:mga0n895_429_c1_765_1178 | 133 |
| 67 | 3300050513 | nmdc:mga0rr50_42396_c1 | nmdc:mga0rr50_42396_c1_992_1405 | 133 |
| 68 | 3300050515 | nmdc:mga0a205_867_c1 | nmdc:mga0a205_867_c1_20407_20820 | 133 |
| 69 | 3300005328 | Ga0070676_10008509 | Ga0070676_100085092 | 134 |
| 70 | 3300005330 | Ga0070690_100019611 | Ga0070690_1000196112 | 134 |
| 71 | 3300005334 | Ga0068869_100004349 | Ga0068869_1000043492 | 134 |
| 72 | 3300005335 | Ga0070666_10257807 | Ga0070666_102578072 | 134 |
| 73 | 3300005335 | Ga0070666_10940536 | Ga0070666_109405362 | 134 |
| 74 | 3300005335 | Ga0070666_11337239 | Ga0070666_113372391 | 134 |
| 75 | 3300005353 | Ga0070669_100049163 | Ga0070669_1000491632 | 134 |
| 76 | 3300005353 | Ga0070669_100096307 | Ga0070669_1000963072 | 134 |
| 77 | 3300005354 | Ga0070675_100002265 | Ga0070675_10000226516 | 134 |
| 78 | 3300005354 | Ga0070675_100122555 | Ga0070675_1001225552 | 134 |
| 79 | 3300005354 | Ga0070675_100558615 | Ga0070675_1005586151 | 134 |
| 80 | 3300005354 | Ga0070675_101138543 | Ga0070675_1011385431 | 134 |
| 81 | 3300005355 | Ga0070671_100059946 | Ga0070671_1000599464 | 134 |
| 82 | 3300005356 | Ga0070674_100076325 | Ga0070674_1000763252 | 134 |
| 83 | 3300005356 | Ga0070674_100208657 | Ga0070674_1002086572 | 134 |
| 84 | 3300005356 | Ga0070674_100557676 | Ga0070674_1005576761 | 134 |
| 85 | 3300005364 | Ga0070673_100019662 | Ga0070673_1000196622 | 134 |
| 86 | 3300005364 | Ga0070673_100024386 | Ga0070673_1000243865 | 134 |
| 87 | 3300005364 | Ga0070673_100514080 | Ga0070673_1005140802 | 134 |
| 88 | 3300005438 | Ga0070701_10149205 | Ga0070701_101492052 | 134 |
| 89 | 3300005441 | Ga0070700_100002700 | Ga0070700_1000027002 | 134 |
| 90 | 3300005455 | Ga0070663_100800391 | Ga0070663_1008003911 | 134 |
| 91 | 3300005456 | Ga0070678_100004885 | Ga0070678_1000048853 | 134 |
| 92 | 3300005456 | Ga0070678_100224186 | Ga0070678_1002241862 | 134 |
| 93 | 3300005459 | Ga0068867_100000229 | Ga0068867_10000022938 | 134 |
| 94 | 3300005466 | Ga0070685_10443497 | Ga0070685_104434972 | 134 |
| 95 | 3300005471 | Ga0070698_100514760 | Ga0070698_1005147601 | 134 |
| 96 | 3300005539 | Ga0068853_102229572 | Ga0068853_1022295721 | 134 |
| 97 | 3300005543 | Ga0070672_100002796 | Ga0070672_10000279612 | 134 |
| 98 | 3300005543 | Ga0070672_100184472 | Ga0070672_1001844722 | 134 |
| 99 | 3300005544 | Ga0070686_100019208 | Ga0070686_1000192082 | 134 |
| 100 | 3300005544 | Ga0070686_100419797 | Ga0070686_1004197972 | 134 |
| 101 | 3300005545 | Ga0070695_100530372 | Ga0070695_1005303722 | 134 |
| 102 | 3300005577 | Ga0068857_100797550 | Ga0068857_1007975502 | 134 |
| 103 | 3300005578 | Ga0068854_100101312 | Ga0068854_1001013122 | 134 |
| 104 | 3300005615 | Ga0070702_100138402 | Ga0070702_1001384022 | 134 |
| 105 | 3300005618 | Ga0068864_100921521 | Ga0068864_1009215211 | 134 |
| 106 | 3300005719 | Ga0068861_100139134 | Ga0068861_1001391341 | 134 |
| 107 | 3300005840 | Ga0068870_10076281 | Ga0068870_100762812 | 134 |
| 108 | 3300005840 | Ga0068870_10184558 | Ga0068870_101845581 | 134 |
| 109 | 3300005841 | Ga0068863_100333889 | Ga0068863_1003338892 | 134 |
| 110 | 3300005841 | Ga0068863_101580293 | Ga0068863_1015802932 | 134 |
| 111 | 3300005843 | Ga0068860_100038517 | Ga0068860_1000385171 | 134 |
| 112 | 3300006358 | Ga0068871_100118180 | Ga0068871_1001181802 | 134 |
| 113 | 3300006881 | Ga0068865_100063384 | Ga0068865_1000633842 | 134 |
| 114 | 3300006881 | Ga0068865_101404781 | Ga0068865_1014047812 | 134 |
| 115 | 3300009094 | Ga0111539_10175430 | Ga0111539_101754302 | 134 |
| 116 | 3300009098 | Ga0105245_10706665 | Ga0105245_107066652 | 134 |
| 117 | 3300009148 | Ga0105243_10006639 | Ga0105243_100066392 | 134 |
| 118 | 3300009176 | Ga0105242_10022994 | Ga0105242_100229943 | 134 |
| 119 | 3300009177 | Ga0105248_10666924 | Ga0105248_106669242 | 134 |
| 120 | 3300011119 | Ga0105246_10164281 | Ga0105246_101642812 | 134 |
| 121 | 3300013297 | Ga0157378_10249635 | Ga0157378_102496353 | 134 |
| 122 | 3300013308 | Ga0157375_10881249 | Ga0157375_108812492 | 134 |
| 123 | 3300014326 | Ga0157380_10012213 | Ga0157380_100122132 | 134 |
| 124 | 3300014326 | Ga0157380_10193539 | Ga0157380_101935392 | 134 |
| 125 | 3300014326 | Ga0157380_10470117 | Ga0157380_104701172 | 134 |
| 126 | 3300014969 | Ga0157376_10573489 | Ga0157376_105734892 | 134 |
| 127 | 3300025893 | Ga0207682_10054946 | Ga0207682_100549462 | 134 |
| 128 | 3300025899 | Ga0207642_10027565 | Ga0207642_100275654 | 134 |
| 129 | 3300025907 | Ga0207645_10012089 | Ga0207645_100120892 | 134 |
| 130 | 3300025908 | Ga0207643_10008512 | Ga0207643_100085124 | 134 |
| 131 | 3300025923 | Ga0207681_10156446 | Ga0207681_101564462 | 134 |
| 132 | 3300025923 | Ga0207681_10219731 | Ga0207681_102197312 | 134 |
| 133 | 3300025925 | Ga0207650_10169500 | Ga0207650_101695002 | 134 |
| 134 | 3300025926 | Ga0207659_10020702 | Ga0207659_100207024 | 134 |
| 135 | 3300025926 | Ga0207659_10084112 | Ga0207659_100841122 | 134 |
| 136 | 3300025926 | Ga0207659_10969471 | Ga0207659_109694712 | 134 |
| 137 | 3300025931 | Ga0207644_10023063 | Ga0207644_100230633 | 134 |
| 138 | 3300025931 | Ga0207644_10214290 | Ga0207644_102142902 | 134 |
| 139 | 3300025933 | Ga0207706_10137157 | Ga0207706_101371573 | 134 |
| 140 | 3300025934 | Ga0207686_10065287 | Ga0207686_100652872 | 134 |
| 141 | 3300025935 | Ga0207709_10006480 | Ga0207709_100064802 | 134 |
| 142 | 3300025937 | Ga0207669_10757789 | Ga0207669_107577892 | 134 |
| 143 | 3300025937 | Ga0207669_11253302 | Ga0207669_112533022 | 134 |
| 144 | 3300025940 | Ga0207691_10063098 | Ga0207691_100630983 | 134 |
| 145 | 3300025941 | Ga0207711_10508680 | Ga0207711_105086802 | 134 |
| 146 | 3300025942 | Ga0207689_10001069 | Ga0207689_1000106918 | 134 |
| 147 | 3300025945 | Ga0207679_10021882 | Ga0207679_100218824 | 134 |
| 148 | 3300025960 | Ga0207651_10012062 | Ga0207651_100120622 | 134 |
| 149 | 3300025986 | Ga0207658_11036730 | Ga0207658_110367302 | 134 |
| 150 | 3300026041 | Ga0207639_12213150 | Ga0207639_122131501 | 134 |
| 151 | 3300026075 | Ga0207708_10003724 | Ga0207708_1000372410 | 134 |
| 152 | 3300026088 | Ga0207641_10309673 | Ga0207641_103096731 | 134 |
| 153 | 3300026089 | Ga0207648_10000144 | Ga0207648_1000014418 | 134 |
| 154 | 3300026095 | Ga0207676_10685681 | Ga0207676_106856812 | 134 |
| 155 | 3300026116 | Ga0207674_10773236 | Ga0207674_107732362 | 134 |
| 156 | 3300026118 | Ga0207675_100188058 | Ga0207675_1001880581 | 134 |
| 157 | 3300026121 | Ga0207683_10184875 | Ga0207683_101848752 | 134 |
| 158 | 3300026121 | Ga0207683_10571601 | Ga0207683_105716012 | 134 |
| 159 | 3300027907 | Ga0207428_10537066 | Ga0207428_105370661 | 134 |
| 160 | 3300028380 | Ga0268265_11754080 | Ga0268265_117540801 | 134 |
| 161 | 3300035725 | Ga0373947_0140107 | Ga0373947_0140107_342_752 | 134 |
| 162 | 3300035725 | Ga0373947_0392198 | Ga0373947_0392198_268_681 | 134 |
| 163 | 3300037068 | Ga0373925_0345256 | Ga0373925_0345256_232_654 | 134 |
| 164 | 3300041408 | Ga0439453_0102205 | Ga0439453_0102205_176_592 | 134 |
| 165 | 3300042435 | Ga0439434_0188127 | Ga0439434_0188127_268_681 | 134 |
| 166 | 3300046472 | Ga0495580_0011821 | Ga0495580_0011821_112_525 | 134 |
| 167 | 3300046531 | Ga0495665_0435234 | Ga0495665_0435234_51_464 | 134 |
| 168 | 3300046615 | Ga0495656_0294992 | Ga0495656_0294992_144_557 | 134 |
| 169 | 3300049575 | Ga0501039_1217611 | Ga0501039_1217611_11_415 | 134 |
| 170 | 3300050511 | nmdc:mga08y16_232851_c1 | nmdc:mga08y16_232851_c1_1134_1538 | 134 |
| 171 | 3300054114 | Ga0501084_0818812 | Ga0501084_0818812_305_709 | 134 |
| 172 | 3300005328 | Ga0070676_10448111 | Ga0070676_104481112 | 135 |
| 173 | 3300005340 | Ga0070689_100486255 | Ga0070689_1004862551 | 135 |
| 174 | 3300005344 | Ga0070661_101390405 | Ga0070661_1013904052 | 135 |
| 175 | 3300005347 | Ga0070668_100205989 | Ga0070668_1002059892 | 135 |
| 176 | 3300005347 | Ga0070668_101509747 | Ga0070668_1015097471 | 135 |
| 177 | 3300005354 | Ga0070675_100002427 | Ga0070675_1000024273 | 135 |
| 178 | 3300005355 | Ga0070671_100412497 | Ga0070671_1004124972 | 135 |
| 179 | 3300005356 | Ga0070674_100008366 | Ga0070674_1000083666 | 135 |
| 180 | 3300005356 | Ga0070674_100962441 | Ga0070674_1009624412 | 135 |
| 181 | 3300005356 | Ga0070674_101670553 | Ga0070674_1016705531 | 135 |
| 182 | 3300005365 | Ga0070688_100284249 | Ga0070688_1002842492 | 135 |
| 183 | 3300005434 | Ga0070709_10697928 | Ga0070709_106979282 | 135 |
| 184 | 3300005435 | Ga0070714_100006277 | Ga0070714_1000062777 | 135 |
| 185 | 3300005436 | Ga0070713_100001089 | Ga0070713_1000010898 | 135 |
| 186 | 3300005439 | Ga0070711_100030198 | Ga0070711_1000301984 | 135 |
| 187 | 3300005439 | Ga0070711_100763122 | Ga0070711_1007631222 | 135 |
| 188 | 3300005445 | Ga0070708_100585494 | Ga0070708_1005854942 | 135 |
| 189 | 3300005455 | Ga0070663_100602495 | Ga0070663_1006024952 | 135 |
| 190 | 3300005457 | Ga0070662_100366535 | Ga0070662_1003665351 | 135 |
| 191 | 3300005459 | Ga0068867_100471483 | Ga0068867_1004714832 | 135 |
| 192 | 3300005539 | Ga0068853_101925889 | Ga0068853_1019258891 | 135 |
| 193 | 3300005543 | Ga0070672_100199416 | Ga0070672_1001994162 | 135 |
| 194 | 3300005543 | Ga0070672_100314422 | Ga0070672_1003144222 | 135 |
| 195 | 3300005548 | Ga0070665_101268475 | Ga0070665_1012684752 | 135 |
| 196 | 3300005617 | Ga0068859_101403914 | Ga0068859_1014039142 | 135 |
| 197 | 3300005618 | Ga0068864_100262786 | Ga0068864_1002627862 | 135 |
| 198 | 3300005840 | Ga0068870_10313683 | Ga0068870_103136831 | 135 |
| 199 | 3300005841 | Ga0068863_100052741 | Ga0068863_1000527415 | 135 |
| 200 | 3300005842 | Ga0068858_100336001 | Ga0068858_1003360012 | 135 |
| 201 | 3300005844 | Ga0068862_100118584 | Ga0068862_1001185842 | 135 |
| 202 | 3300006028 | Ga0070717_10008001 | Ga0070717_100080014 | 135 |
| 203 | 3300006173 | Ga0070716_100142241 | Ga0070716_1001422412 | 135 |
| 204 | 3300006173 | Ga0070716_100257184 | Ga0070716_1002571841 | 135 |
| 205 | 3300006237 | Ga0097621_100065519 | Ga0097621_1000655194 | 135 |
| 206 | 3300006931 | Ga0097620_101403901 | Ga0097620_1014039012 | 135 |
| 207 | 3300007265 | Ga0099794_10029184 | Ga0099794_100291841 | 135 |
| 208 | 3300009177 | Ga0105248_10353015 | Ga0105248_103530152 | 135 |
| 209 | 3300013308 | Ga0157375_10706593 | Ga0157375_107065932 | 135 |
| 210 | 3300014325 | Ga0163163_12027724 | Ga0163163_120277242 | 135 |
| 211 | 3300014326 | Ga0157380_10054889 | Ga0157380_100548896 | 135 |
| 212 | 3300017792 | Ga0163161_10222906 | Ga0163161_102229062 | 135 |
| 213 | 3300025906 | Ga0207699_10403318 | Ga0207699_104033182 | 135 |
| 214 | 3300025908 | Ga0207643_10180727 | Ga0207643_101807272 | 135 |
| 215 | 3300025915 | Ga0207693_10138989 | Ga0207693_101389893 | 135 |
| 216 | 3300025916 | Ga0207663_10101275 | Ga0207663_101012752 | 135 |
| 217 | 3300025926 | Ga0207659_10008078 | Ga0207659_100080786 | 135 |
| 218 | 3300025928 | Ga0207700_10003418 | Ga0207700_100034188 | 135 |
| 219 | 3300025929 | Ga0207664_10123930 | Ga0207664_101239304 | 135 |
| 220 | 3300025931 | Ga0207644_10356650 | Ga0207644_103566502 | 135 |
| 221 | 3300025933 | Ga0207706_10234833 | Ga0207706_102348332 | 135 |
| 222 | 3300025936 | Ga0207670_10408426 | Ga0207670_104084261 | 135 |
| 223 | 3300025939 | Ga0207665_10159792 | Ga0207665_101597923 | 135 |
| 224 | 3300025940 | Ga0207691_10145578 | Ga0207691_101455784 | 135 |
| 225 | 3300025940 | Ga0207691_10483483 | Ga0207691_104834833 | 135 |
| 226 | 3300025941 | Ga0207711_10200732 | Ga0207711_102007322 | 135 |
| 227 | 3300025960 | Ga0207651_10632920 | Ga0207651_106329202 | 135 |
| 228 | 3300025972 | Ga0207668_10111199 | Ga0207668_101111994 | 135 |
| 229 | 3300025972 | Ga0207668_11175777 | Ga0207668_111757772 | 135 |
| 230 | 3300026067 | Ga0207678_10566822 | Ga0207678_105668222 | 135 |
| 231 | 3300026088 | Ga0207641_10026606 | Ga0207641_100266066 | 135 |
| 232 | 3300026089 | Ga0207648_10464668 | Ga0207648_104646682 | 135 |
| 233 | 3300026118 | Ga0207675_100434274 | Ga0207675_1004342742 | 135 |
| 234 | 3300027671 | Ga0209588_1089989 | Ga0209588_10899891 | 135 |
| 235 | 3300028379 | Ga0268266_11065712 | Ga0268266_110657122 | 135 |
| 236 | 3300028380 | Ga0268265_10263578 | Ga0268265_102635781 | 135 |
| 237 | 3300035083 | Ga0373926_0014533 | Ga0373926_0014533_472_885 | 135 |
| 238 | 3300035170 | Ga0373943_0023444 | Ga0373943_0023444_587_1000 | 135 |
| 239 | 3300035695 | Ga0373927_0002388 | Ga0373927_0002388_11522_11935 | 135 |
| 240 | 3300035725 | Ga0373947_0002666 | Ga0373947_0002666_7753_8166 | 135 |
| 241 | 3300037068 | Ga0373925_0000143 | Ga0373925_0000143_72428_72841 | 135 |
| 242 | 3300041463 | Ga0451804_0268028 | Ga0451804_0268028_97_507 | 135 |
| 243 | 3300046535 | Ga0495586_0077918 | Ga0495586_0077918_517_930 | 135 |
| 244 | 3300048907 | Ga0496104_0210665 | Ga0496104_0210665_397_810 | 135 |
| 245 | 3300048917 | Ga0496114_0543142 | Ga0496114_0543142_386_799 | 135 |
| 246 | 3300049742 | Ga0501080_1061816 | Ga0501080_1061816_140_547 | 135 |
| 247 | 3300050511 | nmdc:mga08y16_503107_c1 | nmdc:mga08y16_503107_c1_811_1218 | 135 |
| 248 | 3300050514 | nmdc:mga08x19_278354_c1 | nmdc:mga08x19_278354_c1_630_1043 | 135 |
| 249 | 3300054114 | Ga0501084_0551773 | Ga0501084_0551773_235_642 | 135 |
| 250 | 3300005290 | Ga0065712_10068024 | Ga0065712_1006802411 | 136 |
| 251 | 3300005334 | Ga0068869_100369038 | Ga0068869_1003690382 | 136 |
| 252 | 3300005340 | Ga0070689_100084397 | Ga0070689_1000843973 | 136 |
| 253 | 3300005354 | Ga0070675_100006488 | Ga0070675_1000064882 | 136 |
| 254 | 3300005437 | Ga0070710_10409248 | Ga0070710_104092481 | 136 |
| 255 | 3300005466 | Ga0070685_10340581 | Ga0070685_103405812 | 136 |
| 256 | 3300005564 | Ga0070664_100313440 | Ga0070664_1003134403 | 136 |
| 257 | 3300005617 | Ga0068859_100029033 | Ga0068859_1000290333 | 136 |
| 258 | 3300005841 | Ga0068863_100810502 | Ga0068863_1008105022 | 136 |
| 259 | 3300006852 | Ga0075433_10051543 | Ga0075433_100515433 | 136 |
| 260 | 3300006871 | Ga0075434_100086271 | Ga0075434_1000862712 | 136 |
| 261 | 3300006931 | Ga0097620_100029033 | Ga0097620_1000290333 | 136 |
| 262 | 3300009147 | Ga0114129_11112217 | Ga0114129_111122172 | 136 |
| 263 | 3300010159 | Ga0099796_10291993 | Ga0099796_102919931 | 136 |
| 264 | 3300013306 | Ga0163162_10682927 | Ga0163162_106829271 | 136 |
| 265 | 3300014326 | Ga0157380_10318601 | Ga0157380_103186012 | 136 |
| 266 | 3300014745 | Ga0157377_10016086 | Ga0157377_100160863 | 136 |
| 267 | 3300025901 | Ga0207688_10248161 | Ga0207688_102481613 | 136 |
| 268 | 3300025901 | Ga0207688_11020213 | Ga0207688_110202131 | 136 |
| 269 | 3300025936 | Ga0207670_10080284 | Ga0207670_100802843 | 136 |
| 270 | 3300025945 | Ga0207679_10220677 | Ga0207679_102206773 | 136 |
| 271 | 3300048916 | Ga0496113_0085577 | Ga0496113_0085577_1373_1792 | 136 |
| 272 | 3300050507 | nmdc:mga05p37_967463_c1 | nmdc:mga05p37_967463_c1_376_795 | 136 |
| 273 | 3300050511 | nmdc:mga08y16_207037_c1 | nmdc:mga08y16_207037_c1_273_692 | 136 |
| 274 | 3300050512 | nmdc:mga0n895_201838_c1 | nmdc:mga0n895_201838_c1_528_947 | 136 |
| 275 | 3300005328 | Ga0070676_11174988 | Ga0070676_111749881 | 137 |
| 276 | 3300005843 | Ga0068860_100336732 | Ga0068860_1003367322 | 137 |
| 277 | 3300009551 | Ga0105238_11571696 | Ga0105238_115716962 | 137 |
| 278 | 3300028379 | Ga0268266_10015337 | Ga0268266_100153374 | 137 |
| 279 | 3300028381 | Ga0268264_10417955 | Ga0268264_104179552 | 137 |
| 280 | 3300037068 | Ga0373925_1559459 | Ga0373925_1559459_33_446 | 137 |
| 281 | 3300046474 | Ga0495605_0365963 | Ga0495605_0365963_102_518 | 137 |
| 282 | 3300046492 | Ga0495585_0546136 | Ga0495585_0546136_59_475 | 137 |
| 283 | 3300050507 | nmdc:mga05p37_339747_c1 | nmdc:mga05p37_339747_c1_100_513 | 137 |
| 284 | 3300050513 | nmdc:mga0rr50_210315_c1 | nmdc:mga0rr50_210315_c1_56_469 | 137 |
| 285 | 3300050514 | nmdc:mga08x19_373327_c1 | nmdc:mga08x19_373327_c1_335_748 | 137 |
| 286 | 3300050515 | nmdc:mga0a205_928371_c1 | nmdc:mga0a205_928371_c1_217_636 | 137 |
| 287 | 3300005336 | Ga0070680_100438756 | Ga0070680_1004387561 | 138 |
| 288 | 3300005353 | Ga0070669_101382842 | Ga0070669_1013828421 | 138 |
| 289 | 3300005444 | Ga0070694_100029352 | Ga0070694_1000293522 | 138 |
| 290 | 3300005444 | Ga0070694_100281438 | Ga0070694_1002814382 | 138 |
| 291 | 3300005468 | Ga0070707_100782439 | Ga0070707_1007824392 | 138 |
| 292 | 3300005471 | Ga0070698_100001553 | Ga0070698_10000155316 | 138 |
| 293 | 3300005471 | Ga0070698_100518941 | Ga0070698_1005189411 | 138 |
| 294 | 3300005471 | Ga0070698_101502185 | Ga0070698_1015021851 | 138 |
| 295 | 3300005518 | Ga0070699_100000567 | Ga0070699_10000056726 | 138 |
| 296 | 3300005536 | Ga0070697_100114816 | Ga0070697_1001148162 | 138 |
| 297 | 3300005536 | Ga0070697_101925381 | Ga0070697_1019253811 | 138 |
| 298 | 3300005546 | Ga0070696_100073242 | Ga0070696_1000732422 | 138 |
| 299 | 3300005546 | Ga0070696_100433849 | Ga0070696_1004338492 | 138 |
| 300 | 3300005549 | Ga0070704_100010762 | Ga0070704_1000107623 | 138 |
| 301 | 3300005719 | Ga0068861_101167301 | Ga0068861_1011673012 | 138 |
| 302 | 3300005842 | Ga0068858_100008740 | Ga0068858_1000087405 | 138 |
| 303 | 3300006237 | Ga0097621_100535913 | Ga0097621_1005359133 | 138 |
| 304 | 3300006844 | Ga0075428_100379377 | Ga0075428_1003793772 | 138 |
| 305 | 3300006852 | Ga0075433_10000616 | Ga0075433_100006166 | 138 |
| 306 | 3300006871 | Ga0075434_100000950 | Ga0075434_1000009509 | 138 |
| 307 | 3300006880 | Ga0075429_100187792 | Ga0075429_1001877922 | 138 |
| 308 | 3300007076 | Ga0075435_100004577 | Ga0075435_1000045779 | 138 |
| 309 | 3300009094 | Ga0111539_10014413 | Ga0111539_100144133 | 138 |
| 310 | 3300009147 | Ga0114129_10014347 | Ga0114129_1001434710 | 138 |
| 311 | 3300009147 | Ga0114129_10021698 | Ga0114129_100216988 | 138 |
| 312 | 3300009147 | Ga0114129_11674873 | Ga0114129_116748732 | 138 |
| 313 | 3300009147 | Ga0114129_12056535 | Ga0114129_120565352 | 138 |
| 314 | 3300009148 | Ga0105243_10542055 | Ga0105243_105420552 | 138 |
| 315 | 3300014326 | Ga0157380_10398774 | Ga0157380_103987742 | 138 |
| 316 | 3300025917 | Ga0207660_10298477 | Ga0207660_102984772 | 138 |
| 317 | 3300025923 | Ga0207681_10259349 | Ga0207681_102593492 | 138 |
| 318 | 3300025935 | Ga0207709_10622979 | Ga0207709_106229791 | 138 |
| 319 | 3300025942 | Ga0207689_11058466 | Ga0207689_110584662 | 138 |
| 320 | 3300026118 | Ga0207675_101391273 | Ga0207675_1013912732 | 138 |
| 321 | 3300032005 | Ga0307411_10496295 | Ga0307411_104962952 | 138 |
| 322 | 3300039453 | Ga0436362_1282180 | Ga0436362_1282180_605_1021 | 138 |
| 323 | 3300042125 | Ga0450923_070569 | Ga0450923_070569_131_559 | 138 |
| 324 | 3300046537 | Ga0495598_0010836 | Ga0495598_0010836_1599_2024 | 138 |
| 325 | 3300046664 | Ga0495659_0028645 | Ga0495659_0028645_1065_1490 | 138 |
| 326 | 3300049572 | Ga0501036_0015546 | Ga0501036_0015546_2422_2838 | 138 |
| 327 | 3300049591 | Ga0501075_0177902 | Ga0501075_0177902_95_523 | 138 |
| 328 | 3300049591 | Ga0501075_1114980 | Ga0501075_1114980_56_487 | 138 |
| 329 | 3300049741 | Ga0501079_1550035 | Ga0501079_1550035_51_479 | 138 |
| 330 | 3300050507 | nmdc:mga05p37_1321194_c1 | nmdc:mga05p37_1321194_c1_164_592 | 138 |
| 331 | 3300050507 | nmdc:mga05p37_182714_c1 | nmdc:mga05p37_182714_c1_15_431 | 138 |
| 332 | 3300050507 | nmdc:mga05p37_263869_c1 | nmdc:mga05p37_263869_c1_1301_1717 | 138 |
| 333 | 3300050508 | nmdc:mga09592_223441_c1 | nmdc:mga09592_223441_c1_224_640 | 138 |
| 334 | 3300050508 | nmdc:mga09592_61465_c1 | nmdc:mga09592_61465_c1_2405_2821 | 138 |
| 335 | 3300050509 | nmdc:mga0qj67_119828_c1 | nmdc:mga0qj67_119828_c1_237_653 | 138 |
| 336 | 3300050509 | nmdc:mga0qj67_207300_c1 | nmdc:mga0qj67_207300_c1_443_913 | 138 |
| 337 | 3300050511 | nmdc:mga08y16_12159_c1 | nmdc:mga08y16_12159_c1_8524_8940 | 138 |
| 338 | 3300004798 | Ga0058859_11236937 | Ga0058859_112369371 | 139 |
| 339 | 3300005340 | Ga0070689_101751131 | Ga0070689_1017511311 | 139 |
| 340 | 3300005345 | Ga0070692_10578511 | Ga0070692_105785111 | 139 |
| 341 | 3300005354 | Ga0070675_100020169 | Ga0070675_1000201694 | 139 |
| 342 | 3300005356 | Ga0070674_100028325 | Ga0070674_1000283251 | 139 |
| 343 | 3300005444 | Ga0070694_100221530 | Ga0070694_1002215302 | 139 |
| 344 | 3300005445 | Ga0070708_100059084 | Ga0070708_1000590842 | 139 |
| 345 | 3300005458 | Ga0070681_11464175 | Ga0070681_114641751 | 139 |
| 346 | 3300005459 | Ga0068867_100100152 | Ga0068867_1001001523 | 139 |
| 347 | 3300005468 | Ga0070707_100015672 | Ga0070707_1000156723 | 139 |
| 348 | 3300005546 | Ga0070696_101495916 | Ga0070696_1014959161 | 139 |
| 349 | 3300005577 | Ga0068857_100626726 | Ga0068857_1006267262 | 139 |
| 350 | 3300005617 | Ga0068859_100064345 | Ga0068859_1000643453 | 139 |
| 351 | 3300005618 | Ga0068864_100430938 | Ga0068864_1004309382 | 139 |
| 352 | 3300006358 | Ga0068871_100114530 | Ga0068871_1001145303 | 139 |
| 353 | 3300006846 | Ga0075430_100010183 | Ga0075430_1000101835 | 139 |
| 354 | 3300006846 | Ga0075430_100035401 | Ga0075430_1000354016 | 139 |
| 355 | 3300006846 | Ga0075430_100268119 | Ga0075430_1002681192 | 139 |
| 356 | 3300006846 | Ga0075430_100342591 | Ga0075430_1003425912 | 139 |
| 357 | 3300006847 | Ga0075431_100021013 | Ga0075431_1000210135 | 139 |
| 358 | 3300006847 | Ga0075431_100114967 | Ga0075431_1001149672 | 139 |
| 359 | 3300006852 | Ga0075433_10387116 | Ga0075433_103871162 | 139 |
| 360 | 3300006871 | Ga0075434_100007177 | Ga0075434_1000071773 | 139 |
| 361 | 3300006880 | Ga0075429_100180591 | Ga0075429_1001805912 | 139 |
| 362 | 3300006880 | Ga0075429_100277802 | Ga0075429_1002778022 | 139 |
| 363 | 3300006914 | Ga0075436_100274172 | Ga0075436_1002741722 | 139 |
| 364 | 3300006931 | Ga0097620_100064346 | Ga0097620_1000643463 | 139 |
| 365 | 3300007076 | Ga0075435_100621010 | Ga0075435_1006210102 | 139 |
| 366 | 3300009094 | Ga0111539_10013990 | Ga0111539_100139905 | 139 |
| 367 | 3300009094 | Ga0111539_10160393 | Ga0111539_101603934 | 139 |
| 368 | 3300009101 | Ga0105247_10183276 | Ga0105247_101832762 | 139 |
| 369 | 3300009147 | Ga0114129_11865571 | Ga0114129_118655712 | 139 |
| 370 | 3300009147 | Ga0114129_12411585 | Ga0114129_124115851 | 139 |
| 371 | 3300009147 | Ga0114129_12546883 | Ga0114129_125468832 | 139 |
| 372 | 3300011119 | Ga0105246_11405743 | Ga0105246_114057432 | 139 |
| 373 | 3300014325 | Ga0163163_10008085 | Ga0163163_100080854 | 139 |
| 374 | 3300025893 | Ga0207682_10116478 | Ga0207682_101164783 | 139 |
| 375 | 3300025903 | Ga0207680_10148511 | Ga0207680_101485112 | 139 |
| 376 | 3300025903 | Ga0207680_10602821 | Ga0207680_106028212 | 139 |
| 377 | 3300025907 | Ga0207645_10936653 | Ga0207645_109366531 | 139 |
| 378 | 3300025912 | Ga0207707_10566181 | Ga0207707_105661812 | 139 |
| 379 | 3300025922 | Ga0207646_10017561 | Ga0207646_100175613 | 139 |
| 380 | 3300025926 | Ga0207659_10007393 | Ga0207659_100073936 | 139 |
| 381 | 3300026023 | Ga0207677_11949181 | Ga0207677_119491812 | 139 |
| 382 | 3300026095 | Ga0207676_10167195 | Ga0207676_101671952 | 139 |
| 383 | 3300026116 | Ga0207674_10208078 | Ga0207674_102080782 | 139 |
| 384 | 3300026118 | Ga0207675_101987432 | Ga0207675_1019874322 | 139 |
| 385 | 3300026121 | Ga0207683_10164565 | Ga0207683_101645652 | 139 |
| 386 | 3300027717 | Ga0209998_10026186 | Ga0209998_100261862 | 139 |
| 387 | 3300027907 | Ga0207428_10002268 | Ga0207428_100022685 | 139 |
| 388 | 3300031911 | Ga0307412_10323481 | Ga0307412_103234811 | 139 |
| 389 | 3300032002 | Ga0307416_100544760 | Ga0307416_1005447602 | 139 |
| 390 | 3300049572 | Ga0501036_0043039 | Ga0501036_0043039_1327_1758 | 139 |
| 391 | 3300049575 | Ga0501039_0168201 | Ga0501039_0168201_1270_1701 | 139 |
| 392 | 3300049576 | Ga0501040_0012271 | Ga0501040_0012271_1916_2347 | 139 |
| 393 | 3300049577 | Ga0501041_0482548 | Ga0501041_0482548_39_470 | 139 |
| 394 | 3300049578 | Ga0501042_0001586 | Ga0501042_0001586_12972_13403 | 139 |
| 395 | 3300049578 | Ga0501042_0984645 | Ga0501042_0984645_64_495 | 139 |
| 396 | 3300049580 | Ga0501046_0235541 | Ga0501046_0235541_377_808 | 139 |
| 397 | 3300049582 | Ga0501048_0045174 | Ga0501048_0045174_493_924 | 139 |
| 398 | 3300049586 | Ga0501070_0295328 | Ga0501070_0295328_164_595 | 139 |
| 399 | 3300049588 | Ga0501072_0029045 | Ga0501072_0029045_3405_3836 | 139 |
| 400 | 3300049588 | Ga0501072_0905690 | Ga0501072_0905690_249_668 | 139 |
| 401 | 3300049590 | Ga0501074_0069889 | Ga0501074_0069889_1085_1516 | 139 |
| 402 | 3300049593 | Ga0501077_0482293 | Ga0501077_0482293_82_513 | 139 |
| 403 | 3300049741 | Ga0501079_0043815 | Ga0501079_0043815_3011_3442 | 139 |
| 404 | 3300049743 | Ga0501081_0482947 | Ga0501081_0482947_148_579 | 139 |
| 405 | 3300049824 | Ga0501045_0113015 | Ga0501045_0113015_248_679 | 139 |
| 406 | 3300050507 | nmdc:mga05p37_20113_c1 | nmdc:mga05p37_20113_c1_4056_4490 | 139 |
| 407 | 3300050508 | nmdc:mga09592_410769_c1 | nmdc:mga09592_410769_c1_719_1150 | 139 |
| 408 | 3300050508 | nmdc:mga09592_45067_c1 | nmdc:mga09592_45067_c1_1915_2349 | 139 |
| 409 | 3300050508 | nmdc:mga09592_898607_c1 | nmdc:mga09592_898607_c1_183_617 | 139 |
| 410 | 3300050509 | nmdc:mga0qj67_1147687_c1 | nmdc:mga0qj67_1147687_c1_78_512 | 139 |
| 411 | 3300050509 | nmdc:mga0qj67_127418_c1 | nmdc:mga0qj67_127418_c1_1227_1646 | 139 |
| 412 | 3300050509 | nmdc:mga0qj67_199896_c1 | nmdc:mga0qj67_199896_c1_460_891 | 139 |
| 413 | 3300050509 | nmdc:mga0qj67_74329_c1 | nmdc:mga0qj67_74329_c1_1083_1514 | 139 |
| 414 | 3300050510 | nmdc:mga06r32_102480_c1 | nmdc:mga06r32_102480_c1_1079_1510 | 139 |
| 415 | 3300050510 | nmdc:mga06r32_42494_c1 | nmdc:mga06r32_42494_c1_670_1101 | 139 |
| 416 | 3300050510 | nmdc:mga06r32_456738_c1 | nmdc:mga06r32_456738_c1_747_1166 | 139 |
| 417 | 3300050510 | nmdc:mga06r32_558096_c1 | nmdc:mga06r32_558096_c1_399_833 | 139 |
| 418 | 3300050510 | nmdc:mga06r32_648885_c1 | nmdc:mga06r32_648885_c1_191_625 | 139 |
| 419 | 3300050511 | nmdc:mga08y16_148435_c1 | nmdc:mga08y16_148435_c1_207_638 | 139 |
| 420 | 3300050511 | nmdc:mga08y16_6941_c1 | nmdc:mga08y16_6941_c1_9579_10013 | 139 |
| 421 | 3300054114 | Ga0501084_0010418 | Ga0501084_0010418_5255_5686 | 139 |
| 422 | 3300060353 | Ga0501082_0049473 | Ga0501082_0049473_1870_2301 | 139 |
| 423 | 3300005290 | Ga0065712_10373566 | Ga0065712_103735661 | 140 |
| 424 | 3300005293 | Ga0065715_10011502 | Ga0065715_100115021 | 140 |
| 425 | 3300005295 | Ga0065707_10004206 | Ga0065707_100042065 | 140 |
| 426 | 3300005295 | Ga0065707_10421871 | Ga0065707_104218712 | 140 |
| 427 | 3300005334 | Ga0068869_100523565 | Ga0068869_1005235652 | 140 |
| 428 | 3300005334 | Ga0068869_102054456 | Ga0068869_1020544561 | 140 |
| 429 | 3300005345 | Ga0070692_10189938 | Ga0070692_101899382 | 140 |
| 430 | 3300005354 | Ga0070675_100168290 | Ga0070675_1001682903 | 140 |
| 431 | 3300005438 | Ga0070701_11337489 | Ga0070701_113374891 | 140 |
| 432 | 3300005440 | Ga0070705_100002851 | Ga0070705_1000028512 | 140 |
| 433 | 3300005441 | Ga0070700_101055032 | Ga0070700_1010550321 | 140 |
| 434 | 3300005444 | Ga0070694_100001762 | Ga0070694_1000017627 | 140 |
| 435 | 3300005467 | Ga0070706_100939545 | Ga0070706_1009395452 | 140 |
| 436 | 3300005468 | Ga0070707_100157196 | Ga0070707_1001571962 | 140 |
| 437 | 3300005471 | Ga0070698_100144917 | Ga0070698_1001449173 | 140 |
| 438 | 3300005471 | Ga0070698_100486693 | Ga0070698_1004866932 | 140 |
| 439 | 3300005545 | Ga0070695_100000224 | Ga0070695_10000022414 | 140 |
| 440 | 3300005545 | Ga0070695_100152944 | Ga0070695_1001529442 | 140 |
| 441 | 3300005546 | Ga0070696_100129190 | Ga0070696_1001291902 | 140 |
| 442 | 3300005578 | Ga0068854_101272929 | Ga0068854_1012729292 | 140 |
| 443 | 3300005615 | Ga0070702_100068238 | Ga0070702_1000682382 | 140 |
| 444 | 3300005617 | Ga0068859_100002873 | Ga0068859_10000287316 | 140 |
| 445 | 3300005719 | Ga0068861_102282927 | Ga0068861_1022829271 | 140 |
| 446 | 3300006844 | Ga0075428_100018622 | Ga0075428_1000186228 | 140 |
| 447 | 3300006847 | Ga0075431_100776865 | Ga0075431_1007768652 | 140 |
| 448 | 3300006852 | Ga0075433_10551605 | Ga0075433_105516052 | 140 |
| 449 | 3300006880 | Ga0075429_100050986 | Ga0075429_1000509862 | 140 |
| 450 | 3300006931 | Ga0097620_100002872 | Ga0097620_1000028724 | 140 |
| 451 | 3300007076 | Ga0075435_100471944 | Ga0075435_1004719441 | 140 |
| 452 | 3300009094 | Ga0111539_10001555 | Ga0111539_1000155518 | 140 |
| 453 | 3300009148 | Ga0105243_10014126 | Ga0105243_100141265 | 140 |
| 454 | 3300009176 | Ga0105242_10278753 | Ga0105242_102787532 | 140 |
| 455 | 3300009553 | Ga0105249_11741905 | Ga0105249_117419052 | 140 |
| 456 | 3300025885 | Ga0207653_10070835 | Ga0207653_100708352 | 140 |
| 457 | 3300025908 | Ga0207643_10075341 | Ga0207643_100753413 | 140 |
| 458 | 3300025922 | Ga0207646_10236938 | Ga0207646_102369382 | 140 |
| 459 | 3300025923 | Ga0207681_10638965 | Ga0207681_106389652 | 140 |
| 460 | 3300025926 | Ga0207659_10141838 | Ga0207659_101418383 | 140 |
| 461 | 3300025934 | Ga0207686_10649522 | Ga0207686_106495222 | 140 |
| 462 | 3300025935 | Ga0207709_10372004 | Ga0207709_103720042 | 140 |
| 463 | 3300026075 | Ga0207708_10282953 | Ga0207708_102829532 | 140 |
| 464 | 3300027876 | Ga0209974_10228929 | Ga0209974_102289292 | 140 |
| 465 | 3300027907 | Ga0207428_10001961 | Ga0207428_100019616 | 140 |
| 466 | 3300027907 | Ga0207428_10139775 | Ga0207428_101397753 | 140 |
| 467 | 3300032002 | Ga0307416_101341763 | Ga0307416_1013417632 | 140 |
| 468 | 3300042438 | Ga0439459_0081592 | Ga0439459_0081592_58_480 | 140 |
| 469 | 3300046538 | Ga0495609_0128037 | Ga0495609_0128037_278_700 | 140 |
| 470 | 3300046538 | Ga0495609_0210896 | Ga0495609_0210896_72_494 | 140 |
| 471 | 3300046539 | Ga0495621_0090163 | Ga0495621_0090163_677_1099 | 140 |
| 472 | 3300046539 | Ga0495621_0107379 | Ga0495621_0107379_135_557 | 140 |
| 473 | 3300046615 | Ga0495656_0455625 | Ga0495656_0455625_14_436 | 140 |
| 474 | 3300046664 | Ga0495659_0003235 | Ga0495659_0003235_2506_2928 | 140 |
| 475 | 3300046664 | Ga0495659_0025672 | Ga0495659_0025672_111_533 | 140 |
| 476 | 3300046684 | Ga0495669_0055259 | Ga0495669_0055259_714_1136 | 140 |
| 477 | 3300046684 | Ga0495669_0363686 | Ga0495669_0363686_120_542 | 140 |
| 478 | 3300047318 | Ga0495636_0052349 | Ga0495636_0052349_400_822 | 140 |
| 479 | 3300047447 | Ga0495685_013084 | Ga0495685_013084_1307_1729 | 140 |
| 480 | 3300049570 | Ga0501033_0718541 | Ga0501033_0718541_57_479 | 140 |
| 481 | 3300050511 | nmdc:mga08y16_670_c1 | nmdc:mga08y16_670_c1_9629_10051 | 140 |
| 482 | 3300050513 | nmdc:mga0rr50_1117497_c1 | nmdc:mga0rr50_1117497_c1_22_444 | 140 |
| 483 | 3300050515 | nmdc:mga0a205_546922_c1 | nmdc:mga0a205_546922_c1_315_737 | 140 |
| 484 | 2162886007 | SwRhRL2b_contig_1258267 | SwRhRL2b_0160.00001890 | 141 |
| 485 | 3300004798 | Ga0058859_11334503 | Ga0058859_113345032 | 141 |
| 486 | 3300004801 | Ga0058860_12103558 | Ga0058860_121035581 | 141 |
| 487 | 3300005289 | Ga0065704_10012427 | Ga0065704_100124273 | 141 |
| 488 | 3300005289 | Ga0065704_10017203 | Ga0065704_100172032 | 141 |
| 489 | 3300005289 | Ga0065704_10090174 | Ga0065704_100901742 | 141 |
| 490 | 3300005290 | Ga0065712_10114113 | Ga0065712_101141132 | 141 |
| 491 | 3300005290 | Ga0065712_10310957 | Ga0065712_103109571 | 141 |
| 492 | 3300005293 | Ga0065715_10000766 | Ga0065715_100007667 | 141 |
| 493 | 3300005293 | Ga0065715_10113264 | Ga0065715_101132643 | 141 |
| 494 | 3300005295 | Ga0065707_10001773 | Ga0065707_100017732 | 141 |
| 495 | 3300005295 | Ga0065707_10088576 | Ga0065707_100885763 | 141 |
| 496 | 3300005295 | Ga0065707_10190209 | Ga0065707_101902092 | 141 |
| 497 | 3300005295 | Ga0065707_10222241 | Ga0065707_102222412 | 141 |
| 498 | 3300005295 | Ga0065707_10990295 | Ga0065707_109902951 | 141 |
| 499 | 3300005328 | Ga0070676_10002130 | Ga0070676_100021304 | 141 |
| 500 | 3300005328 | Ga0070676_10196921 | Ga0070676_101969212 | 141 |
| 501 | 3300005328 | Ga0070676_10277113 | Ga0070676_102771131 | 141 |
| 502 | 3300005328 | Ga0070676_10774466 | Ga0070676_107744662 | 141 |
| 503 | 3300005330 | Ga0070690_100006833 | Ga0070690_1000068332 | 141 |
| 504 | 3300005330 | Ga0070690_100035456 | Ga0070690_1000354562 | 141 |
| 505 | 3300005331 | Ga0070670_100006214 | Ga0070670_1000062144 | 141 |
| 506 | 3300005333 | Ga0070677_10004228 | Ga0070677_100042285 | 141 |
| 507 | 3300005334 | Ga0068869_100006944 | Ga0068869_1000069442 | 141 |
| 508 | 3300005334 | Ga0068869_100188677 | Ga0068869_1001886772 | 141 |
| 509 | 3300005334 | Ga0068869_101203171 | Ga0068869_1012031712 | 141 |
| 510 | 3300005334 | Ga0068869_101696026 | Ga0068869_1016960261 | 141 |
| 511 | 3300005335 | Ga0070666_10004014 | Ga0070666_100040142 | 141 |
| 512 | 3300005336 | Ga0070680_100266524 | Ga0070680_1002665242 | 141 |
| 513 | 3300005336 | Ga0070680_100754069 | Ga0070680_1007540692 | 141 |
| 514 | 3300005338 | Ga0068868_100122031 | Ga0068868_1001220312 | 141 |
| 515 | 3300005338 | Ga0068868_100219482 | Ga0068868_1002194822 | 141 |
| 516 | 3300005340 | Ga0070689_100007401 | Ga0070689_1000074013 | 141 |
| 517 | 3300005340 | Ga0070689_100009672 | Ga0070689_1000096724 | 141 |
| 518 | 3300005340 | Ga0070689_100013527 | Ga0070689_1000135275 | 141 |
| 519 | 3300005340 | Ga0070689_100317711 | Ga0070689_1003177112 | 141 |
| 520 | 3300005341 | Ga0070691_10883709 | Ga0070691_108837091 | 141 |
| 521 | 3300005343 | Ga0070687_100105926 | Ga0070687_1001059262 | 141 |
| 522 | 3300005343 | Ga0070687_100204337 | Ga0070687_1002043372 | 141 |
| 523 | 3300005344 | Ga0070661_100009957 | Ga0070661_1000099572 | 141 |
| 524 | 3300005345 | Ga0070692_10016485 | Ga0070692_100164853 | 141 |
| 525 | 3300005347 | Ga0070668_100045307 | Ga0070668_1000453075 | 141 |
| 526 | 3300005347 | Ga0070668_100072618 | Ga0070668_1000726182 | 141 |
| 527 | 3300005353 | Ga0070669_100011599 | Ga0070669_1000115996 | 141 |
| 528 | 3300005353 | Ga0070669_100014609 | Ga0070669_1000146095 | 141 |
| 529 | 3300005353 | Ga0070669_100468997 | Ga0070669_1004689971 | 141 |
| 530 | 3300005353 | Ga0070669_100716712 | Ga0070669_1007167121 | 141 |
| 531 | 3300005354 | Ga0070675_100004043 | Ga0070675_1000040439 | 141 |
| 532 | 3300005354 | Ga0070675_100098495 | Ga0070675_1000984953 | 141 |
| 533 | 3300005354 | Ga0070675_100158624 | Ga0070675_1001586242 | 141 |
| 534 | 3300005354 | Ga0070675_100492599 | Ga0070675_1004925992 | 141 |
| 535 | 3300005355 | Ga0070671_100008742 | Ga0070671_1000087429 | 141 |
| 536 | 3300005355 | Ga0070671_100052868 | Ga0070671_1000528682 | 141 |
| 537 | 3300005355 | Ga0070671_101463564 | Ga0070671_1014635642 | 141 |
| 538 | 3300005356 | Ga0070674_100912380 | Ga0070674_1009123802 | 141 |
| 539 | 3300005364 | Ga0070673_100072817 | Ga0070673_1000728173 | 141 |
| 540 | 3300005364 | Ga0070673_100268772 | Ga0070673_1002687722 | 141 |
| 541 | 3300005364 | Ga0070673_100663185 | Ga0070673_1006631852 | 141 |
| 542 | 3300005365 | Ga0070688_100004251 | Ga0070688_1000042512 | 141 |
| 543 | 3300005365 | Ga0070688_100030597 | Ga0070688_1000305972 | 141 |
| 544 | 3300005365 | Ga0070688_100577600 | Ga0070688_1005776002 | 141 |
| 545 | 3300005366 | Ga0070659_100821726 | Ga0070659_1008217261 | 141 |
| 546 | 3300005366 | Ga0070659_101199680 | Ga0070659_1011996802 | 141 |
| 547 | 3300005367 | Ga0070667_100021283 | Ga0070667_1000212835 | 141 |
| 548 | 3300005438 | Ga0070701_10007994 | Ga0070701_100079943 | 141 |
| 549 | 3300005438 | Ga0070701_10011952 | Ga0070701_100119521 | 141 |
| 550 | 3300005438 | Ga0070701_10052800 | Ga0070701_100528002 | 141 |
| 551 | 3300005440 | Ga0070705_100011812 | Ga0070705_1000118123 | 141 |
| 552 | 3300005440 | Ga0070705_100065077 | Ga0070705_1000650772 | 141 |
| 553 | 3300005441 | Ga0070700_100008474 | Ga0070700_1000084743 | 141 |
| 554 | 3300005441 | Ga0070700_100075791 | Ga0070700_1000757913 | 141 |
| 555 | 3300005441 | Ga0070700_100109781 | Ga0070700_1001097812 | 141 |
| 556 | 3300005441 | Ga0070700_100572546 | Ga0070700_1005725461 | 141 |
| 557 | 3300005441 | Ga0070700_100591406 | Ga0070700_1005914061 | 141 |
| 558 | 3300005444 | Ga0070694_100005154 | Ga0070694_1000051544 | 141 |
| 559 | 3300005444 | Ga0070694_100222347 | Ga0070694_1002223471 | 141 |
| 560 | 3300005444 | Ga0070694_100260206 | Ga0070694_1002602062 | 141 |
| 561 | 3300005444 | Ga0070694_100613499 | Ga0070694_1006134991 | 141 |
| 562 | 3300005444 | Ga0070694_100756998 | Ga0070694_1007569981 | 141 |
| 563 | 3300005455 | Ga0070663_100467382 | Ga0070663_1004673821 | 141 |
| 564 | 3300005456 | Ga0070678_100094772 | Ga0070678_1000947722 | 141 |
| 565 | 3300005457 | Ga0070662_100046881 | Ga0070662_1000468813 | 141 |
| 566 | 3300005457 | Ga0070662_100061885 | Ga0070662_1000618851 | 141 |
| 567 | 3300005457 | Ga0070662_100363014 | Ga0070662_1003630141 | 141 |
| 568 | 3300005459 | Ga0068867_100002574 | Ga0068867_10000257411 | 141 |
| 569 | 3300005459 | Ga0068867_101561603 | Ga0068867_1015616031 | 141 |
| 570 | 3300005466 | Ga0070685_10004167 | Ga0070685_100041676 | 141 |
| 571 | 3300005466 | Ga0070685_10059731 | Ga0070685_100597312 | 141 |
| 572 | 3300005468 | Ga0070707_100071294 | Ga0070707_1000712942 | 141 |
| 573 | 3300005468 | Ga0070707_100755647 | Ga0070707_1007556471 | 141 |
| 574 | 3300005471 | Ga0070698_100003210 | Ga0070698_1000032104 | 141 |
| 575 | 3300005471 | Ga0070698_101141623 | Ga0070698_1011416232 | 141 |
| 576 | 3300005518 | Ga0070699_100014400 | Ga0070699_1000144004 | 141 |
| 577 | 3300005518 | Ga0070699_100094291 | Ga0070699_1000942912 | 141 |
| 578 | 3300005518 | Ga0070699_100946025 | Ga0070699_1009460252 | 141 |
| 579 | 3300005530 | Ga0070679_101787458 | Ga0070679_1017874581 | 141 |
| 580 | 3300005535 | Ga0070684_100162112 | Ga0070684_1001621122 | 141 |
| 581 | 3300005536 | Ga0070697_100072873 | Ga0070697_1000728732 | 141 |
| 582 | 3300005536 | Ga0070697_100208335 | Ga0070697_1002083352 | 141 |
| 583 | 3300005543 | Ga0070672_100059499 | Ga0070672_1000594993 | 141 |
| 584 | 3300005543 | Ga0070672_100075045 | Ga0070672_1000750452 | 141 |
| 585 | 3300005543 | Ga0070672_100506553 | Ga0070672_1005065532 | 141 |
| 586 | 3300005544 | Ga0070686_100008216 | Ga0070686_1000082165 | 141 |
| 587 | 3300005544 | Ga0070686_100488134 | Ga0070686_1004881342 | 141 |
| 588 | 3300005546 | Ga0070696_100005480 | Ga0070696_1000054805 | 141 |
| 589 | 3300005546 | Ga0070696_100043739 | Ga0070696_1000437392 | 141 |
| 590 | 3300005549 | Ga0070704_100002482 | Ga0070704_1000024829 | 141 |
| 591 | 3300005549 | Ga0070704_100030713 | Ga0070704_1000307133 | 141 |
| 592 | 3300005549 | Ga0070704_100097976 | Ga0070704_1000979763 | 141 |
| 593 | 3300005549 | Ga0070704_100173574 | Ga0070704_1001735742 | 141 |
| 594 | 3300005564 | Ga0070664_100005747 | Ga0070664_1000057474 | 141 |
| 595 | 3300005564 | Ga0070664_100221993 | Ga0070664_1002219932 | 141 |
| 596 | 3300005564 | Ga0070664_100228242 | Ga0070664_1002282422 | 141 |
| 597 | 3300005578 | Ga0068854_100368821 | Ga0068854_1003688212 | 141 |
| 598 | 3300005615 | Ga0070702_100042808 | Ga0070702_1000428082 | 141 |
| 599 | 3300005615 | Ga0070702_100080722 | Ga0070702_1000807222 | 141 |
| 600 | 3300005616 | Ga0068852_100115953 | Ga0068852_1001159533 | 141 |
| 601 | 3300005617 | Ga0068859_100003933 | Ga0068859_10000393314 | 141 |
| 602 | 3300005617 | Ga0068859_100022071 | Ga0068859_1000220715 | 141 |
| 603 | 3300005617 | Ga0068859_100134284 | Ga0068859_1001342842 | 141 |
| 604 | 3300005617 | Ga0068859_100925841 | Ga0068859_1009258411 | 141 |
| 605 | 3300005618 | Ga0068864_100029090 | Ga0068864_1000290904 | 141 |
| 606 | 3300005618 | Ga0068864_100051552 | Ga0068864_1000515522 | 141 |
| 607 | 3300005618 | Ga0068864_100244655 | Ga0068864_1002446552 | 141 |
| 608 | 3300005719 | Ga0068861_100005161 | Ga0068861_1000051612 | 141 |
| 609 | 3300005719 | Ga0068861_100017323 | Ga0068861_1000173234 | 141 |
| 610 | 3300005840 | Ga0068870_10000872 | Ga0068870_100008725 | 141 |
| 611 | 3300005840 | Ga0068870_10004262 | Ga0068870_100042625 | 141 |
| 612 | 3300005840 | Ga0068870_10244299 | Ga0068870_102442992 | 141 |
| 613 | 3300005840 | Ga0068870_10916190 | Ga0068870_109161902 | 141 |
| 614 | 3300005841 | Ga0068863_100002061 | Ga0068863_1000020616 | 141 |
| 615 | 3300005841 | Ga0068863_100178488 | Ga0068863_1001784882 | 141 |
| 616 | 3300005841 | Ga0068863_100440924 | Ga0068863_1004409242 | 141 |
| 617 | 3300005841 | Ga0068863_100875398 | Ga0068863_1008753982 | 141 |
| 618 | 3300005842 | Ga0068858_100026137 | Ga0068858_1000261375 | 141 |
| 619 | 3300005842 | Ga0068858_100178835 | Ga0068858_1001788352 | 141 |
| 620 | 3300005843 | Ga0068860_100005513 | Ga0068860_1000055131 | 141 |
| 621 | 3300005843 | Ga0068860_100152118 | Ga0068860_1001521183 | 141 |
| 622 | 3300005843 | Ga0068860_100226513 | Ga0068860_1002265132 | 141 |
| 623 | 3300005844 | Ga0068862_100003220 | Ga0068862_10000322012 | 141 |
| 624 | 3300005844 | Ga0068862_100012749 | Ga0068862_1000127496 | 141 |
| 625 | 3300005844 | Ga0068862_101676820 | Ga0068862_1016768202 | 141 |
| 626 | 3300006058 | Ga0075432_10035274 | Ga0075432_100352742 | 141 |
| 627 | 3300006237 | Ga0097621_100085250 | Ga0097621_1000852502 | 141 |
| 628 | 3300006237 | Ga0097621_100231621 | Ga0097621_1002316212 | 141 |
| 629 | 3300006358 | Ga0068871_100079486 | Ga0068871_1000794862 | 141 |
| 630 | 3300006358 | Ga0068871_101238524 | Ga0068871_1012385242 | 141 |
| 631 | 3300006844 | Ga0075428_100002730 | Ga0075428_10000273013 | 141 |
| 632 | 3300006844 | Ga0075428_100015139 | Ga0075428_1000151392 | 141 |
| 633 | 3300006844 | Ga0075428_100072319 | Ga0075428_1000723192 | 141 |
| 634 | 3300006844 | Ga0075428_100172891 | Ga0075428_1001728911 | 141 |
| 635 | 3300006844 | Ga0075428_100406631 | Ga0075428_1004066312 | 141 |
| 636 | 3300006844 | Ga0075428_100876024 | Ga0075428_1008760242 | 141 |
| 637 | 3300006846 | Ga0075430_100003769 | Ga0075430_1000037695 | 141 |
| 638 | 3300006846 | Ga0075430_100297882 | Ga0075430_1002978822 | 141 |
| 639 | 3300006847 | Ga0075431_100071107 | Ga0075431_1000711075 | 141 |
| 640 | 3300006847 | Ga0075431_100129847 | Ga0075431_1001298472 | 141 |
| 641 | 3300006847 | Ga0075431_100564519 | Ga0075431_1005645191 | 141 |
| 642 | 3300006852 | Ga0075433_10002662 | Ga0075433_100026626 | 141 |
| 643 | 3300006852 | Ga0075433_10158910 | Ga0075433_101589102 | 141 |
| 644 | 3300006852 | Ga0075433_10167183 | Ga0075433_101671832 | 141 |
| 645 | 3300006871 | Ga0075434_100024688 | Ga0075434_1000246882 | 141 |
| 646 | 3300006871 | Ga0075434_100085384 | Ga0075434_1000853842 | 141 |
| 647 | 3300006871 | Ga0075434_100175032 | Ga0075434_1001750322 | 141 |
| 648 | 3300006871 | Ga0075434_100520716 | Ga0075434_1005207162 | 141 |
| 649 | 3300006871 | Ga0075434_100935801 | Ga0075434_1009358011 | 141 |
| 650 | 3300006880 | Ga0075429_100011117 | Ga0075429_1000111175 | 141 |
| 651 | 3300006880 | Ga0075429_100049770 | Ga0075429_1000497702 | 141 |
| 652 | 3300006880 | Ga0075429_100051448 | Ga0075429_1000514482 | 141 |
| 653 | 3300006880 | Ga0075429_100089006 | Ga0075429_1000890063 | 141 |
| 654 | 3300006880 | Ga0075429_100123682 | Ga0075429_1001236823 | 141 |
| 655 | 3300006881 | Ga0068865_100363506 | Ga0068865_1003635062 | 141 |
| 656 | 3300006931 | Ga0097620_100003934 | Ga0097620_1000039343 | 141 |
| 657 | 3300006931 | Ga0097620_100022068 | Ga0097620_1000220685 | 141 |
| 658 | 3300006931 | Ga0097620_100134279 | Ga0097620_1001342793 | 141 |
| 659 | 3300006931 | Ga0097620_100925855 | Ga0097620_1009258551 | 141 |
| 660 | 3300007076 | Ga0075435_100143599 | Ga0075435_1001435992 | 141 |
| 661 | 3300007076 | Ga0075435_100825078 | Ga0075435_1008250782 | 141 |
| 662 | 3300009094 | Ga0111539_10044634 | Ga0111539_100446343 | 141 |
| 663 | 3300009094 | Ga0111539_10097812 | Ga0111539_100978123 | 141 |
| 664 | 3300009094 | Ga0111539_10136151 | Ga0111539_101361512 | 141 |
| 665 | 3300009094 | Ga0111539_10502944 | Ga0111539_105029441 | 141 |
| 666 | 3300009101 | Ga0105247_10266704 | Ga0105247_102667042 | 141 |
| 667 | 3300009101 | Ga0105247_11141394 | Ga0105247_111413941 | 141 |
| 668 | 3300009147 | Ga0114129_10003246 | Ga0114129_100032462 | 141 |
| 669 | 3300009147 | Ga0114129_10043065 | Ga0114129_100430653 | 141 |
| 670 | 3300009147 | Ga0114129_10073691 | Ga0114129_100736914 | 141 |
| 671 | 3300009147 | Ga0114129_10074301 | Ga0114129_100743013 | 141 |
| 672 | 3300009147 | Ga0114129_10260538 | Ga0114129_102605382 | 141 |
| 673 | 3300009147 | Ga0114129_10667655 | Ga0114129_106676552 | 141 |
| 674 | 3300009147 | Ga0114129_10684241 | Ga0114129_106842412 | 141 |
| 675 | 3300009147 | Ga0114129_10931193 | Ga0114129_109311932 | 141 |
| 676 | 3300009147 | Ga0114129_11082329 | Ga0114129_110823292 | 141 |
| 677 | 3300009148 | Ga0105243_10356263 | Ga0105243_103562632 | 141 |
| 678 | 3300009148 | Ga0105243_12158790 | Ga0105243_121587901 | 141 |
| 679 | 3300009177 | Ga0105248_10188467 | Ga0105248_101884673 | 141 |
| 680 | 3300009177 | Ga0105248_10197798 | Ga0105248_101977982 | 141 |
| 681 | 3300009553 | Ga0105249_10001517 | Ga0105249_100015178 | 141 |
| 682 | 3300009553 | Ga0105249_10020569 | Ga0105249_100205693 | 141 |
| 683 | 3300011119 | Ga0105246_10006946 | Ga0105246_100069466 | 141 |
| 684 | 3300012505 | Ga0157339_1012642 | Ga0157339_10126421 | 141 |
| 685 | 3300013102 | Ga0157371_10179565 | Ga0157371_101795652 | 141 |
| 686 | 3300013102 | Ga0157371_10379373 | Ga0157371_103793732 | 141 |
| 687 | 3300013296 | Ga0157374_10151079 | Ga0157374_101510792 | 141 |
| 688 | 3300013296 | Ga0157374_11013834 | Ga0157374_110138342 | 141 |
| 689 | 3300013306 | Ga0163162_10007906 | Ga0163162_100079062 | 141 |
| 690 | 3300013306 | Ga0163162_10228874 | Ga0163162_102288743 | 141 |
| 691 | 3300013308 | Ga0157375_10075434 | Ga0157375_100754342 | 141 |
| 692 | 3300013308 | Ga0157375_10101653 | Ga0157375_101016532 | 141 |
| 693 | 3300014326 | Ga0157380_10031871 | Ga0157380_100318714 | 141 |
| 694 | 3300014326 | Ga0157380_10033205 | Ga0157380_100332054 | 141 |
| 695 | 3300014326 | Ga0157380_10565883 | Ga0157380_105658832 | 141 |
| 696 | 3300014745 | Ga0157377_10022423 | Ga0157377_100224233 | 141 |
| 697 | 3300014745 | Ga0157377_10140341 | Ga0157377_101403412 | 141 |
| 698 | 3300014745 | Ga0157377_10462394 | Ga0157377_104623942 | 141 |
| 699 | 3300014968 | Ga0157379_10060936 | Ga0157379_100609363 | 141 |
| 700 | 3300014968 | Ga0157379_10095254 | Ga0157379_100952543 | 141 |
| 701 | 3300014969 | Ga0157376_10161608 | Ga0157376_101616082 | 141 |
| 702 | 3300014969 | Ga0157376_10480838 | Ga0157376_104808382 | 141 |
| 703 | 3300017792 | Ga0163161_10094497 | Ga0163161_100944972 | 141 |
| 704 | 3300025290 | Ga0207673_1016061 | Ga0207673_10160611 | 141 |
| 705 | 3300025315 | Ga0207697_10001790 | Ga0207697_100017902 | 141 |
| 706 | 3300025885 | Ga0207653_10246993 | Ga0207653_102469932 | 141 |
| 707 | 3300025893 | Ga0207682_10003881 | Ga0207682_100038816 | 141 |
| 708 | 3300025900 | Ga0207710_10115735 | Ga0207710_101157351 | 141 |
| 709 | 3300025901 | Ga0207688_10002313 | Ga0207688_100023134 | 141 |
| 710 | 3300025901 | Ga0207688_10136178 | Ga0207688_101361782 | 141 |
| 711 | 3300025904 | Ga0207647_10126430 | Ga0207647_101264302 | 141 |
| 712 | 3300025904 | Ga0207647_10209673 | Ga0207647_102096732 | 141 |
| 713 | 3300025907 | Ga0207645_10004825 | Ga0207645_100048256 | 141 |
| 714 | 3300025907 | Ga0207645_10378167 | Ga0207645_103781672 | 141 |
| 715 | 3300025907 | Ga0207645_10590991 | Ga0207645_105909912 | 141 |
| 716 | 3300025908 | Ga0207643_10000719 | Ga0207643_100007196 | 141 |
| 717 | 3300025908 | Ga0207643_10009042 | Ga0207643_100090425 | 141 |
| 718 | 3300025908 | Ga0207643_10057012 | Ga0207643_100570122 | 141 |
| 719 | 3300025910 | Ga0207684_10372795 | Ga0207684_103727952 | 141 |
| 720 | 3300025910 | Ga0207684_10677807 | Ga0207684_106778072 | 141 |
| 721 | 3300025917 | Ga0207660_10408746 | Ga0207660_104087462 | 141 |
| 722 | 3300025917 | Ga0207660_10495486 | Ga0207660_104954861 | 141 |
| 723 | 3300025918 | Ga0207662_10004573 | Ga0207662_100045736 | 141 |
| 724 | 3300025918 | Ga0207662_10023004 | Ga0207662_100230043 | 141 |
| 725 | 3300025918 | Ga0207662_10055153 | Ga0207662_100551532 | 141 |
| 726 | 3300025920 | Ga0207649_10091822 | Ga0207649_100918222 | 141 |
| 727 | 3300025920 | Ga0207649_10387496 | Ga0207649_103874962 | 141 |
| 728 | 3300025920 | Ga0207649_10914034 | Ga0207649_109140342 | 141 |
| 729 | 3300025922 | Ga0207646_10036524 | Ga0207646_100365243 | 141 |
| 730 | 3300025922 | Ga0207646_10321953 | Ga0207646_103219532 | 141 |
| 731 | 3300025922 | Ga0207646_10653006 | Ga0207646_106530062 | 141 |
| 732 | 3300025923 | Ga0207681_10094096 | Ga0207681_100940962 | 141 |
| 733 | 3300025923 | Ga0207681_10661638 | Ga0207681_106616382 | 141 |
| 734 | 3300025925 | Ga0207650_10013492 | Ga0207650_100134924 | 141 |
| 735 | 3300025926 | Ga0207659_10001109 | Ga0207659_1000110911 | 141 |
| 736 | 3300025926 | Ga0207659_10003073 | Ga0207659_100030739 | 141 |
| 737 | 3300025926 | Ga0207659_10061735 | Ga0207659_100617353 | 141 |
| 738 | 3300025926 | Ga0207659_11304652 | Ga0207659_113046521 | 141 |
| 739 | 3300025931 | Ga0207644_10102964 | Ga0207644_101029642 | 141 |
| 740 | 3300025931 | Ga0207644_11080554 | Ga0207644_110805542 | 141 |
| 741 | 3300025932 | Ga0207690_11459947 | Ga0207690_114599471 | 141 |
| 742 | 3300025933 | Ga0207706_10009301 | Ga0207706_100093012 | 141 |
| 743 | 3300025933 | Ga0207706_10028229 | Ga0207706_100282293 | 141 |
| 744 | 3300025933 | Ga0207706_10218950 | Ga0207706_102189502 | 141 |
| 745 | 3300025935 | Ga0207709_10046532 | Ga0207709_100465323 | 141 |
| 746 | 3300025935 | Ga0207709_10289190 | Ga0207709_102891902 | 141 |
| 747 | 3300025936 | Ga0207670_10009697 | Ga0207670_100096973 | 141 |
| 748 | 3300025936 | Ga0207670_10364726 | Ga0207670_103647262 | 141 |
| 749 | 3300025937 | Ga0207669_11017080 | Ga0207669_110170801 | 141 |
| 750 | 3300025938 | Ga0207704_10127595 | Ga0207704_101275952 | 141 |
| 751 | 3300025938 | Ga0207704_10319149 | Ga0207704_103191492 | 141 |
| 752 | 3300025938 | Ga0207704_10621973 | Ga0207704_106219732 | 141 |
| 753 | 3300025940 | Ga0207691_10043684 | Ga0207691_100436844 | 141 |
| 754 | 3300025940 | Ga0207691_10063756 | Ga0207691_100637563 | 141 |
| 755 | 3300025940 | Ga0207691_10489508 | Ga0207691_104895082 | 141 |
| 756 | 3300025941 | Ga0207711_11041091 | Ga0207711_110410912 | 141 |
| 757 | 3300025942 | Ga0207689_10009664 | Ga0207689_100096643 | 141 |
| 758 | 3300025942 | Ga0207689_10195850 | Ga0207689_101958503 | 141 |
| 759 | 3300025942 | Ga0207689_10348301 | Ga0207689_103483011 | 141 |
| 760 | 3300025942 | Ga0207689_11323075 | Ga0207689_113230751 | 141 |
| 761 | 3300025944 | Ga0207661_10579930 | Ga0207661_105799302 | 141 |
| 762 | 3300025945 | Ga0207679_10024068 | Ga0207679_100240682 | 141 |
| 763 | 3300025960 | Ga0207651_10042607 | Ga0207651_100426073 | 141 |
| 764 | 3300025960 | Ga0207651_10080713 | Ga0207651_100807131 | 141 |
| 765 | 3300025960 | Ga0207651_10100576 | Ga0207651_101005763 | 141 |
| 766 | 3300025960 | Ga0207651_10110987 | Ga0207651_101109872 | 141 |
| 767 | 3300025961 | Ga0207712_10060348 | Ga0207712_100603483 | 141 |
| 768 | 3300025961 | Ga0207712_10067200 | Ga0207712_100672002 | 141 |
| 769 | 3300025972 | Ga0207668_10143846 | Ga0207668_101438463 | 141 |
| 770 | 3300025972 | Ga0207668_10938308 | Ga0207668_109383082 | 141 |
| 771 | 3300025981 | Ga0207640_10323796 | Ga0207640_103237962 | 141 |
| 772 | 3300025981 | Ga0207640_10618966 | Ga0207640_106189662 | 141 |
| 773 | 3300025986 | Ga0207658_10247569 | Ga0207658_102475692 | 141 |
| 774 | 3300025986 | Ga0207658_10756704 | Ga0207658_107567042 | 141 |
| 775 | 3300025986 | Ga0207658_11029403 | Ga0207658_110294032 | 141 |
| 776 | 3300026023 | Ga0207677_10087334 | Ga0207677_100873343 | 141 |
| 777 | 3300026023 | Ga0207677_10464752 | Ga0207677_104647522 | 141 |
| 778 | 3300026023 | Ga0207677_11192386 | Ga0207677_111923861 | 141 |
| 779 | 3300026035 | Ga0207703_10018309 | Ga0207703_100183095 | 141 |
| 780 | 3300026035 | Ga0207703_10488712 | Ga0207703_104887122 | 141 |
| 781 | 3300026035 | Ga0207703_10847568 | Ga0207703_108475682 | 141 |
| 782 | 3300026067 | Ga0207678_10187933 | Ga0207678_101879332 | 141 |
| 783 | 3300026075 | Ga0207708_10044031 | Ga0207708_100440313 | 141 |
| 784 | 3300026075 | Ga0207708_10069374 | Ga0207708_100693742 | 141 |
| 785 | 3300026075 | Ga0207708_10098955 | Ga0207708_100989552 | 141 |
| 786 | 3300026088 | Ga0207641_10075679 | Ga0207641_100756792 | 141 |
| 787 | 3300026088 | Ga0207641_10119671 | Ga0207641_101196712 | 141 |
| 788 | 3300026088 | Ga0207641_10390122 | Ga0207641_103901221 | 141 |
| 789 | 3300026089 | Ga0207648_10004637 | Ga0207648_100046374 | 141 |
| 790 | 3300026095 | Ga0207676_10034387 | Ga0207676_100343872 | 141 |
| 791 | 3300026095 | Ga0207676_10040361 | Ga0207676_100403614 | 141 |
| 792 | 3300026095 | Ga0207676_10059474 | Ga0207676_100594743 | 141 |
| 793 | 3300026116 | Ga0207674_10014747 | Ga0207674_100147478 | 141 |
| 794 | 3300026116 | Ga0207674_10041866 | Ga0207674_100418664 | 141 |
| 795 | 3300026116 | Ga0207674_10542407 | Ga0207674_105424072 | 141 |
| 796 | 3300026118 | Ga0207675_100009291 | Ga0207675_1000092913 | 141 |
| 797 | 3300026118 | Ga0207675_100010261 | Ga0207675_1000102616 | 141 |
| 798 | 3300026118 | Ga0207675_100017102 | Ga0207675_1000171026 | 141 |
| 799 | 3300026121 | Ga0207683_10009184 | Ga0207683_100091847 | 141 |
| 800 | 3300026142 | Ga0207698_10030727 | Ga0207698_100307275 | 141 |
| 801 | 3300027360 | Ga0209969_1054366 | Ga0209969_10543661 | 141 |
| 802 | 3300027614 | Ga0209970_1074382 | Ga0209970_10743822 | 141 |
| 803 | 3300027907 | Ga0207428_10004387 | Ga0207428_100043873 | 141 |
| 804 | 3300027907 | Ga0207428_10007206 | Ga0207428_100072064 | 141 |
| 805 | 3300027907 | Ga0207428_11055285 | Ga0207428_110552851 | 141 |
| 806 | 3300028379 | Ga0268266_10274382 | Ga0268266_102743822 | 141 |
| 807 | 3300028380 | Ga0268265_10001826 | Ga0268265_1000182613 | 141 |
| 808 | 3300028380 | Ga0268265_10133598 | Ga0268265_101335983 | 141 |
| 809 | 3300028381 | Ga0268264_10005474 | Ga0268264_100054741 | 141 |
| 810 | 3300028381 | Ga0268264_10241352 | Ga0268264_102413523 | 141 |
| 811 | 3300028381 | Ga0268264_10314169 | Ga0268264_103141691 | 141 |
| 812 | 3300028381 | Ga0268264_10795990 | Ga0268264_107959902 | 141 |
| 813 | 3300032002 | Ga0307416_100445012 | Ga0307416_1004450122 | 141 |
| 814 | 3300032002 | Ga0307416_100713528 | Ga0307416_1007135282 | 141 |
| 815 | 3300032002 | Ga0307416_100836611 | Ga0307416_1008366111 | 141 |
| 816 | 3300034817 | Ga0373948_0132751 | Ga0373948_0132751_55_480 | 141 |
| 817 | 3300034818 | Ga0373950_0097878 | Ga0373950_0097878_90_515 | 141 |
| 818 | 3300034819 | Ga0373958_0091664 | Ga0373958_0091664_143_568 | 141 |
| 819 | 3300034820 | Ga0373959_0029708 | Ga0373959_0029708_525_950 | 141 |
| 820 | 3300035084 | Ga0373928_0101492 | Ga0373928_0101492_48_473 | 141 |
| 821 | 3300035091 | Ga0373951_0017699 | Ga0373951_0017699_1116_1541 | 141 |
| 822 | 3300035112 | Ga0373932_0003263 | Ga0373932_0003263_649_1074 | 141 |
| 823 | 3300035114 | Ga0373939_0096588 | Ga0373939_0096588_258_683 | 141 |
| 824 | 3300035115 | Ga0373941_0229246 | Ga0373941_0229246_207_632 | 141 |
| 825 | 3300035207 | Ga0373942_0193580 | Ga0373942_0193580_108_533 | 141 |
| 826 | 3300035242 | Ga0373962_0034641 | Ga0373962_0034641_864_1289 | 141 |
| 827 | 3300035242 | Ga0373962_0124364 | Ga0373962_0124364_16_441 | 141 |
| 828 | 3300035691 | Ga0373931_0141943 | Ga0373931_0141943_838_1263 | 141 |
| 829 | 3300038996 | Ga0242420_039954 | Ga0242420_039954_21_446 | 141 |
| 830 | 3300041408 | Ga0439453_0035315 | Ga0439453_0035315_284_709 | 141 |
| 831 | 3300042009 | Ga0439451_084656 | Ga0439451_084656_143_571 | 141 |
| 832 | 3300042156 | Ga0439446_0169923 | Ga0439446_0169923_11_442 | 141 |
| 833 | 3300042436 | Ga0439435_0001066 | Ga0439435_0001066_1074_1502 | 141 |
| 834 | 3300042436 | Ga0439435_0324014 | Ga0439435_0324014_68_499 | 141 |
| 835 | 3300042461 | Ga0439460_0050049 | Ga0439460_0050049_327_758 | 141 |
| 836 | 3300042993 | Ga0439440_0095765 | Ga0439440_0095765_60_485 | 141 |
| 837 | 3300045051 | Ga0451576_0015029 | Ga0451576_0015029_4136_4576 | 141 |
| 838 | 3300045051 | Ga0451576_0020117 | Ga0451576_0020117_3342_3767 | 141 |
| 839 | 3300045051 | Ga0451576_0539471 | Ga0451576_0539471_605_1030 | 141 |
| 840 | 3300045051 | Ga0451576_2651233 | Ga0451576_2651233_16_441 | 141 |
| 841 | 3300046472 | Ga0495580_0349385 | Ga0495580_0349385_98_538 | 141 |
| 842 | 3300046537 | Ga0495598_0461479 | Ga0495598_0461479_52_492 | 141 |
| 843 | 3300046539 | Ga0495621_0003642 | Ga0495621_0003642_670_1110 | 141 |
| 844 | 3300046664 | Ga0495659_0162825 | Ga0495659_0162825_245_670 | 141 |
| 845 | 3300046684 | Ga0495669_0083038 | Ga0495669_0083038_766_1191 | 141 |
| 846 | 3300046684 | Ga0495669_0428566 | Ga0495669_0428566_35_460 | 141 |
| 847 | 3300047318 | Ga0495636_0050818 | Ga0495636_0050818_28_474 | 141 |
| 848 | 3300047445 | Ga0495677_0056686 | Ga0495677_0056686_600_1040 | 141 |
| 849 | 3300047445 | Ga0495677_0260137 | Ga0495677_0260137_52_477 | 141 |
| 850 | 3300048905 | Ga0496102_0735853 | Ga0496102_0735853_318_743 | 141 |
| 851 | 3300048909 | Ga0496106_0324898 | Ga0496106_0324898_368_793 | 141 |
| 852 | 3300048912 | Ga0496109_0304390 | Ga0496109_0304390_625_1050 | 141 |
| 853 | 3300048913 | Ga0496110_0785149 | Ga0496110_0785149_178_603 | 141 |
| 854 | 3300048915 | Ga0496112_0405482 | Ga0496112_0405482_60_488 | 141 |
| 855 | 3300049568 | Ga0501031_0316041 | Ga0501031_0316041_136_567 | 141 |
| 856 | 3300049570 | Ga0501033_0135580 | Ga0501033_0135580_542_967 | 141 |
| 857 | 3300049570 | Ga0501033_0560909 | Ga0501033_0560909_182_613 | 141 |
| 858 | 3300049571 | Ga0501034_1284720 | Ga0501034_1284720_102_527 | 141 |
| 859 | 3300049572 | Ga0501036_0006517 | Ga0501036_0006517_4639_5115 | 141 |
| 860 | 3300049573 | Ga0501037_0053504 | Ga0501037_0053504_468_893 | 141 |
| 861 | 3300049573 | Ga0501037_0377162 | Ga0501037_0377162_292_768 | 141 |
| 862 | 3300049574 | Ga0501038_0415818 | Ga0501038_0415818_70_501 | 141 |
| 863 | 3300049575 | Ga0501039_0012801 | Ga0501039_0012801_5214_5639 | 141 |
| 864 | 3300049576 | Ga0501040_0011449 | Ga0501040_0011449_3669_4145 | 141 |
| 865 | 3300049576 | Ga0501040_0012274 | Ga0501040_0012274_5158_5583 | 141 |
| 866 | 3300049576 | Ga0501040_0026883 | Ga0501040_0026883_298_729 | 141 |
| 867 | 3300049577 | Ga0501041_0005678 | Ga0501041_0005678_5920_6396 | 141 |
| 868 | 3300049577 | Ga0501041_0005712 | Ga0501041_0005712_6511_6936 | 141 |
| 869 | 3300049577 | Ga0501041_0212142 | Ga0501041_0212142_734_1165 | 141 |
| 870 | 3300049578 | Ga0501042_0007901 | Ga0501042_0007901_1755_2180 | 141 |
| 871 | 3300049578 | Ga0501042_0014823 | Ga0501042_0014823_2534_3010 | 141 |
| 872 | 3300049578 | Ga0501042_0048198 | Ga0501042_0048198_1694_2125 | 141 |
| 873 | 3300049579 | Ga0501043_0036253 | Ga0501043_0036253_1993_2418 | 141 |
| 874 | 3300049579 | Ga0501043_0165115 | Ga0501043_0165115_522_998 | 141 |
| 875 | 3300049579 | Ga0501043_0353426 | Ga0501043_0353426_252_683 | 141 |
| 876 | 3300049580 | Ga0501046_0022494 | Ga0501046_0022494_4609_5085 | 141 |
| 877 | 3300049580 | Ga0501046_0034854 | Ga0501046_0034854_1921_2346 | 141 |
| 878 | 3300049580 | Ga0501046_0071352 | Ga0501046_0071352_911_1342 | 141 |
| 879 | 3300049582 | Ga0501048_0013516 | Ga0501048_0013516_3763_4188 | 141 |
| 880 | 3300049583 | Ga0501067_0132290 | Ga0501067_0132290_732_1157 | 141 |
| 881 | 3300049584 | Ga0501068_0022396 | Ga0501068_0022396_1670_2095 | 141 |
| 882 | 3300049587 | Ga0501071_0010264 | Ga0501071_0010264_2642_3067 | 141 |
| 883 | 3300049587 | Ga0501071_0016080 | Ga0501071_0016080_3097_3573 | 141 |
| 884 | 3300049587 | Ga0501071_0561499 | Ga0501071_0561499_123_548 | 141 |
| 885 | 3300049588 | Ga0501072_0014626 | Ga0501072_0014626_3304_3729 | 141 |
| 886 | 3300049590 | Ga0501074_0192198 | Ga0501074_0192198_989_1414 | 141 |
| 887 | 3300049591 | Ga0501075_0000268 | Ga0501075_0000268_25081_25506 | 141 |
| 888 | 3300049591 | Ga0501075_0013423 | Ga0501075_0013423_4577_5053 | 141 |
| 889 | 3300049591 | Ga0501075_0077307 | Ga0501075_0077307_701_1132 | 141 |
| 890 | 3300049591 | Ga0501075_0807668 | Ga0501075_0807668_127_552 | 141 |
| 891 | 3300049592 | Ga0501076_0004709 | Ga0501076_0004709_7464_7940 | 141 |
| 892 | 3300049592 | Ga0501076_0005998 | Ga0501076_0005998_4333_4758 | 141 |
| 893 | 3300049592 | Ga0501076_0256407 | Ga0501076_0256407_892_1317 | 141 |
| 894 | 3300049593 | Ga0501077_0044953 | Ga0501077_0044953_2097_2573 | 141 |
| 895 | 3300049593 | Ga0501077_0384800 | Ga0501077_0384800_279_710 | 141 |
| 896 | 3300049741 | Ga0501079_0000628 | Ga0501079_0000628_13461_13886 | 141 |
| 897 | 3300049741 | Ga0501079_0002955 | Ga0501079_0002955_10191_10667 | 141 |
| 898 | 3300049741 | Ga0501079_0388428 | Ga0501079_0388428_486_917 | 141 |
| 899 | 3300049742 | Ga0501080_0057691 | Ga0501080_0057691_2494_2919 | 141 |
| 900 | 3300049742 | Ga0501080_0084132 | Ga0501080_0084132_2396_2872 | 141 |
| 901 | 3300049743 | Ga0501081_0006126 | Ga0501081_0006126_5264_5689 | 141 |
| 902 | 3300049743 | Ga0501081_0021904 | Ga0501081_0021904_1484_1915 | 141 |
| 903 | 3300049743 | Ga0501081_0023491 | Ga0501081_0023491_3026_3502 | 141 |
| 904 | 3300049744 | Ga0501083_0383693 | Ga0501083_0383693_57_482 | 141 |
| 905 | 3300049744 | Ga0501083_0488705 | Ga0501083_0488705_234_710 | 141 |
| 906 | 3300049744 | Ga0501083_0986879 | Ga0501083_0986879_38_463 | 141 |
| 907 | 3300049824 | Ga0501045_0013214 | Ga0501045_0013214_3776_4201 | 141 |
| 908 | 3300049824 | Ga0501045_0013639 | Ga0501045_0013639_4639_5115 | 141 |
| 909 | 3300049824 | Ga0501045_0045171 | Ga0501045_0045171_1260_1691 | 141 |
| 910 | 3300050507 | nmdc:mga05p37_1039442_c1 | nmdc:mga05p37_1039442_c1_29_454 | 141 |
| 911 | 3300050507 | nmdc:mga05p37_1081459_c1 | nmdc:mga05p37_1081459_c1_336_761 | 141 |
| 912 | 3300050507 | nmdc:mga05p37_1098_c1 | nmdc:mga05p37_1098_c1_30280_30720 | 141 |
| 913 | 3300050507 | nmdc:mga05p37_173071_c1 | nmdc:mga05p37_173071_c1_320_754 | 141 |
| 914 | 3300050507 | nmdc:mga05p37_1800084_c1 | nmdc:mga05p37_1800084_c1_137_565 | 141 |
| 915 | 3300050507 | nmdc:mga05p37_217986_c1 | nmdc:mga05p37_217986_c1_1327_1758 | 141 |
| 916 | 3300050507 | nmdc:mga05p37_31490_c2 | nmdc:mga05p37_31490_c2_1943_2368 | 141 |
| 917 | 3300050507 | nmdc:mga05p37_331663_c1 | nmdc:mga05p37_331663_c1_193_618 | 141 |
| 918 | 3300050507 | nmdc:mga05p37_41099_c1 | nmdc:mga05p37_41099_c1_3755_4180 | 141 |
| 919 | 3300050508 | nmdc:mga09592_119986_c1 | nmdc:mga09592_119986_c1_338_763 | 141 |
| 920 | 3300050508 | nmdc:mga09592_47639_c1 | nmdc:mga09592_47639_c1_469_894 | 141 |
| 921 | 3300050508 | nmdc:mga09592_69703_c1 | nmdc:mga09592_69703_c1_1321_1746 | 141 |
| 922 | 3300050508 | nmdc:mga09592_717546_c1 | nmdc:mga09592_717546_c1_87_512 | 141 |
| 923 | 3300050508 | nmdc:mga09592_9774_c1 | nmdc:mga09592_9774_c1_5326_5760 | 141 |
| 924 | 3300050509 | nmdc:mga0qj67_1031_c1 | nmdc:mga0qj67_1031_c1_5647_6072 | 141 |
| 925 | 3300050509 | nmdc:mga0qj67_165669_c1 | nmdc:mga0qj67_165669_c1_649_1074 | 141 |
| 926 | 3300050509 | nmdc:mga0qj67_390648_c1 | nmdc:mga0qj67_390648_c1_410_844 | 141 |
| 927 | 3300050510 | nmdc:mga06r32_11151_c1 | nmdc:mga06r32_11151_c1_250_684 | 141 |
| 928 | 3300050510 | nmdc:mga06r32_92505_c1 | nmdc:mga06r32_92505_c1_327_752 | 141 |
| 929 | 3300050511 | nmdc:mga08y16_1686052_c1 | nmdc:mga08y16_1686052_c1_20_484 | 141 |
| 930 | 3300050511 | nmdc:mga08y16_244481_c1 | nmdc:mga08y16_244481_c1_532_957 | 141 |
| 931 | 3300050511 | nmdc:mga08y16_31440_c1 | nmdc:mga08y16_31440_c1_1533_1958 | 141 |
| 932 | 3300050511 | nmdc:mga08y16_80156_c1 | nmdc:mga08y16_80156_c1_2515_2940 | 141 |
| 933 | 3300050512 | nmdc:mga0n895_25280_c1 | nmdc:mga0n895_25280_c1_1658_2083 | 141 |
| 934 | 3300050512 | nmdc:mga0n895_284128_c1 | nmdc:mga0n895_284128_c1_1020_1445 | 141 |
| 935 | 3300050512 | nmdc:mga0n895_589694_c1 | nmdc:mga0n895_589694_c1_52_492 | 141 |
| 936 | 3300050513 | nmdc:mga0rr50_77440_c1 | nmdc:mga0rr50_77440_c1_1783_2208 | 141 |
| 937 | 3300050515 | nmdc:mga0a205_1627_c1 | nmdc:mga0a205_1627_c1_17241_17666 | 141 |
| 938 | 3300050515 | nmdc:mga0a205_84831_c1 | nmdc:mga0a205_84831_c1_571_996 | 141 |
| 939 | 3300050515 | nmdc:mga0a205_8857_c1 | nmdc:mga0a205_8857_c1_207_632 | 141 |
| 940 | 3300054114 | Ga0501084_0017927 | Ga0501084_0017927_5335_5760 | 141 |
| 941 | 3300054114 | Ga0501084_0018490 | Ga0501084_0018490_201_632 | 141 |
| 942 | 3300054114 | Ga0501084_0068690 | Ga0501084_0068690_871_1347 | 141 |
| 943 | 3300060353 | Ga0501082_0002583 | Ga0501082_0002583_5279_5704 | 141 |
| 944 | 3300060353 | Ga0501082_0012187 | Ga0501082_0012187_3097_3573 | 141 |
| 945 | 3300060353 | Ga0501082_0137506 | Ga0501082_0137506_1010_1441 | 141 |
| 946 | 3300061734 | Ga0530510_0000557 | Ga0530510_0000557_15812_16237 | 141 |
| 947 | 3300061734 | Ga0530510_0075231 | Ga0530510_0075231_363_794 | 141 |
| 948 | 3300061734 | Ga0530510_0128788 | Ga0530510_0128788_919_1395 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h9m-assembly1.cif.gz_A | two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound | 0.7768 | 37 | 99 |
| 2pi2-assembly3.cif.gz_C | full-length replication protein a subunits rpa14 and rpa32 | 0.7497 | 36 | 114 |
| 4fxd-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7475 | 39 | 72 |
| 4fxd-assembly2.cif.gz_B | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.744 | 39 | 72 |
| 6hmf-assembly1.cif.gz_A | d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) h451 proof-reading deficient variant | 0.7326 | 32 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PQ00_161_443_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8318 | 42 | 74 | 2.130.10.10 |
| af_B2RYE5_272_368_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8293 | 42 | 70 | 2.30.29.30 |
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8245 | 37 | 75 | 2.40.50.140 |
| af_Q8VC10_106_455_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8161 | 41 | 72 | 3.50.50.60 |
| 3rlfA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8 | 37 | 97 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.9726 | 31 | 124 |
|
| AF-A0A2V8I9N4-F1-model_v4 | DUF5666 domain-containing protein | 0.9541 | 39 | 124 |
|
| AF-A0A351D019-F1-model_v4 | Minor tail protein | 0.9532 | 35 | 125 |
|
| AF-A0A2V8LU00-F1-model_v4 | OB domain-containing protein | 0.9504 | 37 | 123 |
|
| AF-A0A7C2NVP5-F1-model_v4 | Uncharacterized protein | 0.9501 | 35 | 125 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar