F486539

General Info

Members Datasets Scaffolds Average Seq Length
949 474 898 280

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0007784|Ga0496119_0007784_3164_4132
Length 322
Sequence MAVIVAARPDRCFKATLNKPAQAPPALSSVLFGDEDDRAMTASIETISEQRCFGGTQGFYRHDSAMCGGSMRFAVFQPPQAAQGPCAVLYYLAGLTCTEETATIKAGAQRLAAELGLVLVMPDTSPRDTGLEGATGDWEFGEGAGFYLDATQAPWSSRFRMYSYIGEELPALVAAHFPVDAARCGIFGHSMGGHGALTIALKHPQRYRSVSAFAPIVAPMRVPWGQKAFSRYLGADQTAWRDYDASELVRRRAFPGTILIDQGEADKFLEGQLKPELFEQACAEAGQALTLRRQAGYDHSYYFIASFIDDHLRHHASALAGA

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
8 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
11 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
12 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
13 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
14 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
15 2734482264 Dyella sp. AD052 Isolate Unclassified
16 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
17 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
18 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
19 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
20 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
21 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
22 2847085930 Erwinia persicina B64 Isolate Bulb
23 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
24 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
25 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
26 2884411467 Dyella sp. AD56 Isolate Rhizosphere
27 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
28 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
29 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
30 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
31 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
32 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
33 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
34 2904504865 Serratia marcescens 1822 Isolate Unclassified
35 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
36 2919085039 Luteibacter sp. 1214 Isolate Unclassified
37 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
38 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
39 2932406140 Serratia sp. 2723 Isolate Rhizosphere
40 2937967321 Serratia sp. YC16 Isolate Unclassified
41 2939577877 Serratia sp. 509 Isolate Rhizosphere
42 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
43 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
44 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
53 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
58 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
59 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
67 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
83 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
97 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
109 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
159 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
177 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
185 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
186 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
199 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
264 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
272 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
273 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
276 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
277 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
278 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
279 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
280 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
281 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
282 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
289 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
290 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
291 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
292 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
297 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
298 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
299 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
307 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
308 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
309 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
310 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
311 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
312 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
313 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
314 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
315 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
316 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
317 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
318 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
319 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
324 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
375 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
376 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
408 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
409 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
410 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
411 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
412 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
432 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
437 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
438 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
444 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
445 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
446 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
447 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
451 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
452 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
453 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
454 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
455 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
456 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
457 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
458 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
459 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
462 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
463 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
464 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
465 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
466 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 640753048 Serratia proteamaculans 568 Isolate Endosphere
469 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
470 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
471 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
472 8004592986 Serratia sp. S119 Isolate Unclassified
473 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
474 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.78
Metatranscriptomes 0.84
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.11
Endosphere 6.64
Nodule 0.42
Rhizoplane 3.79
Rhizosphere 77.77
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1014268 3300001904 Bacteria 1278
2 JGI24736J21556_1016497 3300001904 Bacteria 1176
3 JGI24741J21665_1003437 3300001915 Bacteria 3777
4 JGI24740J21852_10000727 3300001979 Bacteria 14339
5 JGI24740J21852_10001960 3300001979 Bacteria 9400
6 JGI24740J21852_10010318 3300001979 Bacteria 3607
7 JGI24737J22298_10019089 3300001990 Bacteria 2193
8 JGI25155J39150_1000091 3300002704 Bacteria 51833
9 JGI25156J39149_1000127 3300002705 Bacteria 56051
10 JGI25162J39368_1001785 3300002737 Bacteria 10197
11 JGI25154J39366_1000038 3300002738 Bacteria 155793
12 JGI25157J39369_1000126 3300002741 Bacteria 65430
13 JGI25157J39369_1000155 3300002741 Bacteria 57096
14 JGI25163J39215_1000835 3300002771 Bacteria 7374
15 JGI25164J39214_1000012 3300002772 Bacteria 255140
16 JGI25165J46597_1000048 3300003214 Bacteria 254392
17 rootH2_10014854 3300003320 Bacteria 19746
18 rootH2_10023780 3300003320 Bacteria 27505
19 rootH1_10106964 3300003323 Bacteria 1701
20 Ga0006562J51391_1071442 3300003578 Bacteria 3304
21 Ga0006562J51391_1071443 3300003578 Bacteria 1440
22 Ga0055538_1000486 3300003751 Bacteria 14526
23 Ga0055532_1000023 3300003758 Bacteria 248212
24 Ga0055535_1000151 3300003761 Bacteria 74028
25 Ga0055535_1007606 3300003761 Bacteria 2046
26 Ga0055542_1000034 3300003762 Bacteria 231972
27 Ga0055529_1001207 3300003763 Bacteria 10187
28 Ga0055530_10001427 3300003791 Bacteria 17505
29 Ga0055540_1000312 3300003792 Bacteria 43001
30 Ga0055531_10002021 3300003794 Bacteria 14053
31 Ga0055531_10005293 3300003794 Bacteria 7571
32 Ga0065703_1019008 3300005272 Bacteria 4450
33 Ga0065712_10181904 3300005290 Bacteria 1188
34 Ga0065715_10116314 3300005293 Bacteria 2385
35 Ga0065707_10152917 3300005295 Bacteria 1639
36 Ga0070658_10005302 3300005327 Bacteria 10467
37 Ga0070658_10111842 3300005327 Bacteria 2263
38 Ga0070676_10009222 3300005328 Bacteria 5333
39 Ga0070683_100001770 3300005329 Bacteria 16818
40 Ga0070683_100125830 3300005329 Bacteria 2423
41 Ga0070683_100179651 3300005329 Bacteria 2009
42 Ga0070690_100000447 3300005330 Bacteria 20750
43 Ga0070670_100000001 3300005331 Bacteria 728788
44 Ga0070670_100018619 3300005331 Bacteria 5951
45 Ga0070670_100312257 3300005331 Bacteria 1376
46 Ga0068869_100001940 3300005334 Bacteria 12408
47 Ga0070666_10000005 3300005335 Bacteria 343092
48 Ga0070666_10021808 3300005335 Bacteria 4152
49 Ga0070666_10279265 3300005335 Bacteria 1187
50 Ga0070680_100002154 3300005336 Bacteria 14558
51 Ga0070680_100259479 3300005336 Bacteria 1470
52 Ga0070682_100009177 3300005337 Bacteria 5592
53 Ga0070682_100063104 3300005337 Bacteria 2348
54 Ga0068868_100139217 3300005338 Bacteria 1991
55 Ga0070660_100400191 3300005339 Bacteria 1135
56 Ga0070689_100061253 3300005340 Bacteria 2927
57 Ga0070691_10000094 3300005341 Bacteria 25666
58 Ga0070691_10026844 3300005341 Bacteria 2686
59 Ga0070691_10091782 3300005341 Bacteria 1498
60 Ga0070687_100001347 3300005343 Bacteria 8616
61 Ga0070661_100001262 3300005344 Bacteria 17773
62 Ga0070661_100009331 3300005344 Bacteria 6789
63 Ga0070692_10008406 3300005345 Bacteria 4604
64 Ga0070668_100001327 3300005347 Bacteria 17705
65 Ga0070668_100073379 3300005347 Bacteria 2668
66 Ga0070668_100327540 3300005347 Bacteria 1291
67 Ga0070669_100003178 3300005353 Bacteria 11810
68 Ga0070669_100005867 3300005353 Bacteria 8858
69 Ga0070675_100002389 3300005354 Bacteria 13982
70 Ga0070671_100000042 3300005355 Bacteria 91321
71 Ga0070673_100008457 3300005364 Bacteria 6844
72 Ga0070688_100006549 3300005365 Bacteria 6230
73 Ga0070688_100207489 3300005365 Bacteria 1374
74 Ga0070659_100160227 3300005366 Bacteria 1839
75 Ga0070659_100203551 3300005366 Bacteria 1630
76 Ga0070659_100410390 3300005366 Bacteria 1144
77 Ga0070667_100000096 3300005367 Bacteria 108816
78 Ga0070667_100034514 3300005367 Bacteria 4232
79 Ga0070709_10008040 3300005434 Bacteria 5789
80 Ga0070714_100009475 3300005435 Bacteria 7657
81 Ga0070714_100291409 3300005435 Bacteria 1519
82 Ga0070710_10125318 3300005437 Bacteria 1560
83 Ga0070711_100156049 3300005439 Bacteria 1726
84 Ga0070663_100000972 3300005455 Bacteria 15575
85 Ga0070663_100014982 3300005455 Bacteria 4988
86 Ga0070663_100021471 3300005455 Bacteria 4295
87 Ga0070663_100132995 3300005455 Bacteria 1891
88 Ga0070678_100106696 3300005456 Bacteria 2183
89 Ga0070678_100179449 3300005456 Bacteria 1732
90 Ga0070662_100005325 3300005457 Bacteria 8220
91 Ga0070662_100009243 3300005457 Bacteria 6439
92 Ga0070662_100030662 3300005457 Bacteria 3766
93 Ga0070662_100035932 3300005457 Bacteria 3502
94 Ga0070662_100438047 3300005457 Bacteria 1083
95 Ga0070681_10000450 3300005458 Bacteria 33617
96 Ga0070681_10000783 3300005458 Bacteria 26471
97 Ga0070681_10012951 3300005458 Bacteria 8282
98 Ga0070681_10071805 3300005458 Bacteria 3426
99 Ga0068867_100003630 3300005459 Bacteria 10856
100 Ga0070685_10000002 3300005466 Bacteria 295205
101 Ga0070685_10001947 3300005466 Bacteria 10729
102 Ga0070685_10135439 3300005466 Bacteria 1545
103 Ga0070679_100000455 3300005530 Bacteria 34669
104 Ga0070679_100001730 3300005530 Bacteria 19675
105 Ga0070679_100101777 3300005530 Bacteria 2859
106 Ga0070684_100005357 3300005535 Bacteria 9831
107 Ga0070684_100229878 3300005535 Bacteria 1693
108 Ga0070684_100418005 3300005535 Bacteria 1237
109 Ga0068853_100027910 3300005539 Bacteria 4746
110 Ga0068853_100115153 3300005539 Bacteria 2392
111 Ga0068853_100289314 3300005539 Bacteria 1512
112 Ga0070672_100076371 3300005543 Bacteria 2676
113 Ga0070686_100003983 3300005544 Bacteria 8125
114 Ga0070695_100189659 3300005545 Bacteria 1462
115 Ga0070696_100012785 3300005546 Bacteria 5637
116 Ga0070693_100099156 3300005547 Bacteria 1772
117 Ga0070693_100321376 3300005547 Bacteria 1050
118 Ga0070665_100007655 3300005548 Bacteria 10982
119 Ga0070665_100010439 3300005548 Bacteria 9397
120 Ga0070665_100016024 3300005548 Bacteria 7524
121 Ga0070665_100024577 3300005548 Bacteria 6070
122 Ga0070665_100152388 3300005548 Bacteria 2314
123 Ga0068855_100096086 3300005563 Bacteria 3415
124 Ga0068855_100275441 3300005563 Bacteria 1870
125 Ga0070664_100001499 3300005564 Bacteria 18603
126 Ga0070664_100009538 3300005564 Bacteria 7869
127 Ga0070664_100035157 3300005564 Bacteria 4206
128 Ga0070664_100078684 3300005564 Bacteria 2836
129 Ga0070664_100615292 3300005564 Bacteria 1008
130 Ga0068857_100097504 3300005577 Bacteria 2636
131 Ga0068857_100135927 3300005577 Bacteria 2219
132 Ga0068857_100410436 3300005577 Bacteria 1261
133 Ga0068854_100002703 3300005578 Bacteria 10992
134 Ga0068854_100009198 3300005578 Bacteria 6375
135 Ga0068854_100044088 3300005578 Bacteria 3165
136 Ga0068856_100052307 3300005614 Bacteria 4027
137 Ga0068856_100071101 3300005614 Bacteria 3444
138 Ga0068856_100091052 3300005614 Bacteria 3034
139 Ga0068856_100159138 3300005614 Bacteria 2269
140 Ga0068856_100312381 3300005614 Bacteria 1589
141 Ga0070702_100003933 3300005615 Bacteria 6736
142 Ga0070702_100070632 3300005615 Bacteria 2062
143 Ga0068852_100006182 3300005616 Bacteria 8634
144 Ga0068852_100021909 3300005616 Bacteria 5113
145 Ga0068852_100023505 3300005616 Bacteria 4962
146 Ga0068852_100063861 3300005616 Bacteria 3207
147 Ga0068859_100076339 3300005617 Bacteria 3391
148 Ga0068864_100000006 3300005618 Bacteria 393838
149 Ga0068864_100489192 3300005618 Bacteria 1182
150 Ga0068861_100000011 3300005719 Bacteria 82099
151 Ga0068861_100000527 3300005719 Bacteria 22405
152 Ga0068851_10014972 3300005834 Bacteria 3689
153 Ga0068851_10035096 3300005834 Bacteria 2506
154 Ga0068851_10185125 3300005834 Bacteria 1155
155 Ga0068851_10290590 3300005834 Bacteria 937
156 Ga0068863_100006951 3300005841 Bacteria 11096
157 Ga0068863_100325946 3300005841 Bacteria 1492
158 Ga0068863_100376721 3300005841 Bacteria 1385
159 Ga0068858_100146898 3300005842 Bacteria 2215
160 Ga0068858_100163428 3300005842 Bacteria 2097
161 Ga0068860_100002839 3300005843 Bacteria 17999
162 Ga0068860_100016186 3300005843 Bacteria 7275
163 Ga0068862_100001082 3300005844 Bacteria 25990
164 Ga0068862_100005935 3300005844 Bacteria 10171
165 Ga0068862_100006690 3300005844 Bacteria 9563
166 Ga0068862_100514927 3300005844 Bacteria 1138
167 Ga0081455_10001291 3300005937 Bacteria 31153
168 Ga0070717_10003860 3300006028 Bacteria 10777
169 Ga0075364_10000064 3300006051 Bacteria 40534
170 Ga0070716_100018629 3300006173 Bacteria 3619
171 Ga0070716_100112461 3300006173 Bacteria 1690
172 Ga0097621_100443432 3300006237 Bacteria 1168
173 Ga0075370_10053332 3300006353 Bacteria 2295
174 Ga0068871_100039277 3300006358 Bacteria 3786
175 Ga0068871_100254808 3300006358 Bacteria 1529
176 Ga0075428_100000232 3300006844 Bacteria 54223
177 Ga0075428_100124750 3300006844 Bacteria 2803
178 Ga0075430_100002265 3300006846 Bacteria 15936
179 Ga0075430_100002676 3300006846 Bacteria 14872
180 Ga0075431_100000011 3300006847 Bacteria 95501
181 Ga0075431_100000356 3300006847 Bacteria 36283
182 Ga0075431_100002051 3300006847 Bacteria 19253
183 Ga0075431_100099351 3300006847 Bacteria 3003
184 Ga0075429_100000124 3300006880 Bacteria 45454
185 Ga0075429_100365418 3300006880 Bacteria 1263
186 Ga0097620_100076340 3300006931 Bacteria 3391
187 Ga0099823_1071482 3300006944 Bacteria 1528
188 Ga0079104_1002293 3300006946 Bacteria 10570
189 Ga0105251_10000119 3300009011 Bacteria 79040
190 Ga0105251_10003742 3300009011 Bacteria 10889
191 Ga0105251_10004883 3300009011 Bacteria 8948
192 Ga0105244_10021059 3300009036 Bacteria 3613
193 Ga0105244_10035527 3300009036 Bacteria 2618
194 Ga0105250_10000003 3300009092 Bacteria 547770
195 Ga0105240_10001418 3300009093 Bacteria 41120
196 Ga0105240_10019239 3300009093 Bacteria 9128
197 Ga0105240_10101977 3300009093 Bacteria 3489
198 Ga0105240_10105572 3300009093 Bacteria 3419
199 Ga0105240_10242623 3300009093 Bacteria 2088
200 Ga0111539_10000664 3300009094 Bacteria 44364
201 Ga0111539_10006216 3300009094 Bacteria 15413
202 Ga0111539_10039322 3300009094 Bacteria 5703
203 Ga0105245_10240483 3300009098 Bacteria 1755
204 Ga0105247_10000025 3300009101 Bacteria 208459
205 Ga0105247_10168104 3300009101 Bacteria 1456
206 Ga0114129_10000468 3300009147 Bacteria 48434
207 Ga0114129_10021817 3300009147 Bacteria 9089
208 Ga0114129_10191059 3300009147 Bacteria 2780
209 Ga0105243_10000343 3300009148 Bacteria 50175
210 Ga0105243_10163652 3300009148 Bacteria 1920
211 Ga0105241_10000004 3300009174 Bacteria 803007
212 Ga0105241_10023212 3300009174 Bacteria 4599
213 Ga0105248_10015152 3300009177 Bacteria 8495
214 Ga0105248_10049066 3300009177 Bacteria 4735
215 Ga0105237_10000064 3300009545 Bacteria 139463
216 Ga0105237_10001115 3300009545 Bacteria 35967
217 Ga0105237_10198823 3300009545 Bacteria 2004
218 Ga0105238_10000759 3300009551 Bacteria 33535
219 Ga0105238_10008308 3300009551 Bacteria 10382
220 Ga0105238_10010144 3300009551 Bacteria 9448
221 Ga0105238_10080397 3300009551 Bacteria 3249
222 Ga0105238_10119179 3300009551 Bacteria 2619
223 Ga0105249_10012855 3300009553 Bacteria 7387
224 Ga0105249_10015735 3300009553 Bacteria 6699
225 Ga0105249_10031344 3300009553 Bacteria 4808
226 Ga0105239_10000030 3300010375 Bacteria 233669
227 Ga0105239_10001815 3300010375 Bacteria 27993
228 Ga0105239_10037703 3300010375 Bacteria 5297
229 Ga0105239_10356963 3300010375 Bacteria 1650
230 Ga0105246_10156332 3300011119 Bacteria 1732
231 Ga0157314_1000429 3300012500 Bacteria 4127
232 Ga0157347_1009181 3300012502 Bacteria 1019
233 Ga0157373_10000690 3300013100 Bacteria 26488
234 Ga0157373_10037108 3300013100 Bacteria 3495
235 Ga0157373_10158281 3300013100 Bacteria 1593
236 Ga0157371_10000060 3300013102 Bacteria 170456
237 Ga0157371_10000859 3300013102 Bacteria 34664
238 Ga0157371_10003055 3300013102 Bacteria 15536
239 Ga0157371_10017014 3300013102 Bacteria 5413
240 Ga0157371_10363533 3300013102 Bacteria 1055
241 Ga0157370_10000407 3300013104 Bacteria 54357
242 Ga0157370_10026703 3300013104 Bacteria 5698
243 Ga0157370_10138986 3300013104 Bacteria 2263
244 Ga0157369_10015827 3300013105 Bacteria 8496
245 Ga0157369_10049372 3300013105 Bacteria 4562
246 Ga0157374_10005615 3300013296 Bacteria 10568
247 Ga0157378_10030770 3300013297 Bacteria 4739
248 Ga0163162_10001186 3300013306 Bacteria 24300
249 Ga0163162_10011035 3300013306 Bacteria 8800
250 Ga0163162_10104471 3300013306 Bacteria 2927
251 Ga0163162_10189414 3300013306 Bacteria 2184
252 Ga0157372_10003428 3300013307 Bacteria 17111
253 Ga0157372_10016287 3300013307 Bacteria 7979
254 Ga0157372_10108862 3300013307 Bacteria 3172
255 Ga0157372_10183168 3300013307 Bacteria 2425
256 Ga0157372_10193077 3300013307 Bacteria 2358
257 Ga0157372_10748986 3300013307 Bacteria 1136
258 Ga0157375_10187900 3300013308 Bacteria 2220
259 Ga0163163_10000032 3300014325 Bacteria 167085
260 Ga0163163_10390726 3300014325 Bacteria 1449
261 Ga0163163_10774886 3300014325 Bacteria 1022
262 Ga0157380_10112659 3300014326 Bacteria 2289
263 Ga0157380_10439215 3300014326 Bacteria 1250
264 Ga0157380_10506155 3300014326 Bacteria 1174
265 Ga0182008_10002367 3300014497 Bacteria 11865
266 Ga0182008_10003099 3300014497 Bacteria 10199
267 Ga0182008_10048757 3300014497 Bacteria 2103
268 Ga0182008_10061615 3300014497 Bacteria 1849
269 Ga0157377_10077987 3300014745 Bacteria 1930
270 Ga0157379_10026338 3300014968 Bacteria 5177
271 Ga0157379_10068261 3300014968 Bacteria 3179
272 Ga0157379_10507832 3300014968 Bacteria 1118
273 Ga0157376_10065588 3300014969 Bacteria 3067
274 Ga0157376_10104280 3300014969 Bacteria 2484
275 Ga0182006_1000989 3300015261 Bacteria 18659
276 Ga0182006_1007482 3300015261 Bacteria 4996
277 Ga0182007_10015156 3300015262 Bacteria 2883
278 Ga0182005_1000028 3300015265 Bacteria 221889
279 Ga0182005_1001309 3300015265 Bacteria 10201
280 Ga0163161_10000001 3300017792 Bacteria 2041488
281 Ga0163161_10018332 3300017792 Bacteria 4906
282 Ga0163161_10039868 3300017792 Bacteria 3373
283 Ga0197907_11148482 3300020069 Bacteria 811
284 Ga0206356_11116119 3300020070 Bacteria 8750
285 Ga0206354_11415265 3300020081 Bacteria 5011
286 Ga0206353_10620874 3300020082 Bacteria 9572
287 Ga0206353_10772270 3300020082 Bacteria 7606
288 Ga0154015_1162269 3300020610 Bacteria 2692
289 Ga0213872_10004916 3300021361 Bacteria 6956
290 Ga0209435_100013 3300025206 Bacteria 366789
291 Ga0209760_100447 3300025207 Bacteria 9493
292 Ga0209784_100016 3300025224 Bacteria 481036
293 Ga0209674_101117 3300025226 Bacteria 7874
294 Ga0209672_101053 3300025228 Bacteria 11836
295 Ga0209147_100030 3300025229 Bacteria 366789
296 Ga0207427_100019 3300025231 Bacteria 513977
297 Ga0209437_100054 3300025233 Bacteria 366715
298 Ga0209437_100208 3300025233 Bacteria 111481
299 Ga0209437_101411 3300025233 Bacteria 5989
300 Ga0209258_100039 3300025242 Bacteria 386366
301 Ga0209258_100734 3300025242 Bacteria 21334
302 Ga0209646_1000034 3300025246 Bacteria 366789
303 Ga0209646_1001310 3300025246 Bacteria 6945
304 Ga0209026_1000012 3300025250 Bacteria 480426
305 Ga0209026_1000022 3300025250 Bacteria 366789
306 Ga0209148_1000001 3300025254 Bacteria 2545271
307 Ga0209148_1002822 3300025254 Bacteria 5393
308 Ga0209759_1000018 3300025256 Bacteria 366789
309 Ga0209759_1000404 3300025256 Bacteria 53269
310 Ga0209129_1000583 3300025258 Bacteria 25095
311 Ga0209129_1006513 3300025258 Bacteria 3748
312 Ga0209233_1000002 3300025261 Bacteria 2501366
313 Ga0209455_1000039 3300025272 Bacteria 437734
314 Ga0209455_1000474 3300025272 Bacteria 30028
315 Ga0209455_1002189 3300025272 Bacteria 7735
316 Ga0209455_1009937 3300025272 Bacteria 2456
317 Ga0209758_1000414 3300025297 Bacteria 72487
318 Ga0209050_1001937 3300025298 Bacteria 19686
319 Ga0209051_1000148 3300025303 Bacteria 132600
320 Ga0209051_1002660 3300025303 Bacteria 12497
321 Ga0209257_1000044 3300025304 Bacteria 486709
322 Ga0207656_10010628 3300025321 Bacteria 3454
323 Ga0207656_10043045 3300025321 Bacteria 1924
324 Ga0207656_10059801 3300025321 Bacteria 1669
325 Ga0207696_1000001 3300025711 Bacteria 2579611
326 Ga0207696_1000004 3300025711 Bacteria 671626
327 Ga0207696_1015415 3300025711 Bacteria 2593
328 Ga0207655_1000840 3300025728 Bacteria 32993
329 Ga0207655_1004274 3300025728 Bacteria 10215
330 Ga0207713_1000024 3300025735 Bacteria 339156
331 Ga0207713_1000026 3300025735 Bacteria 319032
332 Ga0207682_10116694 3300025893 Bacteria 1180
333 Ga0207710_10000140 3300025900 Bacteria 83223
334 Ga0207710_10107373 3300025900 Bacteria 1323
335 Ga0207688_10026201 3300025901 Bacteria 3204
336 Ga0207680_10000005 3300025903 Bacteria 660983
337 Ga0207680_10005909 3300025903 Bacteria 5879
338 Ga0207680_10040993 3300025903 Bacteria 2699
339 Ga0207680_10099875 3300025903 Bacteria 1863
340 Ga0207647_10001545 3300025904 Bacteria 17720
341 Ga0207647_10011637 3300025904 Bacteria 6161
342 Ga0207647_10017489 3300025904 Bacteria 4874
343 Ga0207699_10018217 3300025906 Bacteria 3717
344 Ga0207645_10029620 3300025907 Bacteria 3528
345 Ga0207705_10000938 3300025909 Bacteria 23813
346 Ga0207705_10011888 3300025909 Bacteria 6289
347 Ga0207705_10041301 3300025909 Bacteria 3309
348 Ga0207654_10000006 3300025911 Bacteria 815027
349 Ga0207654_10050904 3300025911 Bacteria 2382
350 Ga0207707_10000493 3300025912 Bacteria 40605
351 Ga0207707_10000630 3300025912 Bacteria 34922
352 Ga0207707_10000859 3300025912 Bacteria 29680
353 Ga0207707_10005551 3300025912 Bacteria 11032
354 Ga0207707_10012415 3300025912 Bacteria 7405
355 Ga0207707_10042221 3300025912 Bacteria 3981
356 Ga0207707_10179467 3300025912 Bacteria 1849
357 Ga0207695_10000780 3300025913 Bacteria 60243
358 Ga0207695_10002372 3300025913 Bacteria 27968
359 Ga0207695_10002829 3300025913 Bacteria 25215
360 Ga0207695_10003142 3300025913 Bacteria 23602
361 Ga0207695_10004476 3300025913 Bacteria 19032
362 Ga0207695_10010832 3300025913 Bacteria 11111
363 Ga0207695_10011301 3300025913 Bacteria 10822
364 Ga0207695_10019150 3300025913 Bacteria 7888
365 Ga0207695_10020009 3300025913 Bacteria 7682
366 Ga0207671_10000061 3300025914 Bacteria 175061
367 Ga0207671_10008651 3300025914 Bacteria 8594
368 Ga0207663_10214610 3300025916 Bacteria 1397
369 Ga0207660_10000570 3300025917 Bacteria 24778
370 Ga0207660_10000885 3300025917 Bacteria 19752
371 Ga0207660_10002187 3300025917 Bacteria 12942
372 Ga0207660_10009853 3300025917 Bacteria 6187
373 Ga0207660_10043674 3300025917 Bacteria 3150
374 Ga0207660_10194922 3300025917 Bacteria 1580
375 Ga0207662_10003779 3300025918 Bacteria 7859
376 Ga0207657_10011422 3300025919 Bacteria 8816
377 Ga0207649_10001342 3300025920 Bacteria 14630
378 Ga0207649_10009056 3300025920 Bacteria 5440
379 Ga0207649_10009276 3300025920 Bacteria 5381
380 Ga0207649_10020099 3300025920 Bacteria 3824
381 Ga0207649_10045303 3300025920 Bacteria 2696
382 Ga0207649_10090772 3300025920 Bacteria 2000
383 Ga0207649_10160776 3300025920 Bacteria 1556
384 Ga0207649_10173141 3300025920 Bacteria 1505
385 Ga0207652_10000152 3300025921 Bacteria 74928
386 Ga0207652_10001326 3300025921 Bacteria 21962
387 Ga0207652_10003170 3300025921 Bacteria 13693
388 Ga0207652_10003549 3300025921 Bacteria 12876
389 Ga0207652_10163546 3300025921 Bacteria 1995
390 Ga0207681_10002504 3300025923 Bacteria 11673
391 Ga0207681_10008671 3300025923 Bacteria 6208
392 Ga0207681_10019340 3300025923 Bacteria 4302
393 Ga0207681_10147531 3300025923 Bacteria 1759
394 Ga0207694_10000685 3300025924 Bacteria 30431
395 Ga0207694_10070569 3300025924 Bacteria 2729
396 Ga0207694_10071300 3300025924 Bacteria 2715
397 Ga0207694_10077864 3300025924 Bacteria 2598
398 Ga0207694_10205628 3300025924 Bacteria 1603
399 Ga0207650_10000002 3300025925 Bacteria 1439222
400 Ga0207659_10003909 3300025926 Bacteria 8985
401 Ga0207659_10366503 3300025926 Bacteria 1198
402 Ga0207700_10204005 3300025928 Bacteria 1668
403 Ga0207664_10036623 3300025929 Bacteria 3792
404 Ga0207644_10000076 3300025931 Bacteria 72705
405 Ga0207644_10093888 3300025931 Bacteria 2240
406 Ga0207690_10020303 3300025932 Bacteria 4103
407 Ga0207690_10080533 3300025932 Bacteria 2273
408 Ga0207690_10162513 3300025932 Bacteria 1666
409 Ga0207690_10277395 3300025932 Bacteria 1304
410 Ga0207706_10001035 3300025933 Bacteria 28246
411 Ga0207706_10007611 3300025933 Bacteria 10021
412 Ga0207706_10102892 3300025933 Bacteria 2513
413 Ga0207706_10116872 3300025933 Bacteria 2346
414 Ga0207709_10000057 3300025935 Bacteria 216617
415 Ga0207709_10185072 3300025935 Bacteria 1474
416 Ga0207669_10493689 3300025937 Bacteria 978
417 Ga0207665_10027428 3300025939 Bacteria 3763
418 Ga0207691_10129742 3300025940 Bacteria 2227
419 Ga0207691_10220885 3300025940 Bacteria 1643
420 Ga0207711_10003038 3300025941 Bacteria 14665
421 Ga0207711_10017130 3300025941 Bacteria 6018
422 Ga0207689_10016437 3300025942 Bacteria 6264
423 Ga0207661_10000457 3300025944 Bacteria 26338
424 Ga0207661_10003088 3300025944 Bacteria 11534
425 Ga0207661_10094908 3300025944 Bacteria 2492
426 Ga0207679_10005902 3300025945 Bacteria 7700
427 Ga0207679_10012080 3300025945 Bacteria 5617
428 Ga0207679_10032717 3300025945 Bacteria 3654
429 Ga0207667_10002899 3300025949 Bacteria 21300
430 Ga0207667_10008275 3300025949 Bacteria 12377
431 Ga0207667_10022933 3300025949 Bacteria 6881
432 Ga0207667_10071937 3300025949 Bacteria 3595
433 Ga0207667_10085069 3300025949 Bacteria 3274
434 Ga0207667_10087672 3300025949 Bacteria 3219
435 Ga0207667_10097346 3300025949 Bacteria 3037
436 Ga0207667_10362506 3300025949 Bacteria 1478
437 Ga0207651_10005232 3300025960 Bacteria 6632
438 Ga0207712_10052816 3300025961 Bacteria 2848
439 Ga0207712_10070940 3300025961 Bacteria 2504
440 Ga0207668_10091881 3300025972 Bacteria 2232
441 Ga0207640_10001114 3300025981 Bacteria 14832
442 Ga0207640_10001882 3300025981 Bacteria 11253
443 Ga0207640_10003251 3300025981 Bacteria 8755
444 Ga0207640_10028383 3300025981 Bacteria 3421
445 Ga0207658_10000001 3300025986 Bacteria 1439333
446 Ga0207658_10039925 3300025986 Bacteria 3389
447 Ga0207677_10211529 3300026023 Bacteria 1549
448 Ga0207703_10023876 3300026035 Bacteria 4809
449 Ga0207703_10244418 3300026035 Bacteria 1615
450 Ga0207639_10004251 3300026041 Bacteria 9655
451 Ga0207639_10014895 3300026041 Bacteria 5477
452 Ga0207639_10170960 3300026041 Bacteria 1840
453 Ga0207639_10248080 3300026041 Bacteria 1551
454 Ga0207639_10394505 3300026041 Bacteria 1246
455 Ga0207678_10003283 3300026067 Bacteria 14590
456 Ga0207678_10008993 3300026067 Bacteria 8790
457 Ga0207678_10584147 3300026067 Bacteria 979
458 Ga0207708_10046326 3300026075 Bacteria 3311
459 Ga0207702_10001044 3300026078 Bacteria 28368
460 Ga0207702_10046486 3300026078 Bacteria 3654
461 Ga0207702_10065837 3300026078 Bacteria 3104
462 Ga0207702_10386592 3300026078 Bacteria 1347
463 Ga0207641_10007326 3300026088 Bacteria 9189
464 Ga0207641_10010775 3300026088 Bacteria 7495
465 Ga0207641_10035178 3300026088 Bacteria 4171
466 Ga0207641_10371967 3300026088 Bacteria 1366
467 Ga0207648_10010315 3300026089 Bacteria 8868
468 Ga0207676_10000001 3300026095 Bacteria 1439222
469 Ga0207676_10002491 3300026095 Bacteria 13109
470 Ga0207676_10415314 3300026095 Bacteria 1261
471 Ga0207674_10000279 3300026116 Bacteria 64457
472 Ga0207674_10250129 3300026116 Bacteria 1720
473 Ga0207675_100000254 3300026118 Bacteria 51194
474 Ga0207675_100001636 3300026118 Bacteria 22459
475 Ga0207675_100002172 3300026118 Bacteria 19499
476 Ga0207683_10007149 3300026121 Bacteria 9571
477 Ga0207683_10055487 3300026121 Bacteria 3474
478 Ga0207683_10302443 3300026121 Bacteria 1463
479 Ga0207698_10001050 3300026142 Bacteria 16062
480 Ga0207698_10006712 3300026142 Bacteria 7191
481 Ga0207698_10040040 3300026142 Bacteria 3477
482 Ga0207698_10085920 3300026142 Bacteria 2556
483 Ga0209281_1000008 3300027111 Bacteria 867470
484 Ga0209371_1000074 3300027312 Bacteria 198823
485 Ga0209371_1003036 3300027312 Bacteria 8650
486 Ga0209970_1000606 3300027614 Bacteria 6226
487 Ga0209974_10007325 3300027876 Bacteria 3803
488 Ga0209974_10014186 3300027876 Bacteria 2655
489 Ga0207428_10002738 3300027907 Bacteria 17560
490 Ga0268266_10000004 3300028379 Bacteria 1495817
491 Ga0268266_10009394 3300028379 Bacteria 8616
492 Ga0268266_10041390 3300028379 Bacteria 3931
493 Ga0268266_10058033 3300028379 Bacteria 3332
494 Ga0268266_10115292 3300028379 Bacteria 2385
495 Ga0268266_10575526 3300028379 Bacteria 1080
496 Ga0268266_10597230 3300028379 Bacteria 1060
497 Ga0268265_10000889 3300028380 Bacteria 27884
498 Ga0268265_10002058 3300028380 Bacteria 15752
499 Ga0268264_10000004 3300028381 Bacteria 1116842
500 Ga0268264_10063501 3300028381 Bacteria 3104
501 Ga0265334_10083714 3300028573 Bacteria 1172
502 Ga0307515_10002783 3300028794 Bacteria 37292
503 Ga0307515_10003144 3300028794 Bacteria 34920
504 Ga0268256_1000067 3300030500 Bacteria 198823
505 Ga0268256_1002722 3300030500 Bacteria 8650
506 Ga0307512_10053330 3300030522 Bacteria 3217
507 Ga0265330_10084544 3300031235 Bacteria 1365
508 Ga0265328_10018922 3300031239 Bacteria 2650
509 Ga0265328_10023059 3300031239 Bacteria 2363
510 Ga0265340_10007750 3300031247 Bacteria 5823
511 Ga0265331_10002458 3300031250 Bacteria 12548
512 Ga0265327_10000020 3300031251 Bacteria 424552
513 Ga0265327_10000255 3300031251 Bacteria 105762
514 Ga0265327_10002046 3300031251 Bacteria 22695
515 Ga0265327_10002593 3300031251 Bacteria 18707
516 Ga0265327_10044670 3300031251 Bacteria 2360
517 Ga0265316_10000088 3300031344 Bacteria 98110
518 Ga0307513_10051014 3300031456 Bacteria 4467
519 Ga0307509_10002265 3300031507 Bacteria 31503
520 Ga0307509_10261574 3300031507 Bacteria 1505
521 Ga0307509_10482831 3300031507 Bacteria 927
522 Ga0307408_100001241 3300031548 Bacteria 19160
523 Ga0307408_100005662 3300031548 Bacteria 8326
524 Ga0307408_100115871 3300031548 Bacteria 2067
525 Ga0307408_100121193 3300031548 Bacteria 2026
526 Ga0307408_100146841 3300031548 Bacteria 1857
527 Ga0307408_100234916 3300031548 Bacteria 1504
528 Ga0307514_10001537 3300031649 Bacteria 27450
529 Ga0316578_10090013 3300031728 Bacteria 1832
530 Ga0307516_10005394 3300031730 Bacteria 15348
531 Ga0307516_10028869 3300031730 Bacteria 5610
532 Ga0307405_10031127 3300031731 Bacteria 3137
533 Ga0307405_10094401 3300031731 Bacteria 1989
534 Ga0307413_10005441 3300031824 Bacteria 5687
535 Ga0307413_10028846 3300031824 Bacteria 3097
536 Ga0307410_10005705 3300031852 Bacteria 6629
537 Ga0307410_10029524 3300031852 Bacteria 3493
538 Ga0307410_10313875 3300031852 Bacteria 1241
539 Ga0307406_10008182 3300031901 Bacteria 5827
540 Ga0307406_10066970 3300031901 Bacteria 2339
541 Ga0307406_10083533 3300031901 Bacteria 2130
542 Ga0307406_10120968 3300031901 Bacteria 1820
543 Ga0307406_10285208 3300031901 Bacteria 1261
544 Ga0307406_10383547 3300031901 Bacteria 1109
545 Ga0307412_10019498 3300031911 Bacteria 4109
546 Ga0307412_10025910 3300031911 Bacteria 3638
547 Ga0307412_10035790 3300031911 Bacteria 3175
548 Ga0307412_10100305 3300031911 Bacteria 2046
549 Ga0307412_10105795 3300031911 Bacteria 1999
550 Ga0307412_10155483 3300031911 Bacteria 1692
551 Ga0307412_10157107 3300031911 Bacteria 1685
552 Ga0307409_100116224 3300031995 Bacteria 2254
553 Ga0307409_100238273 3300031995 Bacteria 1654
554 Ga0307416_100109787 3300032002 Bacteria 2427
555 Ga0307416_100754482 3300032002 Bacteria 1066
556 Ga0307414_10035487 3300032004 Bacteria 3319
557 Ga0307414_10222472 3300032004 Bacteria 1550
558 Ga0307414_10227540 3300032004 Bacteria 1535
559 Ga0307414_10602280 3300032004 Bacteria 985
560 Ga0307411_10018164 3300032005 Bacteria 4028
561 Ga0307411_10038363 3300032005 Bacteria 3021
562 Ga0307411_10113371 3300032005 Bacteria 1945
563 Ga0307411_10221493 3300032005 Bacteria 1468
564 Ga0307411_10386639 3300032005 Bacteria 1152
565 Ga0307510_10002640 3300033180 Bacteria 20467
566 Ga0307510_10200141 3300033180 Bacteria 1533
567 Ga0373938_0047595 3300034957 Bacteria 971
568 Ga0316574_0076614 3300035398 Bacteria 2119
569 Ga0316584_0031022 3300036712 Bacteria 3952
570 Ga0395899_0012560 3300037312 Bacteria 6492
571 Ga0395899_0059129 3300037312 Bacteria 2825
572 Ga0395899_0068872 3300037312 Bacteria 2593
573 Ga0395899_0092709 3300037312 Bacteria 2187
574 Ga0395899_0350286 3300037312 Bacteria 988
575 Ga0395900_0043547 3300037418 Bacteria 4626
576 Ga0395900_0044849 3300037418 Bacteria 4554
577 Ga0395900_0058979 3300037418 Bacteria 3951
578 Ga0395900_0128880 3300037418 Bacteria 2593
579 Ga0395898_0061237 3300037466 Bacteria 3656
580 Ga0395898_0203485 3300037466 Bacteria 1889
581 Ga0395898_0317466 3300037466 Bacteria 1486
582 Ga0395898_0373568 3300037466 Bacteria 1360
583 Ga0395905_0012392 3300037471 Bacteria 8209
584 Ga0395905_0049852 3300037471 Bacteria 3924
585 Ga0395905_0068570 3300037471 Bacteria 3322
586 Ga0395905_0098785 3300037471 Bacteria 2742
587 Ga0395905_0224513 3300037471 Bacteria 1758
588 Ga0395901_0040382 3300038443 Bacteria 4832
589 Ga0395901_0143397 3300038443 Bacteria 2510
590 Ga0395901_0245002 3300038443 Bacteria 1868
591 Ga0395901_0324823 3300038443 Bacteria 1591
592 Ga0436361_0106903 3300039447 Bacteria 9400
593 Ga0436361_0959303 3300039447 Bacteria 2385
594 Ga0439436_0000030 3300041404 Bacteria 48429
595 Ga0439438_000002 3300041405 Bacteria 618223
596 Ga0439438_001667 3300041405 Bacteria 9748
597 Ga0439447_002689 3300041407 Bacteria 6435
598 Ga0439465_0000927 3300041413 Bacteria 9301
599 Ga0439465_0007670 3300041413 Bacteria 3424
600 Ga0451791_1385162 3300041451 Bacteria 1628
601 Ga0451793_1620920 3300041452 Bacteria 2102
602 Ga0451793_1723399 3300041452 Bacteria 1448
603 Ga0451837_0285758 3300041494 Bacteria 4245
604 Ga0451851_0568421 3300041507 Bacteria 782
605 Ga0439432_003014 3300042006 Bacteria 6269
606 Ga0439449_0010982 3300042007 Bacteria 3417
607 Ga0439449_0051101 3300042007 Bacteria 1529
608 Ga0450919_007536 3300042121 Bacteria 1271
609 Ga0450894_021614 3300042131 Bacteria 870
610 Ga0450906_005612 3300042145 Bacteria 2568
611 Ga0450918_000146 3300042531 Bacteria 15617
612 Ga0451577_0188437 3300042876 Bacteria 1860
613 Ga0466969_0006906 3300044656 Bacteria 6042
614 Ga0466969_0042216 3300044656 Bacteria 2278
615 Ga0466972_0037105 3300044658 Bacteria 2382
616 Ga0466978_0132332 3300044671 Bacteria 1533
617 Ga0466982_0028105 3300044672 Bacteria 3302
618 Ga0466965_0016936 3300044683 Bacteria 3477
619 Ga0466965_0063678 3300044683 Bacteria 1845
620 Ga0466965_0074706 3300044683 Bacteria 1708
621 Ga0466966_0020484 3300044684 Bacteria 4348
622 Ga0466966_0273621 3300044684 Bacteria 1016
623 Ga0466961_0000063 3300044693 Bacteria 64438
624 Ga0466961_0002563 3300044693 Bacteria 11258
625 Ga0466964_0013910 3300044706 Bacteria 3056
626 Ga0466964_0042457 3300044706 Bacteria 1842
627 Ga0453684_0174032 3300044712 Bacteria 2534
628 Ga0466971_0061402 3300044719 Bacteria 1699
629 Ga0466970_0017539 3300044765 Bacteria 3699
630 Ga0466970_0135904 3300044765 Bacteria 1352
631 Ga0466957_0150204 3300044842 Bacteria 1506
632 Ga0466960_0013028 3300044901 Bacteria 3524
633 Ga0466959_0012131 3300045049 Bacteria 6219
634 Ga0466959_0057743 3300045049 Bacteria 2828
635 Ga0466959_0145120 3300045049 Bacteria 1675
636 Ga0451576_0015523 3300045051 Bacteria 8431
637 Ga0466967_0023046 3300045976 Bacteria 5095
638 Ga0495627_000018 3300046453 Bacteria 315125
639 Ga0495592_0005606 3300046454 Bacteria 9280
640 Ga0495629_0110910 3300046459 Bacteria 1913
641 Ga0495638_0000038 3300046460 Bacteria 249534
642 Ga0495650_0001216 3300046471 Bacteria 27008
643 Ga0495650_0034341 3300046471 Bacteria 2246
644 Ga0495605_0011963 3300046474 Bacteria 4824
645 Ga0495639_0012189 3300046475 Bacteria 3707
646 Ga0495584_0139842 3300046491 Bacteria 1229
647 Ga0495585_0017935 3300046492 Bacteria 4085
648 Ga0495585_0022088 3300046492 Bacteria 3652
649 Ga0495607_0025850 3300046501 Bacteria 3647
650 Ga0495607_0054685 3300046501 Bacteria 2299
651 Ga0495583_0000067 3300046506 Bacteria 189381
652 Ga0495606_0002843 3300046507 Bacteria 19187
653 Ga0495606_0018207 3300046507 Bacteria 5277
654 Ga0495606_0044660 3300046507 Bacteria 2945
655 Ga0495610_0004378 3300046512 Bacteria 10461
656 Ga0495620_0000867 3300046515 Bacteria 18724
657 Ga0495632_0000004 3300046519 Bacteria 381372
658 Ga0495644_0009116 3300046523 Bacteria 3822
659 Ga0495644_0013429 3300046523 Bacteria 3142
660 Ga0495648_0001359 3300046524 Bacteria 24164
661 Ga0495663_0005993 3300046525 Bacteria 3364
662 Ga0495663_0024306 3300046525 Bacteria 1760
663 Ga0495654_0001734 3300046530 Bacteria 14624
664 Ga0495609_0001124 3300046538 Bacteria 18539
665 Ga0495609_0021833 3300046538 Bacteria 2952
666 Ga0495633_0001422 3300046558 Bacteria 18622
667 Ga0495633_0020966 3300046558 Bacteria 3275
668 Ga0495656_0007691 3300046615 Bacteria 3821
669 Ga0495611_0001009 3300046648 Bacteria 14914
670 Ga0495611_0003480 3300046648 Bacteria 6934
671 Ga0495625_0002479 3300046660 Bacteria 19887
672 Ga0495625_0014356 3300046660 Bacteria 6328
673 Ga0495625_0021940 3300046660 Bacteria 4904
674 Ga0495625_0039933 3300046660 Bacteria 3425
675 Ga0495659_0000529 3300046664 Bacteria 14098
676 Ga0495661_0163840 3300046665 Bacteria 1191
677 Ga0495588_0018173 3300046674 Bacteria 3424
678 Ga0495669_0054233 3300046684 Bacteria 1804
679 Ga0495670_0005679 3300046691 Bacteria 6116
680 Ga0495670_0012033 3300046691 Bacteria 4259
681 Ga0495670_0013691 3300046691 Bacteria 3989
682 Ga0495670_0107157 3300046691 Bacteria 1444
683 Ga0495671_0003813 3300046692 Bacteria 9167
684 Ga0495671_0006426 3300046692 Bacteria 6786
685 Ga0495671_0071006 3300046692 Bacteria 1710
686 Ga0495589_0000002 3300046794 Bacteria 758846
687 Ga0495581_0126222 3300047315 Bacteria 1490
688 Ga0495604_0285296 3300047317 Bacteria 1114
689 Ga0495636_0000126 3300047318 Bacteria 31355
690 Ga0495636_0001826 3300047318 Bacteria 8143
691 Ga0495636_0012157 3300047318 Bacteria 3409
692 Ga0495672_0021078 3300047320 Bacteria 4255
693 Ga0495683_0002800 3300047323 Bacteria 10350
694 Ga0495683_0034847 3300047323 Bacteria 2558
695 Ga0495687_001241 3300047443 Bacteria 24342
696 Ga0495677_0009136 3300047445 Bacteria 3662
697 Ga0495679_023734 3300047446 Bacteria 2076
698 Ga0495685_000011 3300047447 Bacteria 83484
699 Ga0495673_0011344 3300047469 Bacteria 4798
700 Ga0495686_0065443 3300047472 Bacteria 2247
701 Ga0495615_0040933 3300048090 Bacteria 1156
702 Ga0496100_0019589 3300048903 Bacteria 4040
703 Ga0496100_0174425 3300048903 Bacteria 1551
704 Ga0496101_0055419 3300048904 Bacteria 2864
705 Ga0496102_0024754 3300048905 Bacteria 5339
706 Ga0496103_0034983 3300048906 Bacteria 3074
707 Ga0496104_0015148 3300048907 Bacteria 6978
708 Ga0496104_0056915 3300048907 Bacteria 3700
709 Ga0496104_0182274 3300048907 Bacteria 2010
710 Ga0496104_0504365 3300048907 Bacteria 1121
711 Ga0496105_0007719 3300048908 Bacteria 8345
712 Ga0496106_0079818 3300048909 Bacteria 2512
713 Ga0496106_0150524 3300048909 Bacteria 1835
714 Ga0496107_0041786 3300048910 Bacteria 3293
715 Ga0496108_0062186 3300048911 Bacteria 3144
716 Ga0496109_0016390 3300048912 Bacteria 6478
717 Ga0496109_0024245 3300048912 Bacteria 5392
718 Ga0496109_0323986 3300048912 Bacteria 1454
719 Ga0496110_0005377 3300048913 Bacteria 10034
720 Ga0496110_0035053 3300048913 Bacteria 4351
721 Ga0496110_0078155 3300048913 Bacteria 2946
722 Ga0496110_0229649 3300048913 Bacteria 1687
723 Ga0496111_0214079 3300048914 Bacteria 1431
724 Ga0496112_0048314 3300048915 Bacteria 4172
725 Ga0496112_0308978 3300048915 Bacteria 1526
726 Ga0496112_0581175 3300048915 Bacteria 1053
727 Ga0496113_0099775 3300048916 Bacteria 2249
728 Ga0496113_0294734 3300048916 Bacteria 1298
729 Ga0496113_0413084 3300048916 Bacteria 1084
730 Ga0496114_0027067 3300048917 Bacteria 4697
731 Ga0496114_0087579 3300048917 Bacteria 2640
732 Ga0496115_0000077 3300048918 Bacteria 89885
733 Ga0496115_0053190 3300048918 Bacteria 3249
734 Ga0496116_0000023 3300048919 Bacteria 475792
735 Ga0496116_0000132 3300048919 Bacteria 156427
736 Ga0496116_0010095 3300048919 Bacteria 7959
737 Ga0496116_0042776 3300048919 Bacteria 3093
738 Ga0496117_0000463 3300048920 Bacteria 67832
739 Ga0496117_0002979 3300048920 Bacteria 20414
740 Ga0496117_0070042 3300048920 Bacteria 2358
741 Ga0496118_0000686 3300048921 Bacteria 55044
742 Ga0496118_0002015 3300048921 Bacteria 28746
743 Ga0496118_0003815 3300048921 Bacteria 18566
744 Ga0496118_0008917 3300048921 Bacteria 10238
745 Ga0496118_0063756 3300048921 Bacteria 2709
746 Ga0496119_0000012 3300048922 Bacteria 411917
747 Ga0496119_0000430 3300048922 Bacteria 57802
748 Ga0496119_0000697 3300048922 Bacteria 45018
749 Ga0496119_0001891 3300048922 Bacteria 24077
750 Ga0496119_0004881 3300048922 Bacteria 13128
751 Ga0496119_0007784 3300048922 Bacteria 9554
752 Ga0496119_0012385 3300048922 Bacteria 6934
753 Ga0496119_0022598 3300048922 Bacteria 4494
754 Ga0496119_0071410 3300048922 Bacteria 2032
755 Ga0496120_0000004 3300048923 Bacteria 534793
756 Ga0496120_0000048 3300048923 Bacteria 187988
757 Ga0496120_0000052 3300048923 Bacteria 186071
758 Ga0496120_0000137 3300048923 Bacteria 123518
759 Ga0496120_0001388 3300048923 Bacteria 29391
760 Ga0496120_0002094 3300048923 Bacteria 21392
761 Ga0496120_0018310 3300048923 Bacteria 4520
762 Ga0496121_0001726 3300048924 Bacteria 35676
763 Ga0496121_0036052 3300048924 Bacteria 4416
764 Ga0496121_0090329 3300048924 Bacteria 2394
765 Ga0496121_0144220 3300048924 Bacteria 1762
766 Ga0496122_0000382 3300048925 Bacteria 94878
767 Ga0496122_0175875 3300048925 Bacteria 1283
768 Ga0496123_0000516 3300048926 Bacteria 67323
769 Ga0496124_0000017 3300048927 Bacteria 444389
770 Ga0496125_0000330 3300048928 Bacteria 91043
771 Ga0496125_0009099 3300048928 Bacteria 10274
772 Ga0496125_0031549 3300048928 Bacteria 4721
773 Ga0496125_0040456 3300048928 Bacteria 3999
774 Ga0496125_0127589 3300048928 Bacteria 1799
775 Ga0496126_0000047 3300048929 Bacteria 322212
776 Ga0496126_0001039 3300048929 Bacteria 46936
777 Ga0496126_0037867 3300048929 Bacteria 4493
778 Ga0496126_0077938 3300048929 Bacteria 2937
779 Ga0496126_0082380 3300048929 Bacteria 2843
780 Ga0496126_0259673 3300048929 Bacteria 1445
781 Ga0496126_0417274 3300048929 Unclassified 1086
782 Ga0495678_001683 3300049459 Bacteria 16763
783 Ga0495682_0000592 3300049460 Bacteria 24625
784 Ga0495682_0005886 3300049460 Bacteria 5032
785 Ga0501290_000376 3300049513 Bacteria 7078
786 Ga0501298_005067 3300049521 Bacteria 2098
787 Ga0501299_009933 3300049522 Bacteria 1580
788 Ga0501300_010377 3300049523 Bacteria 1359
789 Ga0501031_0008845 3300049568 Bacteria 6547
790 Ga0501032_0002377 3300049569 Bacteria 14696
791 Ga0501032_0009421 3300049569 Bacteria 7077
792 Ga0501032_0186104 3300049569 Bacteria 1358
793 Ga0501033_0060374 3300049570 Bacteria 2798
794 Ga0501034_0110665 3300049571 Bacteria 2737
795 Ga0501034_0158249 3300049571 Bacteria 2238
796 Ga0501034_0214661 3300049571 Bacteria 1878
797 Ga0501034_0333914 3300049571 Bacteria 1447
798 Ga0501036_0068231 3300049572 Bacteria 3009
799 Ga0501037_0001786 3300049573 Bacteria 15607
800 Ga0501037_0108833 3300049573 Bacteria 1997
801 Ga0501038_0013274 3300049574 Bacteria 7513
802 Ga0501038_0286619 3300049574 Bacteria 1295
803 Ga0501039_0016576 3300049575 Bacteria 5644
804 Ga0501039_0188814 3300049575 Bacteria 1621
805 Ga0501040_0049683 3300049576 Bacteria 2868
806 Ga0501043_0000004 3300049579 Bacteria 291085
807 Ga0501043_0014311 3300049579 Bacteria 6208
808 Ga0501043_0051364 3300049579 Bacteria 3239
809 Ga0501043_0101683 3300049579 Bacteria 2259
810 Ga0501043_0144710 3300049579 Bacteria 1861
811 Ga0501043_0251255 3300049579 Bacteria 1362
812 Ga0501046_0000016 3300049580 Bacteria 234374
813 Ga0501046_0001067 3300049580 Bacteria 26860
814 Ga0501046_0361178 3300049580 Bacteria 1053
815 Ga0501046_0394927 3300049580 Bacteria 1000
816 Ga0501047_0000012 3300049581 Bacteria 368824
817 Ga0501047_0010222 3300049581 Bacteria 8874
818 Ga0501047_0012660 3300049581 Bacteria 7991
819 Ga0501047_0032841 3300049581 Bacteria 5011
820 Ga0501047_0067393 3300049581 Bacteria 3449
821 Ga0501047_0222711 3300049581 Bacteria 1742
822 Ga0501047_0475506 3300049581 Bacteria 1077
823 Ga0501048_0037281 3300049582 Bacteria 3491
824 Ga0501067_0000848 3300049583 Bacteria 16476
825 Ga0501068_0000617 3300049584 Bacteria 18103
826 Ga0501068_0098348 3300049584 Bacteria 1812
827 Ga0501069_0040598 3300049585 Bacteria 2572
828 Ga0501069_0236578 3300049585 Bacteria 1064
829 Ga0501070_0000303 3300049586 Bacteria 45531
830 Ga0501070_0002582 3300049586 Bacteria 15833
831 Ga0501070_0010641 3300049586 Bacteria 7776
832 Ga0501070_0027717 3300049586 Bacteria 4752
833 Ga0501070_0036559 3300049586 Bacteria 4100
834 Ga0501070_0079526 3300049586 Bacteria 2713
835 Ga0501070_0261101 3300049586 Bacteria 1415
836 Ga0501070_0335079 3300049586 Bacteria 1229
837 Ga0501073_0000010 3300049589 Bacteria 171144
838 Ga0501073_0038823 3300049589 Bacteria 3376
839 Ga0501073_0044972 3300049589 Bacteria 3111
840 Ga0501073_0048654 3300049589 Bacteria 2976
841 Ga0501074_0003264 3300049590 Bacteria 11457
842 Ga0501077_0000020 3300049593 Bacteria 80360
843 Ga0501077_0404250 3300049593 Bacteria 873
844 Ga0501079_0072909 3300049741 Bacteria 2654
845 Ga0501080_0006640 3300049742 Bacteria 10405
846 Ga0501080_0007518 3300049742 Bacteria 9841
847 Ga0501080_0019639 3300049742 Bacteria 6260
848 Ga0501080_0034822 3300049742 Bacteria 4703
849 Ga0501080_0037099 3300049742 Bacteria 4551
850 Ga0501083_0015283 3300049744 Bacteria 5376
851 Ga0501083_0219020 3300049744 Bacteria 1240
852 Ga0501265_000970 3300049762 Bacteria 3227
853 Ga0501275_000183 3300049772 Bacteria 7187
854 Ga0501280_017566 3300049776 Bacteria 1041
855 Ga0501035_0013770 3300049822 Bacteria 7465
856 Ga0501035_0060195 3300049822 Bacteria 3381
857 Ga0501035_0081390 3300049822 Bacteria 2858
858 Ga0501035_0147171 3300049822 Bacteria 2045
859 Ga0501044_0012237 3300049823 Bacteria 9291
860 Ga0501044_0016416 3300049823 Bacteria 7948
861 Ga0501044_0032343 3300049823 Bacteria 5500
862 Ga0501044_0059893 3300049823 Bacteria 3900
863 Ga0501045_0020112 3300049824 Bacteria 4766
864 nmdc:mga0yw44_186648_c1 3300050492 Bacteria 1366
865 nmdc:mga05p37_16474_c1 3300050507 Bacteria 8904
866 nmdc:mga05p37_694_c1 3300050507 Bacteria 37343
867 nmdc:mga09592_404502_c1 3300050508 Bacteria 1180
868 nmdc:mga09592_62130_c1 3300050508 Bacteria 3160
869 nmdc:mga0qj67_228_c1 3300050509 Bacteria 38249
870 nmdc:mga0qj67_450972_c1 3300050509 Bacteria 1036
871 nmdc:mga06r32_1123_c1 3300050510 Bacteria 23971
872 nmdc:mga06r32_1145_c1 3300050510 Bacteria 23824
873 nmdc:mga06r32_31_c1 3300050510 Bacteria 84127
874 nmdc:mga08y16_10451_c1 3300050511 Bacteria 9737
875 nmdc:mga08y16_27836_c1 3300050511 Bacteria 5957
876 nmdc:mga08y16_85150_c1 3300050511 Bacteria 3294
877 nmdc:mga0a205_192793_c1 3300050515 Bacteria 1929
878 nmdc:mga0sz30_8079_c1 3300050516 Bacteria 3964
879 Ga0500610_0000196 3300053079 Bacteria 18435
880 Ga0500643_000211 3300053087 Bacteria 54924
881 Ga0500583_0007954 3300053092 Bacteria 3771
882 Ga0500555_011416 3300053103 Bacteria 2551
883 Ga0500642_0035598 3300053130 Bacteria 2115
884 Ga0500655_003841 3300053133 Bacteria 2712
885 Ga0500658_0001988 3300053134 Bacteria 7989
886 Ga0500559_0000239 3300053136 Bacteria 43769
887 Ga0500559_0002389 3300053136 Bacteria 9751
888 Ga0500564_071224 3300053138 Bacteria 1567
889 Ga0500604_0001101 3300053151 Bacteria 7507
890 Ga0500616_0081439 3300053153 Bacteria 1626
891 Ga0500619_000142 3300053154 Bacteria 17663
892 Ga0500622_0024448 3300053156 Bacteria 3193
893 Ga0500636_0053868 3300053177 Bacteria 2360
894 Ga0500645_015778 3300053730 Bacteria 2388
895 Ga0500587_004922 3300053739 Bacteria 1818
896 Ga0500661_000087 3300055283 Bacteria 14826
897 Ga0500661_020546 3300055283 Bacteria 1173
898 Ga0501082_0227294 3300060353 Bacteria 1624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0020966 Ga0495633_0020966_387_1100 228
2 3300042131 Ga0450894_021614 Ga0450894_021614_112_819 232
3 3300041507 Ga0451851_0568421 Ga0451851_0568421_16_765 245
4 3300013100 Ga0157373_10158281 Ga0157373_101582812 247
5 3300046492 Ga0495585_0017935 Ga0495585_0017935_911_1666 248
6 3300048916 Ga0496113_0294734 Ga0496113_0294734_51_806 248
7 3300001904 JGI24736J21556_1016497 JGI24736J21556_10164972 250
8 3300001915 JGI24741J21665_1003437 JGI24741J21665_10034372 250
9 3300001979 JGI24740J21852_10000727 JGI24740J21852_1000072710 250
10 3300001979 JGI24740J21852_10001960 JGI24740J21852_100019602 250
11 3300005329 Ga0070683_100179651 Ga0070683_1001796512 250
12 3300005336 Ga0070680_100002154 Ga0070680_1000021547 250
13 3300005337 Ga0070682_100009177 Ga0070682_1000091772 250
14 3300005341 Ga0070691_10000094 Ga0070691_100000944 250
15 3300005366 Ga0070659_100160227 Ga0070659_1001602271 250
16 3300005458 Ga0070681_10000783 Ga0070681_1000078313 250
17 3300005530 Ga0070679_100001730 Ga0070679_1000017307 250
18 3300005535 Ga0070684_100418005 Ga0070684_1004180052 250
19 3300005539 Ga0068853_100289314 Ga0068853_1002893141 250
20 3300005546 Ga0070696_100012785 Ga0070696_1000127854 250
21 3300005547 Ga0070693_100099156 Ga0070693_1000991562 250
22 3300005614 Ga0068856_100052307 Ga0068856_1000523072 250
23 3300005614 Ga0068856_100312381 Ga0068856_1003123812 250
24 3300005616 Ga0068852_100063861 Ga0068852_1000638612 250
25 3300005834 Ga0068851_10014972 Ga0068851_100149722 250
26 3300013307 Ga0157372_10016287 Ga0157372_100162878 250
27 3300020069 Ga0197907_11148482 Ga0197907_111484821 250
28 3300020082 Ga0206353_10620874 Ga0206353_106208743 250
29 3300025321 Ga0207656_10010628 Ga0207656_100106282 250
30 3300025904 Ga0207647_10001545 Ga0207647_100015453 250
31 3300025909 Ga0207705_10011888 Ga0207705_100118883 250
32 3300025909 Ga0207705_10041301 Ga0207705_100413012 250
33 3300025911 Ga0207654_10050904 Ga0207654_100509043 250
34 3300025912 Ga0207707_10000493 Ga0207707_1000049313 250
35 3300025912 Ga0207707_10000630 Ga0207707_1000063015 250
36 3300025912 Ga0207707_10042221 Ga0207707_100422213 250
37 3300025913 Ga0207695_10004476 Ga0207695_1000447618 250
38 3300025913 Ga0207695_10019150 Ga0207695_100191502 250
39 3300025917 Ga0207660_10000570 Ga0207660_100005707 250
40 3300025917 Ga0207660_10000885 Ga0207660_1000088513 250
41 3300025917 Ga0207660_10002187 Ga0207660_100021872 250
42 3300025920 Ga0207649_10001342 Ga0207649_1000134210 250
43 3300025920 Ga0207649_10173141 Ga0207649_101731412 250
44 3300025921 Ga0207652_10000152 Ga0207652_1000015263 250
45 3300025921 Ga0207652_10001326 Ga0207652_100013266 250
46 3300025921 Ga0207652_10003549 Ga0207652_100035492 250
47 3300025921 Ga0207652_10163546 Ga0207652_101635462 250
48 3300025924 Ga0207694_10070569 Ga0207694_100705692 250
49 3300025932 Ga0207690_10020303 Ga0207690_100203032 250
50 3300025933 Ga0207706_10102892 Ga0207706_101028922 250
51 3300025944 Ga0207661_10000457 Ga0207661_1000045728 250
52 3300025945 Ga0207679_10005902 Ga0207679_100059025 250
53 3300025949 Ga0207667_10085069 Ga0207667_100850692 250
54 3300025949 Ga0207667_10097346 Ga0207667_100973462 250
55 3300025981 Ga0207640_10001114 Ga0207640_100011146 250
56 3300026041 Ga0207639_10004251 Ga0207639_100042513 250
57 3300026078 Ga0207702_10046486 Ga0207702_100464862 250
58 3300026078 Ga0207702_10065837 Ga0207702_100658373 250
59 3300026116 Ga0207674_10250129 Ga0207674_102501292 250
60 3300049581 Ga0501047_0475506 Ga0501047_0475506_74_826 250
61 3300049586 Ga0501070_0261101 Ga0501070_0261101_629_1381 250
62 3300049822 Ga0501035_0060195 Ga0501035_0060195_1761_2537 252
63 3300049584 Ga0501068_0000617 Ga0501068_0000617_5620_6456 253
64 3300049586 Ga0501070_0079526 Ga0501070_0079526_1352_2188 253
65 3300049589 Ga0501073_0044972 Ga0501073_0044972_98_934 253
66 3300049593 Ga0501077_0404250 Ga0501077_0404250_23_859 253
67 3300049742 Ga0501080_0006640 Ga0501080_0006640_6553_7389 253
68 3300025893 Ga0207682_10116694 Ga0207682_101166941 256
69 3300013306 Ga0163162_10104471 Ga0163162_101044711 258
70 3300014326 Ga0157380_10439215 Ga0157380_104392152 258
71 3300025940 Ga0207691_10220885 Ga0207691_102208852 258
72 3300028379 Ga0268266_10597230 Ga0268266_105972301 258
73 3300037466 Ga0395898_0373568 Ga0395898_0373568_128_961 258
74 3300037471 Ga0395905_0068570 Ga0395905_0068570_1387_2220 258
75 3300046692 Ga0495671_0003813 Ga0495671_0003813_1477_2340 258
76 3300047317 Ga0495604_0285296 Ga0495604_0285296_40_906 258
77 3300048905 Ga0496102_0024754 Ga0496102_0024754_1068_1934 258
78 3300048909 Ga0496106_0079818 Ga0496106_0079818_1263_2129 258
79 3300049569 Ga0501032_0002377 Ga0501032_0002377_650_1492 258
80 3300049579 Ga0501043_0051364 Ga0501043_0051364_123_965 258
81 3300049583 Ga0501067_0000848 Ga0501067_0000848_3925_4767 258
82 3300049589 Ga0501073_0000010 Ga0501073_0000010_28876_29718 258
83 3300049593 Ga0501077_0000020 Ga0501077_0000020_73977_74819 258
84 3300049742 Ga0501080_0037099 Ga0501080_0037099_3511_4353 258
85 3300049744 Ga0501083_0219020 Ga0501083_0219020_172_1014 258
86 3300049823 Ga0501044_0012237 Ga0501044_0012237_1909_2751 258
87 3300005329 Ga0070683_100001770 Ga0070683_1000017705 261
88 3300005535 Ga0070684_100229878 Ga0070684_1002298781 261
89 3300025944 Ga0207661_10094908 Ga0207661_100949082 261
90 3300028794 Ga0307515_10003144 Ga0307515_1000314434 261
91 3300005365 Ga0070688_100006549 Ga0070688_1000065492 262
92 3300005466 Ga0070685_10000002 Ga0070685_10000002201 262
93 3300005843 Ga0068860_100002839 Ga0068860_10000283911 262
94 3300009092 Ga0105250_10000003 Ga0105250_10000003131 262
95 3300025711 Ga0207696_1000004 Ga0207696_1000004502 262
96 3300025900 Ga0207710_10107373 Ga0207710_101073732 262
97 3300026088 Ga0207641_10035178 Ga0207641_100351785 262
98 3300028379 Ga0268266_10575526 Ga0268266_105755262 262
99 3300028381 Ga0268264_10000004 Ga0268264_10000004836 262
100 3300031251 Ga0265327_10002593 Ga0265327_100025939 262
101 3300041413 Ga0439465_0000927 Ga0439465_0000927_8440_9276 262
102 3300042007 Ga0439449_0010982 Ga0439449_0010982_2535_3371 262
103 3300028794 Ga0307515_10002783 Ga0307515_100027832 263
104 3300031456 Ga0307513_10051014 Ga0307513_100510144 263
105 3300031649 Ga0307514_10001537 Ga0307514_100015372 263
106 3300005272 Ga0065703_1019008 Ga0065703_10190082 264
107 3300006946 Ga0079104_1002293 Ga0079104_10022939 264
108 3300009011 Ga0105251_10000119 Ga0105251_100001199 264
109 3300009011 Ga0105251_10003742 Ga0105251_100037424 264
110 3300009101 Ga0105247_10000025 Ga0105247_10000025150 264
111 3300009174 Ga0105241_10000004 Ga0105241_10000004730 264
112 3300013100 Ga0157373_10000690 Ga0157373_100006904 264
113 3300014497 Ga0182008_10061615 Ga0182008_100616152 264
114 3300017792 Ga0163161_10000001 Ga0163161_10000001293 264
115 3300025711 Ga0207696_1000001 Ga0207696_1000001376 264
116 3300025735 Ga0207713_1000024 Ga0207713_1000024271 264
117 3300025735 Ga0207713_1000026 Ga0207713_100002659 264
118 3300025900 Ga0207710_10000140 Ga0207710_100001404 264
119 3300025911 Ga0207654_10000006 Ga0207654_10000006748 264
120 3300027111 Ga0209281_1000008 Ga0209281_100000854 264
121 3300042145 Ga0450906_005612 Ga0450906_005612_167_973 264
122 3300046453 Ga0495627_000018 Ga0495627_000018_248541_249383 264
123 3300046530 Ga0495654_0001734 Ga0495654_0001734_9184_10026 264
124 3300046794 Ga0495589_0000002 Ga0495589_0000002_292121_292963 264
125 3300048907 Ga0496104_0504365 Ga0496104_0504365_85_927 264
126 3300048919 Ga0496116_0000023 Ga0496116_0000023_261523_262365 264
127 3300048920 Ga0496117_0000463 Ga0496117_0000463_12465_13307 264
128 3300048921 Ga0496118_0003815 Ga0496118_0003815_14723_15565 264
129 3300048922 Ga0496119_0001891 Ga0496119_0001891_21773_22615 264
130 3300048922 Ga0496119_0004881 Ga0496119_0004881_1996_2838 264
131 3300048922 Ga0496119_0071410 Ga0496119_0071410_1014_1856 264
132 3300048923 Ga0496120_0000052 Ga0496120_0000052_126257_127099 264
133 3300048923 Ga0496120_0000137 Ga0496120_0000137_28917_29759 264
134 3300048927 Ga0496124_0000017 Ga0496124_0000017_200662_201504 264
135 3300014497 Ga0182008_10003099 Ga0182008_1000309910 266
136 3300015261 Ga0182006_1000989 Ga0182006_100098922 266
137 3300015265 Ga0182005_1001309 Ga0182005_100130911 266
138 3300031911 Ga0307412_10019498 Ga0307412_100194982 266
139 3300041404 Ga0439436_0000030 Ga0439436_0000030_2818_3666 266
140 3300046512 Ga0495610_0004378 Ga0495610_0004378_2364_3212 266
141 3300046691 Ga0495670_0013691 Ga0495670_0013691_1856_2704 266
142 3300048913 Ga0496110_0229649 Ga0496110_0229649_780_1646 266
143 3300048922 Ga0496119_0022598 Ga0496119_0022598_1410_2258 266
144 3300053730 Ga0500645_015778 Ga0500645_015778_60_917 266
145 3300041413 Ga0439465_0007670 Ga0439465_0007670_30_878 267
146 3300031911 Ga0307412_10035790 Ga0307412_100357902 268
147 iso_pu_bacteria 2571042365 2572256253 268
148 iso_pu_bacteria 2602042109 2603868028 268
149 iso_pu_bacteria 642555113 642619682 268
150 iso_pu_bacteria 2643221665 2644363800 270
151 iso_pu_bacteria 2744054655 2745161186 270
152 iso_pu_bacteria 2773857770 2774439561 270
153 iso_pu_bacteria 2919182534 2919186184 270
154 iso_pu_bacteria 2928515477 2928518588 270
155 iso_pu_bacteria 2998344455 2998344756 270
156 3300014326 Ga0157380_10112659 Ga0157380_101126592 271
157 3300046454 Ga0495592_0005606 Ga0495592_0005606_7626_8483 271
158 3300053138 Ga0500564_071224 Ga0500564_071224_362_1219 271
159 iso_pu_bacteria 8055693939 8055695332 271
160 3300005616 Ga0068852_100006182 Ga0068852_1000061822 272
161 3300006944 Ga0099823_1071482 Ga0099823_10714821 272
162 3300021361 Ga0213872_10004916 Ga0213872_100049165 272
163 3300025931 Ga0207644_10093888 Ga0207644_100938882 272
164 3300026142 Ga0207698_10006712 Ga0207698_100067128 272
165 3300031239 Ga0265328_10018922 Ga0265328_100189221 272
166 3300031250 Ga0265331_10002458 Ga0265331_1000245814 272
167 3300031251 Ga0265327_10000020 Ga0265327_10000020227 272
168 3300037312 Ga0395899_0012560 Ga0395899_0012560_561_1394 272
169 3300037418 Ga0395900_0044849 Ga0395900_0044849_3307_4140 272
170 3300037466 Ga0395898_0061237 Ga0395898_0061237_2388_3221 272
171 3300037471 Ga0395905_0049852 Ga0395905_0049852_2609_3442 272
172 3300038443 Ga0395901_0324823 Ga0395901_0324823_344_1177 272
173 3300039447 Ga0436361_0106903 Ga0436361_0106903_4737_5567 272
174 3300044656 Ga0466969_0006906 Ga0466969_0006906_4184_5026 272
175 3300044683 Ga0466965_0074706 Ga0466965_0074706_852_1694 272
176 3300044684 Ga0466966_0020484 Ga0466966_0020484_2833_3675 272
177 3300044693 Ga0466961_0000063 Ga0466961_0000063_19050_19892 272
178 3300044706 Ga0466964_0042457 Ga0466964_0042457_228_1070 272
179 3300045049 Ga0466959_0057743 Ga0466959_0057743_354_1196 272
180 3300045049 Ga0466959_0145120 Ga0466959_0145120_782_1624 272
181 3300046525 Ga0495663_0005993 Ga0495663_0005993_2289_3140 272
182 3300047318 Ga0495636_0001826 Ga0495636_0001826_4476_5318 272
183 3300047318 Ga0495636_0012157 Ga0495636_0012157_606_1445 272
184 3300048915 Ga0496112_0048314 Ga0496112_0048314_520_1350 272
185 3300048916 Ga0496113_0099775 Ga0496113_0099775_281_1111 272
186 3300048929 Ga0496126_0417274 Ga0496126_0417274_96_938 272
187 3300049523 Ga0501300_010377 Ga0501300_010377_141_977 272
188 3300049571 Ga0501034_0158249 Ga0501034_0158249_690_1529 272
189 3300049571 Ga0501034_0333914 Ga0501034_0333914_377_1219 272
190 3300049581 Ga0501047_0012660 Ga0501047_0012660_6100_6930 272
191 iso_pu_bacteria 2506520007 2506577583 272
192 iso_pu_bacteria 2506520008 2506582721 272
193 iso_pu_bacteria 2508501071 2508851520 272
194 iso_pu_bacteria 2654587920 2656277470 272
195 iso_pu_bacteria 2654587920 2656279079 272
196 iso_pu_bacteria 2687453601 2689444061 272
197 iso_pu_bacteria 2739367655 2739612110 272
198 iso_pu_bacteria 2772190666 2772438102 272
199 iso_pu_bacteria 2847085930 2847086700 272
200 iso_pu_bacteria 2869551831 2869553427 272
201 iso_pu_bacteria 2888366609 2888368117 272
202 iso_pu_bacteria 2888373701 2888374266 272
203 iso_pu_bacteria 2904504865 2904505326 272
204 iso_pu_bacteria 2908669403 2908672350 272
205 iso_pu_bacteria 2932406140 2932408457 272
206 iso_pu_bacteria 2937967321 2937969846 272
207 iso_pu_bacteria 2939577877 2939580118 272
208 iso_pu_bacteria 640753048 640937088 272
209 iso_pu_bacteria 8004592986 8004597589 272
210 iso_pu_bacteria 8015394850 8015397185 272
211 3300039447 Ga0436361_0959303 Ga0436361_0959303_1087_1920 273
212 iso_pu_bacteria 2643221603 2644028743 273
213 iso_pu_bacteria 2837678835 2837679331 273
214 iso_pu_bacteria 2837678835 2837682809 273
215 3300005295 Ga0065707_10152917 Ga0065707_101529172 274
216 3300005331 Ga0070670_100000001 Ga0070670_100000001146 274
217 3300005335 Ga0070666_10021808 Ga0070666_100218084 274
218 3300005353 Ga0070669_100005867 Ga0070669_1000058677 274
219 3300005355 Ga0070671_100000042 Ga0070671_10000004254 274
220 3300005367 Ga0070667_100000096 Ga0070667_10000009627 274
221 3300005548 Ga0070665_100016024 Ga0070665_1000160243 274
222 3300005617 Ga0068859_100076339 Ga0068859_1000763391 274
223 3300005618 Ga0068864_100000006 Ga0068864_100000006149 274
224 3300005841 Ga0068863_100376721 Ga0068863_1003767211 274
225 3300005842 Ga0068858_100146898 Ga0068858_1001468982 274
226 3300005844 Ga0068862_100005935 Ga0068862_1000059359 274
227 3300006931 Ga0097620_100076340 Ga0097620_1000763401 274
228 3300009036 Ga0105244_10021059 Ga0105244_100210592 274
229 3300009148 Ga0105243_10000343 Ga0105243_1000034349 274
230 3300009177 Ga0105248_10049066 Ga0105248_100490662 274
231 3300009553 Ga0105249_10012855 Ga0105249_100128558 274
232 3300013102 Ga0157371_10000859 Ga0157371_1000085910 274
233 3300013296 Ga0157374_10005615 Ga0157374_100056158 274
234 3300013307 Ga0157372_10003428 Ga0157372_1000342815 274
235 3300013307 Ga0157372_10193077 Ga0157372_101930771 274
236 3300013307 Ga0157372_10748986 Ga0157372_107489861 274
237 3300014325 Ga0163163_10000032 Ga0163163_1000003291 274
238 3300025272 Ga0209455_1000474 Ga0209455_100047415 274
239 3300025711 Ga0207696_1015415 Ga0207696_10154153 274
240 3300025728 Ga0207655_1000840 Ga0207655_100084014 274
241 3300025728 Ga0207655_1004274 Ga0207655_10042742 274
242 3300025903 Ga0207680_10005909 Ga0207680_100059094 274
243 3300025923 Ga0207681_10002504 Ga0207681_100025046 274
244 3300025923 Ga0207681_10008671 Ga0207681_100086717 274
245 3300025925 Ga0207650_10000002 Ga0207650_10000002825 274
246 3300025931 Ga0207644_10000076 Ga0207644_1000007634 274
247 3300025935 Ga0207709_10000057 Ga0207709_10000057185 274
248 3300025941 Ga0207711_10003038 Ga0207711_100030382 274
249 3300025961 Ga0207712_10070940 Ga0207712_100709402 274
250 3300025986 Ga0207658_10000001 Ga0207658_10000001529 274
251 3300026088 Ga0207641_10007326 Ga0207641_100073262 274
252 3300026088 Ga0207641_10371967 Ga0207641_103719671 274
253 3300026095 Ga0207676_10000001 Ga0207676_10000001825 274
254 3300027312 Ga0209371_1000074 Ga0209371_100007422 274
255 3300027312 Ga0209371_1003036 Ga0209371_10030367 274
256 3300028379 Ga0268266_10009394 Ga0268266_1000939411 274
257 3300028379 Ga0268266_10058033 Ga0268266_100580333 274
258 3300028380 Ga0268265_10002058 Ga0268265_1000205811 274
259 3300030500 Ga0268256_1000067 Ga0268256_100006722 274
260 3300030500 Ga0268256_1002722 Ga0268256_10027224 274
261 3300041405 Ga0439438_000002 Ga0439438_000002_255147_255989 274
262 3300041405 Ga0439438_001667 Ga0439438_001667_4544_5386 274
263 3300041407 Ga0439447_002689 Ga0439447_002689_1062_1904 274
264 3300042006 Ga0439432_003014 Ga0439432_003014_3244_4086 274
265 3300046471 Ga0495650_0034341 Ga0495650_0034341_527_1489 274
266 3300047323 Ga0495683_0034847 Ga0495683_0034847_682_1581 274
267 3300047446 Ga0495679_023734 Ga0495679_023734_893_1855 274
268 3300048907 Ga0496104_0182274 Ga0496104_0182274_704_1666 274
269 3300048919 Ga0496116_0000132 Ga0496116_0000132_34180_35022 274
270 3300048921 Ga0496118_0063756 Ga0496118_0063756_1401_2363 274
271 3300048922 Ga0496119_0000012 Ga0496119_0000012_184893_185735 274
272 3300048922 Ga0496119_0000697 Ga0496119_0000697_1710_2672 274
273 3300048922 Ga0496119_0012385 Ga0496119_0012385_2359_3201 274
274 3300048923 Ga0496120_0000004 Ga0496120_0000004_226183_227025 274
275 3300048923 Ga0496120_0000048 Ga0496120_0000048_152109_152951 274
276 3300048923 Ga0496120_0018310 Ga0496120_0018310_3042_4004 274
277 3300048925 Ga0496122_0175875 Ga0496122_0175875_290_1252 274
278 3300048928 Ga0496125_0031549 Ga0496125_0031549_420_1256 274
279 3300049513 Ga0501290_000376 Ga0501290_000376_982_1872 274
280 3300049580 Ga0501046_0361178 Ga0501046_0361178_92_937 274
281 3300049762 Ga0501265_000970 Ga0501265_000970_559_1449 274
282 3300049772 Ga0501275_000183 Ga0501275_000183_4277_5167 274
283 iso_pu_bacteria 2643221644 2644248778 274
284 iso_pu_bacteria 2818991445 2819591724 274
285 iso_pu_bacteria 2883291878 2883294161 274
286 iso_pu_bacteria 2883354860 2883357313 274
287 iso_pu_bacteria 641228493 641335799 274
288 iso_pu_bacteria 643348555 643389611 274
289 3300005328 Ga0070676_10009222 Ga0070676_100092224 275
290 3300005347 Ga0070668_100001327 Ga0070668_1000013279 275
291 3300005353 Ga0070669_100003178 Ga0070669_1000031786 275
292 3300005457 Ga0070662_100005325 Ga0070662_1000053253 275
293 3300005458 Ga0070681_10071805 Ga0070681_100718052 275
294 3300005719 Ga0068861_100000011 Ga0068861_10000001114 275
295 3300005844 Ga0068862_100001082 Ga0068862_10000108221 275
296 3300009147 Ga0114129_10191059 Ga0114129_101910593 275
297 3300009553 Ga0105249_10015735 Ga0105249_100157356 275
298 3300011119 Ga0105246_10156332 Ga0105246_101563322 275
299 3300013306 Ga0163162_10189414 Ga0163162_101894143 275
300 3300014325 Ga0163163_10390726 Ga0163163_103907263 275
301 3300014325 Ga0163163_10774886 Ga0163163_107748861 275
302 3300025907 Ga0207645_10029620 Ga0207645_100296204 275
303 3300025912 Ga0207707_10179467 Ga0207707_101794673 275
304 3300025917 Ga0207660_10043674 Ga0207660_100436743 275
305 3300025920 Ga0207649_10090772 Ga0207649_100907722 275
306 3300025923 Ga0207681_10019340 Ga0207681_100193406 275
307 3300025932 Ga0207690_10080533 Ga0207690_100805332 275
308 3300025933 Ga0207706_10007611 Ga0207706_100076113 275
309 3300025961 Ga0207712_10052816 Ga0207712_100528163 275
310 3300026118 Ga0207675_100000254 Ga0207675_10000025440 275
311 3300028380 Ga0268265_10000889 Ga0268265_100008899 275
312 3300031251 Ga0265327_10000255 Ga0265327_100002554 275
313 3300049579 Ga0501043_0251255 Ga0501043_0251255_267_1121 275
314 3300049581 Ga0501047_0032841 Ga0501047_0032841_1435_2289 275
315 3300049586 Ga0501070_0036559 Ga0501070_0036559_1373_2227 275
316 3300049823 Ga0501044_0016416 Ga0501044_0016416_868_1722 275
317 iso_pu_bacteria 2537561836 2538832242 275
318 iso_pu_bacteria 2687453130 2687583799 275
319 iso_pu_bacteria 2884411467 2884412187 275
320 3300003791 Ga0055530_10001427 Ga0055530_1000142716 276
321 3300003792 Ga0055540_1000312 Ga0055540_100031237 276
322 3300003794 Ga0055531_10002021 Ga0055531_100020218 276
323 3300003794 Ga0055531_10005293 Ga0055531_100052932 276
324 3300005290 Ga0065712_10181904 Ga0065712_101819041 276
325 3300005293 Ga0065715_10116314 Ga0065715_101163143 276
326 3300005330 Ga0070690_100000447 Ga0070690_10000044721 276
327 3300005331 Ga0070670_100018619 Ga0070670_1000186197 276
328 3300005334 Ga0068869_100001940 Ga0068869_1000019409 276
329 3300005335 Ga0070666_10279265 Ga0070666_102792651 276
330 3300005337 Ga0070682_100063104 Ga0070682_1000631043 276
331 3300005338 Ga0068868_100139217 Ga0068868_1001392173 276
332 3300005341 Ga0070691_10091782 Ga0070691_100917822 276
333 3300005343 Ga0070687_100001347 Ga0070687_1000013474 276
334 3300005344 Ga0070661_100009331 Ga0070661_1000093318 276
335 3300005347 Ga0070668_100073379 Ga0070668_1000733793 276
336 3300005354 Ga0070675_100002389 Ga0070675_10000238913 276
337 3300005364 Ga0070673_100008457 Ga0070673_1000084573 276
338 3300005456 Ga0070678_100179449 Ga0070678_1001794492 276
339 3300005457 Ga0070662_100030662 Ga0070662_1000306623 276
340 3300005459 Ga0068867_100003630 Ga0068867_1000036306 276
341 3300005466 Ga0070685_10001947 Ga0070685_1000194712 276
342 3300005535 Ga0070684_100005357 Ga0070684_1000053577 276
343 3300005543 Ga0070672_100076371 Ga0070672_1000763712 276
344 3300005544 Ga0070686_100003983 Ga0070686_1000039839 276
345 3300005545 Ga0070695_100189659 Ga0070695_1001896592 276
346 3300005547 Ga0070693_100321376 Ga0070693_1003213761 276
347 3300005548 Ga0070665_100010439 Ga0070665_1000104393 276
348 3300005564 Ga0070664_100001499 Ga0070664_10000149921 276
349 3300005577 Ga0068857_100097504 Ga0068857_1000975042 276
350 3300005578 Ga0068854_100044088 Ga0068854_1000440883 276
351 3300005615 Ga0070702_100003933 Ga0070702_1000039337 276
352 3300005615 Ga0070702_100070632 Ga0070702_1000706323 276
353 3300005834 Ga0068851_10290590 Ga0068851_102905901 276
354 3300005841 Ga0068863_100006951 Ga0068863_10000695111 276
355 3300005842 Ga0068858_100163428 Ga0068858_1001634283 276
356 3300005843 Ga0068860_100016186 Ga0068860_1000161863 276
357 3300005844 Ga0068862_100006690 Ga0068862_1000066906 276
358 3300005844 Ga0068862_100514927 Ga0068862_1005149272 276
359 3300006237 Ga0097621_100443432 Ga0097621_1004434322 276
360 3300006358 Ga0068871_100039277 Ga0068871_1000392773 276
361 3300006844 Ga0075428_100124750 Ga0075428_1001247503 276
362 3300006846 Ga0075430_100002265 Ga0075430_10000226514 276
363 3300006846 Ga0075430_100002676 Ga0075430_1000026767 276
364 3300006847 Ga0075431_100000356 Ga0075431_10000035610 276
365 3300006847 Ga0075431_100002051 Ga0075431_10000205112 276
366 3300006880 Ga0075429_100000124 Ga0075429_10000012432 276
367 3300006880 Ga0075429_100365418 Ga0075429_1003654182 276
368 3300009011 Ga0105251_10004883 Ga0105251_100048835 276
369 3300009036 Ga0105244_10035527 Ga0105244_100355271 276
370 3300009094 Ga0111539_10039322 Ga0111539_100393224 276
371 3300009098 Ga0105245_10240483 Ga0105245_102404831 276
372 3300009101 Ga0105247_10168104 Ga0105247_101681042 276
373 3300009147 Ga0114129_10000468 Ga0114129_1000046835 276
374 3300009148 Ga0105243_10163652 Ga0105243_101636522 276
375 3300009177 Ga0105248_10015152 Ga0105248_1001515210 276
376 3300009553 Ga0105249_10031344 Ga0105249_100313444 276
377 3300010375 Ga0105239_10356963 Ga0105239_103569632 276
378 3300013102 Ga0157371_10003055 Ga0157371_1000305510 276
379 3300013104 Ga0157370_10026703 Ga0157370_100267034 276
380 3300013297 Ga0157378_10030770 Ga0157378_100307702 276
381 3300013306 Ga0163162_10011035 Ga0163162_100110353 276
382 3300013308 Ga0157375_10187900 Ga0157375_101879002 276
383 3300014745 Ga0157377_10077987 Ga0157377_100779872 276
384 3300014968 Ga0157379_10026338 Ga0157379_100263386 276
385 3300014969 Ga0157376_10104280 Ga0157376_101042803 276
386 3300025298 Ga0209050_1001937 Ga0209050_10019375 276
387 3300025303 Ga0209051_1000148 Ga0209051_100014817 276
388 3300025304 Ga0209257_1000044 Ga0209257_1000044442 276
389 3300025901 Ga0207688_10026201 Ga0207688_100262013 276
390 3300025903 Ga0207680_10040993 Ga0207680_100409932 276
391 3300025918 Ga0207662_10003779 Ga0207662_100037793 276
392 3300025920 Ga0207649_10009276 Ga0207649_100092762 276
393 3300025923 Ga0207681_10147531 Ga0207681_101475312 276
394 3300025926 Ga0207659_10003909 Ga0207659_100039094 276
395 3300025933 Ga0207706_10116872 Ga0207706_101168723 276
396 3300025935 Ga0207709_10185072 Ga0207709_101850722 276
397 3300025937 Ga0207669_10493689 Ga0207669_104936891 276
398 3300025940 Ga0207691_10129742 Ga0207691_101297422 276
399 3300025941 Ga0207711_10017130 Ga0207711_100171303 276
400 3300025942 Ga0207689_10016437 Ga0207689_100164376 276
401 3300025945 Ga0207679_10012080 Ga0207679_100120806 276
402 3300025960 Ga0207651_10005232 Ga0207651_100052323 276
403 3300025986 Ga0207658_10039925 Ga0207658_100399254 276
404 3300026023 Ga0207677_10211529 Ga0207677_102115292 276
405 3300026035 Ga0207703_10023876 Ga0207703_100238764 276
406 3300026088 Ga0207641_10010775 Ga0207641_100107759 276
407 3300026089 Ga0207648_10010315 Ga0207648_100103156 276
408 3300026095 Ga0207676_10002491 Ga0207676_100024912 276
409 3300026118 Ga0207675_100002172 Ga0207675_10000217211 276
410 3300026121 Ga0207683_10007149 Ga0207683_100071498 276
411 3300027876 Ga0209974_10007325 Ga0209974_100073252 276
412 3300028379 Ga0268266_10115292 Ga0268266_101152923 276
413 3300028381 Ga0268264_10063501 Ga0268264_100635013 276
414 3300031548 Ga0307408_100001241 Ga0307408_1000012415 276
415 3300031548 Ga0307408_100005662 Ga0307408_1000056623 276
416 3300031548 Ga0307408_100115871 Ga0307408_1001158712 276
417 3300031548 Ga0307408_100146841 Ga0307408_1001468412 276
418 3300031548 Ga0307408_100234916 Ga0307408_1002349162 276
419 3300031824 Ga0307413_10005441 Ga0307413_100054413 276
420 3300031852 Ga0307410_10005705 Ga0307410_100057053 276
421 3300031852 Ga0307410_10313875 Ga0307410_103138752 276
422 3300031901 Ga0307406_10008182 Ga0307406_100081824 276
423 3300031901 Ga0307406_10383547 Ga0307406_103835472 276
424 3300031911 Ga0307412_10157107 Ga0307412_101571072 276
425 3300031995 Ga0307409_100116224 Ga0307409_1001162242 276
426 3300031995 Ga0307409_100238273 Ga0307409_1002382732 276
427 3300032002 Ga0307416_100109787 Ga0307416_1001097872 276
428 3300032005 Ga0307411_10018164 Ga0307411_100181643 276
429 3300037312 Ga0395899_0092709 Ga0395899_0092709_641_1474 276
430 3300037471 Ga0395905_0012392 Ga0395905_0012392_4802_5644 276
431 3300037471 Ga0395905_0224513 Ga0395905_0224513_874_1716 276
432 3300042007 Ga0439449_0051101 Ga0439449_0051101_625_1461 276
433 3300044765 Ga0466970_0135904 Ga0466970_0135904_408_1250 276
434 3300045051 Ga0451576_0015523 Ga0451576_0015523_31_870 276
435 3300046491 Ga0495584_0139842 Ga0495584_0139842_46_915 276
436 3300046538 Ga0495609_0021833 Ga0495609_0021833_281_1123 276
437 3300046558 Ga0495633_0001422 Ga0495633_0001422_12410_13252 276
438 3300046660 Ga0495625_0002479 Ga0495625_0002479_17627_18472 276
439 3300046665 Ga0495661_0163840 Ga0495661_0163840_185_1027 276
440 3300046691 Ga0495670_0107157 Ga0495670_0107157_515_1363 276
441 3300046692 Ga0495671_0071006 Ga0495671_0071006_588_1430 276
442 3300048911 Ga0496108_0062186 Ga0496108_0062186_272_1111 276
443 3300048912 Ga0496109_0016390 Ga0496109_0016390_22_861 276
444 3300048912 Ga0496109_0024245 Ga0496109_0024245_2590_3483 276
445 3300048913 Ga0496110_0005377 Ga0496110_0005377_4704_5543 276
446 3300048913 Ga0496110_0078155 Ga0496110_0078155_1133_2026 276
447 3300048915 Ga0496112_0308978 Ga0496112_0308978_173_1012 276
448 3300048915 Ga0496112_0581175 Ga0496112_0581175_78_920 276
449 3300048929 Ga0496126_0082380 Ga0496126_0082380_682_1536 276
450 3300049460 Ga0495682_0000592 Ga0495682_0000592_15493_16335 276
451 3300049521 Ga0501298_005067 Ga0501298_005067_1185_2024 276
452 3300049522 Ga0501299_009933 Ga0501299_009933_143_982 276
453 3300049776 Ga0501280_017566 Ga0501280_017566_105_944 276
454 3300050507 nmdc:mga05p37_694_c1 nmdc:mga05p37_694_c1_27956_28807 276
455 3300050508 nmdc:mga09592_404502_c1 nmdc:mga09592_404502_c1_93_938 276
456 3300050509 nmdc:mga0qj67_228_c1 nmdc:mga0qj67_228_c1_28724_29575 276
457 3300050509 nmdc:mga0qj67_450972_c1 nmdc:mga0qj67_450972_c1_49_894 276
458 3300050510 nmdc:mga06r32_1145_c1 nmdc:mga06r32_1145_c1_2768_3613 276
459 3300050510 nmdc:mga06r32_31_c1 nmdc:mga06r32_31_c1_46723_47574 276
460 3300050511 nmdc:mga08y16_27836_c1 nmdc:mga08y16_27836_c1_2598_3449 276
461 3300050515 nmdc:mga0a205_192793_c1 nmdc:mga0a205_192793_c1_354_1193 276
462 3300053103 Ga0500555_011416 Ga0500555_011416_1098_1952 276
463 3300053153 Ga0500616_0081439 Ga0500616_0081439_211_1053 276
464 iso_pu_bacteria 2593339238 2595446839 276
465 iso_pu_bacteria 2718218334 2721026489 276
466 iso_pu_bacteria 2734482264 2735833514 276
467 iso_pu_bacteria 2895511927 2895513354 276
468 iso_pu_bacteria 2919085039 2919088292 276
469 3300005327 Ga0070658_10111842 Ga0070658_101118422 277
470 3300005331 Ga0070670_100312257 Ga0070670_1003122572 277
471 3300005336 Ga0070680_100259479 Ga0070680_1002594792 277
472 3300005339 Ga0070660_100400191 Ga0070660_1004001912 277
473 3300005340 Ga0070689_100061253 Ga0070689_1000612532 277
474 3300005341 Ga0070691_10026844 Ga0070691_100268442 277
475 3300005344 Ga0070661_100001262 Ga0070661_10000126213 277
476 3300005345 Ga0070692_10008406 Ga0070692_100084062 277
477 3300005365 Ga0070688_100207489 Ga0070688_1002074892 277
478 3300005366 Ga0070659_100203551 Ga0070659_1002035512 277
479 3300005366 Ga0070659_100410390 Ga0070659_1004103902 277
480 3300005455 Ga0070663_100014982 Ga0070663_1000149821 277
481 3300005455 Ga0070663_100021471 Ga0070663_1000214712 277
482 3300005457 Ga0070662_100035932 Ga0070662_1000359322 277
483 3300005457 Ga0070662_100438047 Ga0070662_1004380472 277
484 3300005458 Ga0070681_10000450 Ga0070681_100004505 277
485 3300005466 Ga0070685_10135439 Ga0070685_101354392 277
486 3300005530 Ga0070679_100000455 Ga0070679_10000045533 277
487 3300005539 Ga0068853_100115153 Ga0068853_1001151532 277
488 3300005548 Ga0070665_100152388 Ga0070665_1001523882 277
489 3300005564 Ga0070664_100009538 Ga0070664_1000095383 277
490 3300005564 Ga0070664_100035157 Ga0070664_1000351573 277
491 3300005564 Ga0070664_100078684 Ga0070664_1000786844 277
492 3300005564 Ga0070664_100615292 Ga0070664_1006152922 277
493 3300005577 Ga0068857_100410436 Ga0068857_1004104361 277
494 3300005578 Ga0068854_100009198 Ga0068854_1000091985 277
495 3300005937 Ga0081455_10001291 Ga0081455_100012917 277
496 3300006358 Ga0068871_100254808 Ga0068871_1002548081 277
497 3300006844 Ga0075428_100000232 Ga0075428_10000023225 277
498 3300006847 Ga0075431_100000011 Ga0075431_10000001111 277
499 3300009093 Ga0105240_10101977 Ga0105240_101019772 277
500 3300009094 Ga0111539_10000664 Ga0111539_1000066424 277
501 3300009094 Ga0111539_10006216 Ga0111539_1000621614 277
502 3300009147 Ga0114129_10021817 Ga0114129_100218176 277
503 3300009174 Ga0105241_10023212 Ga0105241_100232122 277
504 3300009551 Ga0105238_10010144 Ga0105238_100101446 277
505 3300009551 Ga0105238_10119179 Ga0105238_101191792 277
506 3300013102 Ga0157371_10017014 Ga0157371_100170142 277
507 3300013102 Ga0157371_10363533 Ga0157371_103635331 277
508 3300013104 Ga0157370_10138986 Ga0157370_101389862 277
509 3300013105 Ga0157369_10049372 Ga0157369_100493722 277
510 3300013307 Ga0157372_10183168 Ga0157372_101831681 277
511 3300025913 Ga0207695_10020009 Ga0207695_100200093 277
512 3300025917 Ga0207660_10194922 Ga0207660_101949222 277
513 3300025919 Ga0207657_10011422 Ga0207657_100114223 277
514 3300025920 Ga0207649_10009056 Ga0207649_100090563 277
515 3300025920 Ga0207649_10160776 Ga0207649_101607763 277
516 3300025926 Ga0207659_10366503 Ga0207659_103665032 277
517 3300025932 Ga0207690_10162513 Ga0207690_101625132 277
518 3300025945 Ga0207679_10032717 Ga0207679_100327173 277
519 3300025949 Ga0207667_10022933 Ga0207667_100229334 277
520 3300025981 Ga0207640_10003251 Ga0207640_100032513 277
521 3300026041 Ga0207639_10014895 Ga0207639_100148953 277
522 3300026067 Ga0207678_10008993 Ga0207678_100089935 277
523 3300026075 Ga0207708_10046326 Ga0207708_100463263 277
524 3300026142 Ga0207698_10001050 Ga0207698_1000105010 277
525 3300027907 Ga0207428_10002738 Ga0207428_1000273811 277
526 3300031548 Ga0307408_100121193 Ga0307408_1001211932 277
527 3300031728 Ga0316578_10090013 Ga0316578_100900132 277
528 3300031901 Ga0307406_10120968 Ga0307406_101209683 277
529 3300031911 Ga0307412_10025910 Ga0307412_100259103 277
530 3300031911 Ga0307412_10100305 Ga0307412_101003054 277
531 3300032005 Ga0307411_10221493 Ga0307411_102214932 277
532 3300034957 Ga0373938_0047595 Ga0373938_0047595_16_870 277
533 3300035398 Ga0316574_0076614 Ga0316574_0076614_616_1458 277
534 3300036712 Ga0316584_0031022 Ga0316584_0031022_1238_2092 277
535 3300037312 Ga0395899_0068872 Ga0395899_0068872_1513_2349 277
536 3300037312 Ga0395899_0350286 Ga0395899_0350286_64_900 277
537 3300037418 Ga0395900_0043547 Ga0395900_0043547_870_1706 277
538 3300037418 Ga0395900_0128880 Ga0395900_0128880_373_1209 277
539 3300037466 Ga0395898_0317466 Ga0395898_0317466_528_1364 277
540 3300038443 Ga0395901_0040382 Ga0395901_0040382_3901_4737 277
541 3300038443 Ga0395901_0245002 Ga0395901_0245002_521_1357 277
542 3300041452 Ga0451793_1620920 Ga0451793_1620920_41_886 277
543 3300044842 Ga0466957_0150204 Ga0466957_0150204_220_1071 277
544 3300046460 Ga0495638_0000038 Ga0495638_0000038_204174_205019 277
545 3300046474 Ga0495605_0011963 Ga0495605_0011963_2870_3811 277
546 3300046492 Ga0495585_0022088 Ga0495585_0022088_1990_2931 277
547 3300046501 Ga0495607_0025850 Ga0495607_0025850_1089_2030 277
548 3300046501 Ga0495607_0054685 Ga0495607_0054685_747_1661 277
549 3300046506 Ga0495583_0000067 Ga0495583_0000067_44727_45668 277
550 3300046523 Ga0495644_0009116 Ga0495644_0009116_2028_2969 277
551 3300046523 Ga0495644_0013429 Ga0495644_0013429_164_1078 277
552 3300046524 Ga0495648_0001359 Ga0495648_0001359_20803_21744 277
553 3300046525 Ga0495663_0024306 Ga0495663_0024306_640_1485 277
554 3300046538 Ga0495609_0001124 Ga0495609_0001124_6161_7102 277
555 3300046615 Ga0495656_0007691 Ga0495656_0007691_2184_3125 277
556 3300046648 Ga0495611_0001009 Ga0495611_0001009_5282_6223 277
557 3300046648 Ga0495611_0003480 Ga0495611_0003480_189_1103 277
558 3300046664 Ga0495659_0000529 Ga0495659_0000529_695_1636 277
559 3300046684 Ga0495669_0054233 Ga0495669_0054233_855_1700 277
560 3300046691 Ga0495670_0005679 Ga0495670_0005679_3094_4035 277
561 3300046691 Ga0495670_0012033 Ga0495670_0012033_36_881 277
562 3300046692 Ga0495671_0006426 Ga0495671_0006426_4243_5184 277
563 3300047318 Ga0495636_0000126 Ga0495636_0000126_18642_19583 277
564 3300047320 Ga0495672_0021078 Ga0495672_0021078_1308_2249 277
565 3300047323 Ga0495683_0002800 Ga0495683_0002800_3884_4825 277
566 3300047443 Ga0495687_001241 Ga0495687_001241_19976_20917 277
567 3300047445 Ga0495677_0009136 Ga0495677_0009136_1608_2549 277
568 3300047447 Ga0495685_000011 Ga0495685_000011_20803_21744 277
569 3300047469 Ga0495673_0011344 Ga0495673_0011344_1377_2318 277
570 3300049459 Ga0495678_001683 Ga0495678_001683_1046_1987 277
571 3300049460 Ga0495682_0005886 Ga0495682_0005886_2314_3255 277
572 3300049576 Ga0501040_0049683 Ga0501040_0049683_322_1215 277
573 3300049581 Ga0501047_0222711 Ga0501047_0222711_60_899 277
574 3300049585 Ga0501069_0040598 Ga0501069_0040598_1688_2524 277
575 3300049585 Ga0501069_0236578 Ga0501069_0236578_46_882 277
576 3300049586 Ga0501070_0000303 Ga0501070_0000303_2792_3628 277
577 3300049586 Ga0501070_0002582 Ga0501070_0002582_14207_15043 277
578 3300049586 Ga0501070_0335079 Ga0501070_0335079_104_940 277
579 3300050507 nmdc:mga05p37_16474_c1 nmdc:mga05p37_16474_c1_4374_5216 277
580 3300050508 nmdc:mga09592_62130_c1 nmdc:mga09592_62130_c1_1938_2780 277
581 3300050510 nmdc:mga06r32_1123_c1 nmdc:mga06r32_1123_c1_20444_21286 277
582 3300050511 nmdc:mga08y16_10451_c1 nmdc:mga08y16_10451_c1_1937_2779 277
583 3300050511 nmdc:mga08y16_85150_c1 nmdc:mga08y16_85150_c1_710_1558 277
584 3300053087 Ga0500643_000211 Ga0500643_000211_4671_5516 277
585 3300053134 Ga0500658_0001988 Ga0500658_0001988_497_1546 277
586 3300053136 Ga0500559_0002389 Ga0500559_0002389_712_1557 277
587 3300055283 Ga0500661_000087 Ga0500661_000087_862_1707 277
588 3300001990 JGI24737J22298_10019089 JGI24737J22298_100190892 278
589 3300002704 JGI25155J39150_1000091 JGI25155J39150_100009130 278
590 3300002705 JGI25156J39149_1000127 JGI25156J39149_100012718 278
591 3300002737 JGI25162J39368_1001785 JGI25162J39368_10017853 278
592 3300002738 JGI25154J39366_1000038 JGI25154J39366_100003833 278
593 3300002741 JGI25157J39369_1000126 JGI25157J39369_100012653 278
594 3300002741 JGI25157J39369_1000155 JGI25157J39369_100015518 278
595 3300002771 JGI25163J39215_1000835 JGI25163J39215_10008355 278
596 3300002772 JGI25164J39214_1000012 JGI25164J39214_1000012247 278
597 3300003214 JGI25165J46597_1000048 JGI25165J46597_10000483 278
598 3300003320 rootH2_10014854 rootH2_1001485413 278
599 3300003320 rootH2_10023780 rootH2_100237802 278
600 3300003323 rootH1_10106964 rootH1_101069643 278
601 3300003578 Ga0006562J51391_1071442 Ga0006562J51391_10714422 278
602 3300003578 Ga0006562J51391_1071443 Ga0006562J51391_10714432 278
603 3300003751 Ga0055538_1000486 Ga0055538_10004862 278
604 3300003758 Ga0055532_1000023 Ga0055532_100002372 278
605 3300003761 Ga0055535_1000151 Ga0055535_10001513 278
606 3300003761 Ga0055535_1007606 Ga0055535_10076062 278
607 3300003762 Ga0055542_1000034 Ga0055542_1000034230 278
608 3300003763 Ga0055529_1001207 Ga0055529_10012073 278
609 3300005327 Ga0070658_10005302 Ga0070658_100053028 278
610 3300005335 Ga0070666_10000005 Ga0070666_10000005167 278
611 3300005435 Ga0070714_100009475 Ga0070714_1000094754 278
612 3300005439 Ga0070711_100156049 Ga0070711_1001560492 278
613 3300005455 Ga0070663_100000972 Ga0070663_10000097210 278
614 3300005455 Ga0070663_100132995 Ga0070663_1001329953 278
615 3300005456 Ga0070678_100106696 Ga0070678_1001066962 278
616 3300005457 Ga0070662_100009243 Ga0070662_1000092434 278
617 3300005548 Ga0070665_100007655 Ga0070665_1000076554 278
618 3300005563 Ga0068855_100275441 Ga0068855_1002754412 278
619 3300005578 Ga0068854_100002703 Ga0068854_10000270312 278
620 3300005614 Ga0068856_100071101 Ga0068856_1000711012 278
621 3300005616 Ga0068852_100023505 Ga0068852_1000235052 278
622 3300005719 Ga0068861_100000527 Ga0068861_1000005273 278
623 3300005834 Ga0068851_10035096 Ga0068851_100350963 278
624 3300006028 Ga0070717_10003860 Ga0070717_1000386010 278
625 3300006051 Ga0075364_10000064 Ga0075364_100000647 278
626 3300006173 Ga0070716_100112461 Ga0070716_1001124611 278
627 3300006847 Ga0075431_100099351 Ga0075431_1000993512 278
628 3300009093 Ga0105240_10001418 Ga0105240_1000141812 278
629 3300009093 Ga0105240_10019239 Ga0105240_1001923911 278
630 3300009093 Ga0105240_10105572 Ga0105240_101055723 278
631 3300009545 Ga0105237_10000064 Ga0105237_1000006482 278
632 3300009545 Ga0105237_10001115 Ga0105237_1000111523 278
633 3300009551 Ga0105238_10000759 Ga0105238_100007597 278
634 3300009551 Ga0105238_10008308 Ga0105238_100083082 278
635 3300010375 Ga0105239_10000030 Ga0105239_10000030207 278
636 3300010375 Ga0105239_10001815 Ga0105239_1000181516 278
637 3300012500 Ga0157314_1000429 Ga0157314_10004292 278
638 3300012502 Ga0157347_1009181 Ga0157347_10091811 278
639 3300013102 Ga0157371_10000060 Ga0157371_1000006032 278
640 3300013306 Ga0163162_10001186 Ga0163162_1000118611 278
641 3300014326 Ga0157380_10506155 Ga0157380_105061552 278
642 3300014497 Ga0182008_10048757 Ga0182008_100487572 278
643 3300014969 Ga0157376_10065588 Ga0157376_100655883 278
644 3300015261 Ga0182006_1007482 Ga0182006_10074822 278
645 3300015262 Ga0182007_10015156 Ga0182007_100151562 278
646 3300025206 Ga0209435_100013 Ga0209435_100013186 278
647 3300025207 Ga0209760_100447 Ga0209760_1004478 278
648 3300025224 Ga0209784_100016 Ga0209784_1000164 278
649 3300025228 Ga0209672_101053 Ga0209672_10105310 278
650 3300025229 Ga0209147_100030 Ga0209147_100030168 278
651 3300025231 Ga0207427_100019 Ga0207427_100019409 278
652 3300025233 Ga0209437_100054 Ga0209437_100054102 278
653 3300025233 Ga0209437_100208 Ga0209437_10020888 278
654 3300025242 Ga0209258_100039 Ga0209258_1000394 278
655 3300025242 Ga0209258_100734 Ga0209258_10073411 278
656 3300025246 Ga0209646_1000034 Ga0209646_1000034186 278
657 3300025246 Ga0209646_1001310 Ga0209646_10013105 278
658 3300025250 Ga0209026_1000012 Ga0209026_1000012481 278
659 3300025250 Ga0209026_1000022 Ga0209026_1000022186 278
660 3300025254 Ga0209148_1000001 Ga0209148_10000011274 278
661 3300025256 Ga0209759_1000018 Ga0209759_1000018186 278
662 3300025256 Ga0209759_1000404 Ga0209759_100040438 278
663 3300025258 Ga0209129_1006513 Ga0209129_10065132 278
664 3300025261 Ga0209233_1000002 Ga0209233_1000002956 278
665 3300025272 Ga0209455_1000039 Ga0209455_10000394 278
666 3300025272 Ga0209455_1002189 Ga0209455_10021893 278
667 3300025272 Ga0209455_1009937 Ga0209455_10099373 278
668 3300025297 Ga0209758_1000414 Ga0209758_10004143 278
669 3300025303 Ga0209051_1002660 Ga0209051_10026608 278
670 3300025321 Ga0207656_10059801 Ga0207656_100598011 278
671 3300025903 Ga0207680_10000005 Ga0207680_10000005525 278
672 3300025904 Ga0207647_10017489 Ga0207647_100174894 278
673 3300025913 Ga0207695_10000780 Ga0207695_1000078032 278
674 3300025913 Ga0207695_10002372 Ga0207695_1000237229 278
675 3300025913 Ga0207695_10002829 Ga0207695_1000282924 278
676 3300025913 Ga0207695_10003142 Ga0207695_100031427 278
677 3300025913 Ga0207695_10011301 Ga0207695_100113014 278
678 3300025914 Ga0207671_10000061 Ga0207671_1000006154 278
679 3300025914 Ga0207671_10008651 Ga0207671_100086512 278
680 3300025916 Ga0207663_10214610 Ga0207663_102146102 278
681 3300025924 Ga0207694_10000685 Ga0207694_100006858 278
682 3300025924 Ga0207694_10077864 Ga0207694_100778642 278
683 3300025924 Ga0207694_10205628 Ga0207694_102056282 278
684 3300025929 Ga0207664_10036623 Ga0207664_100366232 278
685 3300025933 Ga0207706_10001035 Ga0207706_1000103512 278
686 3300025949 Ga0207667_10002899 Ga0207667_100028993 278
687 3300025949 Ga0207667_10071937 Ga0207667_100719373 278
688 3300025949 Ga0207667_10362506 Ga0207667_103625062 278
689 3300025972 Ga0207668_10091881 Ga0207668_100918813 278
690 3300025981 Ga0207640_10028383 Ga0207640_100283833 278
691 3300026035 Ga0207703_10244418 Ga0207703_102444182 278
692 3300026041 Ga0207639_10170960 Ga0207639_101709602 278
693 3300026067 Ga0207678_10003283 Ga0207678_1000328310 278
694 3300026067 Ga0207678_10584147 Ga0207678_105841472 278
695 3300026078 Ga0207702_10386592 Ga0207702_103865921 278
696 3300026116 Ga0207674_10000279 Ga0207674_100002795 278
697 3300026118 Ga0207675_100001636 Ga0207675_10000163620 278
698 3300026121 Ga0207683_10055487 Ga0207683_100554873 278
699 3300026142 Ga0207698_10085920 Ga0207698_100859203 278
700 3300027614 Ga0209970_1000606 Ga0209970_10006063 278
701 3300027876 Ga0209974_10014186 Ga0209974_100141862 278
702 3300028379 Ga0268266_10000004 Ga0268266_100000041007 278
703 3300030522 Ga0307512_10053330 Ga0307512_100533302 278
704 3300031239 Ga0265328_10023059 Ga0265328_100230592 278
705 3300031251 Ga0265327_10002046 Ga0265327_1000204610 278
706 3300031507 Ga0307509_10002265 Ga0307509_1000226514 278
707 3300031507 Ga0307509_10261574 Ga0307509_102615742 278
708 3300031730 Ga0307516_10005394 Ga0307516_100053943 278
709 3300031731 Ga0307405_10031127 Ga0307405_100311272 278
710 3300031731 Ga0307405_10094401 Ga0307405_100944012 278
711 3300031824 Ga0307413_10028846 Ga0307413_100288463 278
712 3300031852 Ga0307410_10029524 Ga0307410_100295244 278
713 3300031901 Ga0307406_10066970 Ga0307406_100669703 278
714 3300031901 Ga0307406_10083533 Ga0307406_100835331 278
715 3300031901 Ga0307406_10285208 Ga0307406_102852082 278
716 3300031911 Ga0307412_10105795 Ga0307412_101057952 278
717 3300031911 Ga0307412_10155483 Ga0307412_101554832 278
718 3300032002 Ga0307416_100754482 Ga0307416_1007544822 278
719 3300032004 Ga0307414_10035487 Ga0307414_100354873 278
720 3300032004 Ga0307414_10222472 Ga0307414_102224722 278
721 3300032004 Ga0307414_10227540 Ga0307414_102275402 278
722 3300032004 Ga0307414_10602280 Ga0307414_106022801 278
723 3300032005 Ga0307411_10038363 Ga0307411_100383633 278
724 3300032005 Ga0307411_10113371 Ga0307411_101133712 278
725 3300032005 Ga0307411_10386639 Ga0307411_103866392 278
726 3300033180 Ga0307510_10002640 Ga0307510_100026409 278
727 3300033180 Ga0307510_10200141 Ga0307510_102001412 278
728 3300037312 Ga0395899_0059129 Ga0395899_0059129_893_1741 278
729 3300037418 Ga0395900_0058979 Ga0395900_0058979_2520_3374 278
730 3300037466 Ga0395898_0203485 Ga0395898_0203485_713_1558 278
731 3300037471 Ga0395905_0098785 Ga0395905_0098785_151_993 278
732 3300038443 Ga0395901_0143397 Ga0395901_0143397_964_1818 278
733 3300042121 Ga0450919_007536 Ga0450919_007536_49_891 278
734 3300042531 Ga0450918_000146 Ga0450918_000146_3664_4506 278
735 3300042876 Ga0451577_0188437 Ga0451577_0188437_262_1107 278
736 3300044656 Ga0466969_0042216 Ga0466969_0042216_99_959 278
737 3300044658 Ga0466972_0037105 Ga0466972_0037105_252_1115 278
738 3300044671 Ga0466978_0132332 Ga0466978_0132332_604_1467 278
739 3300044672 Ga0466982_0028105 Ga0466982_0028105_94_957 278
740 3300044683 Ga0466965_0016936 Ga0466965_0016936_2516_3367 278
741 3300044683 Ga0466965_0063678 Ga0466965_0063678_394_1257 278
742 3300044684 Ga0466966_0273621 Ga0466966_0273621_22_885 278
743 3300044693 Ga0466961_0002563 Ga0466961_0002563_433_1296 278
744 3300044706 Ga0466964_0013910 Ga0466964_0013910_1714_2574 278
745 3300044712 Ga0453684_0174032 Ga0453684_0174032_377_1222 278
746 3300044719 Ga0466971_0061402 Ga0466971_0061402_98_961 278
747 3300044765 Ga0466970_0017539 Ga0466970_0017539_326_1186 278
748 3300044901 Ga0466960_0013028 Ga0466960_0013028_210_1073 278
749 3300045049 Ga0466959_0012131 Ga0466959_0012131_153_1016 278
750 3300045976 Ga0466967_0023046 Ga0466967_0023046_3914_4774 278
751 3300046471 Ga0495650_0001216 Ga0495650_0001216_2467_3312 278
752 3300046507 Ga0495606_0044660 Ga0495606_0044660_1948_2793 278
753 3300046660 Ga0495625_0021940 Ga0495625_0021940_3368_4213 278
754 3300046660 Ga0495625_0039933 Ga0495625_0039933_2162_3010 278
755 3300047472 Ga0495686_0065443 Ga0495686_0065443_1337_2188 278
756 3300048903 Ga0496100_0174425 Ga0496100_0174425_573_1424 278
757 3300048904 Ga0496101_0055419 Ga0496101_0055419_191_1042 278
758 3300048909 Ga0496106_0150524 Ga0496106_0150524_483_1340 278
759 3300048916 Ga0496113_0413084 Ga0496113_0413084_84_944 278
760 3300048918 Ga0496115_0000077 Ga0496115_0000077_737_1582 278
761 3300048918 Ga0496115_0053190 Ga0496115_0053190_2159_3010 278
762 3300048919 Ga0496116_0010095 Ga0496116_0010095_4957_5805 278
763 3300048919 Ga0496116_0042776 Ga0496116_0042776_1738_2589 278
764 3300048920 Ga0496117_0002979 Ga0496117_0002979_16157_17008 278
765 3300048920 Ga0496117_0070042 Ga0496117_0070042_1325_2176 278
766 3300048921 Ga0496118_0002015 Ga0496118_0002015_24589_25440 278
767 3300048921 Ga0496118_0008917 Ga0496118_0008917_3308_4159 278
768 3300048922 Ga0496119_0000430 Ga0496119_0000430_7652_8503 278
769 3300048922 Ga0496119_0007784 Ga0496119_0007784_3164_4132 278
770 3300048923 Ga0496120_0001388 Ga0496120_0001388_7653_8504 278
771 3300048923 Ga0496120_0002094 Ga0496120_0002094_610_1578 278
772 3300048924 Ga0496121_0001726 Ga0496121_0001726_12242_13093 278
773 3300048924 Ga0496121_0036052 Ga0496121_0036052_2325_3206 278
774 3300048924 Ga0496121_0144220 Ga0496121_0144220_495_1343 278
775 3300048925 Ga0496122_0000382 Ga0496122_0000382_22665_23513 278
776 3300048926 Ga0496123_0000516 Ga0496123_0000516_43125_43973 278
777 3300048928 Ga0496125_0000330 Ga0496125_0000330_29377_30258 278
778 3300048928 Ga0496125_0009099 Ga0496125_0009099_4493_5356 278
779 3300048928 Ga0496125_0040456 Ga0496125_0040456_1736_2584 278
780 3300048928 Ga0496125_0127589 Ga0496125_0127589_32_877 278
781 3300048929 Ga0496126_0000047 Ga0496126_0000047_293000_293845 278
782 3300048929 Ga0496126_0001039 Ga0496126_0001039_23683_24534 278
783 3300048929 Ga0496126_0037867 Ga0496126_0037867_2586_3434 278
784 3300048929 Ga0496126_0077938 Ga0496126_0077938_644_1489 278
785 3300048929 Ga0496126_0259673 Ga0496126_0259673_402_1370 278
786 3300049569 Ga0501032_0186104 Ga0501032_0186104_335_1186 278
787 3300049571 Ga0501034_0110665 Ga0501034_0110665_1331_2176 278
788 3300049574 Ga0501038_0013274 Ga0501038_0013274_6470_7315 278
789 3300049579 Ga0501043_0000004 Ga0501043_0000004_100777_101628 278
790 3300049579 Ga0501043_0101683 Ga0501043_0101683_1359_2219 278
791 3300049580 Ga0501046_0000016 Ga0501046_0000016_190208_191059 278
792 3300049581 Ga0501047_0000012 Ga0501047_0000012_189888_190739 278
793 3300049582 Ga0501048_0037281 Ga0501048_0037281_833_1684 278
794 3300049742 Ga0501080_0019639 Ga0501080_0019639_491_1333 278
795 3300049744 Ga0501083_0015283 Ga0501083_0015283_1524_2366 278
796 3300049822 Ga0501035_0147171 Ga0501035_0147171_1021_1866 278
797 3300049824 Ga0501045_0020112 Ga0501045_0020112_530_1381 278
798 3300050492 nmdc:mga0yw44_186648_c1 nmdc:mga0yw44_186648_c1_442_1305 278
799 3300053092 Ga0500583_0007954 Ga0500583_0007954_1445_2308 278
800 3300053130 Ga0500642_0035598 Ga0500642_0035598_312_1175 278
801 3300053133 Ga0500655_003841 Ga0500655_003841_1813_2676 278
802 3300053136 Ga0500559_0000239 Ga0500559_0000239_34231_35088 278
803 3300053151 Ga0500604_0001101 Ga0500604_0001101_1859_2722 278
804 3300053154 Ga0500619_000142 Ga0500619_000142_16207_17070 278
805 3300053156 Ga0500622_0024448 Ga0500622_0024448_1775_2632 278
806 3300053177 Ga0500636_0053868 Ga0500636_0053868_196_1053 278
807 3300053739 Ga0500587_004922 Ga0500587_004922_420_1277 278
808 3300060353 Ga0501082_0227294 Ga0501082_0227294_90_932 278
809 iso_pu_bacteria 2884811622 2884813258 278
810 iso_pu_bacteria 2884836552 2884837525 278
811 iso_pu_bacteria 2884852848 2884853816 278
812 iso_pu_bacteria 2896154374 2896155067 278
813 3300001904 JGI24736J21556_1014268 JGI24736J21556_10142682 279
814 3300001979 JGI24740J21852_10010318 JGI24740J21852_100103182 279
815 3300005329 Ga0070683_100125830 Ga0070683_1001258301 279
816 3300005347 Ga0070668_100327540 Ga0070668_1003275401 279
817 3300005367 Ga0070667_100034514 Ga0070667_1000345144 279
818 3300005434 Ga0070709_10008040 Ga0070709_100080403 279
819 3300005435 Ga0070714_100291409 Ga0070714_1002914092 279
820 3300005437 Ga0070710_10125318 Ga0070710_101253182 279
821 3300005458 Ga0070681_10012951 Ga0070681_100129512 279
822 3300005530 Ga0070679_100101777 Ga0070679_1001017771 279
823 3300005539 Ga0068853_100027910 Ga0068853_1000279105 279
824 3300005548 Ga0070665_100024577 Ga0070665_1000245776 279
825 3300005563 Ga0068855_100096086 Ga0068855_1000960862 279
826 3300005577 Ga0068857_100135927 Ga0068857_1001359273 279
827 3300005614 Ga0068856_100091052 Ga0068856_1000910523 279
828 3300005614 Ga0068856_100159138 Ga0068856_1001591383 279
829 3300005616 Ga0068852_100021909 Ga0068852_1000219093 279
830 3300005618 Ga0068864_100489192 Ga0068864_1004891921 279
831 3300005834 Ga0068851_10185125 Ga0068851_101851251 279
832 3300005841 Ga0068863_100325946 Ga0068863_1003259462 279
833 3300006173 Ga0070716_100018629 Ga0070716_1000186293 279
834 3300006353 Ga0075370_10053332 Ga0075370_100533322 279
835 3300009093 Ga0105240_10242623 Ga0105240_102426232 279
836 3300009545 Ga0105237_10198823 Ga0105237_101988232 279
837 3300009551 Ga0105238_10080397 Ga0105238_100803973 279
838 3300010375 Ga0105239_10037703 Ga0105239_100377031 279
839 3300013100 Ga0157373_10037108 Ga0157373_100371082 279
840 3300013104 Ga0157370_10000407 Ga0157370_1000040731 279
841 3300013105 Ga0157369_10015827 Ga0157369_100158278 279
842 3300013307 Ga0157372_10108862 Ga0157372_101088622 279
843 3300014497 Ga0182008_10002367 Ga0182008_100023679 279
844 3300014968 Ga0157379_10068261 Ga0157379_100682613 279
845 3300014968 Ga0157379_10507832 Ga0157379_105078322 279
846 3300015265 Ga0182005_1000028 Ga0182005_1000028109 279
847 3300017792 Ga0163161_10018332 Ga0163161_100183326 279
848 3300017792 Ga0163161_10039868 Ga0163161_100398684 279
849 3300020070 Ga0206356_11116119 Ga0206356_111161196 279
850 3300020081 Ga0206354_11415265 Ga0206354_114152652 279
851 3300020082 Ga0206353_10772270 Ga0206353_107722701 279
852 3300020610 Ga0154015_1162269 Ga0154015_11622692 279
853 3300025226 Ga0209674_101117 Ga0209674_1011172 279
854 3300025233 Ga0209437_101411 Ga0209437_1014112 279
855 3300025254 Ga0209148_1002822 Ga0209148_10028222 279
856 3300025258 Ga0209129_1000583 Ga0209129_100058327 279
857 3300025321 Ga0207656_10043045 Ga0207656_100430452 279
858 3300025903 Ga0207680_10099875 Ga0207680_100998751 279
859 3300025904 Ga0207647_10011637 Ga0207647_100116375 279
860 3300025906 Ga0207699_10018217 Ga0207699_100182173 279
861 3300025909 Ga0207705_10000938 Ga0207705_1000093818 279
862 3300025912 Ga0207707_10000859 Ga0207707_1000085919 279
863 3300025912 Ga0207707_10005551 Ga0207707_100055512 279
864 3300025912 Ga0207707_10012415 Ga0207707_100124154 279
865 3300025913 Ga0207695_10010832 Ga0207695_100108322 279
866 3300025917 Ga0207660_10009853 Ga0207660_100098532 279
867 3300025920 Ga0207649_10020099 Ga0207649_100200992 279
868 3300025920 Ga0207649_10045303 Ga0207649_100453033 279
869 3300025921 Ga0207652_10003170 Ga0207652_100031703 279
870 3300025924 Ga0207694_10071300 Ga0207694_100713002 279
871 3300025928 Ga0207700_10204005 Ga0207700_102040051 279
872 3300025932 Ga0207690_10277395 Ga0207690_102773951 279
873 3300025939 Ga0207665_10027428 Ga0207665_100274282 279
874 3300025944 Ga0207661_10003088 Ga0207661_100030882 279
875 3300025949 Ga0207667_10008275 Ga0207667_100082752 279
876 3300025949 Ga0207667_10087672 Ga0207667_100876722 279
877 3300025981 Ga0207640_10001882 Ga0207640_100018822 279
878 3300026041 Ga0207639_10248080 Ga0207639_102480801 279
879 3300026041 Ga0207639_10394505 Ga0207639_103945051 279
880 3300026078 Ga0207702_10001044 Ga0207702_1000104419 279
881 3300026095 Ga0207676_10415314 Ga0207676_104153142 279
882 3300026121 Ga0207683_10302443 Ga0207683_103024432 279
883 3300026142 Ga0207698_10040040 Ga0207698_100400402 279
884 3300028379 Ga0268266_10041390 Ga0268266_100413903 279
885 3300028573 Ga0265334_10083714 Ga0265334_100837142 279
886 3300031235 Ga0265330_10084544 Ga0265330_100845442 279
887 3300031247 Ga0265340_10007750 Ga0265340_100077502 279
888 3300031251 Ga0265327_10044670 Ga0265327_100446704 279
889 3300031344 Ga0265316_10000088 Ga0265316_1000008873 279
890 3300031507 Ga0307509_10482831 Ga0307509_104828311 279
891 3300031730 Ga0307516_10028869 Ga0307516_100288695 279
892 3300041451 Ga0451791_1385162 Ga0451791_1385162_646_1494 279
893 3300041452 Ga0451793_1723399 Ga0451793_1723399_535_1380 279
894 3300041494 Ga0451837_0285758 Ga0451837_0285758_2621_3469 279
895 3300046459 Ga0495629_0110910 Ga0495629_0110910_480_1346 279
896 3300046475 Ga0495639_0012189 Ga0495639_0012189_1394_2260 279
897 3300046507 Ga0495606_0002843 Ga0495606_0002843_82_930 279
898 3300046507 Ga0495606_0018207 Ga0495606_0018207_2336_3184 279
899 3300046515 Ga0495620_0000867 Ga0495620_0000867_2050_2898 279
900 3300046519 Ga0495632_0000004 Ga0495632_0000004_127568_128416 279
901 3300046660 Ga0495625_0014356 Ga0495625_0014356_3517_4365 279
902 3300046674 Ga0495588_0018173 Ga0495588_0018173_1743_2609 279
903 3300047315 Ga0495581_0126222 Ga0495581_0126222_550_1416 279
904 3300048090 Ga0495615_0040933 Ga0495615_0040933_268_1134 279
905 3300048903 Ga0496100_0019589 Ga0496100_0019589_1429_2295 279
906 3300048906 Ga0496103_0034983 Ga0496103_0034983_1304_2170 279
907 3300048907 Ga0496104_0015148 Ga0496104_0015148_5325_6191 279
908 3300048907 Ga0496104_0056915 Ga0496104_0056915_1209_2075 279
909 3300048908 Ga0496105_0007719 Ga0496105_0007719_5862_6728 279
910 3300048910 Ga0496107_0041786 Ga0496107_0041786_1266_2132 279
911 3300048912 Ga0496109_0323986 Ga0496109_0323986_14_880 279
912 3300048913 Ga0496110_0035053 Ga0496110_0035053_1024_1890 279
913 3300048914 Ga0496111_0214079 Ga0496111_0214079_130_996 279
914 3300048917 Ga0496114_0027067 Ga0496114_0027067_3427_4293 279
915 3300048917 Ga0496114_0087579 Ga0496114_0087579_569_1435 279
916 3300048921 Ga0496118_0000686 Ga0496118_0000686_21907_22755 279
917 3300048924 Ga0496121_0090329 Ga0496121_0090329_940_1788 279
918 3300049568 Ga0501031_0008845 Ga0501031_0008845_1199_2047 279
919 3300049569 Ga0501032_0009421 Ga0501032_0009421_1754_2602 279
920 3300049570 Ga0501033_0060374 Ga0501033_0060374_122_970 279
921 3300049571 Ga0501034_0214661 Ga0501034_0214661_296_1144 279
922 3300049572 Ga0501036_0068231 Ga0501036_0068231_1853_2701 279
923 3300049573 Ga0501037_0001786 Ga0501037_0001786_956_1804 279
924 3300049573 Ga0501037_0108833 Ga0501037_0108833_489_1373 279
925 3300049574 Ga0501038_0286619 Ga0501038_0286619_131_1015 279
926 3300049575 Ga0501039_0016576 Ga0501039_0016576_478_1326 279
927 3300049575 Ga0501039_0188814 Ga0501039_0188814_481_1329 279
928 3300049579 Ga0501043_0014311 Ga0501043_0014311_1008_1856 279
929 3300049579 Ga0501043_0144710 Ga0501043_0144710_231_1115 279
930 3300049580 Ga0501046_0001067 Ga0501046_0001067_1625_2473 279
931 3300049580 Ga0501046_0394927 Ga0501046_0394927_10_894 279
932 3300049581 Ga0501047_0010222 Ga0501047_0010222_3328_4212 279
933 3300049581 Ga0501047_0067393 Ga0501047_0067393_206_1054 279
934 3300049584 Ga0501068_0098348 Ga0501068_0098348_248_1096 279
935 3300049586 Ga0501070_0010641 Ga0501070_0010641_1302_2186 279
936 3300049586 Ga0501070_0027717 Ga0501070_0027717_283_1122 279
937 3300049589 Ga0501073_0038823 Ga0501073_0038823_1442_2281 279
938 3300049589 Ga0501073_0048654 Ga0501073_0048654_1520_2368 279
939 3300049590 Ga0501074_0003264 Ga0501074_0003264_9712_10596 279
940 3300049741 Ga0501079_0072909 Ga0501079_0072909_777_1661 279
941 3300049742 Ga0501080_0007518 Ga0501080_0007518_8224_9063 279
942 3300049742 Ga0501080_0034822 Ga0501080_0034822_1450_2334 279
943 3300049822 Ga0501035_0013770 Ga0501035_0013770_2427_3275 279
944 3300049822 Ga0501035_0081390 Ga0501035_0081390_997_1881 279
945 3300049823 Ga0501044_0032343 Ga0501044_0032343_868_1707 279
946 3300049823 Ga0501044_0059893 Ga0501044_0059893_2278_3126 279
947 3300050516 nmdc:mga0sz30_8079_c1 nmdc:mga0sz30_8079_c1_166_1014 279
948 3300053079 Ga0500610_0000196 Ga0500610_0000196_7316_8179 279
949 3300055283 Ga0500661_020546 Ga0500661_020546_193_1041 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

64

314

0.96

PF00326

Peptidase_S9

Prolyl oligopeptidase family

169

314

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yvt-assembly3.cif.gz_C s-formylglutathione hydrolase from variovorax sp. pamc 28711 0.9851 2 279
3e4d-assembly2.cif.gz_D structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens 0.9826 4 279
4b6g-assembly2.cif.gz_B the crystal structure of the neisserial esterase d. 0.9796 4 277
7yvt-assembly3.cif.gz_C s-formylglutathione hydrolase from variovorax sp. pamc 28711 0.9782 2 279
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9764 2 278
ID Description Score Start End Superfamily
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9712 5 178 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.969 4 279 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9586 4 279 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9546 4 278 3.40.50.1820
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9494 5 178 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A521QUQ7-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9992 108 279 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A432EL91-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9987 170 277 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A522J3G1-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9959 4 278 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A520HMR5-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9955 151 278 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A520HT63-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9954 129 278 GO:0005829
GO:0018738
GO:0046294
GO:0052689

Feature Viewer

pLDDT pTM Quality
94.7 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map