F486539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 949 | 474 | 898 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0007784|Ga0496119_0007784_3164_4132 |
| Length | 322 |
| Sequence | MAVIVAARPDRCFKATLNKPAQAPPALSSVLFGDEDDRAMTASIETISEQRCFGGTQGFYRHDSAMCGGSMRFAVFQPPQAAQGPCAVLYYLAGLTCTEETATIKAGAQRLAAELGLVLVMPDTSPRDTGLEGATGDWEFGEGAGFYLDATQAPWSSRFRMYSYIGEELPALVAAHFPVDAARCGIFGHSMGGHGALTIALKHPQRYRSVSAFAPIVAPMRVPWGQKAFSRYLGADQTAWRDYDASELVRRRAFPGTILIDQGEADKFLEGQLKPELFEQACAEAGQALTLRRQAGYDHSYYFIASFIDDHLRHHASALAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 2 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 3 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 4 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 5 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 6 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 7 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 8 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 9 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 10 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 11 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 12 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 13 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 14 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 15 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 16 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 17 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 18 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 19 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 20 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 21 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 22 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 23 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 24 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 25 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 26 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 27 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 28 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 29 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 30 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 31 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 32 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 33 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 34 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 35 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 36 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 37 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 38 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 39 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 40 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 41 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 42 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 43 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 44 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 45 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 46 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 47 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 50 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 51 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 52 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 53 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 54 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 55 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 56 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 57 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 58 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 67 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 68 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 116 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 120 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 121 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 122 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 141 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 142 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 159 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 185 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 195 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 273 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 274 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 275 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 277 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 278 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 279 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 280 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 281 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 282 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 283 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 284 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 289 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 290 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 291 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 292 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 293 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 294 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 295 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 298 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 299 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 300 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 301 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 306 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 307 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 308 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 313 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 314 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 315 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 316 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 317 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 318 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 319 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 322 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 323 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 324 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 325 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 328 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 329 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 330 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 331 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 332 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 333 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 334 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 335 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 336 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 337 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 397 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 398 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 399 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 400 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 401 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 402 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 403 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 410 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 411 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 412 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 437 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 438 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 452 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 453 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 456 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 460 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 461 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 463 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 466 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 467 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 469 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 470 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 471 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 472 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 473 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 474 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.78 |
| Metatranscriptomes | 0.84 |
| Isolates | 5.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.11 |
| Endosphere | 6.64 |
| Nodule | 0.42 |
| Rhizoplane | 3.79 |
| Rhizosphere | 77.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1014268 | 3300001904 | Bacteria | 1278 |
| 2 | JGI24736J21556_1016497 | 3300001904 | Bacteria | 1176 |
| 3 | JGI24741J21665_1003437 | 3300001915 | Bacteria | 3777 |
| 4 | JGI24740J21852_10000727 | 3300001979 | Bacteria | 14339 |
| 5 | JGI24740J21852_10001960 | 3300001979 | Bacteria | 9400 |
| 6 | JGI24740J21852_10010318 | 3300001979 | Bacteria | 3607 |
| 7 | JGI24737J22298_10019089 | 3300001990 | Bacteria | 2193 |
| 8 | JGI25155J39150_1000091 | 3300002704 | Bacteria | 51833 |
| 9 | JGI25156J39149_1000127 | 3300002705 | Bacteria | 56051 |
| 10 | JGI25162J39368_1001785 | 3300002737 | Bacteria | 10197 |
| 11 | JGI25154J39366_1000038 | 3300002738 | Bacteria | 155793 |
| 12 | JGI25157J39369_1000126 | 3300002741 | Bacteria | 65430 |
| 13 | JGI25157J39369_1000155 | 3300002741 | Bacteria | 57096 |
| 14 | JGI25163J39215_1000835 | 3300002771 | Bacteria | 7374 |
| 15 | JGI25164J39214_1000012 | 3300002772 | Bacteria | 255140 |
| 16 | JGI25165J46597_1000048 | 3300003214 | Bacteria | 254392 |
| 17 | rootH2_10014854 | 3300003320 | Bacteria | 19746 |
| 18 | rootH2_10023780 | 3300003320 | Bacteria | 27505 |
| 19 | rootH1_10106964 | 3300003323 | Bacteria | 1701 |
| 20 | Ga0006562J51391_1071442 | 3300003578 | Bacteria | 3304 |
| 21 | Ga0006562J51391_1071443 | 3300003578 | Bacteria | 1440 |
| 22 | Ga0055538_1000486 | 3300003751 | Bacteria | 14526 |
| 23 | Ga0055532_1000023 | 3300003758 | Bacteria | 248212 |
| 24 | Ga0055535_1000151 | 3300003761 | Bacteria | 74028 |
| 25 | Ga0055535_1007606 | 3300003761 | Bacteria | 2046 |
| 26 | Ga0055542_1000034 | 3300003762 | Bacteria | 231972 |
| 27 | Ga0055529_1001207 | 3300003763 | Bacteria | 10187 |
| 28 | Ga0055530_10001427 | 3300003791 | Bacteria | 17505 |
| 29 | Ga0055540_1000312 | 3300003792 | Bacteria | 43001 |
| 30 | Ga0055531_10002021 | 3300003794 | Bacteria | 14053 |
| 31 | Ga0055531_10005293 | 3300003794 | Bacteria | 7571 |
| 32 | Ga0065703_1019008 | 3300005272 | Bacteria | 4450 |
| 33 | Ga0065712_10181904 | 3300005290 | Bacteria | 1188 |
| 34 | Ga0065715_10116314 | 3300005293 | Bacteria | 2385 |
| 35 | Ga0065707_10152917 | 3300005295 | Bacteria | 1639 |
| 36 | Ga0070658_10005302 | 3300005327 | Bacteria | 10467 |
| 37 | Ga0070658_10111842 | 3300005327 | Bacteria | 2263 |
| 38 | Ga0070676_10009222 | 3300005328 | Bacteria | 5333 |
| 39 | Ga0070683_100001770 | 3300005329 | Bacteria | 16818 |
| 40 | Ga0070683_100125830 | 3300005329 | Bacteria | 2423 |
| 41 | Ga0070683_100179651 | 3300005329 | Bacteria | 2009 |
| 42 | Ga0070690_100000447 | 3300005330 | Bacteria | 20750 |
| 43 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 44 | Ga0070670_100018619 | 3300005331 | Bacteria | 5951 |
| 45 | Ga0070670_100312257 | 3300005331 | Bacteria | 1376 |
| 46 | Ga0068869_100001940 | 3300005334 | Bacteria | 12408 |
| 47 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 48 | Ga0070666_10021808 | 3300005335 | Bacteria | 4152 |
| 49 | Ga0070666_10279265 | 3300005335 | Bacteria | 1187 |
| 50 | Ga0070680_100002154 | 3300005336 | Bacteria | 14558 |
| 51 | Ga0070680_100259479 | 3300005336 | Bacteria | 1470 |
| 52 | Ga0070682_100009177 | 3300005337 | Bacteria | 5592 |
| 53 | Ga0070682_100063104 | 3300005337 | Bacteria | 2348 |
| 54 | Ga0068868_100139217 | 3300005338 | Bacteria | 1991 |
| 55 | Ga0070660_100400191 | 3300005339 | Bacteria | 1135 |
| 56 | Ga0070689_100061253 | 3300005340 | Bacteria | 2927 |
| 57 | Ga0070691_10000094 | 3300005341 | Bacteria | 25666 |
| 58 | Ga0070691_10026844 | 3300005341 | Bacteria | 2686 |
| 59 | Ga0070691_10091782 | 3300005341 | Bacteria | 1498 |
| 60 | Ga0070687_100001347 | 3300005343 | Bacteria | 8616 |
| 61 | Ga0070661_100001262 | 3300005344 | Bacteria | 17773 |
| 62 | Ga0070661_100009331 | 3300005344 | Bacteria | 6789 |
| 63 | Ga0070692_10008406 | 3300005345 | Bacteria | 4604 |
| 64 | Ga0070668_100001327 | 3300005347 | Bacteria | 17705 |
| 65 | Ga0070668_100073379 | 3300005347 | Bacteria | 2668 |
| 66 | Ga0070668_100327540 | 3300005347 | Bacteria | 1291 |
| 67 | Ga0070669_100003178 | 3300005353 | Bacteria | 11810 |
| 68 | Ga0070669_100005867 | 3300005353 | Bacteria | 8858 |
| 69 | Ga0070675_100002389 | 3300005354 | Bacteria | 13982 |
| 70 | Ga0070671_100000042 | 3300005355 | Bacteria | 91321 |
| 71 | Ga0070673_100008457 | 3300005364 | Bacteria | 6844 |
| 72 | Ga0070688_100006549 | 3300005365 | Bacteria | 6230 |
| 73 | Ga0070688_100207489 | 3300005365 | Bacteria | 1374 |
| 74 | Ga0070659_100160227 | 3300005366 | Bacteria | 1839 |
| 75 | Ga0070659_100203551 | 3300005366 | Bacteria | 1630 |
| 76 | Ga0070659_100410390 | 3300005366 | Bacteria | 1144 |
| 77 | Ga0070667_100000096 | 3300005367 | Bacteria | 108816 |
| 78 | Ga0070667_100034514 | 3300005367 | Bacteria | 4232 |
| 79 | Ga0070709_10008040 | 3300005434 | Bacteria | 5789 |
| 80 | Ga0070714_100009475 | 3300005435 | Bacteria | 7657 |
| 81 | Ga0070714_100291409 | 3300005435 | Bacteria | 1519 |
| 82 | Ga0070710_10125318 | 3300005437 | Bacteria | 1560 |
| 83 | Ga0070711_100156049 | 3300005439 | Bacteria | 1726 |
| 84 | Ga0070663_100000972 | 3300005455 | Bacteria | 15575 |
| 85 | Ga0070663_100014982 | 3300005455 | Bacteria | 4988 |
| 86 | Ga0070663_100021471 | 3300005455 | Bacteria | 4295 |
| 87 | Ga0070663_100132995 | 3300005455 | Bacteria | 1891 |
| 88 | Ga0070678_100106696 | 3300005456 | Bacteria | 2183 |
| 89 | Ga0070678_100179449 | 3300005456 | Bacteria | 1732 |
| 90 | Ga0070662_100005325 | 3300005457 | Bacteria | 8220 |
| 91 | Ga0070662_100009243 | 3300005457 | Bacteria | 6439 |
| 92 | Ga0070662_100030662 | 3300005457 | Bacteria | 3766 |
| 93 | Ga0070662_100035932 | 3300005457 | Bacteria | 3502 |
| 94 | Ga0070662_100438047 | 3300005457 | Bacteria | 1083 |
| 95 | Ga0070681_10000450 | 3300005458 | Bacteria | 33617 |
| 96 | Ga0070681_10000783 | 3300005458 | Bacteria | 26471 |
| 97 | Ga0070681_10012951 | 3300005458 | Bacteria | 8282 |
| 98 | Ga0070681_10071805 | 3300005458 | Bacteria | 3426 |
| 99 | Ga0068867_100003630 | 3300005459 | Bacteria | 10856 |
| 100 | Ga0070685_10000002 | 3300005466 | Bacteria | 295205 |
| 101 | Ga0070685_10001947 | 3300005466 | Bacteria | 10729 |
| 102 | Ga0070685_10135439 | 3300005466 | Bacteria | 1545 |
| 103 | Ga0070679_100000455 | 3300005530 | Bacteria | 34669 |
| 104 | Ga0070679_100001730 | 3300005530 | Bacteria | 19675 |
| 105 | Ga0070679_100101777 | 3300005530 | Bacteria | 2859 |
| 106 | Ga0070684_100005357 | 3300005535 | Bacteria | 9831 |
| 107 | Ga0070684_100229878 | 3300005535 | Bacteria | 1693 |
| 108 | Ga0070684_100418005 | 3300005535 | Bacteria | 1237 |
| 109 | Ga0068853_100027910 | 3300005539 | Bacteria | 4746 |
| 110 | Ga0068853_100115153 | 3300005539 | Bacteria | 2392 |
| 111 | Ga0068853_100289314 | 3300005539 | Bacteria | 1512 |
| 112 | Ga0070672_100076371 | 3300005543 | Bacteria | 2676 |
| 113 | Ga0070686_100003983 | 3300005544 | Bacteria | 8125 |
| 114 | Ga0070695_100189659 | 3300005545 | Bacteria | 1462 |
| 115 | Ga0070696_100012785 | 3300005546 | Bacteria | 5637 |
| 116 | Ga0070693_100099156 | 3300005547 | Bacteria | 1772 |
| 117 | Ga0070693_100321376 | 3300005547 | Bacteria | 1050 |
| 118 | Ga0070665_100007655 | 3300005548 | Bacteria | 10982 |
| 119 | Ga0070665_100010439 | 3300005548 | Bacteria | 9397 |
| 120 | Ga0070665_100016024 | 3300005548 | Bacteria | 7524 |
| 121 | Ga0070665_100024577 | 3300005548 | Bacteria | 6070 |
| 122 | Ga0070665_100152388 | 3300005548 | Bacteria | 2314 |
| 123 | Ga0068855_100096086 | 3300005563 | Bacteria | 3415 |
| 124 | Ga0068855_100275441 | 3300005563 | Bacteria | 1870 |
| 125 | Ga0070664_100001499 | 3300005564 | Bacteria | 18603 |
| 126 | Ga0070664_100009538 | 3300005564 | Bacteria | 7869 |
| 127 | Ga0070664_100035157 | 3300005564 | Bacteria | 4206 |
| 128 | Ga0070664_100078684 | 3300005564 | Bacteria | 2836 |
| 129 | Ga0070664_100615292 | 3300005564 | Bacteria | 1008 |
| 130 | Ga0068857_100097504 | 3300005577 | Bacteria | 2636 |
| 131 | Ga0068857_100135927 | 3300005577 | Bacteria | 2219 |
| 132 | Ga0068857_100410436 | 3300005577 | Bacteria | 1261 |
| 133 | Ga0068854_100002703 | 3300005578 | Bacteria | 10992 |
| 134 | Ga0068854_100009198 | 3300005578 | Bacteria | 6375 |
| 135 | Ga0068854_100044088 | 3300005578 | Bacteria | 3165 |
| 136 | Ga0068856_100052307 | 3300005614 | Bacteria | 4027 |
| 137 | Ga0068856_100071101 | 3300005614 | Bacteria | 3444 |
| 138 | Ga0068856_100091052 | 3300005614 | Bacteria | 3034 |
| 139 | Ga0068856_100159138 | 3300005614 | Bacteria | 2269 |
| 140 | Ga0068856_100312381 | 3300005614 | Bacteria | 1589 |
| 141 | Ga0070702_100003933 | 3300005615 | Bacteria | 6736 |
| 142 | Ga0070702_100070632 | 3300005615 | Bacteria | 2062 |
| 143 | Ga0068852_100006182 | 3300005616 | Bacteria | 8634 |
| 144 | Ga0068852_100021909 | 3300005616 | Bacteria | 5113 |
| 145 | Ga0068852_100023505 | 3300005616 | Bacteria | 4962 |
| 146 | Ga0068852_100063861 | 3300005616 | Bacteria | 3207 |
| 147 | Ga0068859_100076339 | 3300005617 | Bacteria | 3391 |
| 148 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 149 | Ga0068864_100489192 | 3300005618 | Bacteria | 1182 |
| 150 | Ga0068861_100000011 | 3300005719 | Bacteria | 82099 |
| 151 | Ga0068861_100000527 | 3300005719 | Bacteria | 22405 |
| 152 | Ga0068851_10014972 | 3300005834 | Bacteria | 3689 |
| 153 | Ga0068851_10035096 | 3300005834 | Bacteria | 2506 |
| 154 | Ga0068851_10185125 | 3300005834 | Bacteria | 1155 |
| 155 | Ga0068851_10290590 | 3300005834 | Bacteria | 937 |
| 156 | Ga0068863_100006951 | 3300005841 | Bacteria | 11096 |
| 157 | Ga0068863_100325946 | 3300005841 | Bacteria | 1492 |
| 158 | Ga0068863_100376721 | 3300005841 | Bacteria | 1385 |
| 159 | Ga0068858_100146898 | 3300005842 | Bacteria | 2215 |
| 160 | Ga0068858_100163428 | 3300005842 | Bacteria | 2097 |
| 161 | Ga0068860_100002839 | 3300005843 | Bacteria | 17999 |
| 162 | Ga0068860_100016186 | 3300005843 | Bacteria | 7275 |
| 163 | Ga0068862_100001082 | 3300005844 | Bacteria | 25990 |
| 164 | Ga0068862_100005935 | 3300005844 | Bacteria | 10171 |
| 165 | Ga0068862_100006690 | 3300005844 | Bacteria | 9563 |
| 166 | Ga0068862_100514927 | 3300005844 | Bacteria | 1138 |
| 167 | Ga0081455_10001291 | 3300005937 | Bacteria | 31153 |
| 168 | Ga0070717_10003860 | 3300006028 | Bacteria | 10777 |
| 169 | Ga0075364_10000064 | 3300006051 | Bacteria | 40534 |
| 170 | Ga0070716_100018629 | 3300006173 | Bacteria | 3619 |
| 171 | Ga0070716_100112461 | 3300006173 | Bacteria | 1690 |
| 172 | Ga0097621_100443432 | 3300006237 | Bacteria | 1168 |
| 173 | Ga0075370_10053332 | 3300006353 | Bacteria | 2295 |
| 174 | Ga0068871_100039277 | 3300006358 | Bacteria | 3786 |
| 175 | Ga0068871_100254808 | 3300006358 | Bacteria | 1529 |
| 176 | Ga0075428_100000232 | 3300006844 | Bacteria | 54223 |
| 177 | Ga0075428_100124750 | 3300006844 | Bacteria | 2803 |
| 178 | Ga0075430_100002265 | 3300006846 | Bacteria | 15936 |
| 179 | Ga0075430_100002676 | 3300006846 | Bacteria | 14872 |
| 180 | Ga0075431_100000011 | 3300006847 | Bacteria | 95501 |
| 181 | Ga0075431_100000356 | 3300006847 | Bacteria | 36283 |
| 182 | Ga0075431_100002051 | 3300006847 | Bacteria | 19253 |
| 183 | Ga0075431_100099351 | 3300006847 | Bacteria | 3003 |
| 184 | Ga0075429_100000124 | 3300006880 | Bacteria | 45454 |
| 185 | Ga0075429_100365418 | 3300006880 | Bacteria | 1263 |
| 186 | Ga0097620_100076340 | 3300006931 | Bacteria | 3391 |
| 187 | Ga0099823_1071482 | 3300006944 | Bacteria | 1528 |
| 188 | Ga0079104_1002293 | 3300006946 | Bacteria | 10570 |
| 189 | Ga0105251_10000119 | 3300009011 | Bacteria | 79040 |
| 190 | Ga0105251_10003742 | 3300009011 | Bacteria | 10889 |
| 191 | Ga0105251_10004883 | 3300009011 | Bacteria | 8948 |
| 192 | Ga0105244_10021059 | 3300009036 | Bacteria | 3613 |
| 193 | Ga0105244_10035527 | 3300009036 | Bacteria | 2618 |
| 194 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 195 | Ga0105240_10001418 | 3300009093 | Bacteria | 41120 |
| 196 | Ga0105240_10019239 | 3300009093 | Bacteria | 9128 |
| 197 | Ga0105240_10101977 | 3300009093 | Bacteria | 3489 |
| 198 | Ga0105240_10105572 | 3300009093 | Bacteria | 3419 |
| 199 | Ga0105240_10242623 | 3300009093 | Bacteria | 2088 |
| 200 | Ga0111539_10000664 | 3300009094 | Bacteria | 44364 |
| 201 | Ga0111539_10006216 | 3300009094 | Bacteria | 15413 |
| 202 | Ga0111539_10039322 | 3300009094 | Bacteria | 5703 |
| 203 | Ga0105245_10240483 | 3300009098 | Bacteria | 1755 |
| 204 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 205 | Ga0105247_10168104 | 3300009101 | Bacteria | 1456 |
| 206 | Ga0114129_10000468 | 3300009147 | Bacteria | 48434 |
| 207 | Ga0114129_10021817 | 3300009147 | Bacteria | 9089 |
| 208 | Ga0114129_10191059 | 3300009147 | Bacteria | 2780 |
| 209 | Ga0105243_10000343 | 3300009148 | Bacteria | 50175 |
| 210 | Ga0105243_10163652 | 3300009148 | Bacteria | 1920 |
| 211 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 212 | Ga0105241_10023212 | 3300009174 | Bacteria | 4599 |
| 213 | Ga0105248_10015152 | 3300009177 | Bacteria | 8495 |
| 214 | Ga0105248_10049066 | 3300009177 | Bacteria | 4735 |
| 215 | Ga0105237_10000064 | 3300009545 | Bacteria | 139463 |
| 216 | Ga0105237_10001115 | 3300009545 | Bacteria | 35967 |
| 217 | Ga0105237_10198823 | 3300009545 | Bacteria | 2004 |
| 218 | Ga0105238_10000759 | 3300009551 | Bacteria | 33535 |
| 219 | Ga0105238_10008308 | 3300009551 | Bacteria | 10382 |
| 220 | Ga0105238_10010144 | 3300009551 | Bacteria | 9448 |
| 221 | Ga0105238_10080397 | 3300009551 | Bacteria | 3249 |
| 222 | Ga0105238_10119179 | 3300009551 | Bacteria | 2619 |
| 223 | Ga0105249_10012855 | 3300009553 | Bacteria | 7387 |
| 224 | Ga0105249_10015735 | 3300009553 | Bacteria | 6699 |
| 225 | Ga0105249_10031344 | 3300009553 | Bacteria | 4808 |
| 226 | Ga0105239_10000030 | 3300010375 | Bacteria | 233669 |
| 227 | Ga0105239_10001815 | 3300010375 | Bacteria | 27993 |
| 228 | Ga0105239_10037703 | 3300010375 | Bacteria | 5297 |
| 229 | Ga0105239_10356963 | 3300010375 | Bacteria | 1650 |
| 230 | Ga0105246_10156332 | 3300011119 | Bacteria | 1732 |
| 231 | Ga0157314_1000429 | 3300012500 | Bacteria | 4127 |
| 232 | Ga0157347_1009181 | 3300012502 | Bacteria | 1019 |
| 233 | Ga0157373_10000690 | 3300013100 | Bacteria | 26488 |
| 234 | Ga0157373_10037108 | 3300013100 | Bacteria | 3495 |
| 235 | Ga0157373_10158281 | 3300013100 | Bacteria | 1593 |
| 236 | Ga0157371_10000060 | 3300013102 | Bacteria | 170456 |
| 237 | Ga0157371_10000859 | 3300013102 | Bacteria | 34664 |
| 238 | Ga0157371_10003055 | 3300013102 | Bacteria | 15536 |
| 239 | Ga0157371_10017014 | 3300013102 | Bacteria | 5413 |
| 240 | Ga0157371_10363533 | 3300013102 | Bacteria | 1055 |
| 241 | Ga0157370_10000407 | 3300013104 | Bacteria | 54357 |
| 242 | Ga0157370_10026703 | 3300013104 | Bacteria | 5698 |
| 243 | Ga0157370_10138986 | 3300013104 | Bacteria | 2263 |
| 244 | Ga0157369_10015827 | 3300013105 | Bacteria | 8496 |
| 245 | Ga0157369_10049372 | 3300013105 | Bacteria | 4562 |
| 246 | Ga0157374_10005615 | 3300013296 | Bacteria | 10568 |
| 247 | Ga0157378_10030770 | 3300013297 | Bacteria | 4739 |
| 248 | Ga0163162_10001186 | 3300013306 | Bacteria | 24300 |
| 249 | Ga0163162_10011035 | 3300013306 | Bacteria | 8800 |
| 250 | Ga0163162_10104471 | 3300013306 | Bacteria | 2927 |
| 251 | Ga0163162_10189414 | 3300013306 | Bacteria | 2184 |
| 252 | Ga0157372_10003428 | 3300013307 | Bacteria | 17111 |
| 253 | Ga0157372_10016287 | 3300013307 | Bacteria | 7979 |
| 254 | Ga0157372_10108862 | 3300013307 | Bacteria | 3172 |
| 255 | Ga0157372_10183168 | 3300013307 | Bacteria | 2425 |
| 256 | Ga0157372_10193077 | 3300013307 | Bacteria | 2358 |
| 257 | Ga0157372_10748986 | 3300013307 | Bacteria | 1136 |
| 258 | Ga0157375_10187900 | 3300013308 | Bacteria | 2220 |
| 259 | Ga0163163_10000032 | 3300014325 | Bacteria | 167085 |
| 260 | Ga0163163_10390726 | 3300014325 | Bacteria | 1449 |
| 261 | Ga0163163_10774886 | 3300014325 | Bacteria | 1022 |
| 262 | Ga0157380_10112659 | 3300014326 | Bacteria | 2289 |
| 263 | Ga0157380_10439215 | 3300014326 | Bacteria | 1250 |
| 264 | Ga0157380_10506155 | 3300014326 | Bacteria | 1174 |
| 265 | Ga0182008_10002367 | 3300014497 | Bacteria | 11865 |
| 266 | Ga0182008_10003099 | 3300014497 | Bacteria | 10199 |
| 267 | Ga0182008_10048757 | 3300014497 | Bacteria | 2103 |
| 268 | Ga0182008_10061615 | 3300014497 | Bacteria | 1849 |
| 269 | Ga0157377_10077987 | 3300014745 | Bacteria | 1930 |
| 270 | Ga0157379_10026338 | 3300014968 | Bacteria | 5177 |
| 271 | Ga0157379_10068261 | 3300014968 | Bacteria | 3179 |
| 272 | Ga0157379_10507832 | 3300014968 | Bacteria | 1118 |
| 273 | Ga0157376_10065588 | 3300014969 | Bacteria | 3067 |
| 274 | Ga0157376_10104280 | 3300014969 | Bacteria | 2484 |
| 275 | Ga0182006_1000989 | 3300015261 | Bacteria | 18659 |
| 276 | Ga0182006_1007482 | 3300015261 | Bacteria | 4996 |
| 277 | Ga0182007_10015156 | 3300015262 | Bacteria | 2883 |
| 278 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 279 | Ga0182005_1001309 | 3300015265 | Bacteria | 10201 |
| 280 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 281 | Ga0163161_10018332 | 3300017792 | Bacteria | 4906 |
| 282 | Ga0163161_10039868 | 3300017792 | Bacteria | 3373 |
| 283 | Ga0197907_11148482 | 3300020069 | Bacteria | 811 |
| 284 | Ga0206356_11116119 | 3300020070 | Bacteria | 8750 |
| 285 | Ga0206354_11415265 | 3300020081 | Bacteria | 5011 |
| 286 | Ga0206353_10620874 | 3300020082 | Bacteria | 9572 |
| 287 | Ga0206353_10772270 | 3300020082 | Bacteria | 7606 |
| 288 | Ga0154015_1162269 | 3300020610 | Bacteria | 2692 |
| 289 | Ga0213872_10004916 | 3300021361 | Bacteria | 6956 |
| 290 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 291 | Ga0209760_100447 | 3300025207 | Bacteria | 9493 |
| 292 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 293 | Ga0209674_101117 | 3300025226 | Bacteria | 7874 |
| 294 | Ga0209672_101053 | 3300025228 | Bacteria | 11836 |
| 295 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 296 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 297 | Ga0209437_100054 | 3300025233 | Bacteria | 366715 |
| 298 | Ga0209437_100208 | 3300025233 | Bacteria | 111481 |
| 299 | Ga0209437_101411 | 3300025233 | Bacteria | 5989 |
| 300 | Ga0209258_100039 | 3300025242 | Bacteria | 386366 |
| 301 | Ga0209258_100734 | 3300025242 | Bacteria | 21334 |
| 302 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 303 | Ga0209646_1001310 | 3300025246 | Bacteria | 6945 |
| 304 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 305 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 306 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 307 | Ga0209148_1002822 | 3300025254 | Bacteria | 5393 |
| 308 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 309 | Ga0209759_1000404 | 3300025256 | Bacteria | 53269 |
| 310 | Ga0209129_1000583 | 3300025258 | Bacteria | 25095 |
| 311 | Ga0209129_1006513 | 3300025258 | Bacteria | 3748 |
| 312 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 313 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 314 | Ga0209455_1000474 | 3300025272 | Bacteria | 30028 |
| 315 | Ga0209455_1002189 | 3300025272 | Bacteria | 7735 |
| 316 | Ga0209455_1009937 | 3300025272 | Bacteria | 2456 |
| 317 | Ga0209758_1000414 | 3300025297 | Bacteria | 72487 |
| 318 | Ga0209050_1001937 | 3300025298 | Bacteria | 19686 |
| 319 | Ga0209051_1000148 | 3300025303 | Bacteria | 132600 |
| 320 | Ga0209051_1002660 | 3300025303 | Bacteria | 12497 |
| 321 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 322 | Ga0207656_10010628 | 3300025321 | Bacteria | 3454 |
| 323 | Ga0207656_10043045 | 3300025321 | Bacteria | 1924 |
| 324 | Ga0207656_10059801 | 3300025321 | Bacteria | 1669 |
| 325 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 326 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 327 | Ga0207696_1015415 | 3300025711 | Bacteria | 2593 |
| 328 | Ga0207655_1000840 | 3300025728 | Bacteria | 32993 |
| 329 | Ga0207655_1004274 | 3300025728 | Bacteria | 10215 |
| 330 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 331 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 332 | Ga0207682_10116694 | 3300025893 | Bacteria | 1180 |
| 333 | Ga0207710_10000140 | 3300025900 | Bacteria | 83223 |
| 334 | Ga0207710_10107373 | 3300025900 | Bacteria | 1323 |
| 335 | Ga0207688_10026201 | 3300025901 | Bacteria | 3204 |
| 336 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 337 | Ga0207680_10005909 | 3300025903 | Bacteria | 5879 |
| 338 | Ga0207680_10040993 | 3300025903 | Bacteria | 2699 |
| 339 | Ga0207680_10099875 | 3300025903 | Bacteria | 1863 |
| 340 | Ga0207647_10001545 | 3300025904 | Bacteria | 17720 |
| 341 | Ga0207647_10011637 | 3300025904 | Bacteria | 6161 |
| 342 | Ga0207647_10017489 | 3300025904 | Bacteria | 4874 |
| 343 | Ga0207699_10018217 | 3300025906 | Bacteria | 3717 |
| 344 | Ga0207645_10029620 | 3300025907 | Bacteria | 3528 |
| 345 | Ga0207705_10000938 | 3300025909 | Bacteria | 23813 |
| 346 | Ga0207705_10011888 | 3300025909 | Bacteria | 6289 |
| 347 | Ga0207705_10041301 | 3300025909 | Bacteria | 3309 |
| 348 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 349 | Ga0207654_10050904 | 3300025911 | Bacteria | 2382 |
| 350 | Ga0207707_10000493 | 3300025912 | Bacteria | 40605 |
| 351 | Ga0207707_10000630 | 3300025912 | Bacteria | 34922 |
| 352 | Ga0207707_10000859 | 3300025912 | Bacteria | 29680 |
| 353 | Ga0207707_10005551 | 3300025912 | Bacteria | 11032 |
| 354 | Ga0207707_10012415 | 3300025912 | Bacteria | 7405 |
| 355 | Ga0207707_10042221 | 3300025912 | Bacteria | 3981 |
| 356 | Ga0207707_10179467 | 3300025912 | Bacteria | 1849 |
| 357 | Ga0207695_10000780 | 3300025913 | Bacteria | 60243 |
| 358 | Ga0207695_10002372 | 3300025913 | Bacteria | 27968 |
| 359 | Ga0207695_10002829 | 3300025913 | Bacteria | 25215 |
| 360 | Ga0207695_10003142 | 3300025913 | Bacteria | 23602 |
| 361 | Ga0207695_10004476 | 3300025913 | Bacteria | 19032 |
| 362 | Ga0207695_10010832 | 3300025913 | Bacteria | 11111 |
| 363 | Ga0207695_10011301 | 3300025913 | Bacteria | 10822 |
| 364 | Ga0207695_10019150 | 3300025913 | Bacteria | 7888 |
| 365 | Ga0207695_10020009 | 3300025913 | Bacteria | 7682 |
| 366 | Ga0207671_10000061 | 3300025914 | Bacteria | 175061 |
| 367 | Ga0207671_10008651 | 3300025914 | Bacteria | 8594 |
| 368 | Ga0207663_10214610 | 3300025916 | Bacteria | 1397 |
| 369 | Ga0207660_10000570 | 3300025917 | Bacteria | 24778 |
| 370 | Ga0207660_10000885 | 3300025917 | Bacteria | 19752 |
| 371 | Ga0207660_10002187 | 3300025917 | Bacteria | 12942 |
| 372 | Ga0207660_10009853 | 3300025917 | Bacteria | 6187 |
| 373 | Ga0207660_10043674 | 3300025917 | Bacteria | 3150 |
| 374 | Ga0207660_10194922 | 3300025917 | Bacteria | 1580 |
| 375 | Ga0207662_10003779 | 3300025918 | Bacteria | 7859 |
| 376 | Ga0207657_10011422 | 3300025919 | Bacteria | 8816 |
| 377 | Ga0207649_10001342 | 3300025920 | Bacteria | 14630 |
| 378 | Ga0207649_10009056 | 3300025920 | Bacteria | 5440 |
| 379 | Ga0207649_10009276 | 3300025920 | Bacteria | 5381 |
| 380 | Ga0207649_10020099 | 3300025920 | Bacteria | 3824 |
| 381 | Ga0207649_10045303 | 3300025920 | Bacteria | 2696 |
| 382 | Ga0207649_10090772 | 3300025920 | Bacteria | 2000 |
| 383 | Ga0207649_10160776 | 3300025920 | Bacteria | 1556 |
| 384 | Ga0207649_10173141 | 3300025920 | Bacteria | 1505 |
| 385 | Ga0207652_10000152 | 3300025921 | Bacteria | 74928 |
| 386 | Ga0207652_10001326 | 3300025921 | Bacteria | 21962 |
| 387 | Ga0207652_10003170 | 3300025921 | Bacteria | 13693 |
| 388 | Ga0207652_10003549 | 3300025921 | Bacteria | 12876 |
| 389 | Ga0207652_10163546 | 3300025921 | Bacteria | 1995 |
| 390 | Ga0207681_10002504 | 3300025923 | Bacteria | 11673 |
| 391 | Ga0207681_10008671 | 3300025923 | Bacteria | 6208 |
| 392 | Ga0207681_10019340 | 3300025923 | Bacteria | 4302 |
| 393 | Ga0207681_10147531 | 3300025923 | Bacteria | 1759 |
| 394 | Ga0207694_10000685 | 3300025924 | Bacteria | 30431 |
| 395 | Ga0207694_10070569 | 3300025924 | Bacteria | 2729 |
| 396 | Ga0207694_10071300 | 3300025924 | Bacteria | 2715 |
| 397 | Ga0207694_10077864 | 3300025924 | Bacteria | 2598 |
| 398 | Ga0207694_10205628 | 3300025924 | Bacteria | 1603 |
| 399 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 400 | Ga0207659_10003909 | 3300025926 | Bacteria | 8985 |
| 401 | Ga0207659_10366503 | 3300025926 | Bacteria | 1198 |
| 402 | Ga0207700_10204005 | 3300025928 | Bacteria | 1668 |
| 403 | Ga0207664_10036623 | 3300025929 | Bacteria | 3792 |
| 404 | Ga0207644_10000076 | 3300025931 | Bacteria | 72705 |
| 405 | Ga0207644_10093888 | 3300025931 | Bacteria | 2240 |
| 406 | Ga0207690_10020303 | 3300025932 | Bacteria | 4103 |
| 407 | Ga0207690_10080533 | 3300025932 | Bacteria | 2273 |
| 408 | Ga0207690_10162513 | 3300025932 | Bacteria | 1666 |
| 409 | Ga0207690_10277395 | 3300025932 | Bacteria | 1304 |
| 410 | Ga0207706_10001035 | 3300025933 | Bacteria | 28246 |
| 411 | Ga0207706_10007611 | 3300025933 | Bacteria | 10021 |
| 412 | Ga0207706_10102892 | 3300025933 | Bacteria | 2513 |
| 413 | Ga0207706_10116872 | 3300025933 | Bacteria | 2346 |
| 414 | Ga0207709_10000057 | 3300025935 | Bacteria | 216617 |
| 415 | Ga0207709_10185072 | 3300025935 | Bacteria | 1474 |
| 416 | Ga0207669_10493689 | 3300025937 | Bacteria | 978 |
| 417 | Ga0207665_10027428 | 3300025939 | Bacteria | 3763 |
| 418 | Ga0207691_10129742 | 3300025940 | Bacteria | 2227 |
| 419 | Ga0207691_10220885 | 3300025940 | Bacteria | 1643 |
| 420 | Ga0207711_10003038 | 3300025941 | Bacteria | 14665 |
| 421 | Ga0207711_10017130 | 3300025941 | Bacteria | 6018 |
| 422 | Ga0207689_10016437 | 3300025942 | Bacteria | 6264 |
| 423 | Ga0207661_10000457 | 3300025944 | Bacteria | 26338 |
| 424 | Ga0207661_10003088 | 3300025944 | Bacteria | 11534 |
| 425 | Ga0207661_10094908 | 3300025944 | Bacteria | 2492 |
| 426 | Ga0207679_10005902 | 3300025945 | Bacteria | 7700 |
| 427 | Ga0207679_10012080 | 3300025945 | Bacteria | 5617 |
| 428 | Ga0207679_10032717 | 3300025945 | Bacteria | 3654 |
| 429 | Ga0207667_10002899 | 3300025949 | Bacteria | 21300 |
| 430 | Ga0207667_10008275 | 3300025949 | Bacteria | 12377 |
| 431 | Ga0207667_10022933 | 3300025949 | Bacteria | 6881 |
| 432 | Ga0207667_10071937 | 3300025949 | Bacteria | 3595 |
| 433 | Ga0207667_10085069 | 3300025949 | Bacteria | 3274 |
| 434 | Ga0207667_10087672 | 3300025949 | Bacteria | 3219 |
| 435 | Ga0207667_10097346 | 3300025949 | Bacteria | 3037 |
| 436 | Ga0207667_10362506 | 3300025949 | Bacteria | 1478 |
| 437 | Ga0207651_10005232 | 3300025960 | Bacteria | 6632 |
| 438 | Ga0207712_10052816 | 3300025961 | Bacteria | 2848 |
| 439 | Ga0207712_10070940 | 3300025961 | Bacteria | 2504 |
| 440 | Ga0207668_10091881 | 3300025972 | Bacteria | 2232 |
| 441 | Ga0207640_10001114 | 3300025981 | Bacteria | 14832 |
| 442 | Ga0207640_10001882 | 3300025981 | Bacteria | 11253 |
| 443 | Ga0207640_10003251 | 3300025981 | Bacteria | 8755 |
| 444 | Ga0207640_10028383 | 3300025981 | Bacteria | 3421 |
| 445 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 446 | Ga0207658_10039925 | 3300025986 | Bacteria | 3389 |
| 447 | Ga0207677_10211529 | 3300026023 | Bacteria | 1549 |
| 448 | Ga0207703_10023876 | 3300026035 | Bacteria | 4809 |
| 449 | Ga0207703_10244418 | 3300026035 | Bacteria | 1615 |
| 450 | Ga0207639_10004251 | 3300026041 | Bacteria | 9655 |
| 451 | Ga0207639_10014895 | 3300026041 | Bacteria | 5477 |
| 452 | Ga0207639_10170960 | 3300026041 | Bacteria | 1840 |
| 453 | Ga0207639_10248080 | 3300026041 | Bacteria | 1551 |
| 454 | Ga0207639_10394505 | 3300026041 | Bacteria | 1246 |
| 455 | Ga0207678_10003283 | 3300026067 | Bacteria | 14590 |
| 456 | Ga0207678_10008993 | 3300026067 | Bacteria | 8790 |
| 457 | Ga0207678_10584147 | 3300026067 | Bacteria | 979 |
| 458 | Ga0207708_10046326 | 3300026075 | Bacteria | 3311 |
| 459 | Ga0207702_10001044 | 3300026078 | Bacteria | 28368 |
| 460 | Ga0207702_10046486 | 3300026078 | Bacteria | 3654 |
| 461 | Ga0207702_10065837 | 3300026078 | Bacteria | 3104 |
| 462 | Ga0207702_10386592 | 3300026078 | Bacteria | 1347 |
| 463 | Ga0207641_10007326 | 3300026088 | Bacteria | 9189 |
| 464 | Ga0207641_10010775 | 3300026088 | Bacteria | 7495 |
| 465 | Ga0207641_10035178 | 3300026088 | Bacteria | 4171 |
| 466 | Ga0207641_10371967 | 3300026088 | Bacteria | 1366 |
| 467 | Ga0207648_10010315 | 3300026089 | Bacteria | 8868 |
| 468 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 469 | Ga0207676_10002491 | 3300026095 | Bacteria | 13109 |
| 470 | Ga0207676_10415314 | 3300026095 | Bacteria | 1261 |
| 471 | Ga0207674_10000279 | 3300026116 | Bacteria | 64457 |
| 472 | Ga0207674_10250129 | 3300026116 | Bacteria | 1720 |
| 473 | Ga0207675_100000254 | 3300026118 | Bacteria | 51194 |
| 474 | Ga0207675_100001636 | 3300026118 | Bacteria | 22459 |
| 475 | Ga0207675_100002172 | 3300026118 | Bacteria | 19499 |
| 476 | Ga0207683_10007149 | 3300026121 | Bacteria | 9571 |
| 477 | Ga0207683_10055487 | 3300026121 | Bacteria | 3474 |
| 478 | Ga0207683_10302443 | 3300026121 | Bacteria | 1463 |
| 479 | Ga0207698_10001050 | 3300026142 | Bacteria | 16062 |
| 480 | Ga0207698_10006712 | 3300026142 | Bacteria | 7191 |
| 481 | Ga0207698_10040040 | 3300026142 | Bacteria | 3477 |
| 482 | Ga0207698_10085920 | 3300026142 | Bacteria | 2556 |
| 483 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 484 | Ga0209371_1000074 | 3300027312 | Bacteria | 198823 |
| 485 | Ga0209371_1003036 | 3300027312 | Bacteria | 8650 |
| 486 | Ga0209970_1000606 | 3300027614 | Bacteria | 6226 |
| 487 | Ga0209974_10007325 | 3300027876 | Bacteria | 3803 |
| 488 | Ga0209974_10014186 | 3300027876 | Bacteria | 2655 |
| 489 | Ga0207428_10002738 | 3300027907 | Bacteria | 17560 |
| 490 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 491 | Ga0268266_10009394 | 3300028379 | Bacteria | 8616 |
| 492 | Ga0268266_10041390 | 3300028379 | Bacteria | 3931 |
| 493 | Ga0268266_10058033 | 3300028379 | Bacteria | 3332 |
| 494 | Ga0268266_10115292 | 3300028379 | Bacteria | 2385 |
| 495 | Ga0268266_10575526 | 3300028379 | Bacteria | 1080 |
| 496 | Ga0268266_10597230 | 3300028379 | Bacteria | 1060 |
| 497 | Ga0268265_10000889 | 3300028380 | Bacteria | 27884 |
| 498 | Ga0268265_10002058 | 3300028380 | Bacteria | 15752 |
| 499 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 500 | Ga0268264_10063501 | 3300028381 | Bacteria | 3104 |
| 501 | Ga0265334_10083714 | 3300028573 | Bacteria | 1172 |
| 502 | Ga0307515_10002783 | 3300028794 | Bacteria | 37292 |
| 503 | Ga0307515_10003144 | 3300028794 | Bacteria | 34920 |
| 504 | Ga0268256_1000067 | 3300030500 | Bacteria | 198823 |
| 505 | Ga0268256_1002722 | 3300030500 | Bacteria | 8650 |
| 506 | Ga0307512_10053330 | 3300030522 | Bacteria | 3217 |
| 507 | Ga0265330_10084544 | 3300031235 | Bacteria | 1365 |
| 508 | Ga0265328_10018922 | 3300031239 | Bacteria | 2650 |
| 509 | Ga0265328_10023059 | 3300031239 | Bacteria | 2363 |
| 510 | Ga0265340_10007750 | 3300031247 | Bacteria | 5823 |
| 511 | Ga0265331_10002458 | 3300031250 | Bacteria | 12548 |
| 512 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 513 | Ga0265327_10000255 | 3300031251 | Bacteria | 105762 |
| 514 | Ga0265327_10002046 | 3300031251 | Bacteria | 22695 |
| 515 | Ga0265327_10002593 | 3300031251 | Bacteria | 18707 |
| 516 | Ga0265327_10044670 | 3300031251 | Bacteria | 2360 |
| 517 | Ga0265316_10000088 | 3300031344 | Bacteria | 98110 |
| 518 | Ga0307513_10051014 | 3300031456 | Bacteria | 4467 |
| 519 | Ga0307509_10002265 | 3300031507 | Bacteria | 31503 |
| 520 | Ga0307509_10261574 | 3300031507 | Bacteria | 1505 |
| 521 | Ga0307509_10482831 | 3300031507 | Bacteria | 927 |
| 522 | Ga0307408_100001241 | 3300031548 | Bacteria | 19160 |
| 523 | Ga0307408_100005662 | 3300031548 | Bacteria | 8326 |
| 524 | Ga0307408_100115871 | 3300031548 | Bacteria | 2067 |
| 525 | Ga0307408_100121193 | 3300031548 | Bacteria | 2026 |
| 526 | Ga0307408_100146841 | 3300031548 | Bacteria | 1857 |
| 527 | Ga0307408_100234916 | 3300031548 | Bacteria | 1504 |
| 528 | Ga0307514_10001537 | 3300031649 | Bacteria | 27450 |
| 529 | Ga0316578_10090013 | 3300031728 | Bacteria | 1832 |
| 530 | Ga0307516_10005394 | 3300031730 | Bacteria | 15348 |
| 531 | Ga0307516_10028869 | 3300031730 | Bacteria | 5610 |
| 532 | Ga0307405_10031127 | 3300031731 | Bacteria | 3137 |
| 533 | Ga0307405_10094401 | 3300031731 | Bacteria | 1989 |
| 534 | Ga0307413_10005441 | 3300031824 | Bacteria | 5687 |
| 535 | Ga0307413_10028846 | 3300031824 | Bacteria | 3097 |
| 536 | Ga0307410_10005705 | 3300031852 | Bacteria | 6629 |
| 537 | Ga0307410_10029524 | 3300031852 | Bacteria | 3493 |
| 538 | Ga0307410_10313875 | 3300031852 | Bacteria | 1241 |
| 539 | Ga0307406_10008182 | 3300031901 | Bacteria | 5827 |
| 540 | Ga0307406_10066970 | 3300031901 | Bacteria | 2339 |
| 541 | Ga0307406_10083533 | 3300031901 | Bacteria | 2130 |
| 542 | Ga0307406_10120968 | 3300031901 | Bacteria | 1820 |
| 543 | Ga0307406_10285208 | 3300031901 | Bacteria | 1261 |
| 544 | Ga0307406_10383547 | 3300031901 | Bacteria | 1109 |
| 545 | Ga0307412_10019498 | 3300031911 | Bacteria | 4109 |
| 546 | Ga0307412_10025910 | 3300031911 | Bacteria | 3638 |
| 547 | Ga0307412_10035790 | 3300031911 | Bacteria | 3175 |
| 548 | Ga0307412_10100305 | 3300031911 | Bacteria | 2046 |
| 549 | Ga0307412_10105795 | 3300031911 | Bacteria | 1999 |
| 550 | Ga0307412_10155483 | 3300031911 | Bacteria | 1692 |
| 551 | Ga0307412_10157107 | 3300031911 | Bacteria | 1685 |
| 552 | Ga0307409_100116224 | 3300031995 | Bacteria | 2254 |
| 553 | Ga0307409_100238273 | 3300031995 | Bacteria | 1654 |
| 554 | Ga0307416_100109787 | 3300032002 | Bacteria | 2427 |
| 555 | Ga0307416_100754482 | 3300032002 | Bacteria | 1066 |
| 556 | Ga0307414_10035487 | 3300032004 | Bacteria | 3319 |
| 557 | Ga0307414_10222472 | 3300032004 | Bacteria | 1550 |
| 558 | Ga0307414_10227540 | 3300032004 | Bacteria | 1535 |
| 559 | Ga0307414_10602280 | 3300032004 | Bacteria | 985 |
| 560 | Ga0307411_10018164 | 3300032005 | Bacteria | 4028 |
| 561 | Ga0307411_10038363 | 3300032005 | Bacteria | 3021 |
| 562 | Ga0307411_10113371 | 3300032005 | Bacteria | 1945 |
| 563 | Ga0307411_10221493 | 3300032005 | Bacteria | 1468 |
| 564 | Ga0307411_10386639 | 3300032005 | Bacteria | 1152 |
| 565 | Ga0307510_10002640 | 3300033180 | Bacteria | 20467 |
| 566 | Ga0307510_10200141 | 3300033180 | Bacteria | 1533 |
| 567 | Ga0373938_0047595 | 3300034957 | Bacteria | 971 |
| 568 | Ga0316574_0076614 | 3300035398 | Bacteria | 2119 |
| 569 | Ga0316584_0031022 | 3300036712 | Bacteria | 3952 |
| 570 | Ga0395899_0012560 | 3300037312 | Bacteria | 6492 |
| 571 | Ga0395899_0059129 | 3300037312 | Bacteria | 2825 |
| 572 | Ga0395899_0068872 | 3300037312 | Bacteria | 2593 |
| 573 | Ga0395899_0092709 | 3300037312 | Bacteria | 2187 |
| 574 | Ga0395899_0350286 | 3300037312 | Bacteria | 988 |
| 575 | Ga0395900_0043547 | 3300037418 | Bacteria | 4626 |
| 576 | Ga0395900_0044849 | 3300037418 | Bacteria | 4554 |
| 577 | Ga0395900_0058979 | 3300037418 | Bacteria | 3951 |
| 578 | Ga0395900_0128880 | 3300037418 | Bacteria | 2593 |
| 579 | Ga0395898_0061237 | 3300037466 | Bacteria | 3656 |
| 580 | Ga0395898_0203485 | 3300037466 | Bacteria | 1889 |
| 581 | Ga0395898_0317466 | 3300037466 | Bacteria | 1486 |
| 582 | Ga0395898_0373568 | 3300037466 | Bacteria | 1360 |
| 583 | Ga0395905_0012392 | 3300037471 | Bacteria | 8209 |
| 584 | Ga0395905_0049852 | 3300037471 | Bacteria | 3924 |
| 585 | Ga0395905_0068570 | 3300037471 | Bacteria | 3322 |
| 586 | Ga0395905_0098785 | 3300037471 | Bacteria | 2742 |
| 587 | Ga0395905_0224513 | 3300037471 | Bacteria | 1758 |
| 588 | Ga0395901_0040382 | 3300038443 | Bacteria | 4832 |
| 589 | Ga0395901_0143397 | 3300038443 | Bacteria | 2510 |
| 590 | Ga0395901_0245002 | 3300038443 | Bacteria | 1868 |
| 591 | Ga0395901_0324823 | 3300038443 | Bacteria | 1591 |
| 592 | Ga0436361_0106903 | 3300039447 | Bacteria | 9400 |
| 593 | Ga0436361_0959303 | 3300039447 | Bacteria | 2385 |
| 594 | Ga0439436_0000030 | 3300041404 | Bacteria | 48429 |
| 595 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 596 | Ga0439438_001667 | 3300041405 | Bacteria | 9748 |
| 597 | Ga0439447_002689 | 3300041407 | Bacteria | 6435 |
| 598 | Ga0439465_0000927 | 3300041413 | Bacteria | 9301 |
| 599 | Ga0439465_0007670 | 3300041413 | Bacteria | 3424 |
| 600 | Ga0451791_1385162 | 3300041451 | Bacteria | 1628 |
| 601 | Ga0451793_1620920 | 3300041452 | Bacteria | 2102 |
| 602 | Ga0451793_1723399 | 3300041452 | Bacteria | 1448 |
| 603 | Ga0451837_0285758 | 3300041494 | Bacteria | 4245 |
| 604 | Ga0451851_0568421 | 3300041507 | Bacteria | 782 |
| 605 | Ga0439432_003014 | 3300042006 | Bacteria | 6269 |
| 606 | Ga0439449_0010982 | 3300042007 | Bacteria | 3417 |
| 607 | Ga0439449_0051101 | 3300042007 | Bacteria | 1529 |
| 608 | Ga0450919_007536 | 3300042121 | Bacteria | 1271 |
| 609 | Ga0450894_021614 | 3300042131 | Bacteria | 870 |
| 610 | Ga0450906_005612 | 3300042145 | Bacteria | 2568 |
| 611 | Ga0450918_000146 | 3300042531 | Bacteria | 15617 |
| 612 | Ga0451577_0188437 | 3300042876 | Bacteria | 1860 |
| 613 | Ga0466969_0006906 | 3300044656 | Bacteria | 6042 |
| 614 | Ga0466969_0042216 | 3300044656 | Bacteria | 2278 |
| 615 | Ga0466972_0037105 | 3300044658 | Bacteria | 2382 |
| 616 | Ga0466978_0132332 | 3300044671 | Bacteria | 1533 |
| 617 | Ga0466982_0028105 | 3300044672 | Bacteria | 3302 |
| 618 | Ga0466965_0016936 | 3300044683 | Bacteria | 3477 |
| 619 | Ga0466965_0063678 | 3300044683 | Bacteria | 1845 |
| 620 | Ga0466965_0074706 | 3300044683 | Bacteria | 1708 |
| 621 | Ga0466966_0020484 | 3300044684 | Bacteria | 4348 |
| 622 | Ga0466966_0273621 | 3300044684 | Bacteria | 1016 |
| 623 | Ga0466961_0000063 | 3300044693 | Bacteria | 64438 |
| 624 | Ga0466961_0002563 | 3300044693 | Bacteria | 11258 |
| 625 | Ga0466964_0013910 | 3300044706 | Bacteria | 3056 |
| 626 | Ga0466964_0042457 | 3300044706 | Bacteria | 1842 |
| 627 | Ga0453684_0174032 | 3300044712 | Bacteria | 2534 |
| 628 | Ga0466971_0061402 | 3300044719 | Bacteria | 1699 |
| 629 | Ga0466970_0017539 | 3300044765 | Bacteria | 3699 |
| 630 | Ga0466970_0135904 | 3300044765 | Bacteria | 1352 |
| 631 | Ga0466957_0150204 | 3300044842 | Bacteria | 1506 |
| 632 | Ga0466960_0013028 | 3300044901 | Bacteria | 3524 |
| 633 | Ga0466959_0012131 | 3300045049 | Bacteria | 6219 |
| 634 | Ga0466959_0057743 | 3300045049 | Bacteria | 2828 |
| 635 | Ga0466959_0145120 | 3300045049 | Bacteria | 1675 |
| 636 | Ga0451576_0015523 | 3300045051 | Bacteria | 8431 |
| 637 | Ga0466967_0023046 | 3300045976 | Bacteria | 5095 |
| 638 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 639 | Ga0495592_0005606 | 3300046454 | Bacteria | 9280 |
| 640 | Ga0495629_0110910 | 3300046459 | Bacteria | 1913 |
| 641 | Ga0495638_0000038 | 3300046460 | Bacteria | 249534 |
| 642 | Ga0495650_0001216 | 3300046471 | Bacteria | 27008 |
| 643 | Ga0495650_0034341 | 3300046471 | Bacteria | 2246 |
| 644 | Ga0495605_0011963 | 3300046474 | Bacteria | 4824 |
| 645 | Ga0495639_0012189 | 3300046475 | Bacteria | 3707 |
| 646 | Ga0495584_0139842 | 3300046491 | Bacteria | 1229 |
| 647 | Ga0495585_0017935 | 3300046492 | Bacteria | 4085 |
| 648 | Ga0495585_0022088 | 3300046492 | Bacteria | 3652 |
| 649 | Ga0495607_0025850 | 3300046501 | Bacteria | 3647 |
| 650 | Ga0495607_0054685 | 3300046501 | Bacteria | 2299 |
| 651 | Ga0495583_0000067 | 3300046506 | Bacteria | 189381 |
| 652 | Ga0495606_0002843 | 3300046507 | Bacteria | 19187 |
| 653 | Ga0495606_0018207 | 3300046507 | Bacteria | 5277 |
| 654 | Ga0495606_0044660 | 3300046507 | Bacteria | 2945 |
| 655 | Ga0495610_0004378 | 3300046512 | Bacteria | 10461 |
| 656 | Ga0495620_0000867 | 3300046515 | Bacteria | 18724 |
| 657 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 658 | Ga0495644_0009116 | 3300046523 | Bacteria | 3822 |
| 659 | Ga0495644_0013429 | 3300046523 | Bacteria | 3142 |
| 660 | Ga0495648_0001359 | 3300046524 | Bacteria | 24164 |
| 661 | Ga0495663_0005993 | 3300046525 | Bacteria | 3364 |
| 662 | Ga0495663_0024306 | 3300046525 | Bacteria | 1760 |
| 663 | Ga0495654_0001734 | 3300046530 | Bacteria | 14624 |
| 664 | Ga0495609_0001124 | 3300046538 | Bacteria | 18539 |
| 665 | Ga0495609_0021833 | 3300046538 | Bacteria | 2952 |
| 666 | Ga0495633_0001422 | 3300046558 | Bacteria | 18622 |
| 667 | Ga0495633_0020966 | 3300046558 | Bacteria | 3275 |
| 668 | Ga0495656_0007691 | 3300046615 | Bacteria | 3821 |
| 669 | Ga0495611_0001009 | 3300046648 | Bacteria | 14914 |
| 670 | Ga0495611_0003480 | 3300046648 | Bacteria | 6934 |
| 671 | Ga0495625_0002479 | 3300046660 | Bacteria | 19887 |
| 672 | Ga0495625_0014356 | 3300046660 | Bacteria | 6328 |
| 673 | Ga0495625_0021940 | 3300046660 | Bacteria | 4904 |
| 674 | Ga0495625_0039933 | 3300046660 | Bacteria | 3425 |
| 675 | Ga0495659_0000529 | 3300046664 | Bacteria | 14098 |
| 676 | Ga0495661_0163840 | 3300046665 | Bacteria | 1191 |
| 677 | Ga0495588_0018173 | 3300046674 | Bacteria | 3424 |
| 678 | Ga0495669_0054233 | 3300046684 | Bacteria | 1804 |
| 679 | Ga0495670_0005679 | 3300046691 | Bacteria | 6116 |
| 680 | Ga0495670_0012033 | 3300046691 | Bacteria | 4259 |
| 681 | Ga0495670_0013691 | 3300046691 | Bacteria | 3989 |
| 682 | Ga0495670_0107157 | 3300046691 | Bacteria | 1444 |
| 683 | Ga0495671_0003813 | 3300046692 | Bacteria | 9167 |
| 684 | Ga0495671_0006426 | 3300046692 | Bacteria | 6786 |
| 685 | Ga0495671_0071006 | 3300046692 | Bacteria | 1710 |
| 686 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 687 | Ga0495581_0126222 | 3300047315 | Bacteria | 1490 |
| 688 | Ga0495604_0285296 | 3300047317 | Bacteria | 1114 |
| 689 | Ga0495636_0000126 | 3300047318 | Bacteria | 31355 |
| 690 | Ga0495636_0001826 | 3300047318 | Bacteria | 8143 |
| 691 | Ga0495636_0012157 | 3300047318 | Bacteria | 3409 |
| 692 | Ga0495672_0021078 | 3300047320 | Bacteria | 4255 |
| 693 | Ga0495683_0002800 | 3300047323 | Bacteria | 10350 |
| 694 | Ga0495683_0034847 | 3300047323 | Bacteria | 2558 |
| 695 | Ga0495687_001241 | 3300047443 | Bacteria | 24342 |
| 696 | Ga0495677_0009136 | 3300047445 | Bacteria | 3662 |
| 697 | Ga0495679_023734 | 3300047446 | Bacteria | 2076 |
| 698 | Ga0495685_000011 | 3300047447 | Bacteria | 83484 |
| 699 | Ga0495673_0011344 | 3300047469 | Bacteria | 4798 |
| 700 | Ga0495686_0065443 | 3300047472 | Bacteria | 2247 |
| 701 | Ga0495615_0040933 | 3300048090 | Bacteria | 1156 |
| 702 | Ga0496100_0019589 | 3300048903 | Bacteria | 4040 |
| 703 | Ga0496100_0174425 | 3300048903 | Bacteria | 1551 |
| 704 | Ga0496101_0055419 | 3300048904 | Bacteria | 2864 |
| 705 | Ga0496102_0024754 | 3300048905 | Bacteria | 5339 |
| 706 | Ga0496103_0034983 | 3300048906 | Bacteria | 3074 |
| 707 | Ga0496104_0015148 | 3300048907 | Bacteria | 6978 |
| 708 | Ga0496104_0056915 | 3300048907 | Bacteria | 3700 |
| 709 | Ga0496104_0182274 | 3300048907 | Bacteria | 2010 |
| 710 | Ga0496104_0504365 | 3300048907 | Bacteria | 1121 |
| 711 | Ga0496105_0007719 | 3300048908 | Bacteria | 8345 |
| 712 | Ga0496106_0079818 | 3300048909 | Bacteria | 2512 |
| 713 | Ga0496106_0150524 | 3300048909 | Bacteria | 1835 |
| 714 | Ga0496107_0041786 | 3300048910 | Bacteria | 3293 |
| 715 | Ga0496108_0062186 | 3300048911 | Bacteria | 3144 |
| 716 | Ga0496109_0016390 | 3300048912 | Bacteria | 6478 |
| 717 | Ga0496109_0024245 | 3300048912 | Bacteria | 5392 |
| 718 | Ga0496109_0323986 | 3300048912 | Bacteria | 1454 |
| 719 | Ga0496110_0005377 | 3300048913 | Bacteria | 10034 |
| 720 | Ga0496110_0035053 | 3300048913 | Bacteria | 4351 |
| 721 | Ga0496110_0078155 | 3300048913 | Bacteria | 2946 |
| 722 | Ga0496110_0229649 | 3300048913 | Bacteria | 1687 |
| 723 | Ga0496111_0214079 | 3300048914 | Bacteria | 1431 |
| 724 | Ga0496112_0048314 | 3300048915 | Bacteria | 4172 |
| 725 | Ga0496112_0308978 | 3300048915 | Bacteria | 1526 |
| 726 | Ga0496112_0581175 | 3300048915 | Bacteria | 1053 |
| 727 | Ga0496113_0099775 | 3300048916 | Bacteria | 2249 |
| 728 | Ga0496113_0294734 | 3300048916 | Bacteria | 1298 |
| 729 | Ga0496113_0413084 | 3300048916 | Bacteria | 1084 |
| 730 | Ga0496114_0027067 | 3300048917 | Bacteria | 4697 |
| 731 | Ga0496114_0087579 | 3300048917 | Bacteria | 2640 |
| 732 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 733 | Ga0496115_0053190 | 3300048918 | Bacteria | 3249 |
| 734 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 735 | Ga0496116_0000132 | 3300048919 | Bacteria | 156427 |
| 736 | Ga0496116_0010095 | 3300048919 | Bacteria | 7959 |
| 737 | Ga0496116_0042776 | 3300048919 | Bacteria | 3093 |
| 738 | Ga0496117_0000463 | 3300048920 | Bacteria | 67832 |
| 739 | Ga0496117_0002979 | 3300048920 | Bacteria | 20414 |
| 740 | Ga0496117_0070042 | 3300048920 | Bacteria | 2358 |
| 741 | Ga0496118_0000686 | 3300048921 | Bacteria | 55044 |
| 742 | Ga0496118_0002015 | 3300048921 | Bacteria | 28746 |
| 743 | Ga0496118_0003815 | 3300048921 | Bacteria | 18566 |
| 744 | Ga0496118_0008917 | 3300048921 | Bacteria | 10238 |
| 745 | Ga0496118_0063756 | 3300048921 | Bacteria | 2709 |
| 746 | Ga0496119_0000012 | 3300048922 | Bacteria | 411917 |
| 747 | Ga0496119_0000430 | 3300048922 | Bacteria | 57802 |
| 748 | Ga0496119_0000697 | 3300048922 | Bacteria | 45018 |
| 749 | Ga0496119_0001891 | 3300048922 | Bacteria | 24077 |
| 750 | Ga0496119_0004881 | 3300048922 | Bacteria | 13128 |
| 751 | Ga0496119_0007784 | 3300048922 | Bacteria | 9554 |
| 752 | Ga0496119_0012385 | 3300048922 | Bacteria | 6934 |
| 753 | Ga0496119_0022598 | 3300048922 | Bacteria | 4494 |
| 754 | Ga0496119_0071410 | 3300048922 | Bacteria | 2032 |
| 755 | Ga0496120_0000004 | 3300048923 | Bacteria | 534793 |
| 756 | Ga0496120_0000048 | 3300048923 | Bacteria | 187988 |
| 757 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 758 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 759 | Ga0496120_0001388 | 3300048923 | Bacteria | 29391 |
| 760 | Ga0496120_0002094 | 3300048923 | Bacteria | 21392 |
| 761 | Ga0496120_0018310 | 3300048923 | Bacteria | 4520 |
| 762 | Ga0496121_0001726 | 3300048924 | Bacteria | 35676 |
| 763 | Ga0496121_0036052 | 3300048924 | Bacteria | 4416 |
| 764 | Ga0496121_0090329 | 3300048924 | Bacteria | 2394 |
| 765 | Ga0496121_0144220 | 3300048924 | Bacteria | 1762 |
| 766 | Ga0496122_0000382 | 3300048925 | Bacteria | 94878 |
| 767 | Ga0496122_0175875 | 3300048925 | Bacteria | 1283 |
| 768 | Ga0496123_0000516 | 3300048926 | Bacteria | 67323 |
| 769 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 770 | Ga0496125_0000330 | 3300048928 | Bacteria | 91043 |
| 771 | Ga0496125_0009099 | 3300048928 | Bacteria | 10274 |
| 772 | Ga0496125_0031549 | 3300048928 | Bacteria | 4721 |
| 773 | Ga0496125_0040456 | 3300048928 | Bacteria | 3999 |
| 774 | Ga0496125_0127589 | 3300048928 | Bacteria | 1799 |
| 775 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 776 | Ga0496126_0001039 | 3300048929 | Bacteria | 46936 |
| 777 | Ga0496126_0037867 | 3300048929 | Bacteria | 4493 |
| 778 | Ga0496126_0077938 | 3300048929 | Bacteria | 2937 |
| 779 | Ga0496126_0082380 | 3300048929 | Bacteria | 2843 |
| 780 | Ga0496126_0259673 | 3300048929 | Bacteria | 1445 |
| 781 | Ga0496126_0417274 | 3300048929 | Unclassified | 1086 |
| 782 | Ga0495678_001683 | 3300049459 | Bacteria | 16763 |
| 783 | Ga0495682_0000592 | 3300049460 | Bacteria | 24625 |
| 784 | Ga0495682_0005886 | 3300049460 | Bacteria | 5032 |
| 785 | Ga0501290_000376 | 3300049513 | Bacteria | 7078 |
| 786 | Ga0501298_005067 | 3300049521 | Bacteria | 2098 |
| 787 | Ga0501299_009933 | 3300049522 | Bacteria | 1580 |
| 788 | Ga0501300_010377 | 3300049523 | Bacteria | 1359 |
| 789 | Ga0501031_0008845 | 3300049568 | Bacteria | 6547 |
| 790 | Ga0501032_0002377 | 3300049569 | Bacteria | 14696 |
| 791 | Ga0501032_0009421 | 3300049569 | Bacteria | 7077 |
| 792 | Ga0501032_0186104 | 3300049569 | Bacteria | 1358 |
| 793 | Ga0501033_0060374 | 3300049570 | Bacteria | 2798 |
| 794 | Ga0501034_0110665 | 3300049571 | Bacteria | 2737 |
| 795 | Ga0501034_0158249 | 3300049571 | Bacteria | 2238 |
| 796 | Ga0501034_0214661 | 3300049571 | Bacteria | 1878 |
| 797 | Ga0501034_0333914 | 3300049571 | Bacteria | 1447 |
| 798 | Ga0501036_0068231 | 3300049572 | Bacteria | 3009 |
| 799 | Ga0501037_0001786 | 3300049573 | Bacteria | 15607 |
| 800 | Ga0501037_0108833 | 3300049573 | Bacteria | 1997 |
| 801 | Ga0501038_0013274 | 3300049574 | Bacteria | 7513 |
| 802 | Ga0501038_0286619 | 3300049574 | Bacteria | 1295 |
| 803 | Ga0501039_0016576 | 3300049575 | Bacteria | 5644 |
| 804 | Ga0501039_0188814 | 3300049575 | Bacteria | 1621 |
| 805 | Ga0501040_0049683 | 3300049576 | Bacteria | 2868 |
| 806 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 807 | Ga0501043_0014311 | 3300049579 | Bacteria | 6208 |
| 808 | Ga0501043_0051364 | 3300049579 | Bacteria | 3239 |
| 809 | Ga0501043_0101683 | 3300049579 | Bacteria | 2259 |
| 810 | Ga0501043_0144710 | 3300049579 | Bacteria | 1861 |
| 811 | Ga0501043_0251255 | 3300049579 | Bacteria | 1362 |
| 812 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 813 | Ga0501046_0001067 | 3300049580 | Bacteria | 26860 |
| 814 | Ga0501046_0361178 | 3300049580 | Bacteria | 1053 |
| 815 | Ga0501046_0394927 | 3300049580 | Bacteria | 1000 |
| 816 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 817 | Ga0501047_0010222 | 3300049581 | Bacteria | 8874 |
| 818 | Ga0501047_0012660 | 3300049581 | Bacteria | 7991 |
| 819 | Ga0501047_0032841 | 3300049581 | Bacteria | 5011 |
| 820 | Ga0501047_0067393 | 3300049581 | Bacteria | 3449 |
| 821 | Ga0501047_0222711 | 3300049581 | Bacteria | 1742 |
| 822 | Ga0501047_0475506 | 3300049581 | Bacteria | 1077 |
| 823 | Ga0501048_0037281 | 3300049582 | Bacteria | 3491 |
| 824 | Ga0501067_0000848 | 3300049583 | Bacteria | 16476 |
| 825 | Ga0501068_0000617 | 3300049584 | Bacteria | 18103 |
| 826 | Ga0501068_0098348 | 3300049584 | Bacteria | 1812 |
| 827 | Ga0501069_0040598 | 3300049585 | Bacteria | 2572 |
| 828 | Ga0501069_0236578 | 3300049585 | Bacteria | 1064 |
| 829 | Ga0501070_0000303 | 3300049586 | Bacteria | 45531 |
| 830 | Ga0501070_0002582 | 3300049586 | Bacteria | 15833 |
| 831 | Ga0501070_0010641 | 3300049586 | Bacteria | 7776 |
| 832 | Ga0501070_0027717 | 3300049586 | Bacteria | 4752 |
| 833 | Ga0501070_0036559 | 3300049586 | Bacteria | 4100 |
| 834 | Ga0501070_0079526 | 3300049586 | Bacteria | 2713 |
| 835 | Ga0501070_0261101 | 3300049586 | Bacteria | 1415 |
| 836 | Ga0501070_0335079 | 3300049586 | Bacteria | 1229 |
| 837 | Ga0501073_0000010 | 3300049589 | Bacteria | 171144 |
| 838 | Ga0501073_0038823 | 3300049589 | Bacteria | 3376 |
| 839 | Ga0501073_0044972 | 3300049589 | Bacteria | 3111 |
| 840 | Ga0501073_0048654 | 3300049589 | Bacteria | 2976 |
| 841 | Ga0501074_0003264 | 3300049590 | Bacteria | 11457 |
| 842 | Ga0501077_0000020 | 3300049593 | Bacteria | 80360 |
| 843 | Ga0501077_0404250 | 3300049593 | Bacteria | 873 |
| 844 | Ga0501079_0072909 | 3300049741 | Bacteria | 2654 |
| 845 | Ga0501080_0006640 | 3300049742 | Bacteria | 10405 |
| 846 | Ga0501080_0007518 | 3300049742 | Bacteria | 9841 |
| 847 | Ga0501080_0019639 | 3300049742 | Bacteria | 6260 |
| 848 | Ga0501080_0034822 | 3300049742 | Bacteria | 4703 |
| 849 | Ga0501080_0037099 | 3300049742 | Bacteria | 4551 |
| 850 | Ga0501083_0015283 | 3300049744 | Bacteria | 5376 |
| 851 | Ga0501083_0219020 | 3300049744 | Bacteria | 1240 |
| 852 | Ga0501265_000970 | 3300049762 | Bacteria | 3227 |
| 853 | Ga0501275_000183 | 3300049772 | Bacteria | 7187 |
| 854 | Ga0501280_017566 | 3300049776 | Bacteria | 1041 |
| 855 | Ga0501035_0013770 | 3300049822 | Bacteria | 7465 |
| 856 | Ga0501035_0060195 | 3300049822 | Bacteria | 3381 |
| 857 | Ga0501035_0081390 | 3300049822 | Bacteria | 2858 |
| 858 | Ga0501035_0147171 | 3300049822 | Bacteria | 2045 |
| 859 | Ga0501044_0012237 | 3300049823 | Bacteria | 9291 |
| 860 | Ga0501044_0016416 | 3300049823 | Bacteria | 7948 |
| 861 | Ga0501044_0032343 | 3300049823 | Bacteria | 5500 |
| 862 | Ga0501044_0059893 | 3300049823 | Bacteria | 3900 |
| 863 | Ga0501045_0020112 | 3300049824 | Bacteria | 4766 |
| 864 | nmdc:mga0yw44_186648_c1 | 3300050492 | Bacteria | 1366 |
| 865 | nmdc:mga05p37_16474_c1 | 3300050507 | Bacteria | 8904 |
| 866 | nmdc:mga05p37_694_c1 | 3300050507 | Bacteria | 37343 |
| 867 | nmdc:mga09592_404502_c1 | 3300050508 | Bacteria | 1180 |
| 868 | nmdc:mga09592_62130_c1 | 3300050508 | Bacteria | 3160 |
| 869 | nmdc:mga0qj67_228_c1 | 3300050509 | Bacteria | 38249 |
| 870 | nmdc:mga0qj67_450972_c1 | 3300050509 | Bacteria | 1036 |
| 871 | nmdc:mga06r32_1123_c1 | 3300050510 | Bacteria | 23971 |
| 872 | nmdc:mga06r32_1145_c1 | 3300050510 | Bacteria | 23824 |
| 873 | nmdc:mga06r32_31_c1 | 3300050510 | Bacteria | 84127 |
| 874 | nmdc:mga08y16_10451_c1 | 3300050511 | Bacteria | 9737 |
| 875 | nmdc:mga08y16_27836_c1 | 3300050511 | Bacteria | 5957 |
| 876 | nmdc:mga08y16_85150_c1 | 3300050511 | Bacteria | 3294 |
| 877 | nmdc:mga0a205_192793_c1 | 3300050515 | Bacteria | 1929 |
| 878 | nmdc:mga0sz30_8079_c1 | 3300050516 | Bacteria | 3964 |
| 879 | Ga0500610_0000196 | 3300053079 | Bacteria | 18435 |
| 880 | Ga0500643_000211 | 3300053087 | Bacteria | 54924 |
| 881 | Ga0500583_0007954 | 3300053092 | Bacteria | 3771 |
| 882 | Ga0500555_011416 | 3300053103 | Bacteria | 2551 |
| 883 | Ga0500642_0035598 | 3300053130 | Bacteria | 2115 |
| 884 | Ga0500655_003841 | 3300053133 | Bacteria | 2712 |
| 885 | Ga0500658_0001988 | 3300053134 | Bacteria | 7989 |
| 886 | Ga0500559_0000239 | 3300053136 | Bacteria | 43769 |
| 887 | Ga0500559_0002389 | 3300053136 | Bacteria | 9751 |
| 888 | Ga0500564_071224 | 3300053138 | Bacteria | 1567 |
| 889 | Ga0500604_0001101 | 3300053151 | Bacteria | 7507 |
| 890 | Ga0500616_0081439 | 3300053153 | Bacteria | 1626 |
| 891 | Ga0500619_000142 | 3300053154 | Bacteria | 17663 |
| 892 | Ga0500622_0024448 | 3300053156 | Bacteria | 3193 |
| 893 | Ga0500636_0053868 | 3300053177 | Bacteria | 2360 |
| 894 | Ga0500645_015778 | 3300053730 | Bacteria | 2388 |
| 895 | Ga0500587_004922 | 3300053739 | Bacteria | 1818 |
| 896 | Ga0500661_000087 | 3300055283 | Bacteria | 14826 |
| 897 | Ga0500661_020546 | 3300055283 | Bacteria | 1173 |
| 898 | Ga0501082_0227294 | 3300060353 | Bacteria | 1624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0020966 | Ga0495633_0020966_387_1100 | 228 |
| 2 | 3300042131 | Ga0450894_021614 | Ga0450894_021614_112_819 | 232 |
| 3 | 3300041507 | Ga0451851_0568421 | Ga0451851_0568421_16_765 | 245 |
| 4 | 3300013100 | Ga0157373_10158281 | Ga0157373_101582812 | 247 |
| 5 | 3300046492 | Ga0495585_0017935 | Ga0495585_0017935_911_1666 | 248 |
| 6 | 3300048916 | Ga0496113_0294734 | Ga0496113_0294734_51_806 | 248 |
| 7 | 3300001904 | JGI24736J21556_1016497 | JGI24736J21556_10164972 | 250 |
| 8 | 3300001915 | JGI24741J21665_1003437 | JGI24741J21665_10034372 | 250 |
| 9 | 3300001979 | JGI24740J21852_10000727 | JGI24740J21852_1000072710 | 250 |
| 10 | 3300001979 | JGI24740J21852_10001960 | JGI24740J21852_100019602 | 250 |
| 11 | 3300005329 | Ga0070683_100179651 | Ga0070683_1001796512 | 250 |
| 12 | 3300005336 | Ga0070680_100002154 | Ga0070680_1000021547 | 250 |
| 13 | 3300005337 | Ga0070682_100009177 | Ga0070682_1000091772 | 250 |
| 14 | 3300005341 | Ga0070691_10000094 | Ga0070691_100000944 | 250 |
| 15 | 3300005366 | Ga0070659_100160227 | Ga0070659_1001602271 | 250 |
| 16 | 3300005458 | Ga0070681_10000783 | Ga0070681_1000078313 | 250 |
| 17 | 3300005530 | Ga0070679_100001730 | Ga0070679_1000017307 | 250 |
| 18 | 3300005535 | Ga0070684_100418005 | Ga0070684_1004180052 | 250 |
| 19 | 3300005539 | Ga0068853_100289314 | Ga0068853_1002893141 | 250 |
| 20 | 3300005546 | Ga0070696_100012785 | Ga0070696_1000127854 | 250 |
| 21 | 3300005547 | Ga0070693_100099156 | Ga0070693_1000991562 | 250 |
| 22 | 3300005614 | Ga0068856_100052307 | Ga0068856_1000523072 | 250 |
| 23 | 3300005614 | Ga0068856_100312381 | Ga0068856_1003123812 | 250 |
| 24 | 3300005616 | Ga0068852_100063861 | Ga0068852_1000638612 | 250 |
| 25 | 3300005834 | Ga0068851_10014972 | Ga0068851_100149722 | 250 |
| 26 | 3300013307 | Ga0157372_10016287 | Ga0157372_100162878 | 250 |
| 27 | 3300020069 | Ga0197907_11148482 | Ga0197907_111484821 | 250 |
| 28 | 3300020082 | Ga0206353_10620874 | Ga0206353_106208743 | 250 |
| 29 | 3300025321 | Ga0207656_10010628 | Ga0207656_100106282 | 250 |
| 30 | 3300025904 | Ga0207647_10001545 | Ga0207647_100015453 | 250 |
| 31 | 3300025909 | Ga0207705_10011888 | Ga0207705_100118883 | 250 |
| 32 | 3300025909 | Ga0207705_10041301 | Ga0207705_100413012 | 250 |
| 33 | 3300025911 | Ga0207654_10050904 | Ga0207654_100509043 | 250 |
| 34 | 3300025912 | Ga0207707_10000493 | Ga0207707_1000049313 | 250 |
| 35 | 3300025912 | Ga0207707_10000630 | Ga0207707_1000063015 | 250 |
| 36 | 3300025912 | Ga0207707_10042221 | Ga0207707_100422213 | 250 |
| 37 | 3300025913 | Ga0207695_10004476 | Ga0207695_1000447618 | 250 |
| 38 | 3300025913 | Ga0207695_10019150 | Ga0207695_100191502 | 250 |
| 39 | 3300025917 | Ga0207660_10000570 | Ga0207660_100005707 | 250 |
| 40 | 3300025917 | Ga0207660_10000885 | Ga0207660_1000088513 | 250 |
| 41 | 3300025917 | Ga0207660_10002187 | Ga0207660_100021872 | 250 |
| 42 | 3300025920 | Ga0207649_10001342 | Ga0207649_1000134210 | 250 |
| 43 | 3300025920 | Ga0207649_10173141 | Ga0207649_101731412 | 250 |
| 44 | 3300025921 | Ga0207652_10000152 | Ga0207652_1000015263 | 250 |
| 45 | 3300025921 | Ga0207652_10001326 | Ga0207652_100013266 | 250 |
| 46 | 3300025921 | Ga0207652_10003549 | Ga0207652_100035492 | 250 |
| 47 | 3300025921 | Ga0207652_10163546 | Ga0207652_101635462 | 250 |
| 48 | 3300025924 | Ga0207694_10070569 | Ga0207694_100705692 | 250 |
| 49 | 3300025932 | Ga0207690_10020303 | Ga0207690_100203032 | 250 |
| 50 | 3300025933 | Ga0207706_10102892 | Ga0207706_101028922 | 250 |
| 51 | 3300025944 | Ga0207661_10000457 | Ga0207661_1000045728 | 250 |
| 52 | 3300025945 | Ga0207679_10005902 | Ga0207679_100059025 | 250 |
| 53 | 3300025949 | Ga0207667_10085069 | Ga0207667_100850692 | 250 |
| 54 | 3300025949 | Ga0207667_10097346 | Ga0207667_100973462 | 250 |
| 55 | 3300025981 | Ga0207640_10001114 | Ga0207640_100011146 | 250 |
| 56 | 3300026041 | Ga0207639_10004251 | Ga0207639_100042513 | 250 |
| 57 | 3300026078 | Ga0207702_10046486 | Ga0207702_100464862 | 250 |
| 58 | 3300026078 | Ga0207702_10065837 | Ga0207702_100658373 | 250 |
| 59 | 3300026116 | Ga0207674_10250129 | Ga0207674_102501292 | 250 |
| 60 | 3300049581 | Ga0501047_0475506 | Ga0501047_0475506_74_826 | 250 |
| 61 | 3300049586 | Ga0501070_0261101 | Ga0501070_0261101_629_1381 | 250 |
| 62 | 3300049822 | Ga0501035_0060195 | Ga0501035_0060195_1761_2537 | 252 |
| 63 | 3300049584 | Ga0501068_0000617 | Ga0501068_0000617_5620_6456 | 253 |
| 64 | 3300049586 | Ga0501070_0079526 | Ga0501070_0079526_1352_2188 | 253 |
| 65 | 3300049589 | Ga0501073_0044972 | Ga0501073_0044972_98_934 | 253 |
| 66 | 3300049593 | Ga0501077_0404250 | Ga0501077_0404250_23_859 | 253 |
| 67 | 3300049742 | Ga0501080_0006640 | Ga0501080_0006640_6553_7389 | 253 |
| 68 | 3300025893 | Ga0207682_10116694 | Ga0207682_101166941 | 256 |
| 69 | 3300013306 | Ga0163162_10104471 | Ga0163162_101044711 | 258 |
| 70 | 3300014326 | Ga0157380_10439215 | Ga0157380_104392152 | 258 |
| 71 | 3300025940 | Ga0207691_10220885 | Ga0207691_102208852 | 258 |
| 72 | 3300028379 | Ga0268266_10597230 | Ga0268266_105972301 | 258 |
| 73 | 3300037466 | Ga0395898_0373568 | Ga0395898_0373568_128_961 | 258 |
| 74 | 3300037471 | Ga0395905_0068570 | Ga0395905_0068570_1387_2220 | 258 |
| 75 | 3300046692 | Ga0495671_0003813 | Ga0495671_0003813_1477_2340 | 258 |
| 76 | 3300047317 | Ga0495604_0285296 | Ga0495604_0285296_40_906 | 258 |
| 77 | 3300048905 | Ga0496102_0024754 | Ga0496102_0024754_1068_1934 | 258 |
| 78 | 3300048909 | Ga0496106_0079818 | Ga0496106_0079818_1263_2129 | 258 |
| 79 | 3300049569 | Ga0501032_0002377 | Ga0501032_0002377_650_1492 | 258 |
| 80 | 3300049579 | Ga0501043_0051364 | Ga0501043_0051364_123_965 | 258 |
| 81 | 3300049583 | Ga0501067_0000848 | Ga0501067_0000848_3925_4767 | 258 |
| 82 | 3300049589 | Ga0501073_0000010 | Ga0501073_0000010_28876_29718 | 258 |
| 83 | 3300049593 | Ga0501077_0000020 | Ga0501077_0000020_73977_74819 | 258 |
| 84 | 3300049742 | Ga0501080_0037099 | Ga0501080_0037099_3511_4353 | 258 |
| 85 | 3300049744 | Ga0501083_0219020 | Ga0501083_0219020_172_1014 | 258 |
| 86 | 3300049823 | Ga0501044_0012237 | Ga0501044_0012237_1909_2751 | 258 |
| 87 | 3300005329 | Ga0070683_100001770 | Ga0070683_1000017705 | 261 |
| 88 | 3300005535 | Ga0070684_100229878 | Ga0070684_1002298781 | 261 |
| 89 | 3300025944 | Ga0207661_10094908 | Ga0207661_100949082 | 261 |
| 90 | 3300028794 | Ga0307515_10003144 | Ga0307515_1000314434 | 261 |
| 91 | 3300005365 | Ga0070688_100006549 | Ga0070688_1000065492 | 262 |
| 92 | 3300005466 | Ga0070685_10000002 | Ga0070685_10000002201 | 262 |
| 93 | 3300005843 | Ga0068860_100002839 | Ga0068860_10000283911 | 262 |
| 94 | 3300009092 | Ga0105250_10000003 | Ga0105250_10000003131 | 262 |
| 95 | 3300025711 | Ga0207696_1000004 | Ga0207696_1000004502 | 262 |
| 96 | 3300025900 | Ga0207710_10107373 | Ga0207710_101073732 | 262 |
| 97 | 3300026088 | Ga0207641_10035178 | Ga0207641_100351785 | 262 |
| 98 | 3300028379 | Ga0268266_10575526 | Ga0268266_105755262 | 262 |
| 99 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004836 | 262 |
| 100 | 3300031251 | Ga0265327_10002593 | Ga0265327_100025939 | 262 |
| 101 | 3300041413 | Ga0439465_0000927 | Ga0439465_0000927_8440_9276 | 262 |
| 102 | 3300042007 | Ga0439449_0010982 | Ga0439449_0010982_2535_3371 | 262 |
| 103 | 3300028794 | Ga0307515_10002783 | Ga0307515_100027832 | 263 |
| 104 | 3300031456 | Ga0307513_10051014 | Ga0307513_100510144 | 263 |
| 105 | 3300031649 | Ga0307514_10001537 | Ga0307514_100015372 | 263 |
| 106 | 3300005272 | Ga0065703_1019008 | Ga0065703_10190082 | 264 |
| 107 | 3300006946 | Ga0079104_1002293 | Ga0079104_10022939 | 264 |
| 108 | 3300009011 | Ga0105251_10000119 | Ga0105251_100001199 | 264 |
| 109 | 3300009011 | Ga0105251_10003742 | Ga0105251_100037424 | 264 |
| 110 | 3300009101 | Ga0105247_10000025 | Ga0105247_10000025150 | 264 |
| 111 | 3300009174 | Ga0105241_10000004 | Ga0105241_10000004730 | 264 |
| 112 | 3300013100 | Ga0157373_10000690 | Ga0157373_100006904 | 264 |
| 113 | 3300014497 | Ga0182008_10061615 | Ga0182008_100616152 | 264 |
| 114 | 3300017792 | Ga0163161_10000001 | Ga0163161_10000001293 | 264 |
| 115 | 3300025711 | Ga0207696_1000001 | Ga0207696_1000001376 | 264 |
| 116 | 3300025735 | Ga0207713_1000024 | Ga0207713_1000024271 | 264 |
| 117 | 3300025735 | Ga0207713_1000026 | Ga0207713_100002659 | 264 |
| 118 | 3300025900 | Ga0207710_10000140 | Ga0207710_100001404 | 264 |
| 119 | 3300025911 | Ga0207654_10000006 | Ga0207654_10000006748 | 264 |
| 120 | 3300027111 | Ga0209281_1000008 | Ga0209281_100000854 | 264 |
| 121 | 3300042145 | Ga0450906_005612 | Ga0450906_005612_167_973 | 264 |
| 122 | 3300046453 | Ga0495627_000018 | Ga0495627_000018_248541_249383 | 264 |
| 123 | 3300046530 | Ga0495654_0001734 | Ga0495654_0001734_9184_10026 | 264 |
| 124 | 3300046794 | Ga0495589_0000002 | Ga0495589_0000002_292121_292963 | 264 |
| 125 | 3300048907 | Ga0496104_0504365 | Ga0496104_0504365_85_927 | 264 |
| 126 | 3300048919 | Ga0496116_0000023 | Ga0496116_0000023_261523_262365 | 264 |
| 127 | 3300048920 | Ga0496117_0000463 | Ga0496117_0000463_12465_13307 | 264 |
| 128 | 3300048921 | Ga0496118_0003815 | Ga0496118_0003815_14723_15565 | 264 |
| 129 | 3300048922 | Ga0496119_0001891 | Ga0496119_0001891_21773_22615 | 264 |
| 130 | 3300048922 | Ga0496119_0004881 | Ga0496119_0004881_1996_2838 | 264 |
| 131 | 3300048922 | Ga0496119_0071410 | Ga0496119_0071410_1014_1856 | 264 |
| 132 | 3300048923 | Ga0496120_0000052 | Ga0496120_0000052_126257_127099 | 264 |
| 133 | 3300048923 | Ga0496120_0000137 | Ga0496120_0000137_28917_29759 | 264 |
| 134 | 3300048927 | Ga0496124_0000017 | Ga0496124_0000017_200662_201504 | 264 |
| 135 | 3300014497 | Ga0182008_10003099 | Ga0182008_1000309910 | 266 |
| 136 | 3300015261 | Ga0182006_1000989 | Ga0182006_100098922 | 266 |
| 137 | 3300015265 | Ga0182005_1001309 | Ga0182005_100130911 | 266 |
| 138 | 3300031911 | Ga0307412_10019498 | Ga0307412_100194982 | 266 |
| 139 | 3300041404 | Ga0439436_0000030 | Ga0439436_0000030_2818_3666 | 266 |
| 140 | 3300046512 | Ga0495610_0004378 | Ga0495610_0004378_2364_3212 | 266 |
| 141 | 3300046691 | Ga0495670_0013691 | Ga0495670_0013691_1856_2704 | 266 |
| 142 | 3300048913 | Ga0496110_0229649 | Ga0496110_0229649_780_1646 | 266 |
| 143 | 3300048922 | Ga0496119_0022598 | Ga0496119_0022598_1410_2258 | 266 |
| 144 | 3300053730 | Ga0500645_015778 | Ga0500645_015778_60_917 | 266 |
| 145 | 3300041413 | Ga0439465_0007670 | Ga0439465_0007670_30_878 | 267 |
| 146 | 3300031911 | Ga0307412_10035790 | Ga0307412_100357902 | 268 |
| 147 | iso_pu_bacteria | 2571042365 | 2572256253 | 268 |
| 148 | iso_pu_bacteria | 2602042109 | 2603868028 | 268 |
| 149 | iso_pu_bacteria | 642555113 | 642619682 | 268 |
| 150 | iso_pu_bacteria | 2643221665 | 2644363800 | 270 |
| 151 | iso_pu_bacteria | 2744054655 | 2745161186 | 270 |
| 152 | iso_pu_bacteria | 2773857770 | 2774439561 | 270 |
| 153 | iso_pu_bacteria | 2919182534 | 2919186184 | 270 |
| 154 | iso_pu_bacteria | 2928515477 | 2928518588 | 270 |
| 155 | iso_pu_bacteria | 2998344455 | 2998344756 | 270 |
| 156 | 3300014326 | Ga0157380_10112659 | Ga0157380_101126592 | 271 |
| 157 | 3300046454 | Ga0495592_0005606 | Ga0495592_0005606_7626_8483 | 271 |
| 158 | 3300053138 | Ga0500564_071224 | Ga0500564_071224_362_1219 | 271 |
| 159 | iso_pu_bacteria | 8055693939 | 8055695332 | 271 |
| 160 | 3300005616 | Ga0068852_100006182 | Ga0068852_1000061822 | 272 |
| 161 | 3300006944 | Ga0099823_1071482 | Ga0099823_10714821 | 272 |
| 162 | 3300021361 | Ga0213872_10004916 | Ga0213872_100049165 | 272 |
| 163 | 3300025931 | Ga0207644_10093888 | Ga0207644_100938882 | 272 |
| 164 | 3300026142 | Ga0207698_10006712 | Ga0207698_100067128 | 272 |
| 165 | 3300031239 | Ga0265328_10018922 | Ga0265328_100189221 | 272 |
| 166 | 3300031250 | Ga0265331_10002458 | Ga0265331_1000245814 | 272 |
| 167 | 3300031251 | Ga0265327_10000020 | Ga0265327_10000020227 | 272 |
| 168 | 3300037312 | Ga0395899_0012560 | Ga0395899_0012560_561_1394 | 272 |
| 169 | 3300037418 | Ga0395900_0044849 | Ga0395900_0044849_3307_4140 | 272 |
| 170 | 3300037466 | Ga0395898_0061237 | Ga0395898_0061237_2388_3221 | 272 |
| 171 | 3300037471 | Ga0395905_0049852 | Ga0395905_0049852_2609_3442 | 272 |
| 172 | 3300038443 | Ga0395901_0324823 | Ga0395901_0324823_344_1177 | 272 |
| 173 | 3300039447 | Ga0436361_0106903 | Ga0436361_0106903_4737_5567 | 272 |
| 174 | 3300044656 | Ga0466969_0006906 | Ga0466969_0006906_4184_5026 | 272 |
| 175 | 3300044683 | Ga0466965_0074706 | Ga0466965_0074706_852_1694 | 272 |
| 176 | 3300044684 | Ga0466966_0020484 | Ga0466966_0020484_2833_3675 | 272 |
| 177 | 3300044693 | Ga0466961_0000063 | Ga0466961_0000063_19050_19892 | 272 |
| 178 | 3300044706 | Ga0466964_0042457 | Ga0466964_0042457_228_1070 | 272 |
| 179 | 3300045049 | Ga0466959_0057743 | Ga0466959_0057743_354_1196 | 272 |
| 180 | 3300045049 | Ga0466959_0145120 | Ga0466959_0145120_782_1624 | 272 |
| 181 | 3300046525 | Ga0495663_0005993 | Ga0495663_0005993_2289_3140 | 272 |
| 182 | 3300047318 | Ga0495636_0001826 | Ga0495636_0001826_4476_5318 | 272 |
| 183 | 3300047318 | Ga0495636_0012157 | Ga0495636_0012157_606_1445 | 272 |
| 184 | 3300048915 | Ga0496112_0048314 | Ga0496112_0048314_520_1350 | 272 |
| 185 | 3300048916 | Ga0496113_0099775 | Ga0496113_0099775_281_1111 | 272 |
| 186 | 3300048929 | Ga0496126_0417274 | Ga0496126_0417274_96_938 | 272 |
| 187 | 3300049523 | Ga0501300_010377 | Ga0501300_010377_141_977 | 272 |
| 188 | 3300049571 | Ga0501034_0158249 | Ga0501034_0158249_690_1529 | 272 |
| 189 | 3300049571 | Ga0501034_0333914 | Ga0501034_0333914_377_1219 | 272 |
| 190 | 3300049581 | Ga0501047_0012660 | Ga0501047_0012660_6100_6930 | 272 |
| 191 | iso_pu_bacteria | 2506520007 | 2506577583 | 272 |
| 192 | iso_pu_bacteria | 2506520008 | 2506582721 | 272 |
| 193 | iso_pu_bacteria | 2508501071 | 2508851520 | 272 |
| 194 | iso_pu_bacteria | 2654587920 | 2656277470 | 272 |
| 195 | iso_pu_bacteria | 2654587920 | 2656279079 | 272 |
| 196 | iso_pu_bacteria | 2687453601 | 2689444061 | 272 |
| 197 | iso_pu_bacteria | 2739367655 | 2739612110 | 272 |
| 198 | iso_pu_bacteria | 2772190666 | 2772438102 | 272 |
| 199 | iso_pu_bacteria | 2847085930 | 2847086700 | 272 |
| 200 | iso_pu_bacteria | 2869551831 | 2869553427 | 272 |
| 201 | iso_pu_bacteria | 2888366609 | 2888368117 | 272 |
| 202 | iso_pu_bacteria | 2888373701 | 2888374266 | 272 |
| 203 | iso_pu_bacteria | 2904504865 | 2904505326 | 272 |
| 204 | iso_pu_bacteria | 2908669403 | 2908672350 | 272 |
| 205 | iso_pu_bacteria | 2932406140 | 2932408457 | 272 |
| 206 | iso_pu_bacteria | 2937967321 | 2937969846 | 272 |
| 207 | iso_pu_bacteria | 2939577877 | 2939580118 | 272 |
| 208 | iso_pu_bacteria | 640753048 | 640937088 | 272 |
| 209 | iso_pu_bacteria | 8004592986 | 8004597589 | 272 |
| 210 | iso_pu_bacteria | 8015394850 | 8015397185 | 272 |
| 211 | 3300039447 | Ga0436361_0959303 | Ga0436361_0959303_1087_1920 | 273 |
| 212 | iso_pu_bacteria | 2643221603 | 2644028743 | 273 |
| 213 | iso_pu_bacteria | 2837678835 | 2837679331 | 273 |
| 214 | iso_pu_bacteria | 2837678835 | 2837682809 | 273 |
| 215 | 3300005295 | Ga0065707_10152917 | Ga0065707_101529172 | 274 |
| 216 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001146 | 274 |
| 217 | 3300005335 | Ga0070666_10021808 | Ga0070666_100218084 | 274 |
| 218 | 3300005353 | Ga0070669_100005867 | Ga0070669_1000058677 | 274 |
| 219 | 3300005355 | Ga0070671_100000042 | Ga0070671_10000004254 | 274 |
| 220 | 3300005367 | Ga0070667_100000096 | Ga0070667_10000009627 | 274 |
| 221 | 3300005548 | Ga0070665_100016024 | Ga0070665_1000160243 | 274 |
| 222 | 3300005617 | Ga0068859_100076339 | Ga0068859_1000763391 | 274 |
| 223 | 3300005618 | Ga0068864_100000006 | Ga0068864_100000006149 | 274 |
| 224 | 3300005841 | Ga0068863_100376721 | Ga0068863_1003767211 | 274 |
| 225 | 3300005842 | Ga0068858_100146898 | Ga0068858_1001468982 | 274 |
| 226 | 3300005844 | Ga0068862_100005935 | Ga0068862_1000059359 | 274 |
| 227 | 3300006931 | Ga0097620_100076340 | Ga0097620_1000763401 | 274 |
| 228 | 3300009036 | Ga0105244_10021059 | Ga0105244_100210592 | 274 |
| 229 | 3300009148 | Ga0105243_10000343 | Ga0105243_1000034349 | 274 |
| 230 | 3300009177 | Ga0105248_10049066 | Ga0105248_100490662 | 274 |
| 231 | 3300009553 | Ga0105249_10012855 | Ga0105249_100128558 | 274 |
| 232 | 3300013102 | Ga0157371_10000859 | Ga0157371_1000085910 | 274 |
| 233 | 3300013296 | Ga0157374_10005615 | Ga0157374_100056158 | 274 |
| 234 | 3300013307 | Ga0157372_10003428 | Ga0157372_1000342815 | 274 |
| 235 | 3300013307 | Ga0157372_10193077 | Ga0157372_101930771 | 274 |
| 236 | 3300013307 | Ga0157372_10748986 | Ga0157372_107489861 | 274 |
| 237 | 3300014325 | Ga0163163_10000032 | Ga0163163_1000003291 | 274 |
| 238 | 3300025272 | Ga0209455_1000474 | Ga0209455_100047415 | 274 |
| 239 | 3300025711 | Ga0207696_1015415 | Ga0207696_10154153 | 274 |
| 240 | 3300025728 | Ga0207655_1000840 | Ga0207655_100084014 | 274 |
| 241 | 3300025728 | Ga0207655_1004274 | Ga0207655_10042742 | 274 |
| 242 | 3300025903 | Ga0207680_10005909 | Ga0207680_100059094 | 274 |
| 243 | 3300025923 | Ga0207681_10002504 | Ga0207681_100025046 | 274 |
| 244 | 3300025923 | Ga0207681_10008671 | Ga0207681_100086717 | 274 |
| 245 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002825 | 274 |
| 246 | 3300025931 | Ga0207644_10000076 | Ga0207644_1000007634 | 274 |
| 247 | 3300025935 | Ga0207709_10000057 | Ga0207709_10000057185 | 274 |
| 248 | 3300025941 | Ga0207711_10003038 | Ga0207711_100030382 | 274 |
| 249 | 3300025961 | Ga0207712_10070940 | Ga0207712_100709402 | 274 |
| 250 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001529 | 274 |
| 251 | 3300026088 | Ga0207641_10007326 | Ga0207641_100073262 | 274 |
| 252 | 3300026088 | Ga0207641_10371967 | Ga0207641_103719671 | 274 |
| 253 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001825 | 274 |
| 254 | 3300027312 | Ga0209371_1000074 | Ga0209371_100007422 | 274 |
| 255 | 3300027312 | Ga0209371_1003036 | Ga0209371_10030367 | 274 |
| 256 | 3300028379 | Ga0268266_10009394 | Ga0268266_1000939411 | 274 |
| 257 | 3300028379 | Ga0268266_10058033 | Ga0268266_100580333 | 274 |
| 258 | 3300028380 | Ga0268265_10002058 | Ga0268265_1000205811 | 274 |
| 259 | 3300030500 | Ga0268256_1000067 | Ga0268256_100006722 | 274 |
| 260 | 3300030500 | Ga0268256_1002722 | Ga0268256_10027224 | 274 |
| 261 | 3300041405 | Ga0439438_000002 | Ga0439438_000002_255147_255989 | 274 |
| 262 | 3300041405 | Ga0439438_001667 | Ga0439438_001667_4544_5386 | 274 |
| 263 | 3300041407 | Ga0439447_002689 | Ga0439447_002689_1062_1904 | 274 |
| 264 | 3300042006 | Ga0439432_003014 | Ga0439432_003014_3244_4086 | 274 |
| 265 | 3300046471 | Ga0495650_0034341 | Ga0495650_0034341_527_1489 | 274 |
| 266 | 3300047323 | Ga0495683_0034847 | Ga0495683_0034847_682_1581 | 274 |
| 267 | 3300047446 | Ga0495679_023734 | Ga0495679_023734_893_1855 | 274 |
| 268 | 3300048907 | Ga0496104_0182274 | Ga0496104_0182274_704_1666 | 274 |
| 269 | 3300048919 | Ga0496116_0000132 | Ga0496116_0000132_34180_35022 | 274 |
| 270 | 3300048921 | Ga0496118_0063756 | Ga0496118_0063756_1401_2363 | 274 |
| 271 | 3300048922 | Ga0496119_0000012 | Ga0496119_0000012_184893_185735 | 274 |
| 272 | 3300048922 | Ga0496119_0000697 | Ga0496119_0000697_1710_2672 | 274 |
| 273 | 3300048922 | Ga0496119_0012385 | Ga0496119_0012385_2359_3201 | 274 |
| 274 | 3300048923 | Ga0496120_0000004 | Ga0496120_0000004_226183_227025 | 274 |
| 275 | 3300048923 | Ga0496120_0000048 | Ga0496120_0000048_152109_152951 | 274 |
| 276 | 3300048923 | Ga0496120_0018310 | Ga0496120_0018310_3042_4004 | 274 |
| 277 | 3300048925 | Ga0496122_0175875 | Ga0496122_0175875_290_1252 | 274 |
| 278 | 3300048928 | Ga0496125_0031549 | Ga0496125_0031549_420_1256 | 274 |
| 279 | 3300049513 | Ga0501290_000376 | Ga0501290_000376_982_1872 | 274 |
| 280 | 3300049580 | Ga0501046_0361178 | Ga0501046_0361178_92_937 | 274 |
| 281 | 3300049762 | Ga0501265_000970 | Ga0501265_000970_559_1449 | 274 |
| 282 | 3300049772 | Ga0501275_000183 | Ga0501275_000183_4277_5167 | 274 |
| 283 | iso_pu_bacteria | 2643221644 | 2644248778 | 274 |
| 284 | iso_pu_bacteria | 2818991445 | 2819591724 | 274 |
| 285 | iso_pu_bacteria | 2883291878 | 2883294161 | 274 |
| 286 | iso_pu_bacteria | 2883354860 | 2883357313 | 274 |
| 287 | iso_pu_bacteria | 641228493 | 641335799 | 274 |
| 288 | iso_pu_bacteria | 643348555 | 643389611 | 274 |
| 289 | 3300005328 | Ga0070676_10009222 | Ga0070676_100092224 | 275 |
| 290 | 3300005347 | Ga0070668_100001327 | Ga0070668_1000013279 | 275 |
| 291 | 3300005353 | Ga0070669_100003178 | Ga0070669_1000031786 | 275 |
| 292 | 3300005457 | Ga0070662_100005325 | Ga0070662_1000053253 | 275 |
| 293 | 3300005458 | Ga0070681_10071805 | Ga0070681_100718052 | 275 |
| 294 | 3300005719 | Ga0068861_100000011 | Ga0068861_10000001114 | 275 |
| 295 | 3300005844 | Ga0068862_100001082 | Ga0068862_10000108221 | 275 |
| 296 | 3300009147 | Ga0114129_10191059 | Ga0114129_101910593 | 275 |
| 297 | 3300009553 | Ga0105249_10015735 | Ga0105249_100157356 | 275 |
| 298 | 3300011119 | Ga0105246_10156332 | Ga0105246_101563322 | 275 |
| 299 | 3300013306 | Ga0163162_10189414 | Ga0163162_101894143 | 275 |
| 300 | 3300014325 | Ga0163163_10390726 | Ga0163163_103907263 | 275 |
| 301 | 3300014325 | Ga0163163_10774886 | Ga0163163_107748861 | 275 |
| 302 | 3300025907 | Ga0207645_10029620 | Ga0207645_100296204 | 275 |
| 303 | 3300025912 | Ga0207707_10179467 | Ga0207707_101794673 | 275 |
| 304 | 3300025917 | Ga0207660_10043674 | Ga0207660_100436743 | 275 |
| 305 | 3300025920 | Ga0207649_10090772 | Ga0207649_100907722 | 275 |
| 306 | 3300025923 | Ga0207681_10019340 | Ga0207681_100193406 | 275 |
| 307 | 3300025932 | Ga0207690_10080533 | Ga0207690_100805332 | 275 |
| 308 | 3300025933 | Ga0207706_10007611 | Ga0207706_100076113 | 275 |
| 309 | 3300025961 | Ga0207712_10052816 | Ga0207712_100528163 | 275 |
| 310 | 3300026118 | Ga0207675_100000254 | Ga0207675_10000025440 | 275 |
| 311 | 3300028380 | Ga0268265_10000889 | Ga0268265_100008899 | 275 |
| 312 | 3300031251 | Ga0265327_10000255 | Ga0265327_100002554 | 275 |
| 313 | 3300049579 | Ga0501043_0251255 | Ga0501043_0251255_267_1121 | 275 |
| 314 | 3300049581 | Ga0501047_0032841 | Ga0501047_0032841_1435_2289 | 275 |
| 315 | 3300049586 | Ga0501070_0036559 | Ga0501070_0036559_1373_2227 | 275 |
| 316 | 3300049823 | Ga0501044_0016416 | Ga0501044_0016416_868_1722 | 275 |
| 317 | iso_pu_bacteria | 2537561836 | 2538832242 | 275 |
| 318 | iso_pu_bacteria | 2687453130 | 2687583799 | 275 |
| 319 | iso_pu_bacteria | 2884411467 | 2884412187 | 275 |
| 320 | 3300003791 | Ga0055530_10001427 | Ga0055530_1000142716 | 276 |
| 321 | 3300003792 | Ga0055540_1000312 | Ga0055540_100031237 | 276 |
| 322 | 3300003794 | Ga0055531_10002021 | Ga0055531_100020218 | 276 |
| 323 | 3300003794 | Ga0055531_10005293 | Ga0055531_100052932 | 276 |
| 324 | 3300005290 | Ga0065712_10181904 | Ga0065712_101819041 | 276 |
| 325 | 3300005293 | Ga0065715_10116314 | Ga0065715_101163143 | 276 |
| 326 | 3300005330 | Ga0070690_100000447 | Ga0070690_10000044721 | 276 |
| 327 | 3300005331 | Ga0070670_100018619 | Ga0070670_1000186197 | 276 |
| 328 | 3300005334 | Ga0068869_100001940 | Ga0068869_1000019409 | 276 |
| 329 | 3300005335 | Ga0070666_10279265 | Ga0070666_102792651 | 276 |
| 330 | 3300005337 | Ga0070682_100063104 | Ga0070682_1000631043 | 276 |
| 331 | 3300005338 | Ga0068868_100139217 | Ga0068868_1001392173 | 276 |
| 332 | 3300005341 | Ga0070691_10091782 | Ga0070691_100917822 | 276 |
| 333 | 3300005343 | Ga0070687_100001347 | Ga0070687_1000013474 | 276 |
| 334 | 3300005344 | Ga0070661_100009331 | Ga0070661_1000093318 | 276 |
| 335 | 3300005347 | Ga0070668_100073379 | Ga0070668_1000733793 | 276 |
| 336 | 3300005354 | Ga0070675_100002389 | Ga0070675_10000238913 | 276 |
| 337 | 3300005364 | Ga0070673_100008457 | Ga0070673_1000084573 | 276 |
| 338 | 3300005456 | Ga0070678_100179449 | Ga0070678_1001794492 | 276 |
| 339 | 3300005457 | Ga0070662_100030662 | Ga0070662_1000306623 | 276 |
| 340 | 3300005459 | Ga0068867_100003630 | Ga0068867_1000036306 | 276 |
| 341 | 3300005466 | Ga0070685_10001947 | Ga0070685_1000194712 | 276 |
| 342 | 3300005535 | Ga0070684_100005357 | Ga0070684_1000053577 | 276 |
| 343 | 3300005543 | Ga0070672_100076371 | Ga0070672_1000763712 | 276 |
| 344 | 3300005544 | Ga0070686_100003983 | Ga0070686_1000039839 | 276 |
| 345 | 3300005545 | Ga0070695_100189659 | Ga0070695_1001896592 | 276 |
| 346 | 3300005547 | Ga0070693_100321376 | Ga0070693_1003213761 | 276 |
| 347 | 3300005548 | Ga0070665_100010439 | Ga0070665_1000104393 | 276 |
| 348 | 3300005564 | Ga0070664_100001499 | Ga0070664_10000149921 | 276 |
| 349 | 3300005577 | Ga0068857_100097504 | Ga0068857_1000975042 | 276 |
| 350 | 3300005578 | Ga0068854_100044088 | Ga0068854_1000440883 | 276 |
| 351 | 3300005615 | Ga0070702_100003933 | Ga0070702_1000039337 | 276 |
| 352 | 3300005615 | Ga0070702_100070632 | Ga0070702_1000706323 | 276 |
| 353 | 3300005834 | Ga0068851_10290590 | Ga0068851_102905901 | 276 |
| 354 | 3300005841 | Ga0068863_100006951 | Ga0068863_10000695111 | 276 |
| 355 | 3300005842 | Ga0068858_100163428 | Ga0068858_1001634283 | 276 |
| 356 | 3300005843 | Ga0068860_100016186 | Ga0068860_1000161863 | 276 |
| 357 | 3300005844 | Ga0068862_100006690 | Ga0068862_1000066906 | 276 |
| 358 | 3300005844 | Ga0068862_100514927 | Ga0068862_1005149272 | 276 |
| 359 | 3300006237 | Ga0097621_100443432 | Ga0097621_1004434322 | 276 |
| 360 | 3300006358 | Ga0068871_100039277 | Ga0068871_1000392773 | 276 |
| 361 | 3300006844 | Ga0075428_100124750 | Ga0075428_1001247503 | 276 |
| 362 | 3300006846 | Ga0075430_100002265 | Ga0075430_10000226514 | 276 |
| 363 | 3300006846 | Ga0075430_100002676 | Ga0075430_1000026767 | 276 |
| 364 | 3300006847 | Ga0075431_100000356 | Ga0075431_10000035610 | 276 |
| 365 | 3300006847 | Ga0075431_100002051 | Ga0075431_10000205112 | 276 |
| 366 | 3300006880 | Ga0075429_100000124 | Ga0075429_10000012432 | 276 |
| 367 | 3300006880 | Ga0075429_100365418 | Ga0075429_1003654182 | 276 |
| 368 | 3300009011 | Ga0105251_10004883 | Ga0105251_100048835 | 276 |
| 369 | 3300009036 | Ga0105244_10035527 | Ga0105244_100355271 | 276 |
| 370 | 3300009094 | Ga0111539_10039322 | Ga0111539_100393224 | 276 |
| 371 | 3300009098 | Ga0105245_10240483 | Ga0105245_102404831 | 276 |
| 372 | 3300009101 | Ga0105247_10168104 | Ga0105247_101681042 | 276 |
| 373 | 3300009147 | Ga0114129_10000468 | Ga0114129_1000046835 | 276 |
| 374 | 3300009148 | Ga0105243_10163652 | Ga0105243_101636522 | 276 |
| 375 | 3300009177 | Ga0105248_10015152 | Ga0105248_1001515210 | 276 |
| 376 | 3300009553 | Ga0105249_10031344 | Ga0105249_100313444 | 276 |
| 377 | 3300010375 | Ga0105239_10356963 | Ga0105239_103569632 | 276 |
| 378 | 3300013102 | Ga0157371_10003055 | Ga0157371_1000305510 | 276 |
| 379 | 3300013104 | Ga0157370_10026703 | Ga0157370_100267034 | 276 |
| 380 | 3300013297 | Ga0157378_10030770 | Ga0157378_100307702 | 276 |
| 381 | 3300013306 | Ga0163162_10011035 | Ga0163162_100110353 | 276 |
| 382 | 3300013308 | Ga0157375_10187900 | Ga0157375_101879002 | 276 |
| 383 | 3300014745 | Ga0157377_10077987 | Ga0157377_100779872 | 276 |
| 384 | 3300014968 | Ga0157379_10026338 | Ga0157379_100263386 | 276 |
| 385 | 3300014969 | Ga0157376_10104280 | Ga0157376_101042803 | 276 |
| 386 | 3300025298 | Ga0209050_1001937 | Ga0209050_10019375 | 276 |
| 387 | 3300025303 | Ga0209051_1000148 | Ga0209051_100014817 | 276 |
| 388 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044442 | 276 |
| 389 | 3300025901 | Ga0207688_10026201 | Ga0207688_100262013 | 276 |
| 390 | 3300025903 | Ga0207680_10040993 | Ga0207680_100409932 | 276 |
| 391 | 3300025918 | Ga0207662_10003779 | Ga0207662_100037793 | 276 |
| 392 | 3300025920 | Ga0207649_10009276 | Ga0207649_100092762 | 276 |
| 393 | 3300025923 | Ga0207681_10147531 | Ga0207681_101475312 | 276 |
| 394 | 3300025926 | Ga0207659_10003909 | Ga0207659_100039094 | 276 |
| 395 | 3300025933 | Ga0207706_10116872 | Ga0207706_101168723 | 276 |
| 396 | 3300025935 | Ga0207709_10185072 | Ga0207709_101850722 | 276 |
| 397 | 3300025937 | Ga0207669_10493689 | Ga0207669_104936891 | 276 |
| 398 | 3300025940 | Ga0207691_10129742 | Ga0207691_101297422 | 276 |
| 399 | 3300025941 | Ga0207711_10017130 | Ga0207711_100171303 | 276 |
| 400 | 3300025942 | Ga0207689_10016437 | Ga0207689_100164376 | 276 |
| 401 | 3300025945 | Ga0207679_10012080 | Ga0207679_100120806 | 276 |
| 402 | 3300025960 | Ga0207651_10005232 | Ga0207651_100052323 | 276 |
| 403 | 3300025986 | Ga0207658_10039925 | Ga0207658_100399254 | 276 |
| 404 | 3300026023 | Ga0207677_10211529 | Ga0207677_102115292 | 276 |
| 405 | 3300026035 | Ga0207703_10023876 | Ga0207703_100238764 | 276 |
| 406 | 3300026088 | Ga0207641_10010775 | Ga0207641_100107759 | 276 |
| 407 | 3300026089 | Ga0207648_10010315 | Ga0207648_100103156 | 276 |
| 408 | 3300026095 | Ga0207676_10002491 | Ga0207676_100024912 | 276 |
| 409 | 3300026118 | Ga0207675_100002172 | Ga0207675_10000217211 | 276 |
| 410 | 3300026121 | Ga0207683_10007149 | Ga0207683_100071498 | 276 |
| 411 | 3300027876 | Ga0209974_10007325 | Ga0209974_100073252 | 276 |
| 412 | 3300028379 | Ga0268266_10115292 | Ga0268266_101152923 | 276 |
| 413 | 3300028381 | Ga0268264_10063501 | Ga0268264_100635013 | 276 |
| 414 | 3300031548 | Ga0307408_100001241 | Ga0307408_1000012415 | 276 |
| 415 | 3300031548 | Ga0307408_100005662 | Ga0307408_1000056623 | 276 |
| 416 | 3300031548 | Ga0307408_100115871 | Ga0307408_1001158712 | 276 |
| 417 | 3300031548 | Ga0307408_100146841 | Ga0307408_1001468412 | 276 |
| 418 | 3300031548 | Ga0307408_100234916 | Ga0307408_1002349162 | 276 |
| 419 | 3300031824 | Ga0307413_10005441 | Ga0307413_100054413 | 276 |
| 420 | 3300031852 | Ga0307410_10005705 | Ga0307410_100057053 | 276 |
| 421 | 3300031852 | Ga0307410_10313875 | Ga0307410_103138752 | 276 |
| 422 | 3300031901 | Ga0307406_10008182 | Ga0307406_100081824 | 276 |
| 423 | 3300031901 | Ga0307406_10383547 | Ga0307406_103835472 | 276 |
| 424 | 3300031911 | Ga0307412_10157107 | Ga0307412_101571072 | 276 |
| 425 | 3300031995 | Ga0307409_100116224 | Ga0307409_1001162242 | 276 |
| 426 | 3300031995 | Ga0307409_100238273 | Ga0307409_1002382732 | 276 |
| 427 | 3300032002 | Ga0307416_100109787 | Ga0307416_1001097872 | 276 |
| 428 | 3300032005 | Ga0307411_10018164 | Ga0307411_100181643 | 276 |
| 429 | 3300037312 | Ga0395899_0092709 | Ga0395899_0092709_641_1474 | 276 |
| 430 | 3300037471 | Ga0395905_0012392 | Ga0395905_0012392_4802_5644 | 276 |
| 431 | 3300037471 | Ga0395905_0224513 | Ga0395905_0224513_874_1716 | 276 |
| 432 | 3300042007 | Ga0439449_0051101 | Ga0439449_0051101_625_1461 | 276 |
| 433 | 3300044765 | Ga0466970_0135904 | Ga0466970_0135904_408_1250 | 276 |
| 434 | 3300045051 | Ga0451576_0015523 | Ga0451576_0015523_31_870 | 276 |
| 435 | 3300046491 | Ga0495584_0139842 | Ga0495584_0139842_46_915 | 276 |
| 436 | 3300046538 | Ga0495609_0021833 | Ga0495609_0021833_281_1123 | 276 |
| 437 | 3300046558 | Ga0495633_0001422 | Ga0495633_0001422_12410_13252 | 276 |
| 438 | 3300046660 | Ga0495625_0002479 | Ga0495625_0002479_17627_18472 | 276 |
| 439 | 3300046665 | Ga0495661_0163840 | Ga0495661_0163840_185_1027 | 276 |
| 440 | 3300046691 | Ga0495670_0107157 | Ga0495670_0107157_515_1363 | 276 |
| 441 | 3300046692 | Ga0495671_0071006 | Ga0495671_0071006_588_1430 | 276 |
| 442 | 3300048911 | Ga0496108_0062186 | Ga0496108_0062186_272_1111 | 276 |
| 443 | 3300048912 | Ga0496109_0016390 | Ga0496109_0016390_22_861 | 276 |
| 444 | 3300048912 | Ga0496109_0024245 | Ga0496109_0024245_2590_3483 | 276 |
| 445 | 3300048913 | Ga0496110_0005377 | Ga0496110_0005377_4704_5543 | 276 |
| 446 | 3300048913 | Ga0496110_0078155 | Ga0496110_0078155_1133_2026 | 276 |
| 447 | 3300048915 | Ga0496112_0308978 | Ga0496112_0308978_173_1012 | 276 |
| 448 | 3300048915 | Ga0496112_0581175 | Ga0496112_0581175_78_920 | 276 |
| 449 | 3300048929 | Ga0496126_0082380 | Ga0496126_0082380_682_1536 | 276 |
| 450 | 3300049460 | Ga0495682_0000592 | Ga0495682_0000592_15493_16335 | 276 |
| 451 | 3300049521 | Ga0501298_005067 | Ga0501298_005067_1185_2024 | 276 |
| 452 | 3300049522 | Ga0501299_009933 | Ga0501299_009933_143_982 | 276 |
| 453 | 3300049776 | Ga0501280_017566 | Ga0501280_017566_105_944 | 276 |
| 454 | 3300050507 | nmdc:mga05p37_694_c1 | nmdc:mga05p37_694_c1_27956_28807 | 276 |
| 455 | 3300050508 | nmdc:mga09592_404502_c1 | nmdc:mga09592_404502_c1_93_938 | 276 |
| 456 | 3300050509 | nmdc:mga0qj67_228_c1 | nmdc:mga0qj67_228_c1_28724_29575 | 276 |
| 457 | 3300050509 | nmdc:mga0qj67_450972_c1 | nmdc:mga0qj67_450972_c1_49_894 | 276 |
| 458 | 3300050510 | nmdc:mga06r32_1145_c1 | nmdc:mga06r32_1145_c1_2768_3613 | 276 |
| 459 | 3300050510 | nmdc:mga06r32_31_c1 | nmdc:mga06r32_31_c1_46723_47574 | 276 |
| 460 | 3300050511 | nmdc:mga08y16_27836_c1 | nmdc:mga08y16_27836_c1_2598_3449 | 276 |
| 461 | 3300050515 | nmdc:mga0a205_192793_c1 | nmdc:mga0a205_192793_c1_354_1193 | 276 |
| 462 | 3300053103 | Ga0500555_011416 | Ga0500555_011416_1098_1952 | 276 |
| 463 | 3300053153 | Ga0500616_0081439 | Ga0500616_0081439_211_1053 | 276 |
| 464 | iso_pu_bacteria | 2593339238 | 2595446839 | 276 |
| 465 | iso_pu_bacteria | 2718218334 | 2721026489 | 276 |
| 466 | iso_pu_bacteria | 2734482264 | 2735833514 | 276 |
| 467 | iso_pu_bacteria | 2895511927 | 2895513354 | 276 |
| 468 | iso_pu_bacteria | 2919085039 | 2919088292 | 276 |
| 469 | 3300005327 | Ga0070658_10111842 | Ga0070658_101118422 | 277 |
| 470 | 3300005331 | Ga0070670_100312257 | Ga0070670_1003122572 | 277 |
| 471 | 3300005336 | Ga0070680_100259479 | Ga0070680_1002594792 | 277 |
| 472 | 3300005339 | Ga0070660_100400191 | Ga0070660_1004001912 | 277 |
| 473 | 3300005340 | Ga0070689_100061253 | Ga0070689_1000612532 | 277 |
| 474 | 3300005341 | Ga0070691_10026844 | Ga0070691_100268442 | 277 |
| 475 | 3300005344 | Ga0070661_100001262 | Ga0070661_10000126213 | 277 |
| 476 | 3300005345 | Ga0070692_10008406 | Ga0070692_100084062 | 277 |
| 477 | 3300005365 | Ga0070688_100207489 | Ga0070688_1002074892 | 277 |
| 478 | 3300005366 | Ga0070659_100203551 | Ga0070659_1002035512 | 277 |
| 479 | 3300005366 | Ga0070659_100410390 | Ga0070659_1004103902 | 277 |
| 480 | 3300005455 | Ga0070663_100014982 | Ga0070663_1000149821 | 277 |
| 481 | 3300005455 | Ga0070663_100021471 | Ga0070663_1000214712 | 277 |
| 482 | 3300005457 | Ga0070662_100035932 | Ga0070662_1000359322 | 277 |
| 483 | 3300005457 | Ga0070662_100438047 | Ga0070662_1004380472 | 277 |
| 484 | 3300005458 | Ga0070681_10000450 | Ga0070681_100004505 | 277 |
| 485 | 3300005466 | Ga0070685_10135439 | Ga0070685_101354392 | 277 |
| 486 | 3300005530 | Ga0070679_100000455 | Ga0070679_10000045533 | 277 |
| 487 | 3300005539 | Ga0068853_100115153 | Ga0068853_1001151532 | 277 |
| 488 | 3300005548 | Ga0070665_100152388 | Ga0070665_1001523882 | 277 |
| 489 | 3300005564 | Ga0070664_100009538 | Ga0070664_1000095383 | 277 |
| 490 | 3300005564 | Ga0070664_100035157 | Ga0070664_1000351573 | 277 |
| 491 | 3300005564 | Ga0070664_100078684 | Ga0070664_1000786844 | 277 |
| 492 | 3300005564 | Ga0070664_100615292 | Ga0070664_1006152922 | 277 |
| 493 | 3300005577 | Ga0068857_100410436 | Ga0068857_1004104361 | 277 |
| 494 | 3300005578 | Ga0068854_100009198 | Ga0068854_1000091985 | 277 |
| 495 | 3300005937 | Ga0081455_10001291 | Ga0081455_100012917 | 277 |
| 496 | 3300006358 | Ga0068871_100254808 | Ga0068871_1002548081 | 277 |
| 497 | 3300006844 | Ga0075428_100000232 | Ga0075428_10000023225 | 277 |
| 498 | 3300006847 | Ga0075431_100000011 | Ga0075431_10000001111 | 277 |
| 499 | 3300009093 | Ga0105240_10101977 | Ga0105240_101019772 | 277 |
| 500 | 3300009094 | Ga0111539_10000664 | Ga0111539_1000066424 | 277 |
| 501 | 3300009094 | Ga0111539_10006216 | Ga0111539_1000621614 | 277 |
| 502 | 3300009147 | Ga0114129_10021817 | Ga0114129_100218176 | 277 |
| 503 | 3300009174 | Ga0105241_10023212 | Ga0105241_100232122 | 277 |
| 504 | 3300009551 | Ga0105238_10010144 | Ga0105238_100101446 | 277 |
| 505 | 3300009551 | Ga0105238_10119179 | Ga0105238_101191792 | 277 |
| 506 | 3300013102 | Ga0157371_10017014 | Ga0157371_100170142 | 277 |
| 507 | 3300013102 | Ga0157371_10363533 | Ga0157371_103635331 | 277 |
| 508 | 3300013104 | Ga0157370_10138986 | Ga0157370_101389862 | 277 |
| 509 | 3300013105 | Ga0157369_10049372 | Ga0157369_100493722 | 277 |
| 510 | 3300013307 | Ga0157372_10183168 | Ga0157372_101831681 | 277 |
| 511 | 3300025913 | Ga0207695_10020009 | Ga0207695_100200093 | 277 |
| 512 | 3300025917 | Ga0207660_10194922 | Ga0207660_101949222 | 277 |
| 513 | 3300025919 | Ga0207657_10011422 | Ga0207657_100114223 | 277 |
| 514 | 3300025920 | Ga0207649_10009056 | Ga0207649_100090563 | 277 |
| 515 | 3300025920 | Ga0207649_10160776 | Ga0207649_101607763 | 277 |
| 516 | 3300025926 | Ga0207659_10366503 | Ga0207659_103665032 | 277 |
| 517 | 3300025932 | Ga0207690_10162513 | Ga0207690_101625132 | 277 |
| 518 | 3300025945 | Ga0207679_10032717 | Ga0207679_100327173 | 277 |
| 519 | 3300025949 | Ga0207667_10022933 | Ga0207667_100229334 | 277 |
| 520 | 3300025981 | Ga0207640_10003251 | Ga0207640_100032513 | 277 |
| 521 | 3300026041 | Ga0207639_10014895 | Ga0207639_100148953 | 277 |
| 522 | 3300026067 | Ga0207678_10008993 | Ga0207678_100089935 | 277 |
| 523 | 3300026075 | Ga0207708_10046326 | Ga0207708_100463263 | 277 |
| 524 | 3300026142 | Ga0207698_10001050 | Ga0207698_1000105010 | 277 |
| 525 | 3300027907 | Ga0207428_10002738 | Ga0207428_1000273811 | 277 |
| 526 | 3300031548 | Ga0307408_100121193 | Ga0307408_1001211932 | 277 |
| 527 | 3300031728 | Ga0316578_10090013 | Ga0316578_100900132 | 277 |
| 528 | 3300031901 | Ga0307406_10120968 | Ga0307406_101209683 | 277 |
| 529 | 3300031911 | Ga0307412_10025910 | Ga0307412_100259103 | 277 |
| 530 | 3300031911 | Ga0307412_10100305 | Ga0307412_101003054 | 277 |
| 531 | 3300032005 | Ga0307411_10221493 | Ga0307411_102214932 | 277 |
| 532 | 3300034957 | Ga0373938_0047595 | Ga0373938_0047595_16_870 | 277 |
| 533 | 3300035398 | Ga0316574_0076614 | Ga0316574_0076614_616_1458 | 277 |
| 534 | 3300036712 | Ga0316584_0031022 | Ga0316584_0031022_1238_2092 | 277 |
| 535 | 3300037312 | Ga0395899_0068872 | Ga0395899_0068872_1513_2349 | 277 |
| 536 | 3300037312 | Ga0395899_0350286 | Ga0395899_0350286_64_900 | 277 |
| 537 | 3300037418 | Ga0395900_0043547 | Ga0395900_0043547_870_1706 | 277 |
| 538 | 3300037418 | Ga0395900_0128880 | Ga0395900_0128880_373_1209 | 277 |
| 539 | 3300037466 | Ga0395898_0317466 | Ga0395898_0317466_528_1364 | 277 |
| 540 | 3300038443 | Ga0395901_0040382 | Ga0395901_0040382_3901_4737 | 277 |
| 541 | 3300038443 | Ga0395901_0245002 | Ga0395901_0245002_521_1357 | 277 |
| 542 | 3300041452 | Ga0451793_1620920 | Ga0451793_1620920_41_886 | 277 |
| 543 | 3300044842 | Ga0466957_0150204 | Ga0466957_0150204_220_1071 | 277 |
| 544 | 3300046460 | Ga0495638_0000038 | Ga0495638_0000038_204174_205019 | 277 |
| 545 | 3300046474 | Ga0495605_0011963 | Ga0495605_0011963_2870_3811 | 277 |
| 546 | 3300046492 | Ga0495585_0022088 | Ga0495585_0022088_1990_2931 | 277 |
| 547 | 3300046501 | Ga0495607_0025850 | Ga0495607_0025850_1089_2030 | 277 |
| 548 | 3300046501 | Ga0495607_0054685 | Ga0495607_0054685_747_1661 | 277 |
| 549 | 3300046506 | Ga0495583_0000067 | Ga0495583_0000067_44727_45668 | 277 |
| 550 | 3300046523 | Ga0495644_0009116 | Ga0495644_0009116_2028_2969 | 277 |
| 551 | 3300046523 | Ga0495644_0013429 | Ga0495644_0013429_164_1078 | 277 |
| 552 | 3300046524 | Ga0495648_0001359 | Ga0495648_0001359_20803_21744 | 277 |
| 553 | 3300046525 | Ga0495663_0024306 | Ga0495663_0024306_640_1485 | 277 |
| 554 | 3300046538 | Ga0495609_0001124 | Ga0495609_0001124_6161_7102 | 277 |
| 555 | 3300046615 | Ga0495656_0007691 | Ga0495656_0007691_2184_3125 | 277 |
| 556 | 3300046648 | Ga0495611_0001009 | Ga0495611_0001009_5282_6223 | 277 |
| 557 | 3300046648 | Ga0495611_0003480 | Ga0495611_0003480_189_1103 | 277 |
| 558 | 3300046664 | Ga0495659_0000529 | Ga0495659_0000529_695_1636 | 277 |
| 559 | 3300046684 | Ga0495669_0054233 | Ga0495669_0054233_855_1700 | 277 |
| 560 | 3300046691 | Ga0495670_0005679 | Ga0495670_0005679_3094_4035 | 277 |
| 561 | 3300046691 | Ga0495670_0012033 | Ga0495670_0012033_36_881 | 277 |
| 562 | 3300046692 | Ga0495671_0006426 | Ga0495671_0006426_4243_5184 | 277 |
| 563 | 3300047318 | Ga0495636_0000126 | Ga0495636_0000126_18642_19583 | 277 |
| 564 | 3300047320 | Ga0495672_0021078 | Ga0495672_0021078_1308_2249 | 277 |
| 565 | 3300047323 | Ga0495683_0002800 | Ga0495683_0002800_3884_4825 | 277 |
| 566 | 3300047443 | Ga0495687_001241 | Ga0495687_001241_19976_20917 | 277 |
| 567 | 3300047445 | Ga0495677_0009136 | Ga0495677_0009136_1608_2549 | 277 |
| 568 | 3300047447 | Ga0495685_000011 | Ga0495685_000011_20803_21744 | 277 |
| 569 | 3300047469 | Ga0495673_0011344 | Ga0495673_0011344_1377_2318 | 277 |
| 570 | 3300049459 | Ga0495678_001683 | Ga0495678_001683_1046_1987 | 277 |
| 571 | 3300049460 | Ga0495682_0005886 | Ga0495682_0005886_2314_3255 | 277 |
| 572 | 3300049576 | Ga0501040_0049683 | Ga0501040_0049683_322_1215 | 277 |
| 573 | 3300049581 | Ga0501047_0222711 | Ga0501047_0222711_60_899 | 277 |
| 574 | 3300049585 | Ga0501069_0040598 | Ga0501069_0040598_1688_2524 | 277 |
| 575 | 3300049585 | Ga0501069_0236578 | Ga0501069_0236578_46_882 | 277 |
| 576 | 3300049586 | Ga0501070_0000303 | Ga0501070_0000303_2792_3628 | 277 |
| 577 | 3300049586 | Ga0501070_0002582 | Ga0501070_0002582_14207_15043 | 277 |
| 578 | 3300049586 | Ga0501070_0335079 | Ga0501070_0335079_104_940 | 277 |
| 579 | 3300050507 | nmdc:mga05p37_16474_c1 | nmdc:mga05p37_16474_c1_4374_5216 | 277 |
| 580 | 3300050508 | nmdc:mga09592_62130_c1 | nmdc:mga09592_62130_c1_1938_2780 | 277 |
| 581 | 3300050510 | nmdc:mga06r32_1123_c1 | nmdc:mga06r32_1123_c1_20444_21286 | 277 |
| 582 | 3300050511 | nmdc:mga08y16_10451_c1 | nmdc:mga08y16_10451_c1_1937_2779 | 277 |
| 583 | 3300050511 | nmdc:mga08y16_85150_c1 | nmdc:mga08y16_85150_c1_710_1558 | 277 |
| 584 | 3300053087 | Ga0500643_000211 | Ga0500643_000211_4671_5516 | 277 |
| 585 | 3300053134 | Ga0500658_0001988 | Ga0500658_0001988_497_1546 | 277 |
| 586 | 3300053136 | Ga0500559_0002389 | Ga0500559_0002389_712_1557 | 277 |
| 587 | 3300055283 | Ga0500661_000087 | Ga0500661_000087_862_1707 | 277 |
| 588 | 3300001990 | JGI24737J22298_10019089 | JGI24737J22298_100190892 | 278 |
| 589 | 3300002704 | JGI25155J39150_1000091 | JGI25155J39150_100009130 | 278 |
| 590 | 3300002705 | JGI25156J39149_1000127 | JGI25156J39149_100012718 | 278 |
| 591 | 3300002737 | JGI25162J39368_1001785 | JGI25162J39368_10017853 | 278 |
| 592 | 3300002738 | JGI25154J39366_1000038 | JGI25154J39366_100003833 | 278 |
| 593 | 3300002741 | JGI25157J39369_1000126 | JGI25157J39369_100012653 | 278 |
| 594 | 3300002741 | JGI25157J39369_1000155 | JGI25157J39369_100015518 | 278 |
| 595 | 3300002771 | JGI25163J39215_1000835 | JGI25163J39215_10008355 | 278 |
| 596 | 3300002772 | JGI25164J39214_1000012 | JGI25164J39214_1000012247 | 278 |
| 597 | 3300003214 | JGI25165J46597_1000048 | JGI25165J46597_10000483 | 278 |
| 598 | 3300003320 | rootH2_10014854 | rootH2_1001485413 | 278 |
| 599 | 3300003320 | rootH2_10023780 | rootH2_100237802 | 278 |
| 600 | 3300003323 | rootH1_10106964 | rootH1_101069643 | 278 |
| 601 | 3300003578 | Ga0006562J51391_1071442 | Ga0006562J51391_10714422 | 278 |
| 602 | 3300003578 | Ga0006562J51391_1071443 | Ga0006562J51391_10714432 | 278 |
| 603 | 3300003751 | Ga0055538_1000486 | Ga0055538_10004862 | 278 |
| 604 | 3300003758 | Ga0055532_1000023 | Ga0055532_100002372 | 278 |
| 605 | 3300003761 | Ga0055535_1000151 | Ga0055535_10001513 | 278 |
| 606 | 3300003761 | Ga0055535_1007606 | Ga0055535_10076062 | 278 |
| 607 | 3300003762 | Ga0055542_1000034 | Ga0055542_1000034230 | 278 |
| 608 | 3300003763 | Ga0055529_1001207 | Ga0055529_10012073 | 278 |
| 609 | 3300005327 | Ga0070658_10005302 | Ga0070658_100053028 | 278 |
| 610 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005167 | 278 |
| 611 | 3300005435 | Ga0070714_100009475 | Ga0070714_1000094754 | 278 |
| 612 | 3300005439 | Ga0070711_100156049 | Ga0070711_1001560492 | 278 |
| 613 | 3300005455 | Ga0070663_100000972 | Ga0070663_10000097210 | 278 |
| 614 | 3300005455 | Ga0070663_100132995 | Ga0070663_1001329953 | 278 |
| 615 | 3300005456 | Ga0070678_100106696 | Ga0070678_1001066962 | 278 |
| 616 | 3300005457 | Ga0070662_100009243 | Ga0070662_1000092434 | 278 |
| 617 | 3300005548 | Ga0070665_100007655 | Ga0070665_1000076554 | 278 |
| 618 | 3300005563 | Ga0068855_100275441 | Ga0068855_1002754412 | 278 |
| 619 | 3300005578 | Ga0068854_100002703 | Ga0068854_10000270312 | 278 |
| 620 | 3300005614 | Ga0068856_100071101 | Ga0068856_1000711012 | 278 |
| 621 | 3300005616 | Ga0068852_100023505 | Ga0068852_1000235052 | 278 |
| 622 | 3300005719 | Ga0068861_100000527 | Ga0068861_1000005273 | 278 |
| 623 | 3300005834 | Ga0068851_10035096 | Ga0068851_100350963 | 278 |
| 624 | 3300006028 | Ga0070717_10003860 | Ga0070717_1000386010 | 278 |
| 625 | 3300006051 | Ga0075364_10000064 | Ga0075364_100000647 | 278 |
| 626 | 3300006173 | Ga0070716_100112461 | Ga0070716_1001124611 | 278 |
| 627 | 3300006847 | Ga0075431_100099351 | Ga0075431_1000993512 | 278 |
| 628 | 3300009093 | Ga0105240_10001418 | Ga0105240_1000141812 | 278 |
| 629 | 3300009093 | Ga0105240_10019239 | Ga0105240_1001923911 | 278 |
| 630 | 3300009093 | Ga0105240_10105572 | Ga0105240_101055723 | 278 |
| 631 | 3300009545 | Ga0105237_10000064 | Ga0105237_1000006482 | 278 |
| 632 | 3300009545 | Ga0105237_10001115 | Ga0105237_1000111523 | 278 |
| 633 | 3300009551 | Ga0105238_10000759 | Ga0105238_100007597 | 278 |
| 634 | 3300009551 | Ga0105238_10008308 | Ga0105238_100083082 | 278 |
| 635 | 3300010375 | Ga0105239_10000030 | Ga0105239_10000030207 | 278 |
| 636 | 3300010375 | Ga0105239_10001815 | Ga0105239_1000181516 | 278 |
| 637 | 3300012500 | Ga0157314_1000429 | Ga0157314_10004292 | 278 |
| 638 | 3300012502 | Ga0157347_1009181 | Ga0157347_10091811 | 278 |
| 639 | 3300013102 | Ga0157371_10000060 | Ga0157371_1000006032 | 278 |
| 640 | 3300013306 | Ga0163162_10001186 | Ga0163162_1000118611 | 278 |
| 641 | 3300014326 | Ga0157380_10506155 | Ga0157380_105061552 | 278 |
| 642 | 3300014497 | Ga0182008_10048757 | Ga0182008_100487572 | 278 |
| 643 | 3300014969 | Ga0157376_10065588 | Ga0157376_100655883 | 278 |
| 644 | 3300015261 | Ga0182006_1007482 | Ga0182006_10074822 | 278 |
| 645 | 3300015262 | Ga0182007_10015156 | Ga0182007_100151562 | 278 |
| 646 | 3300025206 | Ga0209435_100013 | Ga0209435_100013186 | 278 |
| 647 | 3300025207 | Ga0209760_100447 | Ga0209760_1004478 | 278 |
| 648 | 3300025224 | Ga0209784_100016 | Ga0209784_1000164 | 278 |
| 649 | 3300025228 | Ga0209672_101053 | Ga0209672_10105310 | 278 |
| 650 | 3300025229 | Ga0209147_100030 | Ga0209147_100030168 | 278 |
| 651 | 3300025231 | Ga0207427_100019 | Ga0207427_100019409 | 278 |
| 652 | 3300025233 | Ga0209437_100054 | Ga0209437_100054102 | 278 |
| 653 | 3300025233 | Ga0209437_100208 | Ga0209437_10020888 | 278 |
| 654 | 3300025242 | Ga0209258_100039 | Ga0209258_1000394 | 278 |
| 655 | 3300025242 | Ga0209258_100734 | Ga0209258_10073411 | 278 |
| 656 | 3300025246 | Ga0209646_1000034 | Ga0209646_1000034186 | 278 |
| 657 | 3300025246 | Ga0209646_1001310 | Ga0209646_10013105 | 278 |
| 658 | 3300025250 | Ga0209026_1000012 | Ga0209026_1000012481 | 278 |
| 659 | 3300025250 | Ga0209026_1000022 | Ga0209026_1000022186 | 278 |
| 660 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011274 | 278 |
| 661 | 3300025256 | Ga0209759_1000018 | Ga0209759_1000018186 | 278 |
| 662 | 3300025256 | Ga0209759_1000404 | Ga0209759_100040438 | 278 |
| 663 | 3300025258 | Ga0209129_1006513 | Ga0209129_10065132 | 278 |
| 664 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002956 | 278 |
| 665 | 3300025272 | Ga0209455_1000039 | Ga0209455_10000394 | 278 |
| 666 | 3300025272 | Ga0209455_1002189 | Ga0209455_10021893 | 278 |
| 667 | 3300025272 | Ga0209455_1009937 | Ga0209455_10099373 | 278 |
| 668 | 3300025297 | Ga0209758_1000414 | Ga0209758_10004143 | 278 |
| 669 | 3300025303 | Ga0209051_1002660 | Ga0209051_10026608 | 278 |
| 670 | 3300025321 | Ga0207656_10059801 | Ga0207656_100598011 | 278 |
| 671 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005525 | 278 |
| 672 | 3300025904 | Ga0207647_10017489 | Ga0207647_100174894 | 278 |
| 673 | 3300025913 | Ga0207695_10000780 | Ga0207695_1000078032 | 278 |
| 674 | 3300025913 | Ga0207695_10002372 | Ga0207695_1000237229 | 278 |
| 675 | 3300025913 | Ga0207695_10002829 | Ga0207695_1000282924 | 278 |
| 676 | 3300025913 | Ga0207695_10003142 | Ga0207695_100031427 | 278 |
| 677 | 3300025913 | Ga0207695_10011301 | Ga0207695_100113014 | 278 |
| 678 | 3300025914 | Ga0207671_10000061 | Ga0207671_1000006154 | 278 |
| 679 | 3300025914 | Ga0207671_10008651 | Ga0207671_100086512 | 278 |
| 680 | 3300025916 | Ga0207663_10214610 | Ga0207663_102146102 | 278 |
| 681 | 3300025924 | Ga0207694_10000685 | Ga0207694_100006858 | 278 |
| 682 | 3300025924 | Ga0207694_10077864 | Ga0207694_100778642 | 278 |
| 683 | 3300025924 | Ga0207694_10205628 | Ga0207694_102056282 | 278 |
| 684 | 3300025929 | Ga0207664_10036623 | Ga0207664_100366232 | 278 |
| 685 | 3300025933 | Ga0207706_10001035 | Ga0207706_1000103512 | 278 |
| 686 | 3300025949 | Ga0207667_10002899 | Ga0207667_100028993 | 278 |
| 687 | 3300025949 | Ga0207667_10071937 | Ga0207667_100719373 | 278 |
| 688 | 3300025949 | Ga0207667_10362506 | Ga0207667_103625062 | 278 |
| 689 | 3300025972 | Ga0207668_10091881 | Ga0207668_100918813 | 278 |
| 690 | 3300025981 | Ga0207640_10028383 | Ga0207640_100283833 | 278 |
| 691 | 3300026035 | Ga0207703_10244418 | Ga0207703_102444182 | 278 |
| 692 | 3300026041 | Ga0207639_10170960 | Ga0207639_101709602 | 278 |
| 693 | 3300026067 | Ga0207678_10003283 | Ga0207678_1000328310 | 278 |
| 694 | 3300026067 | Ga0207678_10584147 | Ga0207678_105841472 | 278 |
| 695 | 3300026078 | Ga0207702_10386592 | Ga0207702_103865921 | 278 |
| 696 | 3300026116 | Ga0207674_10000279 | Ga0207674_100002795 | 278 |
| 697 | 3300026118 | Ga0207675_100001636 | Ga0207675_10000163620 | 278 |
| 698 | 3300026121 | Ga0207683_10055487 | Ga0207683_100554873 | 278 |
| 699 | 3300026142 | Ga0207698_10085920 | Ga0207698_100859203 | 278 |
| 700 | 3300027614 | Ga0209970_1000606 | Ga0209970_10006063 | 278 |
| 701 | 3300027876 | Ga0209974_10014186 | Ga0209974_100141862 | 278 |
| 702 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041007 | 278 |
| 703 | 3300030522 | Ga0307512_10053330 | Ga0307512_100533302 | 278 |
| 704 | 3300031239 | Ga0265328_10023059 | Ga0265328_100230592 | 278 |
| 705 | 3300031251 | Ga0265327_10002046 | Ga0265327_1000204610 | 278 |
| 706 | 3300031507 | Ga0307509_10002265 | Ga0307509_1000226514 | 278 |
| 707 | 3300031507 | Ga0307509_10261574 | Ga0307509_102615742 | 278 |
| 708 | 3300031730 | Ga0307516_10005394 | Ga0307516_100053943 | 278 |
| 709 | 3300031731 | Ga0307405_10031127 | Ga0307405_100311272 | 278 |
| 710 | 3300031731 | Ga0307405_10094401 | Ga0307405_100944012 | 278 |
| 711 | 3300031824 | Ga0307413_10028846 | Ga0307413_100288463 | 278 |
| 712 | 3300031852 | Ga0307410_10029524 | Ga0307410_100295244 | 278 |
| 713 | 3300031901 | Ga0307406_10066970 | Ga0307406_100669703 | 278 |
| 714 | 3300031901 | Ga0307406_10083533 | Ga0307406_100835331 | 278 |
| 715 | 3300031901 | Ga0307406_10285208 | Ga0307406_102852082 | 278 |
| 716 | 3300031911 | Ga0307412_10105795 | Ga0307412_101057952 | 278 |
| 717 | 3300031911 | Ga0307412_10155483 | Ga0307412_101554832 | 278 |
| 718 | 3300032002 | Ga0307416_100754482 | Ga0307416_1007544822 | 278 |
| 719 | 3300032004 | Ga0307414_10035487 | Ga0307414_100354873 | 278 |
| 720 | 3300032004 | Ga0307414_10222472 | Ga0307414_102224722 | 278 |
| 721 | 3300032004 | Ga0307414_10227540 | Ga0307414_102275402 | 278 |
| 722 | 3300032004 | Ga0307414_10602280 | Ga0307414_106022801 | 278 |
| 723 | 3300032005 | Ga0307411_10038363 | Ga0307411_100383633 | 278 |
| 724 | 3300032005 | Ga0307411_10113371 | Ga0307411_101133712 | 278 |
| 725 | 3300032005 | Ga0307411_10386639 | Ga0307411_103866392 | 278 |
| 726 | 3300033180 | Ga0307510_10002640 | Ga0307510_100026409 | 278 |
| 727 | 3300033180 | Ga0307510_10200141 | Ga0307510_102001412 | 278 |
| 728 | 3300037312 | Ga0395899_0059129 | Ga0395899_0059129_893_1741 | 278 |
| 729 | 3300037418 | Ga0395900_0058979 | Ga0395900_0058979_2520_3374 | 278 |
| 730 | 3300037466 | Ga0395898_0203485 | Ga0395898_0203485_713_1558 | 278 |
| 731 | 3300037471 | Ga0395905_0098785 | Ga0395905_0098785_151_993 | 278 |
| 732 | 3300038443 | Ga0395901_0143397 | Ga0395901_0143397_964_1818 | 278 |
| 733 | 3300042121 | Ga0450919_007536 | Ga0450919_007536_49_891 | 278 |
| 734 | 3300042531 | Ga0450918_000146 | Ga0450918_000146_3664_4506 | 278 |
| 735 | 3300042876 | Ga0451577_0188437 | Ga0451577_0188437_262_1107 | 278 |
| 736 | 3300044656 | Ga0466969_0042216 | Ga0466969_0042216_99_959 | 278 |
| 737 | 3300044658 | Ga0466972_0037105 | Ga0466972_0037105_252_1115 | 278 |
| 738 | 3300044671 | Ga0466978_0132332 | Ga0466978_0132332_604_1467 | 278 |
| 739 | 3300044672 | Ga0466982_0028105 | Ga0466982_0028105_94_957 | 278 |
| 740 | 3300044683 | Ga0466965_0016936 | Ga0466965_0016936_2516_3367 | 278 |
| 741 | 3300044683 | Ga0466965_0063678 | Ga0466965_0063678_394_1257 | 278 |
| 742 | 3300044684 | Ga0466966_0273621 | Ga0466966_0273621_22_885 | 278 |
| 743 | 3300044693 | Ga0466961_0002563 | Ga0466961_0002563_433_1296 | 278 |
| 744 | 3300044706 | Ga0466964_0013910 | Ga0466964_0013910_1714_2574 | 278 |
| 745 | 3300044712 | Ga0453684_0174032 | Ga0453684_0174032_377_1222 | 278 |
| 746 | 3300044719 | Ga0466971_0061402 | Ga0466971_0061402_98_961 | 278 |
| 747 | 3300044765 | Ga0466970_0017539 | Ga0466970_0017539_326_1186 | 278 |
| 748 | 3300044901 | Ga0466960_0013028 | Ga0466960_0013028_210_1073 | 278 |
| 749 | 3300045049 | Ga0466959_0012131 | Ga0466959_0012131_153_1016 | 278 |
| 750 | 3300045976 | Ga0466967_0023046 | Ga0466967_0023046_3914_4774 | 278 |
| 751 | 3300046471 | Ga0495650_0001216 | Ga0495650_0001216_2467_3312 | 278 |
| 752 | 3300046507 | Ga0495606_0044660 | Ga0495606_0044660_1948_2793 | 278 |
| 753 | 3300046660 | Ga0495625_0021940 | Ga0495625_0021940_3368_4213 | 278 |
| 754 | 3300046660 | Ga0495625_0039933 | Ga0495625_0039933_2162_3010 | 278 |
| 755 | 3300047472 | Ga0495686_0065443 | Ga0495686_0065443_1337_2188 | 278 |
| 756 | 3300048903 | Ga0496100_0174425 | Ga0496100_0174425_573_1424 | 278 |
| 757 | 3300048904 | Ga0496101_0055419 | Ga0496101_0055419_191_1042 | 278 |
| 758 | 3300048909 | Ga0496106_0150524 | Ga0496106_0150524_483_1340 | 278 |
| 759 | 3300048916 | Ga0496113_0413084 | Ga0496113_0413084_84_944 | 278 |
| 760 | 3300048918 | Ga0496115_0000077 | Ga0496115_0000077_737_1582 | 278 |
| 761 | 3300048918 | Ga0496115_0053190 | Ga0496115_0053190_2159_3010 | 278 |
| 762 | 3300048919 | Ga0496116_0010095 | Ga0496116_0010095_4957_5805 | 278 |
| 763 | 3300048919 | Ga0496116_0042776 | Ga0496116_0042776_1738_2589 | 278 |
| 764 | 3300048920 | Ga0496117_0002979 | Ga0496117_0002979_16157_17008 | 278 |
| 765 | 3300048920 | Ga0496117_0070042 | Ga0496117_0070042_1325_2176 | 278 |
| 766 | 3300048921 | Ga0496118_0002015 | Ga0496118_0002015_24589_25440 | 278 |
| 767 | 3300048921 | Ga0496118_0008917 | Ga0496118_0008917_3308_4159 | 278 |
| 768 | 3300048922 | Ga0496119_0000430 | Ga0496119_0000430_7652_8503 | 278 |
| 769 | 3300048922 | Ga0496119_0007784 | Ga0496119_0007784_3164_4132 | 278 |
| 770 | 3300048923 | Ga0496120_0001388 | Ga0496120_0001388_7653_8504 | 278 |
| 771 | 3300048923 | Ga0496120_0002094 | Ga0496120_0002094_610_1578 | 278 |
| 772 | 3300048924 | Ga0496121_0001726 | Ga0496121_0001726_12242_13093 | 278 |
| 773 | 3300048924 | Ga0496121_0036052 | Ga0496121_0036052_2325_3206 | 278 |
| 774 | 3300048924 | Ga0496121_0144220 | Ga0496121_0144220_495_1343 | 278 |
| 775 | 3300048925 | Ga0496122_0000382 | Ga0496122_0000382_22665_23513 | 278 |
| 776 | 3300048926 | Ga0496123_0000516 | Ga0496123_0000516_43125_43973 | 278 |
| 777 | 3300048928 | Ga0496125_0000330 | Ga0496125_0000330_29377_30258 | 278 |
| 778 | 3300048928 | Ga0496125_0009099 | Ga0496125_0009099_4493_5356 | 278 |
| 779 | 3300048928 | Ga0496125_0040456 | Ga0496125_0040456_1736_2584 | 278 |
| 780 | 3300048928 | Ga0496125_0127589 | Ga0496125_0127589_32_877 | 278 |
| 781 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_293000_293845 | 278 |
| 782 | 3300048929 | Ga0496126_0001039 | Ga0496126_0001039_23683_24534 | 278 |
| 783 | 3300048929 | Ga0496126_0037867 | Ga0496126_0037867_2586_3434 | 278 |
| 784 | 3300048929 | Ga0496126_0077938 | Ga0496126_0077938_644_1489 | 278 |
| 785 | 3300048929 | Ga0496126_0259673 | Ga0496126_0259673_402_1370 | 278 |
| 786 | 3300049569 | Ga0501032_0186104 | Ga0501032_0186104_335_1186 | 278 |
| 787 | 3300049571 | Ga0501034_0110665 | Ga0501034_0110665_1331_2176 | 278 |
| 788 | 3300049574 | Ga0501038_0013274 | Ga0501038_0013274_6470_7315 | 278 |
| 789 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_100777_101628 | 278 |
| 790 | 3300049579 | Ga0501043_0101683 | Ga0501043_0101683_1359_2219 | 278 |
| 791 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_190208_191059 | 278 |
| 792 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_189888_190739 | 278 |
| 793 | 3300049582 | Ga0501048_0037281 | Ga0501048_0037281_833_1684 | 278 |
| 794 | 3300049742 | Ga0501080_0019639 | Ga0501080_0019639_491_1333 | 278 |
| 795 | 3300049744 | Ga0501083_0015283 | Ga0501083_0015283_1524_2366 | 278 |
| 796 | 3300049822 | Ga0501035_0147171 | Ga0501035_0147171_1021_1866 | 278 |
| 797 | 3300049824 | Ga0501045_0020112 | Ga0501045_0020112_530_1381 | 278 |
| 798 | 3300050492 | nmdc:mga0yw44_186648_c1 | nmdc:mga0yw44_186648_c1_442_1305 | 278 |
| 799 | 3300053092 | Ga0500583_0007954 | Ga0500583_0007954_1445_2308 | 278 |
| 800 | 3300053130 | Ga0500642_0035598 | Ga0500642_0035598_312_1175 | 278 |
| 801 | 3300053133 | Ga0500655_003841 | Ga0500655_003841_1813_2676 | 278 |
| 802 | 3300053136 | Ga0500559_0000239 | Ga0500559_0000239_34231_35088 | 278 |
| 803 | 3300053151 | Ga0500604_0001101 | Ga0500604_0001101_1859_2722 | 278 |
| 804 | 3300053154 | Ga0500619_000142 | Ga0500619_000142_16207_17070 | 278 |
| 805 | 3300053156 | Ga0500622_0024448 | Ga0500622_0024448_1775_2632 | 278 |
| 806 | 3300053177 | Ga0500636_0053868 | Ga0500636_0053868_196_1053 | 278 |
| 807 | 3300053739 | Ga0500587_004922 | Ga0500587_004922_420_1277 | 278 |
| 808 | 3300060353 | Ga0501082_0227294 | Ga0501082_0227294_90_932 | 278 |
| 809 | iso_pu_bacteria | 2884811622 | 2884813258 | 278 |
| 810 | iso_pu_bacteria | 2884836552 | 2884837525 | 278 |
| 811 | iso_pu_bacteria | 2884852848 | 2884853816 | 278 |
| 812 | iso_pu_bacteria | 2896154374 | 2896155067 | 278 |
| 813 | 3300001904 | JGI24736J21556_1014268 | JGI24736J21556_10142682 | 279 |
| 814 | 3300001979 | JGI24740J21852_10010318 | JGI24740J21852_100103182 | 279 |
| 815 | 3300005329 | Ga0070683_100125830 | Ga0070683_1001258301 | 279 |
| 816 | 3300005347 | Ga0070668_100327540 | Ga0070668_1003275401 | 279 |
| 817 | 3300005367 | Ga0070667_100034514 | Ga0070667_1000345144 | 279 |
| 818 | 3300005434 | Ga0070709_10008040 | Ga0070709_100080403 | 279 |
| 819 | 3300005435 | Ga0070714_100291409 | Ga0070714_1002914092 | 279 |
| 820 | 3300005437 | Ga0070710_10125318 | Ga0070710_101253182 | 279 |
| 821 | 3300005458 | Ga0070681_10012951 | Ga0070681_100129512 | 279 |
| 822 | 3300005530 | Ga0070679_100101777 | Ga0070679_1001017771 | 279 |
| 823 | 3300005539 | Ga0068853_100027910 | Ga0068853_1000279105 | 279 |
| 824 | 3300005548 | Ga0070665_100024577 | Ga0070665_1000245776 | 279 |
| 825 | 3300005563 | Ga0068855_100096086 | Ga0068855_1000960862 | 279 |
| 826 | 3300005577 | Ga0068857_100135927 | Ga0068857_1001359273 | 279 |
| 827 | 3300005614 | Ga0068856_100091052 | Ga0068856_1000910523 | 279 |
| 828 | 3300005614 | Ga0068856_100159138 | Ga0068856_1001591383 | 279 |
| 829 | 3300005616 | Ga0068852_100021909 | Ga0068852_1000219093 | 279 |
| 830 | 3300005618 | Ga0068864_100489192 | Ga0068864_1004891921 | 279 |
| 831 | 3300005834 | Ga0068851_10185125 | Ga0068851_101851251 | 279 |
| 832 | 3300005841 | Ga0068863_100325946 | Ga0068863_1003259462 | 279 |
| 833 | 3300006173 | Ga0070716_100018629 | Ga0070716_1000186293 | 279 |
| 834 | 3300006353 | Ga0075370_10053332 | Ga0075370_100533322 | 279 |
| 835 | 3300009093 | Ga0105240_10242623 | Ga0105240_102426232 | 279 |
| 836 | 3300009545 | Ga0105237_10198823 | Ga0105237_101988232 | 279 |
| 837 | 3300009551 | Ga0105238_10080397 | Ga0105238_100803973 | 279 |
| 838 | 3300010375 | Ga0105239_10037703 | Ga0105239_100377031 | 279 |
| 839 | 3300013100 | Ga0157373_10037108 | Ga0157373_100371082 | 279 |
| 840 | 3300013104 | Ga0157370_10000407 | Ga0157370_1000040731 | 279 |
| 841 | 3300013105 | Ga0157369_10015827 | Ga0157369_100158278 | 279 |
| 842 | 3300013307 | Ga0157372_10108862 | Ga0157372_101088622 | 279 |
| 843 | 3300014497 | Ga0182008_10002367 | Ga0182008_100023679 | 279 |
| 844 | 3300014968 | Ga0157379_10068261 | Ga0157379_100682613 | 279 |
| 845 | 3300014968 | Ga0157379_10507832 | Ga0157379_105078322 | 279 |
| 846 | 3300015265 | Ga0182005_1000028 | Ga0182005_1000028109 | 279 |
| 847 | 3300017792 | Ga0163161_10018332 | Ga0163161_100183326 | 279 |
| 848 | 3300017792 | Ga0163161_10039868 | Ga0163161_100398684 | 279 |
| 849 | 3300020070 | Ga0206356_11116119 | Ga0206356_111161196 | 279 |
| 850 | 3300020081 | Ga0206354_11415265 | Ga0206354_114152652 | 279 |
| 851 | 3300020082 | Ga0206353_10772270 | Ga0206353_107722701 | 279 |
| 852 | 3300020610 | Ga0154015_1162269 | Ga0154015_11622692 | 279 |
| 853 | 3300025226 | Ga0209674_101117 | Ga0209674_1011172 | 279 |
| 854 | 3300025233 | Ga0209437_101411 | Ga0209437_1014112 | 279 |
| 855 | 3300025254 | Ga0209148_1002822 | Ga0209148_10028222 | 279 |
| 856 | 3300025258 | Ga0209129_1000583 | Ga0209129_100058327 | 279 |
| 857 | 3300025321 | Ga0207656_10043045 | Ga0207656_100430452 | 279 |
| 858 | 3300025903 | Ga0207680_10099875 | Ga0207680_100998751 | 279 |
| 859 | 3300025904 | Ga0207647_10011637 | Ga0207647_100116375 | 279 |
| 860 | 3300025906 | Ga0207699_10018217 | Ga0207699_100182173 | 279 |
| 861 | 3300025909 | Ga0207705_10000938 | Ga0207705_1000093818 | 279 |
| 862 | 3300025912 | Ga0207707_10000859 | Ga0207707_1000085919 | 279 |
| 863 | 3300025912 | Ga0207707_10005551 | Ga0207707_100055512 | 279 |
| 864 | 3300025912 | Ga0207707_10012415 | Ga0207707_100124154 | 279 |
| 865 | 3300025913 | Ga0207695_10010832 | Ga0207695_100108322 | 279 |
| 866 | 3300025917 | Ga0207660_10009853 | Ga0207660_100098532 | 279 |
| 867 | 3300025920 | Ga0207649_10020099 | Ga0207649_100200992 | 279 |
| 868 | 3300025920 | Ga0207649_10045303 | Ga0207649_100453033 | 279 |
| 869 | 3300025921 | Ga0207652_10003170 | Ga0207652_100031703 | 279 |
| 870 | 3300025924 | Ga0207694_10071300 | Ga0207694_100713002 | 279 |
| 871 | 3300025928 | Ga0207700_10204005 | Ga0207700_102040051 | 279 |
| 872 | 3300025932 | Ga0207690_10277395 | Ga0207690_102773951 | 279 |
| 873 | 3300025939 | Ga0207665_10027428 | Ga0207665_100274282 | 279 |
| 874 | 3300025944 | Ga0207661_10003088 | Ga0207661_100030882 | 279 |
| 875 | 3300025949 | Ga0207667_10008275 | Ga0207667_100082752 | 279 |
| 876 | 3300025949 | Ga0207667_10087672 | Ga0207667_100876722 | 279 |
| 877 | 3300025981 | Ga0207640_10001882 | Ga0207640_100018822 | 279 |
| 878 | 3300026041 | Ga0207639_10248080 | Ga0207639_102480801 | 279 |
| 879 | 3300026041 | Ga0207639_10394505 | Ga0207639_103945051 | 279 |
| 880 | 3300026078 | Ga0207702_10001044 | Ga0207702_1000104419 | 279 |
| 881 | 3300026095 | Ga0207676_10415314 | Ga0207676_104153142 | 279 |
| 882 | 3300026121 | Ga0207683_10302443 | Ga0207683_103024432 | 279 |
| 883 | 3300026142 | Ga0207698_10040040 | Ga0207698_100400402 | 279 |
| 884 | 3300028379 | Ga0268266_10041390 | Ga0268266_100413903 | 279 |
| 885 | 3300028573 | Ga0265334_10083714 | Ga0265334_100837142 | 279 |
| 886 | 3300031235 | Ga0265330_10084544 | Ga0265330_100845442 | 279 |
| 887 | 3300031247 | Ga0265340_10007750 | Ga0265340_100077502 | 279 |
| 888 | 3300031251 | Ga0265327_10044670 | Ga0265327_100446704 | 279 |
| 889 | 3300031344 | Ga0265316_10000088 | Ga0265316_1000008873 | 279 |
| 890 | 3300031507 | Ga0307509_10482831 | Ga0307509_104828311 | 279 |
| 891 | 3300031730 | Ga0307516_10028869 | Ga0307516_100288695 | 279 |
| 892 | 3300041451 | Ga0451791_1385162 | Ga0451791_1385162_646_1494 | 279 |
| 893 | 3300041452 | Ga0451793_1723399 | Ga0451793_1723399_535_1380 | 279 |
| 894 | 3300041494 | Ga0451837_0285758 | Ga0451837_0285758_2621_3469 | 279 |
| 895 | 3300046459 | Ga0495629_0110910 | Ga0495629_0110910_480_1346 | 279 |
| 896 | 3300046475 | Ga0495639_0012189 | Ga0495639_0012189_1394_2260 | 279 |
| 897 | 3300046507 | Ga0495606_0002843 | Ga0495606_0002843_82_930 | 279 |
| 898 | 3300046507 | Ga0495606_0018207 | Ga0495606_0018207_2336_3184 | 279 |
| 899 | 3300046515 | Ga0495620_0000867 | Ga0495620_0000867_2050_2898 | 279 |
| 900 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_127568_128416 | 279 |
| 901 | 3300046660 | Ga0495625_0014356 | Ga0495625_0014356_3517_4365 | 279 |
| 902 | 3300046674 | Ga0495588_0018173 | Ga0495588_0018173_1743_2609 | 279 |
| 903 | 3300047315 | Ga0495581_0126222 | Ga0495581_0126222_550_1416 | 279 |
| 904 | 3300048090 | Ga0495615_0040933 | Ga0495615_0040933_268_1134 | 279 |
| 905 | 3300048903 | Ga0496100_0019589 | Ga0496100_0019589_1429_2295 | 279 |
| 906 | 3300048906 | Ga0496103_0034983 | Ga0496103_0034983_1304_2170 | 279 |
| 907 | 3300048907 | Ga0496104_0015148 | Ga0496104_0015148_5325_6191 | 279 |
| 908 | 3300048907 | Ga0496104_0056915 | Ga0496104_0056915_1209_2075 | 279 |
| 909 | 3300048908 | Ga0496105_0007719 | Ga0496105_0007719_5862_6728 | 279 |
| 910 | 3300048910 | Ga0496107_0041786 | Ga0496107_0041786_1266_2132 | 279 |
| 911 | 3300048912 | Ga0496109_0323986 | Ga0496109_0323986_14_880 | 279 |
| 912 | 3300048913 | Ga0496110_0035053 | Ga0496110_0035053_1024_1890 | 279 |
| 913 | 3300048914 | Ga0496111_0214079 | Ga0496111_0214079_130_996 | 279 |
| 914 | 3300048917 | Ga0496114_0027067 | Ga0496114_0027067_3427_4293 | 279 |
| 915 | 3300048917 | Ga0496114_0087579 | Ga0496114_0087579_569_1435 | 279 |
| 916 | 3300048921 | Ga0496118_0000686 | Ga0496118_0000686_21907_22755 | 279 |
| 917 | 3300048924 | Ga0496121_0090329 | Ga0496121_0090329_940_1788 | 279 |
| 918 | 3300049568 | Ga0501031_0008845 | Ga0501031_0008845_1199_2047 | 279 |
| 919 | 3300049569 | Ga0501032_0009421 | Ga0501032_0009421_1754_2602 | 279 |
| 920 | 3300049570 | Ga0501033_0060374 | Ga0501033_0060374_122_970 | 279 |
| 921 | 3300049571 | Ga0501034_0214661 | Ga0501034_0214661_296_1144 | 279 |
| 922 | 3300049572 | Ga0501036_0068231 | Ga0501036_0068231_1853_2701 | 279 |
| 923 | 3300049573 | Ga0501037_0001786 | Ga0501037_0001786_956_1804 | 279 |
| 924 | 3300049573 | Ga0501037_0108833 | Ga0501037_0108833_489_1373 | 279 |
| 925 | 3300049574 | Ga0501038_0286619 | Ga0501038_0286619_131_1015 | 279 |
| 926 | 3300049575 | Ga0501039_0016576 | Ga0501039_0016576_478_1326 | 279 |
| 927 | 3300049575 | Ga0501039_0188814 | Ga0501039_0188814_481_1329 | 279 |
| 928 | 3300049579 | Ga0501043_0014311 | Ga0501043_0014311_1008_1856 | 279 |
| 929 | 3300049579 | Ga0501043_0144710 | Ga0501043_0144710_231_1115 | 279 |
| 930 | 3300049580 | Ga0501046_0001067 | Ga0501046_0001067_1625_2473 | 279 |
| 931 | 3300049580 | Ga0501046_0394927 | Ga0501046_0394927_10_894 | 279 |
| 932 | 3300049581 | Ga0501047_0010222 | Ga0501047_0010222_3328_4212 | 279 |
| 933 | 3300049581 | Ga0501047_0067393 | Ga0501047_0067393_206_1054 | 279 |
| 934 | 3300049584 | Ga0501068_0098348 | Ga0501068_0098348_248_1096 | 279 |
| 935 | 3300049586 | Ga0501070_0010641 | Ga0501070_0010641_1302_2186 | 279 |
| 936 | 3300049586 | Ga0501070_0027717 | Ga0501070_0027717_283_1122 | 279 |
| 937 | 3300049589 | Ga0501073_0038823 | Ga0501073_0038823_1442_2281 | 279 |
| 938 | 3300049589 | Ga0501073_0048654 | Ga0501073_0048654_1520_2368 | 279 |
| 939 | 3300049590 | Ga0501074_0003264 | Ga0501074_0003264_9712_10596 | 279 |
| 940 | 3300049741 | Ga0501079_0072909 | Ga0501079_0072909_777_1661 | 279 |
| 941 | 3300049742 | Ga0501080_0007518 | Ga0501080_0007518_8224_9063 | 279 |
| 942 | 3300049742 | Ga0501080_0034822 | Ga0501080_0034822_1450_2334 | 279 |
| 943 | 3300049822 | Ga0501035_0013770 | Ga0501035_0013770_2427_3275 | 279 |
| 944 | 3300049822 | Ga0501035_0081390 | Ga0501035_0081390_997_1881 | 279 |
| 945 | 3300049823 | Ga0501044_0032343 | Ga0501044_0032343_868_1707 | 279 |
| 946 | 3300049823 | Ga0501044_0059893 | Ga0501044_0059893_2278_3126 | 279 |
| 947 | 3300050516 | nmdc:mga0sz30_8079_c1 | nmdc:mga0sz30_8079_c1_166_1014 | 279 |
| 948 | 3300053079 | Ga0500610_0000196 | Ga0500610_0000196_7316_8179 | 279 |
| 949 | 3300055283 | Ga0500661_020546 | Ga0500661_020546_193_1041 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yvt-assembly3.cif.gz_C | s-formylglutathione hydrolase from variovorax sp. pamc 28711 | 0.9851 | 2 | 279 |
| 3e4d-assembly2.cif.gz_D | structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens | 0.9826 | 4 | 279 |
| 4b6g-assembly2.cif.gz_B | the crystal structure of the neisserial esterase d. | 0.9796 | 4 | 277 |
| 7yvt-assembly3.cif.gz_C | s-formylglutathione hydrolase from variovorax sp. pamc 28711 | 0.9782 | 2 | 279 |
| 3s8y-assembly1.cif.gz_A | bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica | 0.9764 | 2 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0G2JYG2_4_177_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9712 | 5 | 178 | 3.40.50.1820 |
| 3fcxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.969 | 4 | 279 | 3.40.50.1820 |
| 3fcxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9586 | 4 | 279 | 3.40.50.1820 |
| af_Q54RL8_4_285_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9546 | 4 | 278 | 3.40.50.1820 |
| af_A0A0G2JYG2_4_177_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9494 | 5 | 178 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521QUQ7-F1-model_v4 | S-formylglutathione hydrolase (EC 3.1.2.12) | 0.9992 | 108 | 279 |
GO:0005829
GO:0018738 GO:0046294 GO:0052689 |
| AF-A0A432EL91-F1-model_v4 | S-formylglutathione hydrolase (EC 3.1.2.12) | 0.9987 | 170 | 277 |
GO:0005829
GO:0018738 GO:0046294 GO:0052689 |
| AF-A0A522J3G1-F1-model_v4 | S-formylglutathione hydrolase (EC 3.1.2.12) | 0.9959 | 4 | 278 |
GO:0005829
GO:0018738 GO:0046294 GO:0052689 |
| AF-A0A520HMR5-F1-model_v4 | S-formylglutathione hydrolase (EC 3.1.2.12) | 0.9955 | 151 | 278 |
GO:0005829
GO:0018738 GO:0046294 GO:0052689 |
| AF-A0A520HT63-F1-model_v4 | S-formylglutathione hydrolase (EC 3.1.2.12) | 0.9954 | 129 | 278 |
GO:0005829
GO:0018738 GO:0046294 GO:0052689 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar