F486544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 950 | 392 | 942 | 411 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100011909|Ga0068869_1000119094 |
| Length | 448 |
| Sequence | MRPLAAAIKIRLRECALYIAHSRIILDHTARELRSSTQRTSVPSAHPAPCEGVSTVTRPRLPTKITVWNGWTDVQAENFTRLLDQYNKEHPDVQVTQLVTPSDQVLQKVLTAVRGNSAPDVAYMFGSWSPNIAEIPQVVNMAEYVKQPDWKWDDFYPGERAAATVGDKVVGVPALVDNLAIVYNKTLFEQAGLTPPTSAAAKLTDPAKGQYGWSIPADGSEDTVWHYLPMLWEAGGDLLTPDNQHAAFNSEAGVKALTTLQQMAVTDKSLYVDTTNQEYSKLFTAGKIGMLVTGPWDLGTFSDVDYGVQIMPTYTGSAGGHQTISGPDNWVVFDNGAQRKQAAIDFVKWLTAAPQVKSTSLTTADLPTRISVGDDSAFVAELNEKQPGSEVFVHNLANAQKARPTVSQYPKISEALGQAIVSVLLGKAQPADALNTAAQTTDAALAEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 5 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 6 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 7 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 252 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 383 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 0.63 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.05 |
| Nodule | 0 |
| Rhizoplane | 8.32 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002611 | 3300001976 | Bacteria | 2399 |
| 2 | JGI24746J21847_1000089 | 3300001977 | Bacteria | 10008 |
| 3 | JGI24743J22301_10000709 | 3300001991 | Bacteria | 4122 |
| 4 | JGI24033J26618_1000486 | 3300002155 | Bacteria | 3902 |
| 5 | JGI24751J29686_10000684 | 3300002459 | Bacteria | 8434 |
| 6 | JGI24751J29686_10009198 | 3300002459 | Bacteria | 2029 |
| 7 | JGI24751J29686_10016832 | 3300002459 | Bacteria | 1509 |
| 8 | JGI25404J52841_10001437 | 3300003659 | Bacteria | 4191 |
| 9 | Ga0055540_1001155 | 3300003792 | Bacteria | 16426 |
| 10 | Ga0055540_1002276 | 3300003792 | Bacteria | 10354 |
| 11 | Ga0058861_11975033 | 3300004800 | Bacteria | 1991 |
| 12 | Ga0058862_10034740 | 3300004803 | Bacteria | 1396 |
| 13 | Ga0070658_10093466 | 3300005327 | Bacteria | 2481 |
| 14 | Ga0070683_100199128 | 3300005329 | Bacteria | 1902 |
| 15 | Ga0070670_100088619 | 3300005331 | Bacteria | 2660 |
| 16 | Ga0068869_100011909 | 3300005334 | Bacteria | 5722 |
| 17 | Ga0068869_100068037 | 3300005334 | Bacteria | 2629 |
| 18 | Ga0070680_100072410 | 3300005336 | Bacteria | 2832 |
| 19 | Ga0070682_100022719 | 3300005337 | Bacteria | 3718 |
| 20 | Ga0070682_100049408 | 3300005337 | Bacteria | 2622 |
| 21 | Ga0068868_100000529 | 3300005338 | Bacteria | 25593 |
| 22 | Ga0068868_100014372 | 3300005338 | Bacteria | 5834 |
| 23 | Ga0070660_100188515 | 3300005339 | Bacteria | 1670 |
| 24 | Ga0070660_100222383 | 3300005339 | Bacteria | 1535 |
| 25 | Ga0070691_10011823 | 3300005341 | Bacteria | 3994 |
| 26 | Ga0070661_100005479 | 3300005344 | Bacteria | 8752 |
| 27 | Ga0070661_100009141 | 3300005344 | Bacteria | 6848 |
| 28 | Ga0070668_100005441 | 3300005347 | Bacteria | 9451 |
| 29 | Ga0070668_100055714 | 3300005347 | Bacteria | 3052 |
| 30 | Ga0070675_100063813 | 3300005354 | Bacteria | 3045 |
| 31 | Ga0070675_100313505 | 3300005354 | Bacteria | 1384 |
| 32 | Ga0070671_100010460 | 3300005355 | Bacteria | 7442 |
| 33 | Ga0070671_100013019 | 3300005355 | Bacteria | 6704 |
| 34 | Ga0070671_100047247 | 3300005355 | Bacteria | 3580 |
| 35 | Ga0070674_100002482 | 3300005356 | Bacteria | 10217 |
| 36 | Ga0070674_100003430 | 3300005356 | Bacteria | 8897 |
| 37 | Ga0070674_100021807 | 3300005356 | Bacteria | 4121 |
| 38 | Ga0070673_100010279 | 3300005364 | Bacteria | 6329 |
| 39 | Ga0070688_100005859 | 3300005365 | Bacteria | 6503 |
| 40 | Ga0070667_100002267 | 3300005367 | Bacteria | 16931 |
| 41 | Ga0070667_100105326 | 3300005367 | Bacteria | 2441 |
| 42 | Ga0070667_100212282 | 3300005367 | Bacteria | 1721 |
| 43 | Ga0070703_10000001 | 3300005406 | Bacteria | 202194 |
| 44 | Ga0070703_10010304 | 3300005406 | Bacteria | 2634 |
| 45 | Ga0070709_10000243 | 3300005434 | Bacteria | 35120 |
| 46 | Ga0070709_10000794 | 3300005434 | Bacteria | 17668 |
| 47 | Ga0070709_10012534 | 3300005434 | Bacteria | 4746 |
| 48 | Ga0070709_10022973 | 3300005434 | Bacteria | 3656 |
| 49 | Ga0070709_10079546 | 3300005434 | Bacteria | 2135 |
| 50 | Ga0070709_10173787 | 3300005434 | Bacteria | 1507 |
| 51 | Ga0070714_100000640 | 3300005435 | Bacteria | 24879 |
| 52 | Ga0070714_100004478 | 3300005435 | Bacteria | 10525 |
| 53 | Ga0070714_100040816 | 3300005435 | Bacteria | 3912 |
| 54 | Ga0070714_100042573 | 3300005435 | Bacteria | 3837 |
| 55 | Ga0070714_100060030 | 3300005435 | Bacteria | 3263 |
| 56 | Ga0070714_100180351 | 3300005435 | Bacteria | 1921 |
| 57 | Ga0070714_100180693 | 3300005435 | Bacteria | 1919 |
| 58 | Ga0070713_100000428 | 3300005436 | Bacteria | 26844 |
| 59 | Ga0070713_100004385 | 3300005436 | Bacteria | 9479 |
| 60 | Ga0070713_100021199 | 3300005436 | Bacteria | 4993 |
| 61 | Ga0070713_100023985 | 3300005436 | Bacteria | 4744 |
| 62 | Ga0070713_100025930 | 3300005436 | Bacteria | 4593 |
| 63 | Ga0070713_100113829 | 3300005436 | Bacteria | 2362 |
| 64 | Ga0070710_10000101 | 3300005437 | Bacteria | 39498 |
| 65 | Ga0070710_10000900 | 3300005437 | Bacteria | 14236 |
| 66 | Ga0070710_10001923 | 3300005437 | Bacteria | 9836 |
| 67 | Ga0070710_10003412 | 3300005437 | Bacteria | 7527 |
| 68 | Ga0070710_10073616 | 3300005437 | Bacteria | 1976 |
| 69 | Ga0070701_10003486 | 3300005438 | Bacteria | 6233 |
| 70 | Ga0070701_10023934 | 3300005438 | Bacteria | 2948 |
| 71 | Ga0070711_100000437 | 3300005439 | Bacteria | 21680 |
| 72 | Ga0070711_100001095 | 3300005439 | Bacteria | 14465 |
| 73 | Ga0070711_100001607 | 3300005439 | Bacteria | 12467 |
| 74 | Ga0070711_100004296 | 3300005439 | Bacteria | 8388 |
| 75 | Ga0070711_100004473 | 3300005439 | Bacteria | 8258 |
| 76 | Ga0070711_100105261 | 3300005439 | Bacteria | 2060 |
| 77 | Ga0070711_100147979 | 3300005439 | Bacteria | 1768 |
| 78 | Ga0070705_100018343 | 3300005440 | Bacteria | 3667 |
| 79 | Ga0070705_100027798 | 3300005440 | Bacteria | 3091 |
| 80 | Ga0070705_100038364 | 3300005440 | Bacteria | 2710 |
| 81 | Ga0070700_100008542 | 3300005441 | Bacteria | 5575 |
| 82 | Ga0070700_100009104 | 3300005441 | Bacteria | 5441 |
| 83 | Ga0070700_100018846 | 3300005441 | Bacteria | 3974 |
| 84 | Ga0070700_100049200 | 3300005441 | Bacteria | 2616 |
| 85 | Ga0070694_100015852 | 3300005444 | Bacteria | 4741 |
| 86 | Ga0070694_100033732 | 3300005444 | Bacteria | 3371 |
| 87 | Ga0070694_100041620 | 3300005444 | Bacteria | 3066 |
| 88 | Ga0070708_100001067 | 3300005445 | Bacteria | 20944 |
| 89 | Ga0070708_100287649 | 3300005445 | Bacteria | 1547 |
| 90 | Ga0070663_100004269 | 3300005455 | Bacteria | 8363 |
| 91 | Ga0070663_100018208 | 3300005455 | Bacteria | 4599 |
| 92 | Ga0070663_100140945 | 3300005455 | Bacteria | 1841 |
| 93 | Ga0070678_100009361 | 3300005456 | Bacteria | 5929 |
| 94 | Ga0070678_100067738 | 3300005456 | Bacteria | 2658 |
| 95 | Ga0070662_100009027 | 3300005457 | Bacteria | 6502 |
| 96 | Ga0070662_100017040 | 3300005457 | Bacteria | 4889 |
| 97 | Ga0070662_100044175 | 3300005457 | Bacteria | 3190 |
| 98 | Ga0070681_10126386 | 3300005458 | Bacteria | 2489 |
| 99 | Ga0068867_100001323 | 3300005459 | Bacteria | 17157 |
| 100 | Ga0068867_100002000 | 3300005459 | Bacteria | 14225 |
| 101 | Ga0068867_100149122 | 3300005459 | Bacteria | 1835 |
| 102 | Ga0070685_10050343 | 3300005466 | Bacteria | 2406 |
| 103 | Ga0070706_100003990 | 3300005467 | Bacteria | 14367 |
| 104 | Ga0070706_100010233 | 3300005467 | Bacteria | 8717 |
| 105 | Ga0070706_100030567 | 3300005467 | Bacteria | 4964 |
| 106 | Ga0070706_100298265 | 3300005467 | Bacteria | 1504 |
| 107 | Ga0070707_100000041 | 3300005468 | Bacteria | 111077 |
| 108 | Ga0070707_100008503 | 3300005468 | Bacteria | 9535 |
| 109 | Ga0070707_100011276 | 3300005468 | Bacteria | 8333 |
| 110 | Ga0070707_100031450 | 3300005468 | Bacteria | 5056 |
| 111 | Ga0070707_100140216 | 3300005468 | Bacteria | 2353 |
| 112 | Ga0070698_100000082 | 3300005471 | Bacteria | 73573 |
| 113 | Ga0070698_100030094 | 3300005471 | Bacteria | 5633 |
| 114 | Ga0070698_100051050 | 3300005471 | Bacteria | 4214 |
| 115 | Ga0070698_100075801 | 3300005471 | Bacteria | 3367 |
| 116 | Ga0070698_100173688 | 3300005471 | Bacteria | 2095 |
| 117 | Ga0070684_100003351 | 3300005535 | Bacteria | 12004 |
| 118 | Ga0070684_100031025 | 3300005535 | Bacteria | 4547 |
| 119 | Ga0070684_100082513 | 3300005535 | Bacteria | 2846 |
| 120 | Ga0070697_100036724 | 3300005536 | Bacteria | 3958 |
| 121 | Ga0070697_100049392 | 3300005536 | Bacteria | 3415 |
| 122 | Ga0068853_100008397 | 3300005539 | Bacteria | 8294 |
| 123 | Ga0068853_100016775 | 3300005539 | Bacteria | 6034 |
| 124 | Ga0068853_100049796 | 3300005539 | Bacteria | 3601 |
| 125 | Ga0068853_100069006 | 3300005539 | Bacteria | 3074 |
| 126 | Ga0070672_100162157 | 3300005543 | Bacteria | 1856 |
| 127 | Ga0070695_100010024 | 3300005545 | Bacteria | 5651 |
| 128 | Ga0070695_100139249 | 3300005545 | Bacteria | 1681 |
| 129 | Ga0070695_100182054 | 3300005545 | Bacteria | 1490 |
| 130 | Ga0070696_100003305 | 3300005546 | Bacteria | 10765 |
| 131 | Ga0070696_100005272 | 3300005546 | Bacteria | 8629 |
| 132 | Ga0070696_100058492 | 3300005546 | Bacteria | 2692 |
| 133 | Ga0070696_100063569 | 3300005546 | Bacteria | 2585 |
| 134 | Ga0070693_100001858 | 3300005547 | Bacteria | 9651 |
| 135 | Ga0070665_100001745 | 3300005548 | Bacteria | 24881 |
| 136 | Ga0070665_100009958 | 3300005548 | Bacteria | 9614 |
| 137 | Ga0070665_100022355 | 3300005548 | Bacteria | 6364 |
| 138 | Ga0070665_100045725 | 3300005548 | Bacteria | 4396 |
| 139 | Ga0070665_100096225 | 3300005548 | Bacteria | 2966 |
| 140 | Ga0070704_100000706 | 3300005549 | Bacteria | 16275 |
| 141 | Ga0070704_100004595 | 3300005549 | Bacteria | 7982 |
| 142 | Ga0070704_100007803 | 3300005549 | Bacteria | 6381 |
| 143 | Ga0068855_100055086 | 3300005563 | Bacteria | 4672 |
| 144 | Ga0068855_100076751 | 3300005563 | Bacteria | 3876 |
| 145 | Ga0070664_100002582 | 3300005564 | Bacteria | 14605 |
| 146 | Ga0068857_100017591 | 3300005577 | Bacteria | 6267 |
| 147 | Ga0068854_100005243 | 3300005578 | Bacteria | 8178 |
| 148 | Ga0070702_100001404 | 3300005615 | Bacteria | 9838 |
| 149 | Ga0070702_100017389 | 3300005615 | Bacteria | 3708 |
| 150 | Ga0070702_100148897 | 3300005615 | Unclassified | 1500 |
| 151 | Ga0068852_100156097 | 3300005616 | Bacteria | 2126 |
| 152 | Ga0068859_100003134 | 3300005617 | Bacteria | 16809 |
| 153 | Ga0068864_100020685 | 3300005618 | Bacteria | 5506 |
| 154 | Ga0068864_100098059 | 3300005618 | Bacteria | 2595 |
| 155 | Ga0068864_100114068 | 3300005618 | Bacteria | 2409 |
| 156 | Ga0068866_10000376 | 3300005718 | Bacteria | 21007 |
| 157 | Ga0068866_10013060 | 3300005718 | Bacteria | 3633 |
| 158 | Ga0068866_10057117 | 3300005718 | Bacteria | 2010 |
| 159 | Ga0068861_100025534 | 3300005719 | Bacteria | 4286 |
| 160 | Ga0068861_100030613 | 3300005719 | Bacteria | 3946 |
| 161 | Ga0068861_100052331 | 3300005719 | Bacteria | 3103 |
| 162 | Ga0068870_10029598 | 3300005840 | Bacteria | 2760 |
| 163 | Ga0068863_100001514 | 3300005841 | Bacteria | 22958 |
| 164 | Ga0068863_100006801 | 3300005841 | Bacteria | 11207 |
| 165 | Ga0068858_100002465 | 3300005842 | Bacteria | 18668 |
| 166 | Ga0068858_100071177 | 3300005842 | Bacteria | 3225 |
| 167 | Ga0068858_100080445 | 3300005842 | Bacteria | 3028 |
| 168 | Ga0068858_100113426 | 3300005842 | Bacteria | 2531 |
| 169 | Ga0068860_100025928 | 3300005843 | Bacteria | 5656 |
| 170 | Ga0068860_100115207 | 3300005843 | Bacteria | 2570 |
| 171 | Ga0068860_100249342 | 3300005843 | Bacteria | 1728 |
| 172 | Ga0068862_100043121 | 3300005844 | Bacteria | 3845 |
| 173 | Ga0081455_10001614 | 3300005937 | Bacteria | 27559 |
| 174 | Ga0081455_10003773 | 3300005937 | Bacteria | 17295 |
| 175 | Ga0081455_10043919 | 3300005937 | Bacteria | 3905 |
| 176 | Ga0081455_10071142 | 3300005937 | Bacteria | 2885 |
| 177 | Ga0081538_10000404 | 3300005981 | Bacteria | 48911 |
| 178 | Ga0081540_1000505 | 3300005983 | Bacteria | 38435 |
| 179 | Ga0081539_10021040 | 3300005985 | Bacteria | 4377 |
| 180 | Ga0070717_10000956 | 3300006028 | Bacteria | 19241 |
| 181 | Ga0070717_10007851 | 3300006028 | Bacteria | 7943 |
| 182 | Ga0070717_10034864 | 3300006028 | Bacteria | 4070 |
| 183 | Ga0070717_10047787 | 3300006028 | Bacteria | 3508 |
| 184 | Ga0070717_10064802 | 3300006028 | Bacteria | 3036 |
| 185 | Ga0075365_10015384 | 3300006038 | Bacteria | 4627 |
| 186 | Ga0075365_10090040 | 3300006038 | Bacteria | 2089 |
| 187 | Ga0075365_10140439 | 3300006038 | Bacteria | 1677 |
| 188 | Ga0075363_100000787 | 3300006048 | Bacteria | 10932 |
| 189 | Ga0075363_100060987 | 3300006048 | Bacteria | 2031 |
| 190 | Ga0075363_100077904 | 3300006048 | Bacteria | 1809 |
| 191 | Ga0075363_100087743 | 3300006048 | Bacteria | 1709 |
| 192 | Ga0075363_100115160 | 3300006048 | Bacteria | 1497 |
| 193 | Ga0075364_10000184 | 3300006051 | Bacteria | 28604 |
| 194 | Ga0075364_10006965 | 3300006051 | Bacteria | 6679 |
| 195 | Ga0075364_10076198 | 3300006051 | Bacteria | 2213 |
| 196 | Ga0075432_10000387 | 3300006058 | Bacteria | 12750 |
| 197 | Ga0075432_10004840 | 3300006058 | Bacteria | 4582 |
| 198 | Ga0070715_10004042 | 3300006163 | Bacteria | 4759 |
| 199 | Ga0070715_10013894 | 3300006163 | Bacteria | 2968 |
| 200 | Ga0070715_10023722 | 3300006163 | Bacteria | 2407 |
| 201 | Ga0070716_100000560 | 3300006173 | Bacteria | 15555 |
| 202 | Ga0070716_100002661 | 3300006173 | Bacteria | 8264 |
| 203 | Ga0070716_100004017 | 3300006173 | Bacteria | 6984 |
| 204 | Ga0070716_100005420 | 3300006173 | Bacteria | 6179 |
| 205 | Ga0070716_100006565 | 3300006173 | Bacteria | 5687 |
| 206 | Ga0070712_100001062 | 3300006175 | Bacteria | 16596 |
| 207 | Ga0070712_100002191 | 3300006175 | Bacteria | 12010 |
| 208 | Ga0070712_100012459 | 3300006175 | Bacteria | 5406 |
| 209 | Ga0070712_100017727 | 3300006175 | Bacteria | 4612 |
| 210 | Ga0070712_100102759 | 3300006175 | Bacteria | 2117 |
| 211 | Ga0070712_100126999 | 3300006175 | Bacteria | 1928 |
| 212 | Ga0075367_10001919 | 3300006178 | Bacteria | 9229 |
| 213 | Ga0075367_10088124 | 3300006178 | Bacteria | 1886 |
| 214 | Ga0075369_10001370 | 3300006186 | Bacteria | 8293 |
| 215 | Ga0075369_10037641 | 3300006186 | Bacteria | 2061 |
| 216 | Ga0097621_100015140 | 3300006237 | Bacteria | 5795 |
| 217 | Ga0097621_100073596 | 3300006237 | Bacteria | 2828 |
| 218 | Ga0075370_10008783 | 3300006353 | Bacteria | 5215 |
| 219 | Ga0075370_10033932 | 3300006353 | Bacteria | 2860 |
| 220 | Ga0075370_10044383 | 3300006353 | Bacteria | 2513 |
| 221 | Ga0068871_100018339 | 3300006358 | Bacteria | 5316 |
| 222 | Ga0068871_100189674 | 3300006358 | Bacteria | 1770 |
| 223 | Ga0075428_100065799 | 3300006844 | Bacteria | 3969 |
| 224 | Ga0075428_100089059 | 3300006844 | Bacteria | 3366 |
| 225 | Ga0075430_100051156 | 3300006846 | Bacteria | 3482 |
| 226 | Ga0075431_100036726 | 3300006847 | Bacteria | 5046 |
| 227 | Ga0075433_10005527 | 3300006852 | Bacteria | 9923 |
| 228 | Ga0075433_10012875 | 3300006852 | Bacteria | 6777 |
| 229 | Ga0075433_10163690 | 3300006852 | Bacteria | 1980 |
| 230 | Ga0075434_100003943 | 3300006871 | Bacteria | 13290 |
| 231 | Ga0075434_100005157 | 3300006871 | Bacteria | 11860 |
| 232 | Ga0075434_100008894 | 3300006871 | Bacteria | 9348 |
| 233 | Ga0075434_100014932 | 3300006871 | Bacteria | 7431 |
| 234 | Ga0068865_100000828 | 3300006881 | Bacteria | 17443 |
| 235 | Ga0068865_100022777 | 3300006881 | Bacteria | 4092 |
| 236 | Ga0068865_100028975 | 3300006881 | Bacteria | 3669 |
| 237 | Ga0068865_100029811 | 3300006881 | Bacteria | 3624 |
| 238 | Ga0097620_100003133 | 3300006931 | Bacteria | 16809 |
| 239 | Ga0075435_100007491 | 3300007076 | Bacteria | 7786 |
| 240 | Ga0075435_100107436 | 3300007076 | Bacteria | 2318 |
| 241 | Ga0105251_10017533 | 3300009011 | Bacteria | 3834 |
| 242 | Ga0111539_10184592 | 3300009094 | Bacteria | 2436 |
| 243 | Ga0105245_10003220 | 3300009098 | Bacteria | 14625 |
| 244 | Ga0105245_10018583 | 3300009098 | Bacteria | 6080 |
| 245 | Ga0105245_10107688 | 3300009098 | Bacteria | 2588 |
| 246 | Ga0105245_10116217 | 3300009098 | Bacteria | 2494 |
| 247 | Ga0105245_10133233 | 3300009098 | Bacteria | 2333 |
| 248 | Ga0105245_10162114 | 3300009098 | Bacteria | 2123 |
| 249 | Ga0105245_10171307 | 3300009098 | Bacteria | 2067 |
| 250 | Ga0105247_10000334 | 3300009101 | Bacteria | 41242 |
| 251 | Ga0105247_10029448 | 3300009101 | Bacteria | 3327 |
| 252 | Ga0105247_10069989 | 3300009101 | Bacteria | 2191 |
| 253 | Ga0114129_10004398 | 3300009147 | Bacteria | 19873 |
| 254 | Ga0114129_10018631 | 3300009147 | Bacteria | 9882 |
| 255 | Ga0114129_10019233 | 3300009147 | Bacteria | 9728 |
| 256 | Ga0114129_10026156 | 3300009147 | Bacteria | 8264 |
| 257 | Ga0114129_10039891 | 3300009147 | Bacteria | 6623 |
| 258 | Ga0114129_10223859 | 3300009147 | Bacteria | 2537 |
| 259 | Ga0105243_10005418 | 3300009148 | Bacteria | 9960 |
| 260 | Ga0105243_10006751 | 3300009148 | Bacteria | 8853 |
| 261 | Ga0105243_10007191 | 3300009148 | Bacteria | 8556 |
| 262 | Ga0105243_10116559 | 3300009148 | Bacteria | 2244 |
| 263 | Ga0105241_10019951 | 3300009174 | Bacteria | 4948 |
| 264 | Ga0105242_10000620 | 3300009176 | Bacteria | 27832 |
| 265 | Ga0105242_10002226 | 3300009176 | Bacteria | 15303 |
| 266 | Ga0105242_10002528 | 3300009176 | Bacteria | 14350 |
| 267 | Ga0105242_10042211 | 3300009176 | Bacteria | 3682 |
| 268 | Ga0105242_10052953 | 3300009176 | Bacteria | 3313 |
| 269 | Ga0105248_10004419 | 3300009177 | Bacteria | 15561 |
| 270 | Ga0105248_10025304 | 3300009177 | Bacteria | 6599 |
| 271 | Ga0105248_10044839 | 3300009177 | Bacteria | 4960 |
| 272 | Ga0105237_10000178 | 3300009545 | Bacteria | 89960 |
| 273 | Ga0105237_10002564 | 3300009545 | Bacteria | 22427 |
| 274 | Ga0105237_10034235 | 3300009545 | Bacteria | 5144 |
| 275 | Ga0105237_10051382 | 3300009545 | Bacteria | 4140 |
| 276 | Ga0105238_10093468 | 3300009551 | Bacteria | 2995 |
| 277 | Ga0105238_10195444 | 3300009551 | Bacteria | 1999 |
| 278 | Ga0105249_10000767 | 3300009553 | Bacteria | 28791 |
| 279 | Ga0105249_10012184 | 3300009553 | Bacteria | 7573 |
| 280 | Ga0105249_10053836 | 3300009553 | Bacteria | 3678 |
| 281 | Ga0105249_10108817 | 3300009553 | Bacteria | 2617 |
| 282 | Ga0105249_10172159 | 3300009553 | Bacteria | 2101 |
| 283 | Ga0105239_10002879 | 3300010375 | Bacteria | 21522 |
| 284 | Ga0105239_10007516 | 3300010375 | Bacteria | 12498 |
| 285 | Ga0105239_10030663 | 3300010375 | Bacteria | 5914 |
| 286 | Ga0105239_10059987 | 3300010375 | Bacteria | 4174 |
| 287 | Ga0105239_10228472 | 3300010375 | Bacteria | 2088 |
| 288 | Ga0105239_10269472 | 3300010375 | Archaea | 1915 |
| 289 | Ga0105246_10066414 | 3300011119 | Bacteria | 2525 |
| 290 | Ga0105246_10140320 | 3300011119 | Bacteria | 1816 |
| 291 | Ga0157373_10015473 | 3300013100 | Bacteria | 5577 |
| 292 | Ga0157371_10099871 | 3300013102 | Bacteria | 2058 |
| 293 | Ga0157370_10030713 | 3300013104 | Bacteria | 5263 |
| 294 | Ga0157369_10003613 | 3300013105 | Bacteria | 18373 |
| 295 | Ga0157374_10035561 | 3300013296 | Bacteria | 4558 |
| 296 | Ga0157374_10067899 | 3300013296 | Bacteria | 3353 |
| 297 | Ga0157374_10232882 | 3300013296 | Bacteria | 1810 |
| 298 | Ga0157378_10001690 | 3300013297 | Bacteria | 19860 |
| 299 | Ga0157378_10018845 | 3300013297 | Bacteria | 6066 |
| 300 | Ga0157378_10019027 | 3300013297 | Bacteria | 6035 |
| 301 | Ga0157378_10089398 | 3300013297 | Bacteria | 2797 |
| 302 | Ga0163162_10026392 | 3300013306 | Bacteria | 5740 |
| 303 | Ga0163162_10027146 | 3300013306 | Bacteria | 5661 |
| 304 | Ga0163162_10174064 | 3300013306 | Bacteria | 2277 |
| 305 | Ga0163162_10205789 | 3300013306 | Bacteria | 2097 |
| 306 | Ga0157372_10171892 | 3300013307 | Bacteria | 2507 |
| 307 | Ga0157372_10341252 | 3300013307 | Bacteria | 1745 |
| 308 | Ga0157375_10003452 | 3300013308 | Bacteria | 13692 |
| 309 | Ga0157375_10042351 | 3300013308 | Bacteria | 4407 |
| 310 | Ga0157375_10122797 | 3300013308 | Bacteria | 2709 |
| 311 | Ga0163163_10002897 | 3300014325 | Bacteria | 14510 |
| 312 | Ga0163163_10008170 | 3300014325 | Bacteria | 9282 |
| 313 | Ga0163163_10021984 | 3300014325 | Bacteria | 6030 |
| 314 | Ga0163163_10032021 | 3300014325 | Bacteria | 5078 |
| 315 | Ga0163163_10067769 | 3300014325 | Bacteria | 3549 |
| 316 | Ga0163163_10385973 | 3300014325 | Bacteria | 1458 |
| 317 | Ga0157380_10003813 | 3300014326 | Bacteria | 10374 |
| 318 | Ga0157377_10007912 | 3300014745 | Bacteria | 5159 |
| 319 | Ga0157377_10122128 | 3300014745 | Bacteria | 1580 |
| 320 | Ga0157377_10146693 | 3300014745 | Bacteria | 1455 |
| 321 | Ga0157379_10004932 | 3300014968 | Bacteria | 11450 |
| 322 | Ga0157379_10069475 | 3300014968 | Bacteria | 3150 |
| 323 | Ga0157376_10022035 | 3300014969 | Bacteria | 4957 |
| 324 | Ga0157376_10023837 | 3300014969 | Bacteria | 4798 |
| 325 | Ga0157376_10083979 | 3300014969 | Bacteria | 2741 |
| 326 | Ga0163161_10061975 | 3300017792 | Bacteria | 2724 |
| 327 | Ga0163161_10171762 | 3300017792 | Bacteria | 1658 |
| 328 | Ga0206352_10246956 | 3300020078 | Bacteria | 1383 |
| 329 | Ga0206353_11818343 | 3300020082 | Bacteria | 4369 |
| 330 | Ga0213875_10000570 | 3300021388 | Bacteria | 30105 |
| 331 | Ga0213875_10000604 | 3300021388 | Bacteria | 29093 |
| 332 | Ga0224712_10040519 | 3300022467 | Bacteria | 1753 |
| 333 | Ga0224712_10065178 | 3300022467 | Bacteria | 1463 |
| 334 | Ga0209051_1000528 | 3300025303 | Bacteria | 47444 |
| 335 | Ga0209051_1001208 | 3300025303 | Bacteria | 23322 |
| 336 | Ga0209051_1006114 | 3300025303 | Bacteria | 6849 |
| 337 | Ga0209051_1008439 | 3300025303 | Bacteria | 5451 |
| 338 | Ga0209051_1028496 | 3300025303 | Bacteria | 2205 |
| 339 | Ga0207656_10030145 | 3300025321 | Bacteria | 2239 |
| 340 | Ga0207653_10000004 | 3300025885 | Bacteria | 263142 |
| 341 | Ga0207653_10002058 | 3300025885 | Bacteria | 6408 |
| 342 | Ga0207692_10001870 | 3300025898 | Bacteria | 7987 |
| 343 | Ga0207642_10002962 | 3300025899 | Bacteria | 5313 |
| 344 | Ga0207642_10012124 | 3300025899 | Bacteria | 3101 |
| 345 | Ga0207642_10030974 | 3300025899 | Bacteria | 2236 |
| 346 | Ga0207710_10001088 | 3300025900 | Bacteria | 13985 |
| 347 | Ga0207710_10081651 | 3300025900 | Bacteria | 1501 |
| 348 | Ga0207688_10000352 | 3300025901 | Bacteria | 21384 |
| 349 | Ga0207688_10001514 | 3300025901 | Bacteria | 12214 |
| 350 | Ga0207688_10014587 | 3300025901 | Bacteria | 4269 |
| 351 | Ga0207647_10063954 | 3300025904 | Bacteria | 2237 |
| 352 | Ga0207647_10079885 | 3300025904 | Bacteria | 1962 |
| 353 | Ga0207685_10001280 | 3300025905 | Bacteria | 5144 |
| 354 | Ga0207685_10003910 | 3300025905 | Bacteria | 3698 |
| 355 | Ga0207699_10000156 | 3300025906 | Bacteria | 42514 |
| 356 | Ga0207699_10002495 | 3300025906 | Bacteria | 8691 |
| 357 | Ga0207699_10028701 | 3300025906 | Bacteria | 3095 |
| 358 | Ga0207643_10000055 | 3300025908 | Bacteria | 73929 |
| 359 | Ga0207643_10002720 | 3300025908 | Bacteria | 9565 |
| 360 | Ga0207684_10000339 | 3300025910 | Bacteria | 65102 |
| 361 | Ga0207684_10000911 | 3300025910 | Bacteria | 33666 |
| 362 | Ga0207684_10057831 | 3300025910 | Bacteria | 3290 |
| 363 | Ga0207654_10092056 | 3300025911 | Bacteria | 1851 |
| 364 | Ga0207671_10008270 | 3300025914 | Bacteria | 8850 |
| 365 | Ga0207671_10011790 | 3300025914 | Bacteria | 7076 |
| 366 | Ga0207693_10000199 | 3300025915 | Bacteria | 54571 |
| 367 | Ga0207693_10001171 | 3300025915 | Bacteria | 23404 |
| 368 | Ga0207693_10001690 | 3300025915 | Bacteria | 19437 |
| 369 | Ga0207693_10002490 | 3300025915 | Bacteria | 16019 |
| 370 | Ga0207693_10005402 | 3300025915 | Bacteria | 10677 |
| 371 | Ga0207693_10045359 | 3300025915 | Bacteria | 3454 |
| 372 | Ga0207693_10061181 | 3300025915 | Bacteria | 2949 |
| 373 | Ga0207693_10089600 | 3300025915 | Bacteria | 2411 |
| 374 | Ga0207693_10093630 | 3300025915 | Bacteria | 2355 |
| 375 | Ga0207663_10001603 | 3300025916 | Bacteria | 10631 |
| 376 | Ga0207663_10005265 | 3300025916 | Bacteria | 6513 |
| 377 | Ga0207663_10006245 | 3300025916 | Bacteria | 6079 |
| 378 | Ga0207663_10014279 | 3300025916 | Bacteria | 4343 |
| 379 | Ga0207663_10017362 | 3300025916 | Bacteria | 4008 |
| 380 | Ga0207663_10021617 | 3300025916 | Bacteria | 3665 |
| 381 | Ga0207662_10004973 | 3300025918 | Bacteria | 7033 |
| 382 | Ga0207657_10030438 | 3300025919 | Bacteria | 4899 |
| 383 | Ga0207657_10072009 | 3300025919 | Bacteria | 2925 |
| 384 | Ga0207649_10020440 | 3300025920 | Bacteria | 3798 |
| 385 | Ga0207649_10082505 | 3300025920 | Bacteria | 2084 |
| 386 | Ga0207646_10000061 | 3300025922 | Bacteria | 151425 |
| 387 | Ga0207646_10005885 | 3300025922 | Bacteria | 12805 |
| 388 | Ga0207646_10007478 | 3300025922 | Bacteria | 11089 |
| 389 | Ga0207646_10009346 | 3300025922 | Bacteria | 9691 |
| 390 | Ga0207646_10042854 | 3300025922 | Bacteria | 4066 |
| 391 | Ga0207650_10001024 | 3300025925 | Bacteria | 20982 |
| 392 | Ga0207650_10020009 | 3300025925 | Bacteria | 4713 |
| 393 | Ga0207659_10138959 | 3300025926 | Bacteria | 1884 |
| 394 | Ga0207687_10001147 | 3300025927 | Bacteria | 18035 |
| 395 | Ga0207687_10029528 | 3300025927 | Bacteria | 3689 |
| 396 | Ga0207687_10165851 | 3300025927 | Bacteria | 1699 |
| 397 | Ga0207700_10000063 | 3300025928 | Bacteria | 65696 |
| 398 | Ga0207700_10016567 | 3300025928 | Bacteria | 4900 |
| 399 | Ga0207700_10026919 | 3300025928 | Bacteria | 4018 |
| 400 | Ga0207700_10029262 | 3300025928 | Bacteria | 3884 |
| 401 | Ga0207700_10029504 | 3300025928 | Bacteria | 3871 |
| 402 | Ga0207700_10055669 | 3300025928 | Bacteria | 2974 |
| 403 | Ga0207700_10109651 | 3300025928 | Bacteria | 2219 |
| 404 | Ga0207664_10000196 | 3300025929 | Bacteria | 45388 |
| 405 | Ga0207664_10001029 | 3300025929 | Bacteria | 18674 |
| 406 | Ga0207664_10002329 | 3300025929 | Bacteria | 12548 |
| 407 | Ga0207664_10021830 | 3300025929 | Bacteria | 4770 |
| 408 | Ga0207664_10024393 | 3300025929 | Bacteria | 4544 |
| 409 | Ga0207664_10032064 | 3300025929 | Bacteria | 4025 |
| 410 | Ga0207664_10044307 | 3300025929 | Bacteria | 3483 |
| 411 | Ga0207664_10047539 | 3300025929 | Bacteria | 3371 |
| 412 | Ga0207664_10056440 | 3300025929 | Bacteria | 3119 |
| 413 | Ga0207664_10243144 | 3300025929 | Bacteria | 1568 |
| 414 | Ga0207664_10272932 | 3300025929 | Bacteria | 1482 |
| 415 | Ga0207664_10331043 | 3300025929 | Bacteria | 1345 |
| 416 | Ga0207644_10005208 | 3300025931 | Bacteria | 8493 |
| 417 | Ga0207644_10031027 | 3300025931 | Bacteria | 3721 |
| 418 | Ga0207644_10103641 | 3300025931 | Bacteria | 2141 |
| 419 | Ga0207690_10028152 | 3300025932 | Bacteria | 3559 |
| 420 | Ga0207690_10054150 | 3300025932 | Bacteria | 2696 |
| 421 | Ga0207706_10001128 | 3300025933 | Bacteria | 27189 |
| 422 | Ga0207706_10009818 | 3300025933 | Bacteria | 8781 |
| 423 | Ga0207706_10019781 | 3300025933 | Bacteria | 6054 |
| 424 | Ga0207706_10022575 | 3300025933 | Bacteria | 5647 |
| 425 | Ga0207686_10002468 | 3300025934 | Bacteria | 10044 |
| 426 | Ga0207686_10005839 | 3300025934 | Bacteria | 6603 |
| 427 | Ga0207686_10006248 | 3300025934 | Bacteria | 6406 |
| 428 | Ga0207686_10037607 | 3300025934 | Bacteria | 2922 |
| 429 | Ga0207709_10007186 | 3300025935 | Bacteria | 6215 |
| 430 | Ga0207709_10017218 | 3300025935 | Bacteria | 4030 |
| 431 | Ga0207709_10023700 | 3300025935 | Bacteria | 3496 |
| 432 | Ga0207709_10034736 | 3300025935 | Bacteria | 2975 |
| 433 | Ga0207709_10196818 | 3300025935 | Unclassified | 1436 |
| 434 | Ga0207670_10127309 | 3300025936 | Bacteria | 1860 |
| 435 | Ga0207669_10032348 | 3300025937 | Bacteria | 2936 |
| 436 | Ga0207669_10057020 | 3300025937 | Bacteria | 2376 |
| 437 | Ga0207669_10058311 | 3300025937 | Bacteria | 2355 |
| 438 | Ga0207704_10000377 | 3300025938 | Bacteria | 20506 |
| 439 | Ga0207704_10012981 | 3300025938 | Bacteria | 4153 |
| 440 | Ga0207704_10044070 | 3300025938 | Bacteria | 2640 |
| 441 | Ga0207704_10132560 | 3300025938 | Bacteria | 1729 |
| 442 | Ga0207665_10000226 | 3300025939 | Bacteria | 38498 |
| 443 | Ga0207665_10001670 | 3300025939 | Bacteria | 14929 |
| 444 | Ga0207665_10005772 | 3300025939 | Bacteria | 8231 |
| 445 | Ga0207665_10013801 | 3300025939 | Bacteria | 5314 |
| 446 | Ga0207665_10056850 | 3300025939 | Bacteria | 2642 |
| 447 | Ga0207665_10058954 | 3300025939 | Bacteria | 2597 |
| 448 | Ga0207665_10059404 | 3300025939 | Bacteria | 2588 |
| 449 | Ga0207665_10067547 | 3300025939 | Bacteria | 2435 |
| 450 | Ga0207665_10073331 | 3300025939 | Bacteria | 2341 |
| 451 | Ga0207691_10033981 | 3300025940 | Bacteria | 4746 |
| 452 | Ga0207691_10040532 | 3300025940 | Bacteria | 4302 |
| 453 | Ga0207711_10108185 | 3300025941 | Bacteria | 2469 |
| 454 | Ga0207711_10165028 | 3300025941 | Bacteria | 2007 |
| 455 | Ga0207689_10002296 | 3300025942 | Bacteria | 17905 |
| 456 | Ga0207689_10009916 | 3300025942 | Bacteria | 8213 |
| 457 | Ga0207689_10025969 | 3300025942 | Bacteria | 4905 |
| 458 | Ga0207661_10082020 | 3300025944 | Bacteria | 2665 |
| 459 | Ga0207661_10097199 | 3300025944 | Bacteria | 2465 |
| 460 | Ga0207661_10104229 | 3300025944 | Bacteria | 2388 |
| 461 | Ga0207679_10002946 | 3300025945 | Bacteria | 10545 |
| 462 | Ga0207679_10169321 | 3300025945 | Bacteria | 1797 |
| 463 | Ga0207667_10107381 | 3300025949 | Bacteria | 2880 |
| 464 | Ga0207651_10050424 | 3300025960 | Bacteria | 2826 |
| 465 | Ga0207712_10006309 | 3300025961 | Bacteria | 7477 |
| 466 | Ga0207712_10043419 | 3300025961 | Bacteria | 3101 |
| 467 | Ga0207668_10056080 | 3300025972 | Bacteria | 2742 |
| 468 | Ga0207640_10003409 | 3300025981 | Bacteria | 8561 |
| 469 | Ga0207658_10012179 | 3300025986 | Bacteria | 5867 |
| 470 | Ga0207677_10011441 | 3300026023 | Bacteria | 5061 |
| 471 | Ga0207703_10014135 | 3300026035 | Bacteria | 6223 |
| 472 | Ga0207703_10018284 | 3300026035 | Bacteria | 5473 |
| 473 | Ga0207703_10053855 | 3300026035 | Bacteria | 3271 |
| 474 | Ga0207678_10001390 | 3300026067 | Bacteria | 22261 |
| 475 | Ga0207678_10016407 | 3300026067 | Bacteria | 6503 |
| 476 | Ga0207678_10032965 | 3300026067 | Bacteria | 4513 |
| 477 | Ga0207678_10045686 | 3300026067 | Bacteria | 3787 |
| 478 | Ga0207708_10003968 | 3300026075 | Bacteria | 10890 |
| 479 | Ga0207708_10005234 | 3300026075 | Bacteria | 9557 |
| 480 | Ga0207708_10005684 | 3300026075 | Bacteria | 9215 |
| 481 | Ga0207708_10006707 | 3300026075 | Bacteria | 8516 |
| 482 | Ga0207702_10138335 | 3300026078 | Bacteria | 2200 |
| 483 | Ga0207641_10003507 | 3300026088 | Bacteria | 13886 |
| 484 | Ga0207641_10071720 | 3300026088 | Bacteria | 2980 |
| 485 | Ga0207648_10001355 | 3300026089 | Bacteria | 27091 |
| 486 | Ga0207648_10004217 | 3300026089 | Bacteria | 14857 |
| 487 | Ga0207648_10026700 | 3300026089 | Bacteria | 5129 |
| 488 | Ga0207648_10103641 | 3300026089 | Bacteria | 2495 |
| 489 | Ga0207676_10001452 | 3300026095 | Bacteria | 17629 |
| 490 | Ga0207676_10016180 | 3300026095 | Bacteria | 5399 |
| 491 | Ga0207676_10022955 | 3300026095 | Bacteria | 4594 |
| 492 | Ga0207674_10000186 | 3300026116 | Bacteria | 75904 |
| 493 | Ga0207674_10010966 | 3300026116 | Bacteria | 10198 |
| 494 | Ga0207674_10150848 | 3300026116 | Bacteria | 2282 |
| 495 | Ga0207675_100013054 | 3300026118 | Bacteria | 7753 |
| 496 | Ga0207675_100015022 | 3300026118 | Bacteria | 7224 |
| 497 | Ga0207675_100017867 | 3300026118 | Bacteria | 6615 |
| 498 | Ga0207675_100040429 | 3300026118 | Bacteria | 4355 |
| 499 | Ga0207675_100078529 | 3300026118 | Bacteria | 3092 |
| 500 | Ga0207675_100163300 | 3300026118 | Bacteria | 2126 |
| 501 | Ga0207683_10000201 | 3300026121 | Bacteria | 51559 |
| 502 | Ga0207683_10008060 | 3300026121 | Bacteria | 9009 |
| 503 | Ga0207683_10027425 | 3300026121 | Bacteria | 4922 |
| 504 | Ga0207698_10205597 | 3300026142 | Bacteria | 1767 |
| 505 | Ga0207428_10001001 | 3300027907 | Bacteria | 31346 |
| 506 | Ga0207428_10011760 | 3300027907 | Bacteria | 7719 |
| 507 | Ga0268266_10007843 | 3300028379 | Bacteria | 9563 |
| 508 | Ga0268266_10065058 | 3300028379 | Bacteria | 3152 |
| 509 | Ga0268266_10188837 | 3300028379 | Bacteria | 1880 |
| 510 | Ga0268266_10205726 | 3300028379 | Bacteria | 1803 |
| 511 | Ga0268266_10246931 | 3300028379 | Bacteria | 1649 |
| 512 | Ga0268265_10121015 | 3300028380 | Bacteria | 2156 |
| 513 | Ga0268264_10114403 | 3300028381 | Bacteria | 2368 |
| 514 | Ga0265337_1000027 | 3300028556 | Bacteria | 68392 |
| 515 | Ga0265326_10001234 | 3300028558 | Bacteria | 9119 |
| 516 | Ga0265319_1001055 | 3300028563 | Bacteria | 17217 |
| 517 | Ga0265334_10000773 | 3300028573 | Bacteria | 16014 |
| 518 | Ga0265322_10001284 | 3300028654 | Bacteria | 8433 |
| 519 | Ga0265336_10002288 | 3300028666 | Bacteria | 8003 |
| 520 | Ga0265338_10000227 | 3300028800 | Bacteria | 104795 |
| 521 | Ga0265338_10001512 | 3300028800 | Bacteria | 37550 |
| 522 | Ga0265338_10007886 | 3300028800 | Bacteria | 13062 |
| 523 | Ga0265338_10011419 | 3300028800 | Bacteria | 10257 |
| 524 | Ga0265324_10004386 | 3300029957 | Bacteria | 6400 |
| 525 | Ga0265332_10001185 | 3300031238 | Bacteria | 15099 |
| 526 | Ga0265325_10005218 | 3300031241 | Bacteria | 8066 |
| 527 | Ga0265339_10021776 | 3300031249 | Bacteria | 3723 |
| 528 | Ga0265327_10008031 | 3300031251 | Bacteria | 7964 |
| 529 | Ga0265316_10007705 | 3300031344 | Bacteria | 10091 |
| 530 | Ga0307408_100231039 | 3300031548 | Bacteria | 1515 |
| 531 | Ga0265313_10010516 | 3300031595 | Bacteria | 5839 |
| 532 | Ga0265314_10010105 | 3300031711 | Bacteria | 7910 |
| 533 | Ga0307405_10018316 | 3300031731 | Bacteria | 3860 |
| 534 | Ga0307406_10058952 | 3300031901 | Bacteria | 2469 |
| 535 | Ga0307409_100226090 | 3300031995 | Bacteria | 1693 |
| 536 | Ga0307416_100017768 | 3300032002 | Bacteria | 4988 |
| 537 | Ga0307415_100027908 | 3300032126 | Bacteria | 3583 |
| 538 | Ga0373926_0001462 | 3300035083 | Bacteria | 7192 |
| 539 | Ga0373926_0021075 | 3300035083 | Bacteria | 2254 |
| 540 | Ga0373926_0032850 | 3300035083 | Bacteria | 1832 |
| 541 | Ga0373934_0015454 | 3300035086 | Bacteria | 2895 |
| 542 | Ga0373940_0001161 | 3300035088 | Bacteria | 4616 |
| 543 | Ga0373944_0000926 | 3300035089 | Bacteria | 7259 |
| 544 | Ga0373923_0009489 | 3300035111 | Bacteria | 3512 |
| 545 | Ga0373923_0010272 | 3300035111 | Bacteria | 3401 |
| 546 | Ga0373923_0020707 | 3300035111 | Bacteria | 2558 |
| 547 | Ga0373936_0000519 | 3300035113 | Bacteria | 13160 |
| 548 | Ga0373936_0004471 | 3300035113 | Bacteria | 5286 |
| 549 | Ga0373936_0006048 | 3300035113 | Bacteria | 4562 |
| 550 | Ga0373936_0008708 | 3300035113 | Bacteria | 3820 |
| 551 | Ga0373936_0014364 | 3300035113 | Bacteria | 3025 |
| 552 | Ga0373939_0005927 | 3300035114 | Bacteria | 2926 |
| 553 | Ga0373941_0005711 | 3300035115 | Bacteria | 2950 |
| 554 | Ga0373945_0001751 | 3300035116 | Bacteria | 6703 |
| 555 | Ga0373945_0014754 | 3300035116 | Bacteria | 2622 |
| 556 | Ga0373953_0003298 | 3300035117 | Bacteria | 5010 |
| 557 | Ga0373954_0014349 | 3300035118 | Bacteria | 3533 |
| 558 | Ga0373954_0035904 | 3300035118 | Bacteria | 2299 |
| 559 | Ga0373956_0025651 | 3300035119 | Bacteria | 2549 |
| 560 | Ga0373957_0015658 | 3300035120 | Bacteria | 2613 |
| 561 | Ga0373957_0051606 | 3300035120 | Bacteria | 1573 |
| 562 | Ga0373943_0000223 | 3300035170 | Bacteria | 23116 |
| 563 | Ga0373946_0000756 | 3300035171 | Bacteria | 10990 |
| 564 | Ga0373946_0000798 | 3300035171 | Bacteria | 10747 |
| 565 | Ga0373955_0021637 | 3300035172 | Bacteria | 3250 |
| 566 | Ga0373955_0101848 | 3300035172 | Bacteria | 1650 |
| 567 | Ga0373962_0007345 | 3300035242 | Bacteria | 2697 |
| 568 | Ga0373924_0008387 | 3300035410 | Bacteria | 3752 |
| 569 | Ga0373924_0012085 | 3300035410 | Bacteria | 3220 |
| 570 | Ga0373924_0051869 | 3300035410 | Bacteria | 1702 |
| 571 | Ga0373931_0013389 | 3300035691 | Bacteria | 3994 |
| 572 | Ga0373931_0022723 | 3300035691 | Bacteria | 3159 |
| 573 | Ga0373935_0004598 | 3300035692 | Bacteria | 8110 |
| 574 | Ga0373935_0010760 | 3300035692 | Bacteria | 5494 |
| 575 | Ga0373935_0042798 | 3300035692 | Bacteria | 2848 |
| 576 | Ga0373927_0003276 | 3300035695 | Bacteria | 11646 |
| 577 | Ga0373927_0051849 | 3300035695 | Bacteria | 2653 |
| 578 | Ga0373947_0000014 | 3300035725 | Bacteria | 135749 |
| 579 | Ga0373937_0065515 | 3300036401 | Bacteria | 3344 |
| 580 | Ga0373925_0000421 | 3300037068 | Bacteria | 43136 |
| 581 | Ga0373925_0009690 | 3300037068 | Bacteria | 7009 |
| 582 | Ga0373925_0010661 | 3300037068 | Bacteria | 6665 |
| 583 | Ga0373925_0012062 | 3300037068 | Bacteria | 6257 |
| 584 | Ga0373925_0045115 | 3300037068 | Bacteria | 3274 |
| 585 | Ga0373925_0081599 | 3300037068 | Bacteria | 2459 |
| 586 | Ga0395899_0005983 | 3300037312 | Bacteria | 9447 |
| 587 | Ga0395899_0140674 | 3300037312 | Unclassified | 1717 |
| 588 | Ga0395900_0033278 | 3300037418 | Bacteria | 5306 |
| 589 | Ga0395900_0125814 | 3300037418 | Bacteria | 2629 |
| 590 | Ga0395898_0003800 | 3300037466 | Bacteria | 16715 |
| 591 | Ga0395898_0019897 | 3300037466 | Bacteria | 6826 |
| 592 | Ga0395898_0019979 | 3300037466 | Bacteria | 6812 |
| 593 | Ga0395905_0008955 | 3300037471 | Bacteria | 9823 |
| 594 | Ga0395905_0047873 | 3300037471 | Bacteria | 4006 |
| 595 | Ga0436364_0485851 | 3300037853 | Bacteria | 2704 |
| 596 | Ga0436364_0824111 | 3300037853 | Bacteria | 10643 |
| 597 | Ga0436364_0841117 | 3300037853 | Bacteria | 5270 |
| 598 | Ga0436364_1107254 | 3300037853 | Bacteria | 1626 |
| 599 | Ga0436364_1421530 | 3300037853 | Bacteria | 3172 |
| 600 | Ga0436364_1435297 | 3300037853 | Bacteria | 74939 |
| 601 | Ga0436364_1450559 | 3300037853 | Bacteria | 2346 |
| 602 | Ga0436364_1520571 | 3300037853 | Bacteria | 46168 |
| 603 | Ga0395901_0032219 | 3300038443 | Bacteria | 5408 |
| 604 | Ga0439461_0000217 | 3300041410 | Bacteria | 8182 |
| 605 | Ga0439466_0021262 | 3300041411 | Bacteria | 2303 |
| 606 | Ga0439465_0000349 | 3300041413 | Bacteria | 13257 |
| 607 | Ga0439431_0000859 | 3300041997 | Bacteria | 6579 |
| 608 | Ga0439440_0014134 | 3300042993 | Bacteria | 1720 |
| 609 | Ga0466969_0078576 | 3300044656 | Bacteria | 1578 |
| 610 | Ga0466972_0012299 | 3300044658 | Bacteria | 4302 |
| 611 | Ga0466965_0002177 | 3300044683 | Bacteria | 8246 |
| 612 | Ga0466965_0022873 | 3300044683 | Bacteria | 3015 |
| 613 | Ga0466966_0009549 | 3300044684 | Bacteria | 6420 |
| 614 | Ga0466961_0002650 | 3300044693 | Bacteria | 11103 |
| 615 | Ga0466963_0005765 | 3300044694 | Bacteria | 7282 |
| 616 | Ga0466963_0040770 | 3300044694 | Bacteria | 3044 |
| 617 | Ga0466964_0005286 | 3300044706 | Bacteria | 4789 |
| 618 | Ga0466964_0017103 | 3300044706 | Bacteria | 2774 |
| 619 | Ga0466968_0001088 | 3300044735 | Bacteria | 9619 |
| 620 | Ga0466970_0016640 | 3300044765 | Bacteria | 3794 |
| 621 | Ga0466957_0008856 | 3300044842 | Bacteria | 5731 |
| 622 | Ga0466957_0043503 | 3300044842 | Bacteria | 2720 |
| 623 | Ga0466960_0079258 | 3300044901 | Bacteria | 1651 |
| 624 | Ga0466959_0001490 | 3300045049 | Bacteria | 14375 |
| 625 | Ga0466959_0027893 | 3300045049 | Bacteria | 4188 |
| 626 | Ga0466959_0075817 | 3300045049 | Bacteria | 2429 |
| 627 | Ga0466958_0063732 | 3300045836 | Bacteria | 2248 |
| 628 | Ga0466967_0010721 | 3300045976 | Bacteria | 6891 |
| 629 | Ga0466967_0012654 | 3300045976 | Bacteria | 6471 |
| 630 | Ga0466967_0036069 | 3300045976 | Bacteria | 4218 |
| 631 | Ga0466967_0056273 | 3300045976 | Bacteria | 3467 |
| 632 | Ga0466967_0056739 | 3300045976 | Bacteria | 3455 |
| 633 | Ga0466967_0111964 | 3300045976 | Bacteria | 2509 |
| 634 | Ga0466967_0113400 | 3300045976 | Bacteria | 2494 |
| 635 | Ga0466967_0132388 | 3300045976 | Bacteria | 2316 |
| 636 | Ga0466967_0158221 | 3300045976 | Bacteria | 2124 |
| 637 | Ga0495592_0000455 | 3300046454 | Bacteria | 30633 |
| 638 | Ga0495592_0015925 | 3300046454 | Bacteria | 5704 |
| 639 | Ga0495592_0025553 | 3300046454 | Bacteria | 4482 |
| 640 | Ga0495592_0068405 | 3300046454 | Bacteria | 2592 |
| 641 | Ga0495603_0001901 | 3300046455 | Bacteria | 12324 |
| 642 | Ga0495603_0006218 | 3300046455 | Bacteria | 7140 |
| 643 | Ga0495603_0024918 | 3300046455 | Bacteria | 3618 |
| 644 | Ga0495603_0040047 | 3300046455 | Bacteria | 2806 |
| 645 | Ga0495603_0122091 | 3300046455 | Bacteria | 1518 |
| 646 | Ga0495629_0003190 | 3300046459 | Bacteria | 12420 |
| 647 | Ga0495629_0012234 | 3300046459 | Bacteria | 6215 |
| 648 | Ga0495629_0190503 | 3300046459 | Bacteria | 1419 |
| 649 | Ga0495638_0002264 | 3300046460 | Bacteria | 15935 |
| 650 | Ga0495641_0007936 | 3300046461 | Bacteria | 6551 |
| 651 | Ga0495641_0012394 | 3300046461 | Bacteria | 4773 |
| 652 | Ga0495641_0044956 | 3300046461 | Bacteria | 2034 |
| 653 | Ga0495651_0000174 | 3300046462 | Bacteria | 47579 |
| 654 | Ga0495651_0007208 | 3300046462 | Bacteria | 8501 |
| 655 | Ga0495651_0059179 | 3300046462 | Bacteria | 2938 |
| 656 | Ga0495653_0000414 | 3300046463 | Bacteria | 34250 |
| 657 | Ga0495580_0206685 | 3300046472 | Unclassified | 1352 |
| 658 | Ga0495582_0013066 | 3300046473 | Bacteria | 4571 |
| 659 | Ga0495582_0027448 | 3300046473 | Bacteria | 3121 |
| 660 | Ga0495582_0033593 | 3300046473 | Bacteria | 2820 |
| 661 | Ga0495582_0036446 | 3300046473 | Bacteria | 2706 |
| 662 | Ga0495582_0155062 | 3300046473 | Unclassified | 1301 |
| 663 | Ga0495605_0139752 | 3300046474 | Unclassified | 1087 |
| 664 | Ga0495639_0019856 | 3300046475 | Bacteria | 2933 |
| 665 | Ga0495662_0005395 | 3300046476 | Bacteria | 6399 |
| 666 | Ga0495662_0013986 | 3300046476 | Bacteria | 3907 |
| 667 | Ga0495662_0027687 | 3300046476 | Bacteria | 2738 |
| 668 | Ga0495664_0000074 | 3300046477 | Bacteria | 48269 |
| 669 | Ga0495664_0003697 | 3300046477 | Bacteria | 8341 |
| 670 | Ga0495664_0039541 | 3300046477 | Bacteria | 2787 |
| 671 | Ga0495664_0099478 | 3300046477 | Bacteria | 1751 |
| 672 | Ga0495664_0113788 | 3300046477 | Bacteria | 1634 |
| 673 | Ga0495664_0136094 | 3300046477 | Unclassified | 1488 |
| 674 | Ga0495584_0037466 | 3300046491 | Bacteria | 2451 |
| 675 | Ga0495584_0069862 | 3300046491 | Unclassified | 1765 |
| 676 | Ga0495584_0089727 | 3300046491 | Bacteria | 1550 |
| 677 | Ga0495594_0100555 | 3300046499 | Bacteria | 1626 |
| 678 | Ga0495596_0029721 | 3300046500 | Bacteria | 2190 |
| 679 | Ga0495606_0051487 | 3300046507 | Bacteria | 2685 |
| 680 | Ga0495608_0000410 | 3300046511 | Bacteria | 29942 |
| 681 | Ga0495608_0010194 | 3300046511 | Bacteria | 6558 |
| 682 | Ga0495608_0018431 | 3300046511 | Bacteria | 4815 |
| 683 | Ga0495618_0039001 | 3300046514 | Bacteria | 2986 |
| 684 | Ga0495618_0071028 | 3300046514 | Bacteria | 2214 |
| 685 | Ga0495618_0089619 | 3300046514 | Bacteria | 1967 |
| 686 | Ga0495628_0000444 | 3300046516 | Bacteria | 37801 |
| 687 | Ga0495628_0024834 | 3300046516 | Bacteria | 4902 |
| 688 | Ga0495628_0101290 | 3300046516 | Bacteria | 2222 |
| 689 | Ga0495628_0102534 | 3300046516 | Bacteria | 2207 |
| 690 | Ga0495630_0009396 | 3300046517 | Bacteria | 7025 |
| 691 | Ga0495630_0011332 | 3300046517 | Bacteria | 6451 |
| 692 | Ga0495630_0016278 | 3300046517 | Bacteria | 5433 |
| 693 | Ga0495630_0032481 | 3300046517 | Bacteria | 3889 |
| 694 | Ga0495631_0051413 | 3300046518 | Bacteria | 1801 |
| 695 | Ga0495644_0027858 | 3300046523 | Bacteria | 2139 |
| 696 | Ga0495644_0028662 | 3300046523 | Bacteria | 2106 |
| 697 | Ga0495648_0005458 | 3300046524 | Bacteria | 10554 |
| 698 | Ga0495663_0006952 | 3300046525 | Bacteria | 3122 |
| 699 | Ga0495666_0000996 | 3300046526 | Bacteria | 13421 |
| 700 | Ga0495666_0068629 | 3300046526 | Bacteria | 1688 |
| 701 | Ga0495652_0000665 | 3300046529 | Bacteria | 39849 |
| 702 | Ga0495652_0043197 | 3300046529 | Bacteria | 3884 |
| 703 | Ga0495654_0081550 | 3300046530 | Bacteria | 1516 |
| 704 | Ga0495665_0009444 | 3300046531 | Bacteria | 5280 |
| 705 | Ga0495665_0013989 | 3300046531 | Bacteria | 4333 |
| 706 | Ga0495665_0061076 | 3300046531 | Bacteria | 1990 |
| 707 | Ga0495640_0006097 | 3300046533 | Bacteria | 9555 |
| 708 | Ga0495640_0018263 | 3300046533 | Bacteria | 5207 |
| 709 | Ga0495586_0005340 | 3300046535 | Bacteria | 6874 |
| 710 | Ga0495586_0107155 | 3300046535 | Bacteria | 1554 |
| 711 | Ga0495587_0002878 | 3300046536 | Bacteria | 11528 |
| 712 | Ga0495587_0019393 | 3300046536 | Bacteria | 4209 |
| 713 | Ga0495587_0055100 | 3300046536 | Bacteria | 2342 |
| 714 | Ga0495587_0091279 | 3300046536 | Bacteria | 1759 |
| 715 | Ga0495609_0051361 | 3300046538 | Bacteria | 1836 |
| 716 | Ga0495621_0023587 | 3300046539 | Bacteria | 2048 |
| 717 | Ga0495645_0001127 | 3300046543 | Bacteria | 18070 |
| 718 | Ga0495645_0158078 | 3300046543 | Bacteria | 1569 |
| 719 | Ga0495667_0000117 | 3300046559 | Bacteria | 57725 |
| 720 | Ga0495667_0000908 | 3300046559 | Bacteria | 19115 |
| 721 | Ga0495667_0029518 | 3300046559 | Bacteria | 3691 |
| 722 | Ga0495667_0047522 | 3300046559 | Bacteria | 2835 |
| 723 | Ga0495667_0057206 | 3300046559 | Bacteria | 2564 |
| 724 | Ga0495667_0068884 | 3300046559 | Bacteria | 2309 |
| 725 | Ga0495667_0087160 | 3300046559 | Bacteria | 2024 |
| 726 | Ga0495656_0000291 | 3300046615 | Bacteria | 17446 |
| 727 | Ga0495656_0022991 | 3300046615 | Bacteria | 2448 |
| 728 | Ga0495634_0001586 | 3300046642 | Bacteria | 19947 |
| 729 | Ga0495634_0002700 | 3300046642 | Bacteria | 14596 |
| 730 | Ga0495634_0056454 | 3300046642 | Bacteria | 2623 |
| 731 | Ga0495635_0000773 | 3300046663 | Bacteria | 20815 |
| 732 | Ga0495635_0011752 | 3300046663 | Bacteria | 6139 |
| 733 | Ga0495635_0063839 | 3300046663 | Bacteria | 2528 |
| 734 | Ga0495635_0173446 | 3300046663 | Bacteria | 1466 |
| 735 | Ga0495659_0000889 | 3300046664 | Bacteria | 10637 |
| 736 | Ga0495588_0001357 | 3300046674 | Bacteria | 10445 |
| 737 | Ga0495657_0006991 | 3300046675 | Bacteria | 8754 |
| 738 | Ga0495657_0007099 | 3300046675 | Bacteria | 8687 |
| 739 | Ga0495657_0051040 | 3300046675 | Bacteria | 2778 |
| 740 | Ga0495599_0000185 | 3300046678 | Bacteria | 40953 |
| 741 | Ga0495599_0053041 | 3300046678 | Bacteria | 2540 |
| 742 | Ga0495623_0055054 | 3300046679 | Bacteria | 2508 |
| 743 | Ga0495646_0000628 | 3300046680 | Bacteria | 19227 |
| 744 | Ga0495646_0018567 | 3300046680 | Bacteria | 4403 |
| 745 | Ga0495646_0041034 | 3300046680 | Bacteria | 2845 |
| 746 | Ga0495647_0001537 | 3300046681 | Bacteria | 7126 |
| 747 | Ga0495647_0042764 | 3300046681 | Bacteria | 1731 |
| 748 | Ga0495647_0058534 | 3300046681 | Bacteria | 1515 |
| 749 | Ga0495658_0001438 | 3300046683 | Bacteria | 12529 |
| 750 | Ga0495658_0011377 | 3300046683 | Bacteria | 4475 |
| 751 | Ga0495613_0053181 | 3300046689 | Bacteria | 2980 |
| 752 | Ga0495613_0108031 | 3300046689 | Bacteria | 2007 |
| 753 | Ga0495624_0006757 | 3300046690 | Bacteria | 8106 |
| 754 | Ga0495624_0028048 | 3300046690 | Bacteria | 3681 |
| 755 | Ga0495624_0033267 | 3300046690 | Bacteria | 3339 |
| 756 | Ga0495624_0086899 | 3300046690 | Bacteria | 1931 |
| 757 | Ga0495671_0034988 | 3300046692 | Bacteria | 2553 |
| 758 | Ga0495589_0007696 | 3300046794 | Bacteria | 5639 |
| 759 | Ga0495600_0014669 | 3300046809 | Bacteria | 4940 |
| 760 | Ga0495581_0004943 | 3300047315 | Bacteria | 7715 |
| 761 | Ga0495581_0008059 | 3300047315 | Bacteria | 6097 |
| 762 | Ga0495581_0009928 | 3300047315 | Bacteria | 5508 |
| 763 | Ga0495581_0036608 | 3300047315 | Bacteria | 2839 |
| 764 | Ga0495604_0016061 | 3300047317 | Bacteria | 5979 |
| 765 | Ga0495604_0025456 | 3300047317 | Bacteria | 4715 |
| 766 | Ga0495636_0005073 | 3300047318 | Bacteria | 5170 |
| 767 | Ga0495674_0000984 | 3300047319 | Bacteria | 27406 |
| 768 | Ga0495674_0002797 | 3300047319 | Bacteria | 16935 |
| 769 | Ga0495674_0041283 | 3300047319 | Bacteria | 4122 |
| 770 | Ga0495674_0050652 | 3300047319 | Bacteria | 3664 |
| 771 | Ga0495674_0054886 | 3300047319 | Bacteria | 3497 |
| 772 | Ga0495674_0107812 | 3300047319 | Bacteria | 2364 |
| 773 | Ga0495672_0030900 | 3300047320 | Bacteria | 3350 |
| 774 | Ga0495676_0020287 | 3300047321 | Bacteria | 5835 |
| 775 | Ga0495676_0040298 | 3300047321 | Bacteria | 3856 |
| 776 | Ga0495680_0000401 | 3300047322 | Bacteria | 48480 |
| 777 | Ga0495680_0001586 | 3300047322 | Bacteria | 24314 |
| 778 | Ga0495680_0029597 | 3300047322 | Bacteria | 4483 |
| 779 | Ga0495680_0071146 | 3300047322 | Bacteria | 2649 |
| 780 | Ga0495680_0167712 | 3300047322 | Bacteria | 1591 |
| 781 | Ga0495675_0005713 | 3300047444 | Bacteria | 7607 |
| 782 | Ga0495675_0009139 | 3300047444 | Bacteria | 6161 |
| 783 | Ga0495673_0001205 | 3300047469 | Bacteria | 21534 |
| 784 | Ga0495684_0000598 | 3300047471 | Bacteria | 29035 |
| 785 | Ga0495684_0005984 | 3300047471 | Bacteria | 9451 |
| 786 | Ga0495686_0003330 | 3300047472 | Bacteria | 14025 |
| 787 | Ga0495686_0058912 | 3300047472 | Bacteria | 2393 |
| 788 | Ga0495593_0015763 | 3300047673 | Bacteria | 4272 |
| 789 | Ga0495593_0050767 | 3300047673 | Bacteria | 2196 |
| 790 | Ga0495602_0002949 | 3300048088 | Bacteria | 17454 |
| 791 | Ga0495602_0130474 | 3300048088 | Bacteria | 2005 |
| 792 | Ga0495614_0001554 | 3300048089 | Bacteria | 9962 |
| 793 | Ga0496100_0004799 | 3300048903 | Bacteria | 7220 |
| 794 | Ga0496100_0006150 | 3300048903 | Bacteria | 6531 |
| 795 | Ga0496100_0009450 | 3300048903 | Bacteria | 5482 |
| 796 | Ga0496100_0042136 | 3300048903 | Bacteria | 2914 |
| 797 | Ga0496100_0083030 | 3300048903 | Bacteria | 2168 |
| 798 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 799 | Ga0496101_0001613 | 3300048904 | Bacteria | 13562 |
| 800 | Ga0496101_0056770 | 3300048904 | Bacteria | 2830 |
| 801 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 802 | Ga0496102_0000590 | 3300048905 | Bacteria | 38332 |
| 803 | Ga0496102_0001309 | 3300048905 | Bacteria | 22360 |
| 804 | Ga0496102_0010316 | 3300048905 | Bacteria | 8034 |
| 805 | Ga0496102_0029162 | 3300048905 | Bacteria | 4935 |
| 806 | Ga0496102_0073674 | 3300048905 | Bacteria | 3138 |
| 807 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 808 | Ga0496103_0015572 | 3300048906 | Bacteria | 4529 |
| 809 | Ga0496103_0019054 | 3300048906 | Bacteria | 4120 |
| 810 | Ga0496103_0041252 | 3300048906 | Bacteria | 2837 |
| 811 | Ga0496103_0074244 | 3300048906 | Bacteria | 2131 |
| 812 | Ga0496103_0156782 | 3300048906 | Bacteria | 1459 |
| 813 | Ga0496104_0010504 | 3300048907 | Bacteria | 8271 |
| 814 | Ga0496104_0011782 | 3300048907 | Bacteria | 7846 |
| 815 | Ga0496104_0020133 | 3300048907 | Bacteria | 6112 |
| 816 | Ga0496104_0091076 | 3300048907 | Bacteria | 2914 |
| 817 | Ga0496104_0187398 | 3300048907 | Bacteria | 1980 |
| 818 | Ga0496104_0323470 | 3300048907 | Bacteria | 1455 |
| 819 | Ga0496105_0015872 | 3300048908 | Bacteria | 6008 |
| 820 | Ga0496105_0031392 | 3300048908 | Bacteria | 4355 |
| 821 | Ga0496105_0057685 | 3300048908 | Bacteria | 3205 |
| 822 | Ga0496105_0182583 | 3300048908 | Bacteria | 1718 |
| 823 | Ga0496106_0002503 | 3300048909 | Bacteria | 13678 |
| 824 | Ga0496106_0003195 | 3300048909 | Bacteria | 12259 |
| 825 | Ga0496106_0003386 | 3300048909 | Bacteria | 11881 |
| 826 | Ga0496106_0028783 | 3300048909 | Bacteria | 4139 |
| 827 | Ga0496106_0065366 | 3300048909 | Bacteria | 2769 |
| 828 | Ga0496106_0107582 | 3300048909 | Bacteria | 2169 |
| 829 | Ga0496107_0000321 | 3300048910 | Bacteria | 25887 |
| 830 | Ga0496107_0003559 | 3300048910 | Bacteria | 10431 |
| 831 | Ga0496107_0011486 | 3300048910 | Bacteria | 6170 |
| 832 | Ga0496107_0016357 | 3300048910 | Bacteria | 5206 |
| 833 | Ga0496107_0040227 | 3300048910 | Bacteria | 3355 |
| 834 | Ga0496107_0041137 | 3300048910 | Bacteria | 3318 |
| 835 | Ga0496107_0074185 | 3300048910 | Bacteria | 2475 |
| 836 | Ga0496108_0000645 | 3300048911 | Bacteria | 27126 |
| 837 | Ga0496108_0020996 | 3300048911 | Bacteria | 5368 |
| 838 | Ga0496108_0021599 | 3300048911 | Bacteria | 5289 |
| 839 | Ga0496108_0028914 | 3300048911 | Bacteria | 4587 |
| 840 | Ga0496108_0093677 | 3300048911 | Bacteria | 2555 |
| 841 | Ga0496108_0127244 | 3300048911 | Bacteria | 2188 |
| 842 | Ga0496108_0132006 | 3300048911 | Bacteria | 2147 |
| 843 | Ga0496108_0143694 | 3300048911 | Bacteria | 2056 |
| 844 | Ga0496109_0016603 | 3300048912 | Bacteria | 6438 |
| 845 | Ga0496109_0024888 | 3300048912 | Bacteria | 5329 |
| 846 | Ga0496109_0053112 | 3300048912 | Bacteria | 3694 |
| 847 | Ga0496109_0280463 | 3300048912 | Bacteria | 1570 |
| 848 | Ga0496110_0002173 | 3300048913 | Bacteria | 14645 |
| 849 | Ga0496110_0034997 | 3300048913 | Bacteria | 4354 |
| 850 | Ga0496110_0039235 | 3300048913 | Bacteria | 4123 |
| 851 | Ga0496110_0209617 | 3300048913 | Bacteria | 1771 |
| 852 | Ga0496110_0231112 | 3300048913 | Bacteria | 1682 |
| 853 | Ga0496111_0025718 | 3300048914 | Bacteria | 4154 |
| 854 | Ga0496111_0031195 | 3300048914 | Bacteria | 3795 |
| 855 | Ga0496111_0043019 | 3300048914 | Bacteria | 3245 |
| 856 | Ga0496111_0072558 | 3300048914 | Bacteria | 2505 |
| 857 | Ga0496111_0078746 | 3300048914 | Bacteria | 2403 |
| 858 | Ga0496111_0117387 | 3300048914 | Bacteria | 1963 |
| 859 | Ga0496112_0005708 | 3300048915 | Bacteria | 10813 |
| 860 | Ga0496112_0117982 | 3300048915 | Bacteria | 2624 |
| 861 | Ga0496113_0013407 | 3300048916 | Bacteria | 5553 |
| 862 | Ga0496113_0032813 | 3300048916 | Bacteria | 3775 |
| 863 | Ga0496113_0121038 | 3300048916 | Bacteria | 2046 |
| 864 | Ga0496114_0000495 | 3300048917 | Bacteria | 28787 |
| 865 | Ga0496114_0002288 | 3300048917 | Bacteria | 14597 |
| 866 | Ga0496114_0032144 | 3300048917 | Bacteria | 4318 |
| 867 | Ga0496114_0041127 | 3300048917 | Bacteria | 3830 |
| 868 | Ga0496115_0001075 | 3300048918 | Bacteria | 19794 |
| 869 | Ga0496115_0003085 | 3300048918 | Bacteria | 11965 |
| 870 | Ga0496115_0014339 | 3300048918 | Bacteria | 6000 |
| 871 | Ga0496115_0101112 | 3300048918 | Bacteria | 2363 |
| 872 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 873 | Ga0496116_0000166 | 3300048919 | Bacteria | 133474 |
| 874 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 875 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 876 | Ga0496118_0051275 | 3300048921 | Bacteria | 3158 |
| 877 | Ga0496119_0000454 | 3300048922 | Bacteria | 56086 |
| 878 | Ga0496119_0060786 | 3300048922 | Bacteria | 2260 |
| 879 | Ga0496119_0072685 | 3300048922 | Bacteria | 2008 |
| 880 | Ga0496120_0001962 | 3300048923 | Bacteria | 22491 |
| 881 | Ga0496120_0006298 | 3300048923 | Bacteria | 9148 |
| 882 | Ga0496121_0000177 | 3300048924 | Bacteria | 141456 |
| 883 | Ga0496125_0016319 | 3300048928 | Bacteria | 7136 |
| 884 | Ga0496126_0001113 | 3300048929 | Bacteria | 45012 |
| 885 | Ga0501034_0127982 | 3300049571 | Bacteria | 2524 |
| 886 | Ga0501038_0121932 | 3300049574 | Bacteria | 2149 |
| 887 | Ga0501067_0004530 | 3300049583 | Bacteria | 7678 |
| 888 | Ga0501068_0110415 | 3300049584 | Bacteria | 1709 |
| 889 | Ga0501070_0040248 | 3300049586 | Bacteria | 3897 |
| 890 | Ga0501073_0100478 | 3300049589 | Bacteria | 2008 |
| 891 | Ga0501074_0062711 | 3300049590 | Bacteria | 2677 |
| 892 | Ga0501074_0133790 | 3300049590 | Bacteria | 1773 |
| 893 | Ga0501077_0028597 | 3300049593 | Bacteria | 3543 |
| 894 | Ga0501080_0516152 | 3300049742 | Bacteria | 1066 |
| 895 | Ga0501083_0016126 | 3300049744 | Bacteria | 5233 |
| 896 | Ga0501083_0038734 | 3300049744 | Bacteria | 3239 |
| 897 | Ga0501044_0196617 | 3300049823 | Bacteria | 1976 |
| 898 | nmdc:mga03683_3552_c1 | 3300050489 | Bacteria | 5050 |
| 899 | nmdc:mga03n38_17725_c1 | 3300050490 | Bacteria | 2795 |
| 900 | nmdc:mga03n38_7306_c1 | 3300050490 | Bacteria | 3903 |
| 901 | nmdc:mga03n38_9110_c1 | 3300050490 | Bacteria | 3593 |
| 902 | nmdc:mga00v17_1369_c1 | 3300050491 | Bacteria | 12779 |
| 903 | nmdc:mga00v17_17742_c2 | 3300050491 | Bacteria | 3508 |
| 904 | nmdc:mga00v17_5888_c1 | 3300050491 | Bacteria | 6476 |
| 905 | nmdc:mga0yw44_15068_c1 | 3300050492 | Bacteria | 4128 |
| 906 | nmdc:mga0yw44_64861_c1 | 3300050492 | Bacteria | 2249 |
| 907 | nmdc:mga07m45_24287_c1 | 3300050496 | Bacteria | 3319 |
| 908 | nmdc:mga07m45_69649_c1 | 3300050496 | Bacteria | 2000 |
| 909 | nmdc:mga05p37_11253_c1 | 3300050507 | Bacteria | 10641 |
| 910 | nmdc:mga05p37_47560_c1 | 3300050507 | Bacteria | 5275 |
| 911 | nmdc:mga05p37_87829_c1 | 3300050507 | Bacteria | 3833 |
| 912 | nmdc:mga09592_86124_c1 | 3300050508 | Bacteria | 2681 |
| 913 | nmdc:mga08y16_140196_c1 | 3300050511 | Bacteria | 2514 |
| 914 | nmdc:mga0n895_16162_c1 | 3300050512 | Bacteria | 6841 |
| 915 | nmdc:mga0n895_17799_c1 | 3300050512 | Bacteria | 6560 |
| 916 | nmdc:mga0n895_213832_c1 | 3300050512 | Bacteria | 1958 |
| 917 | nmdc:mga0n895_39305_c1 | 3300050512 | Bacteria | 4590 |
| 918 | nmdc:mga0rr50_3260_c1 | 3300050513 | Bacteria | 9300 |
| 919 | nmdc:mga0a205_2637_c1 | 3300050515 | Bacteria | 15841 |
| 920 | nmdc:mga0sz30_3201_c1 | 3300050516 | Bacteria | 5873 |
| 921 | nmdc:mga0sz30_42494_c1 | 3300050516 | Bacteria | 1912 |
| 922 | nmdc:mga0sz30_88335_c1 | 3300050516 | Bacteria | 1347 |
| 923 | Ga0495601_0015602 | 3300053077 | Bacteria | 4592 |
| 924 | Ga0495601_0085524 | 3300053077 | Unclassified | 2026 |
| 925 | Ga0495612_0008199 | 3300053078 | Bacteria | 4245 |
| 926 | Ga0500635_0004952 | 3300053080 | Bacteria | 3464 |
| 927 | Ga0495655_0001501 | 3300053083 | Bacteria | 3589 |
| 928 | Ga0495595_0002988 | 3300053084 | Bacteria | 6681 |
| 929 | Ga0495595_0024353 | 3300053084 | Bacteria | 2674 |
| 930 | Ga0495619_0001449 | 3300053085 | Bacteria | 15619 |
| 931 | Ga0495619_0037454 | 3300053085 | Bacteria | 3161 |
| 932 | Ga0495619_0046837 | 3300053085 | Bacteria | 2845 |
| 933 | Ga0495619_0063206 | 3300053085 | Bacteria | 2466 |
| 934 | Ga0500643_001154 | 3300053087 | Bacteria | 15747 |
| 935 | Ga0500643_001862 | 3300053087 | Bacteria | 11500 |
| 936 | Ga0500643_006474 | 3300053087 | Bacteria | 4886 |
| 937 | Ga0500643_007970 | 3300053087 | Bacteria | 4207 |
| 938 | Ga0500556_0001572 | 3300053104 | Bacteria | 9240 |
| 939 | Ga0500562_005490 | 3300053108 | Bacteria | 3182 |
| 940 | Ga0500652_007547 | 3300053131 | Bacteria | 3567 |
| 941 | Ga0500645_000035 | 3300053730 | Bacteria | 113679 |
| 942 | Ga0501082_0022336 | 3300060353 | Bacteria | 5450 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0127982 | Ga0501034_0127982_1505_2509 | 316 |
| 2 | 3300050516 | nmdc:mga0sz30_88335_c1 | nmdc:mga0sz30_88335_c1_294_1298 | 318 |
| 3 | 3300049742 | Ga0501080_0516152 | Ga0501080_0516152_17_1021 | 321 |
| 4 | 3300050516 | nmdc:mga0sz30_42494_c1 | nmdc:mga0sz30_42494_c1_32_1114 | 344 |
| 5 | 3300050489 | nmdc:mga03683_3552_c1 | nmdc:mga03683_3552_c1_23_1120 | 345 |
| 6 | 3300046474 | Ga0495605_0139752 | Ga0495605_0139752_31_1077 | 346 |
| 7 | 3300046794 | Ga0495589_0007696 | Ga0495589_0007696_2503_3549 | 346 |
| 8 | 3300046473 | Ga0495582_0155062 | Ga0495582_0155062_53_1246 | 352 |
| 9 | 3300005843 | Ga0068860_100115207 | Ga0068860_1001152071 | 354 |
| 10 | 3300046518 | Ga0495631_0051413 | Ga0495631_0051413_45_1247 | 358 |
| 11 | 3300046663 | Ga0495635_0173446 | Ga0495635_0173446_349_1440 | 360 |
| 12 | 3300025945 | Ga0207679_10169321 | Ga0207679_101693212 | 364 |
| 13 | 3300053083 | Ga0495655_0001501 | Ga0495655_0001501_93_1424 | 365 |
| 14 | 3300046491 | Ga0495584_0089727 | Ga0495584_0089727_31_1362 | 368 |
| 15 | 3300005331 | Ga0070670_100088619 | Ga0070670_1000886192 | 370 |
| 16 | 3300046538 | Ga0495609_0051361 | Ga0495609_0051361_378_1712 | 370 |
| 17 | 3300046539 | Ga0495621_0023587 | Ga0495621_0023587_335_1669 | 370 |
| 18 | 3300046690 | Ga0495624_0086899 | Ga0495624_0086899_159_1487 | 375 |
| 19 | 3300046476 | Ga0495662_0027687 | Ga0495662_0027687_219_1565 | 376 |
| 20 | 3300046681 | Ga0495647_0058534 | Ga0495647_0058534_111_1463 | 378 |
| 21 | 3300005338 | Ga0068868_100014372 | Ga0068868_1000143725 | 379 |
| 22 | 3300005356 | Ga0070674_100002482 | Ga0070674_10000248210 | 379 |
| 23 | 3300005440 | Ga0070705_100018343 | Ga0070705_1000183433 | 379 |
| 24 | 3300005444 | Ga0070694_100041620 | Ga0070694_1000416202 | 379 |
| 25 | 3300005459 | Ga0068867_100002000 | Ga0068867_1000020008 | 379 |
| 26 | 3300005468 | Ga0070707_100140216 | Ga0070707_1001402161 | 379 |
| 27 | 3300005545 | Ga0070695_100010024 | Ga0070695_1000100244 | 379 |
| 28 | 3300005549 | Ga0070704_100004595 | Ga0070704_1000045954 | 379 |
| 29 | 3300005615 | Ga0070702_100148897 | Ga0070702_1001488972 | 379 |
| 30 | 3300005842 | Ga0068858_100071177 | Ga0068858_1000711771 | 379 |
| 31 | 3300006237 | Ga0097621_100073596 | Ga0097621_1000735963 | 379 |
| 32 | 3300006358 | Ga0068871_100018339 | Ga0068871_1000183393 | 379 |
| 33 | 3300006881 | Ga0068865_100029811 | Ga0068865_1000298114 | 379 |
| 34 | 3300009101 | Ga0105247_10069989 | Ga0105247_100699892 | 379 |
| 35 | 3300009176 | Ga0105242_10002528 | Ga0105242_100025289 | 379 |
| 36 | 3300009177 | Ga0105248_10025304 | Ga0105248_100253046 | 379 |
| 37 | 3300010375 | Ga0105239_10059987 | Ga0105239_100599874 | 379 |
| 38 | 3300011119 | Ga0105246_10066414 | Ga0105246_100664142 | 379 |
| 39 | 3300013104 | Ga0157370_10030713 | Ga0157370_100307134 | 379 |
| 40 | 3300013296 | Ga0157374_10035561 | Ga0157374_100355615 | 379 |
| 41 | 3300013306 | Ga0163162_10174064 | Ga0163162_101740642 | 379 |
| 42 | 3300013308 | Ga0157375_10042351 | Ga0157375_100423512 | 379 |
| 43 | 3300014325 | Ga0163163_10008170 | Ga0163163_100081702 | 379 |
| 44 | 3300014968 | Ga0157379_10004932 | Ga0157379_100049325 | 379 |
| 45 | 3300014969 | Ga0157376_10023837 | Ga0157376_100238374 | 379 |
| 46 | 3300025934 | Ga0207686_10005839 | Ga0207686_100058394 | 379 |
| 47 | 3300025937 | Ga0207669_10058311 | Ga0207669_100583112 | 379 |
| 48 | 3300025938 | Ga0207704_10044070 | Ga0207704_100440702 | 379 |
| 49 | 3300025939 | Ga0207665_10073331 | Ga0207665_100733312 | 379 |
| 50 | 3300025949 | Ga0207667_10107381 | Ga0207667_101073812 | 379 |
| 51 | 3300026035 | Ga0207703_10053855 | Ga0207703_100538551 | 379 |
| 52 | 3300026089 | Ga0207648_10004217 | Ga0207648_100042177 | 379 |
| 53 | 3300026116 | Ga0207674_10150848 | Ga0207674_101508482 | 379 |
| 54 | 3300048903 | Ga0496100_0083030 | Ga0496100_0083030_725_2014 | 379 |
| 55 | 3300048905 | Ga0496102_0010316 | Ga0496102_0010316_2965_4290 | 379 |
| 56 | 3300048906 | Ga0496103_0156782 | Ga0496103_0156782_34_1359 | 379 |
| 57 | 3300048907 | Ga0496104_0020133 | Ga0496104_0020133_2854_4143 | 379 |
| 58 | 3300048908 | Ga0496105_0015872 | Ga0496105_0015872_2311_3600 | 379 |
| 59 | 3300048911 | Ga0496108_0020996 | Ga0496108_0020996_2399_3688 | 379 |
| 60 | 3300048913 | Ga0496110_0002173 | Ga0496110_0002173_3282_4571 | 379 |
| 61 | 3300048914 | Ga0496111_0043019 | Ga0496111_0043019_1143_2432 | 379 |
| 62 | 3300048916 | Ga0496113_0013407 | Ga0496113_0013407_3548_4837 | 379 |
| 63 | 3300049584 | Ga0501068_0110415 | Ga0501068_0110415_29_1207 | 379 |
| 64 | 3300049586 | Ga0501070_0040248 | Ga0501070_0040248_1415_2704 | 379 |
| 65 | 3300049589 | Ga0501073_0100478 | Ga0501073_0100478_538_1827 | 379 |
| 66 | 3300049590 | Ga0501074_0062711 | Ga0501074_0062711_1317_2606 | 379 |
| 67 | 3300060353 | Ga0501082_0022336 | Ga0501082_0022336_1480_2769 | 379 |
| 68 | 3300005434 | Ga0070709_10173787 | Ga0070709_101737872 | 380 |
| 69 | 3300025928 | Ga0207700_10026919 | Ga0207700_100269192 | 380 |
| 70 | 3300035172 | Ga0373955_0021637 | Ga0373955_0021637_1615_2904 | 380 |
| 71 | 3300035410 | Ga0373924_0008387 | Ga0373924_0008387_2447_3736 | 380 |
| 72 | 3300036401 | Ga0373937_0065515 | Ga0373937_0065515_670_1959 | 380 |
| 73 | 3300045976 | Ga0466967_0158221 | Ga0466967_0158221_58_1326 | 380 |
| 74 | 3300046454 | Ga0495592_0000455 | Ga0495592_0000455_15091_16380 | 380 |
| 75 | 3300046462 | Ga0495651_0000174 | Ga0495651_0000174_13444_14733 | 380 |
| 76 | 3300046463 | Ga0495653_0000414 | Ga0495653_0000414_93_1382 | 380 |
| 77 | 3300046477 | Ga0495664_0136094 | Ga0495664_0136094_152_1441 | 380 |
| 78 | 3300046511 | Ga0495608_0000410 | Ga0495608_0000410_17204_18493 | 380 |
| 79 | 3300046514 | Ga0495618_0039001 | Ga0495618_0039001_501_1790 | 380 |
| 80 | 3300046516 | Ga0495628_0000444 | Ga0495628_0000444_25113_26402 | 380 |
| 81 | 3300046529 | Ga0495652_0000665 | Ga0495652_0000665_13468_14757 | 380 |
| 82 | 3300046531 | Ga0495665_0061076 | Ga0495665_0061076_284_1573 | 380 |
| 83 | 3300046533 | Ga0495640_0006097 | Ga0495640_0006097_1495_2784 | 380 |
| 84 | 3300046536 | Ga0495587_0002878 | Ga0495587_0002878_2685_3974 | 380 |
| 85 | 3300046543 | Ga0495645_0001127 | Ga0495645_0001127_12571_13860 | 380 |
| 86 | 3300046559 | Ga0495667_0000117 | Ga0495667_0000117_31104_32393 | 380 |
| 87 | 3300046642 | Ga0495634_0001586 | Ga0495634_0001586_14707_15996 | 380 |
| 88 | 3300046675 | Ga0495657_0006991 | Ga0495657_0006991_3569_4858 | 380 |
| 89 | 3300046678 | Ga0495599_0000185 | Ga0495599_0000185_25112_26401 | 380 |
| 90 | 3300046680 | Ga0495646_0000628 | Ga0495646_0000628_16509_17798 | 380 |
| 91 | 3300046809 | Ga0495600_0014669 | Ga0495600_0014669_2717_4006 | 380 |
| 92 | 3300047317 | Ga0495604_0016061 | Ga0495604_0016061_2010_3299 | 380 |
| 93 | 3300047319 | Ga0495674_0000984 | Ga0495674_0000984_13470_14759 | 380 |
| 94 | 3300047322 | Ga0495680_0000401 | Ga0495680_0000401_32875_34164 | 380 |
| 95 | 3300047444 | Ga0495675_0009139 | Ga0495675_0009139_3636_4925 | 380 |
| 96 | 3300047471 | Ga0495684_0000598 | Ga0495684_0000598_2647_3936 | 380 |
| 97 | 3300048088 | Ga0495602_0002949 | Ga0495602_0002949_2694_3983 | 380 |
| 98 | 3300053077 | Ga0495601_0085524 | Ga0495601_0085524_110_1399 | 380 |
| 99 | 3300005436 | Ga0070713_100023985 | Ga0070713_1000239852 | 381 |
| 100 | 3300006028 | Ga0070717_10007851 | Ga0070717_100078514 | 381 |
| 101 | 3300025928 | Ga0207700_10055669 | Ga0207700_100556692 | 381 |
| 102 | 3300037466 | Ga0395898_0019979 | Ga0395898_0019979_4380_5738 | 381 |
| 103 | 3300047319 | Ga0495674_0050652 | Ga0495674_0050652_2217_3476 | 381 |
| 104 | 3300005441 | Ga0070700_100018846 | Ga0070700_1000188461 | 382 |
| 105 | 3300013307 | Ga0157372_10341252 | Ga0157372_103412522 | 382 |
| 106 | 3300044683 | Ga0466965_0002177 | Ga0466965_0002177_3501_4754 | 382 |
| 107 | 3300044735 | Ga0466968_0001088 | Ga0466968_0001088_867_2120 | 382 |
| 108 | 3300044765 | Ga0466970_0016640 | Ga0466970_0016640_1925_3178 | 382 |
| 109 | 3300045049 | Ga0466959_0027893 | Ga0466959_0027893_499_1752 | 382 |
| 110 | 3300049574 | Ga0501038_0121932 | Ga0501038_0121932_799_2091 | 382 |
| 111 | 3300006028 | Ga0070717_10064802 | Ga0070717_100648023 | 383 |
| 112 | 3300009177 | Ga0105248_10044839 | Ga0105248_100448392 | 383 |
| 113 | 3300031995 | Ga0307409_100226090 | Ga0307409_1002260902 | 383 |
| 114 | 3300048903 | Ga0496100_0006150 | Ga0496100_0006150_760_2016 | 383 |
| 115 | 3300048907 | Ga0496104_0010504 | Ga0496104_0010504_2940_4196 | 383 |
| 116 | 3300048909 | Ga0496106_0003195 | Ga0496106_0003195_5466_6722 | 383 |
| 117 | 3300048910 | Ga0496107_0003559 | Ga0496107_0003559_3635_4891 | 383 |
| 118 | 3300048917 | Ga0496114_0002288 | Ga0496114_0002288_9086_10342 | 383 |
| 119 | 3300005548 | Ga0070665_100001745 | Ga0070665_10000174525 | 384 |
| 120 | 3300009176 | Ga0105242_10000620 | Ga0105242_1000062013 | 384 |
| 121 | 3300028379 | Ga0268266_10007843 | Ga0268266_100078433 | 384 |
| 122 | 3300048906 | Ga0496103_0019054 | Ga0496103_0019054_2808_4076 | 384 |
| 123 | 3300048908 | Ga0496105_0031392 | Ga0496105_0031392_126_1427 | 384 |
| 124 | 3300005337 | Ga0070682_100049408 | Ga0070682_1000494082 | 385 |
| 125 | 3300005339 | Ga0070660_100188515 | Ga0070660_1001885152 | 385 |
| 126 | 3300005535 | Ga0070684_100031025 | Ga0070684_1000310252 | 385 |
| 127 | 3300005548 | Ga0070665_100096225 | Ga0070665_1000962251 | 385 |
| 128 | 3300005616 | Ga0068852_100156097 | Ga0068852_1001560972 | 385 |
| 129 | 3300006048 | Ga0075363_100077904 | Ga0075363_1000779042 | 385 |
| 130 | 3300009098 | Ga0105245_10107688 | Ga0105245_101076882 | 385 |
| 131 | 3300009098 | Ga0105245_10171307 | Ga0105245_101713072 | 385 |
| 132 | 3300010375 | Ga0105239_10228472 | Ga0105239_102284722 | 385 |
| 133 | 3300025929 | Ga0207664_10021830 | Ga0207664_100218303 | 385 |
| 134 | 3300025938 | Ga0207704_10132560 | Ga0207704_101325602 | 385 |
| 135 | 3300025944 | Ga0207661_10082020 | Ga0207661_100820202 | 385 |
| 136 | 3300026142 | Ga0207698_10205597 | Ga0207698_102055972 | 385 |
| 137 | 3300037853 | Ga0436364_0485851 | Ga0436364_0485851_638_1960 | 385 |
| 138 | 3300047322 | Ga0495680_0167712 | Ga0495680_0167712_104_1405 | 385 |
| 139 | 3300048911 | Ga0496108_0143694 | Ga0496108_0143694_526_1809 | 385 |
| 140 | 3300048912 | Ga0496109_0280463 | Ga0496109_0280463_166_1449 | 385 |
| 141 | 3300048914 | Ga0496111_0117387 | Ga0496111_0117387_259_1542 | 385 |
| 142 | 3300005937 | Ga0081455_10001614 | Ga0081455_1000161416 | 386 |
| 143 | 3300046472 | Ga0495580_0206685 | Ga0495580_0206685_32_1333 | 386 |
| 144 | 3300005334 | Ga0068869_100011909 | Ga0068869_1000119094 | 387 |
| 145 | 3300005338 | Ga0068868_100000529 | Ga0068868_10000052914 | 387 |
| 146 | 3300005341 | Ga0070691_10011823 | Ga0070691_100118232 | 387 |
| 147 | 3300005347 | Ga0070668_100005441 | Ga0070668_1000054415 | 387 |
| 148 | 3300005355 | Ga0070671_100010460 | Ga0070671_1000104602 | 387 |
| 149 | 3300005356 | Ga0070674_100003430 | Ga0070674_1000034303 | 387 |
| 150 | 3300005365 | Ga0070688_100005859 | Ga0070688_1000058593 | 387 |
| 151 | 3300005367 | Ga0070667_100002267 | Ga0070667_10000226711 | 387 |
| 152 | 3300005434 | Ga0070709_10022973 | Ga0070709_100229733 | 387 |
| 153 | 3300005437 | Ga0070710_10000900 | Ga0070710_1000090012 | 387 |
| 154 | 3300005438 | Ga0070701_10003486 | Ga0070701_100034864 | 387 |
| 155 | 3300005439 | Ga0070711_100001095 | Ga0070711_1000010952 | 387 |
| 156 | 3300005440 | Ga0070705_100038364 | Ga0070705_1000383642 | 387 |
| 157 | 3300005456 | Ga0070678_100009361 | Ga0070678_1000093616 | 387 |
| 158 | 3300005457 | Ga0070662_100017040 | Ga0070662_1000170404 | 387 |
| 159 | 3300005459 | Ga0068867_100001323 | Ga0068867_1000013237 | 387 |
| 160 | 3300005466 | Ga0070685_10050343 | Ga0070685_100503432 | 387 |
| 161 | 3300005539 | Ga0068853_100008397 | Ga0068853_1000083977 | 387 |
| 162 | 3300005546 | Ga0070696_100003305 | Ga0070696_1000033059 | 387 |
| 163 | 3300005547 | Ga0070693_100001858 | Ga0070693_1000018582 | 387 |
| 164 | 3300005548 | Ga0070665_100022355 | Ga0070665_1000223556 | 387 |
| 165 | 3300005549 | Ga0070704_100000706 | Ga0070704_1000007062 | 387 |
| 166 | 3300005563 | Ga0068855_100076751 | Ga0068855_1000767512 | 387 |
| 167 | 3300005578 | Ga0068854_100005243 | Ga0068854_1000052437 | 387 |
| 168 | 3300005615 | Ga0070702_100001404 | Ga0070702_1000014048 | 387 |
| 169 | 3300005617 | Ga0068859_100003134 | Ga0068859_1000031347 | 387 |
| 170 | 3300005718 | Ga0068866_10000376 | Ga0068866_1000037620 | 387 |
| 171 | 3300005842 | Ga0068858_100002465 | Ga0068858_1000024651 | 387 |
| 172 | 3300005843 | Ga0068860_100025928 | Ga0068860_1000259282 | 387 |
| 173 | 3300006048 | Ga0075363_100060987 | Ga0075363_1000609872 | 387 |
| 174 | 3300006173 | Ga0070716_100002661 | Ga0070716_1000026616 | 387 |
| 175 | 3300006175 | Ga0070712_100001062 | Ga0070712_10000106216 | 387 |
| 176 | 3300006237 | Ga0097621_100015140 | Ga0097621_1000151402 | 387 |
| 177 | 3300006358 | Ga0068871_100189674 | Ga0068871_1001896742 | 387 |
| 178 | 3300006881 | Ga0068865_100000828 | Ga0068865_1000008282 | 387 |
| 179 | 3300006931 | Ga0097620_100003133 | Ga0097620_10000313312 | 387 |
| 180 | 3300009098 | Ga0105245_10003220 | Ga0105245_100032204 | 387 |
| 181 | 3300009101 | Ga0105247_10000334 | Ga0105247_100003342 | 387 |
| 182 | 3300009147 | Ga0114129_10223859 | Ga0114129_102238592 | 387 |
| 183 | 3300009148 | Ga0105243_10005418 | Ga0105243_100054182 | 387 |
| 184 | 3300009174 | Ga0105241_10019951 | Ga0105241_100199512 | 387 |
| 185 | 3300009545 | Ga0105237_10034235 | Ga0105237_100342354 | 387 |
| 186 | 3300009553 | Ga0105249_10000767 | Ga0105249_1000076717 | 387 |
| 187 | 3300011119 | Ga0105246_10140320 | Ga0105246_101403202 | 387 |
| 188 | 3300013297 | Ga0157378_10001690 | Ga0157378_1000169016 | 387 |
| 189 | 3300013308 | Ga0157375_10003452 | Ga0157375_1000345213 | 387 |
| 190 | 3300013308 | Ga0157375_10122797 | Ga0157375_101227973 | 387 |
| 191 | 3300014326 | Ga0157380_10003813 | Ga0157380_100038134 | 387 |
| 192 | 3300014745 | Ga0157377_10122128 | Ga0157377_101221282 | 387 |
| 193 | 3300014969 | Ga0157376_10083979 | Ga0157376_100839792 | 387 |
| 194 | 3300025899 | Ga0207642_10002962 | Ga0207642_100029622 | 387 |
| 195 | 3300025900 | Ga0207710_10001088 | Ga0207710_100010883 | 387 |
| 196 | 3300025901 | Ga0207688_10000352 | Ga0207688_1000035216 | 387 |
| 197 | 3300025915 | Ga0207693_10001171 | Ga0207693_100011717 | 387 |
| 198 | 3300025916 | Ga0207663_10005265 | Ga0207663_100052652 | 387 |
| 199 | 3300025927 | Ga0207687_10001147 | Ga0207687_1000114717 | 387 |
| 200 | 3300025928 | Ga0207700_10109651 | Ga0207700_101096512 | 387 |
| 201 | 3300025931 | Ga0207644_10103641 | Ga0207644_101036412 | 387 |
| 202 | 3300025932 | Ga0207690_10028152 | Ga0207690_100281522 | 387 |
| 203 | 3300025933 | Ga0207706_10001128 | Ga0207706_1000112826 | 387 |
| 204 | 3300025934 | Ga0207686_10002468 | Ga0207686_100024688 | 387 |
| 205 | 3300025935 | Ga0207709_10007186 | Ga0207709_100071866 | 387 |
| 206 | 3300025936 | Ga0207670_10127309 | Ga0207670_101273092 | 387 |
| 207 | 3300025938 | Ga0207704_10000377 | Ga0207704_1000037718 | 387 |
| 208 | 3300025939 | Ga0207665_10005772 | Ga0207665_100057723 | 387 |
| 209 | 3300025941 | Ga0207711_10108185 | Ga0207711_101081852 | 387 |
| 210 | 3300025942 | Ga0207689_10025969 | Ga0207689_100259693 | 387 |
| 211 | 3300025961 | Ga0207712_10006309 | Ga0207712_100063092 | 387 |
| 212 | 3300025972 | Ga0207668_10056080 | Ga0207668_100560802 | 387 |
| 213 | 3300025981 | Ga0207640_10003409 | Ga0207640_100034097 | 387 |
| 214 | 3300026035 | Ga0207703_10014135 | Ga0207703_100141352 | 387 |
| 215 | 3300026089 | Ga0207648_10001355 | Ga0207648_1000135519 | 387 |
| 216 | 3300026121 | Ga0207683_10000201 | Ga0207683_1000020140 | 387 |
| 217 | 3300028379 | Ga0268266_10188837 | Ga0268266_101888372 | 387 |
| 218 | 3300028380 | Ga0268265_10121015 | Ga0268265_101210152 | 387 |
| 219 | 3300028381 | Ga0268264_10114403 | Ga0268264_101144032 | 387 |
| 220 | 3300035691 | Ga0373931_0022723 | Ga0373931_0022723_890_2341 | 387 |
| 221 | 3300046455 | Ga0495603_0001901 | Ga0495603_0001901_11058_12254 | 387 |
| 222 | 3300046459 | Ga0495629_0190503 | Ga0495629_0190503_171_1370 | 387 |
| 223 | 3300046473 | Ga0495582_0036446 | Ga0495582_0036446_54_1340 | 387 |
| 224 | 3300048903 | Ga0496100_0004799 | Ga0496100_0004799_5326_6777 | 387 |
| 225 | 3300048904 | Ga0496101_0001613 | Ga0496101_0001613_577_2028 | 387 |
| 226 | 3300048905 | Ga0496102_0001309 | Ga0496102_0001309_12349_13800 | 387 |
| 227 | 3300048909 | Ga0496106_0002503 | Ga0496106_0002503_10656_12107 | 387 |
| 228 | 3300048910 | Ga0496107_0000321 | Ga0496107_0000321_13495_14946 | 387 |
| 229 | 3300048917 | Ga0496114_0000495 | Ga0496114_0000495_20995_22446 | 387 |
| 230 | 3300048918 | Ga0496115_0003085 | Ga0496115_0003085_4764_5987 | 387 |
| 231 | 3300049583 | Ga0501067_0004530 | Ga0501067_0004530_5701_6993 | 387 |
| 232 | 3300049590 | Ga0501074_0133790 | Ga0501074_0133790_297_1589 | 387 |
| 233 | 3300049593 | Ga0501077_0028597 | Ga0501077_0028597_505_1797 | 387 |
| 234 | 3300049744 | Ga0501083_0016126 | Ga0501083_0016126_3175_4467 | 387 |
| 235 | 3300046455 | Ga0495603_0122091 | Ga0495603_0122091_81_1382 | 388 |
| 236 | 3300046460 | Ga0495638_0002264 | Ga0495638_0002264_7663_8943 | 388 |
| 237 | 3300046530 | Ga0495654_0081550 | Ga0495654_0081550_280_1455 | 388 |
| 238 | 3300046692 | Ga0495671_0034988 | Ga0495671_0034988_564_1844 | 388 |
| 239 | 3300047319 | Ga0495674_0054886 | Ga0495674_0054886_1809_3110 | 388 |
| 240 | 3300053104 | Ga0500556_0001572 | Ga0500556_0001572_4725_6005 | 388 |
| 241 | 3300006048 | Ga0075363_100000787 | Ga0075363_1000007879 | 389 |
| 242 | 3300006051 | Ga0075364_10000184 | Ga0075364_1000018415 | 389 |
| 243 | 3300006051 | Ga0075364_10006965 | Ga0075364_100069652 | 389 |
| 244 | 3300006178 | Ga0075367_10001919 | Ga0075367_100019197 | 389 |
| 245 | 3300006353 | Ga0075370_10044383 | Ga0075370_100443832 | 389 |
| 246 | 3300025303 | Ga0209051_1028496 | Ga0209051_10284962 | 389 |
| 247 | 3300045976 | Ga0466967_0036069 | Ga0466967_0036069_2838_4088 | 389 |
| 248 | 3300045976 | Ga0466967_0113400 | Ga0466967_0113400_194_1426 | 389 |
| 249 | 3300048907 | Ga0496104_0011782 | Ga0496104_0011782_5794_7095 | 389 |
| 250 | 3300050490 | nmdc:mga03n38_9110_c1 | nmdc:mga03n38_9110_c1_1894_3174 | 389 |
| 251 | 3300050491 | nmdc:mga00v17_1369_c1 | nmdc:mga00v17_1369_c1_10169_11449 | 389 |
| 252 | 3300050491 | nmdc:mga00v17_5888_c1 | nmdc:mga00v17_5888_c1_2416_3696 | 389 |
| 253 | 3300050496 | nmdc:mga07m45_24287_c1 | nmdc:mga07m45_24287_c1_498_1778 | 389 |
| 254 | 3300005356 | Ga0070674_100021807 | Ga0070674_1000218073 | 390 |
| 255 | 3300005406 | Ga0070703_10000001 | Ga0070703_10000001122 | 390 |
| 256 | 3300005444 | Ga0070694_100033732 | Ga0070694_1000337322 | 390 |
| 257 | 3300005445 | Ga0070708_100001067 | Ga0070708_1000010671 | 390 |
| 258 | 3300005467 | Ga0070706_100010233 | Ga0070706_1000102338 | 390 |
| 259 | 3300005468 | Ga0070707_100008503 | Ga0070707_1000085035 | 390 |
| 260 | 3300005471 | Ga0070698_100051050 | Ga0070698_1000510504 | 390 |
| 261 | 3300005546 | Ga0070696_100005272 | Ga0070696_1000052723 | 390 |
| 262 | 3300005718 | Ga0068866_10013060 | Ga0068866_100130602 | 390 |
| 263 | 3300005719 | Ga0068861_100052331 | Ga0068861_1000523313 | 390 |
| 264 | 3300006048 | Ga0075363_100115160 | Ga0075363_1001151601 | 390 |
| 265 | 3300006186 | Ga0075369_10037641 | Ga0075369_100376412 | 390 |
| 266 | 3300006353 | Ga0075370_10033932 | Ga0075370_100339322 | 390 |
| 267 | 3300009098 | Ga0105245_10133233 | Ga0105245_101332332 | 390 |
| 268 | 3300009148 | Ga0105243_10007191 | Ga0105243_100071918 | 390 |
| 269 | 3300009176 | Ga0105242_10002226 | Ga0105242_100022263 | 390 |
| 270 | 3300009553 | Ga0105249_10053836 | Ga0105249_100538363 | 390 |
| 271 | 3300010375 | Ga0105239_10269472 | Ga0105239_102694722 | 390 |
| 272 | 3300013297 | Ga0157378_10018845 | Ga0157378_100188453 | 390 |
| 273 | 3300013306 | Ga0163162_10026392 | Ga0163162_100263922 | 390 |
| 274 | 3300025885 | Ga0207653_10000004 | Ga0207653_10000004123 | 390 |
| 275 | 3300025899 | Ga0207642_10030974 | Ga0207642_100309742 | 390 |
| 276 | 3300025910 | Ga0207684_10000911 | Ga0207684_1000091116 | 390 |
| 277 | 3300025922 | Ga0207646_10007478 | Ga0207646_1000747811 | 390 |
| 278 | 3300025934 | Ga0207686_10006248 | Ga0207686_100062483 | 390 |
| 279 | 3300025935 | Ga0207709_10034736 | Ga0207709_100347362 | 390 |
| 280 | 3300025937 | Ga0207669_10032348 | Ga0207669_100323482 | 390 |
| 281 | 3300025941 | Ga0207711_10165028 | Ga0207711_101650282 | 390 |
| 282 | 3300026118 | Ga0207675_100078529 | Ga0207675_1000785293 | 390 |
| 283 | 3300044683 | Ga0466965_0022873 | Ga0466965_0022873_1345_2673 | 390 |
| 284 | 3300048909 | Ga0496106_0065366 | Ga0496106_0065366_282_1595 | 390 |
| 285 | 3300048910 | Ga0496107_0040227 | Ga0496107_0040227_911_2224 | 390 |
| 286 | 3300048914 | Ga0496111_0025718 | Ga0496111_0025718_210_1523 | 390 |
| 287 | 3300053085 | Ga0495619_0063206 | Ga0495619_0063206_767_2038 | 390 |
| 288 | 3300005437 | Ga0070710_10073616 | Ga0070710_100736162 | 391 |
| 289 | 3300005439 | Ga0070711_100147979 | Ga0070711_1001479791 | 391 |
| 290 | 3300013306 | Ga0163162_10205789 | Ga0163162_102057892 | 391 |
| 291 | 3300047472 | Ga0495686_0058912 | Ga0495686_0058912_766_2019 | 391 |
| 292 | 3300048918 | Ga0496115_0101112 | Ga0496115_0101112_69_1379 | 391 |
| 293 | 3300053108 | Ga0500562_005490 | Ga0500562_005490_794_2074 | 391 |
| 294 | 3300053730 | Ga0500645_000035 | Ga0500645_000035_50657_51925 | 391 |
| 295 | 3300005435 | Ga0070714_100004478 | Ga0070714_1000044789 | 392 |
| 296 | 3300005436 | Ga0070713_100025930 | Ga0070713_1000259304 | 392 |
| 297 | 3300005439 | Ga0070711_100004296 | Ga0070711_1000042964 | 392 |
| 298 | 3300006175 | Ga0070712_100126999 | Ga0070712_1001269992 | 392 |
| 299 | 3300013105 | Ga0157369_10003613 | Ga0157369_1000361313 | 392 |
| 300 | 3300025915 | Ga0207693_10005402 | Ga0207693_1000540213 | 392 |
| 301 | 3300025916 | Ga0207663_10021617 | Ga0207663_100216172 | 392 |
| 302 | 3300025928 | Ga0207700_10029262 | Ga0207700_100292624 | 392 |
| 303 | 3300025929 | Ga0207664_10001029 | Ga0207664_100010292 | 392 |
| 304 | 3300028800 | Ga0265338_10011419 | Ga0265338_1001141910 | 392 |
| 305 | 3300031251 | Ga0265327_10008031 | Ga0265327_100080313 | 392 |
| 306 | 3300046455 | Ga0495603_0006218 | Ga0495603_0006218_2716_4050 | 392 |
| 307 | 3300048906 | Ga0496103_0041252 | Ga0496103_0041252_1026_2387 | 392 |
| 308 | 3300048907 | Ga0496104_0187398 | Ga0496104_0187398_485_1786 | 392 |
| 309 | 3300048908 | Ga0496105_0057685 | Ga0496105_0057685_219_1580 | 392 |
| 310 | 3300048910 | Ga0496107_0074185 | Ga0496107_0074185_969_2330 | 392 |
| 311 | 3300048911 | Ga0496108_0021599 | Ga0496108_0021599_3167_4528 | 392 |
| 312 | 3300048911 | Ga0496108_0132006 | Ga0496108_0132006_590_1879 | 392 |
| 313 | 3300048912 | Ga0496109_0053112 | Ga0496109_0053112_486_1847 | 392 |
| 314 | 3300048913 | Ga0496110_0034997 | Ga0496110_0034997_2900_4261 | 392 |
| 315 | 3300048914 | Ga0496111_0078746 | Ga0496111_0078746_144_1505 | 392 |
| 316 | 3300048915 | Ga0496112_0117982 | Ga0496112_0117982_52_1413 | 392 |
| 317 | 3300048917 | Ga0496114_0041127 | Ga0496114_0041127_333_1694 | 392 |
| 318 | 3300048918 | Ga0496115_0001075 | Ga0496115_0001075_13844_15145 | 392 |
| 319 | 3300048918 | Ga0496115_0014339 | Ga0496115_0014339_1921_3282 | 392 |
| 320 | 3300048919 | Ga0496116_0000166 | Ga0496116_0000166_120358_121680 | 392 |
| 321 | 3300048922 | Ga0496119_0000454 | Ga0496119_0000454_11694_13016 | 392 |
| 322 | 3300053087 | Ga0500643_007970 | Ga0500643_007970_1202_2527 | 392 |
| 323 | 3300004800 | Ga0058861_11975033 | Ga0058861_119750332 | 393 |
| 324 | 3300004803 | Ga0058862_10034740 | Ga0058862_100347401 | 393 |
| 325 | 3300005441 | Ga0070700_100049200 | Ga0070700_1000492002 | 393 |
| 326 | 3300005719 | Ga0068861_100025534 | Ga0068861_1000255343 | 393 |
| 327 | 3300013307 | Ga0157372_10171892 | Ga0157372_101718922 | 393 |
| 328 | 3300025927 | Ga0207687_10029528 | Ga0207687_100295282 | 393 |
| 329 | 3300026075 | Ga0207708_10003968 | Ga0207708_100039688 | 393 |
| 330 | 3300026118 | Ga0207675_100040429 | Ga0207675_1000404292 | 393 |
| 331 | 3300028379 | Ga0268266_10065058 | Ga0268266_100650583 | 393 |
| 332 | 3300005367 | Ga0070667_100212282 | Ga0070667_1002122822 | 394 |
| 333 | 3300005435 | Ga0070714_100060030 | Ga0070714_1000600302 | 394 |
| 334 | 3300005435 | Ga0070714_100180351 | Ga0070714_1001803511 | 394 |
| 335 | 3300005439 | Ga0070711_100105261 | Ga0070711_1001052611 | 394 |
| 336 | 3300005457 | Ga0070662_100009027 | Ga0070662_1000090274 | 394 |
| 337 | 3300005467 | Ga0070706_100030567 | Ga0070706_1000305673 | 394 |
| 338 | 3300005468 | Ga0070707_100011276 | Ga0070707_1000112762 | 394 |
| 339 | 3300006163 | Ga0070715_10013894 | Ga0070715_100138942 | 394 |
| 340 | 3300009148 | Ga0105243_10116559 | Ga0105243_101165592 | 394 |
| 341 | 3300020078 | Ga0206352_10246956 | Ga0206352_102469561 | 394 |
| 342 | 3300025922 | Ga0207646_10005885 | Ga0207646_100058852 | 394 |
| 343 | 3300025929 | Ga0207664_10331043 | Ga0207664_103310431 | 394 |
| 344 | 3300025933 | Ga0207706_10009818 | Ga0207706_1000981811 | 394 |
| 345 | 3300025939 | Ga0207665_10056850 | Ga0207665_100568503 | 394 |
| 346 | 3300035083 | Ga0373926_0032850 | Ga0373926_0032850_434_1723 | 394 |
| 347 | 3300035725 | Ga0373947_0000014 | Ga0373947_0000014_127127_128416 | 394 |
| 348 | 3300046454 | Ga0495592_0025553 | Ga0495592_0025553_2685_3989 | 394 |
| 349 | 3300046462 | Ga0495651_0007208 | Ga0495651_0007208_3796_5100 | 394 |
| 350 | 3300046477 | Ga0495664_0113788 | Ga0495664_0113788_84_1388 | 394 |
| 351 | 3300046511 | Ga0495608_0010194 | Ga0495608_0010194_1774_3078 | 394 |
| 352 | 3300046559 | Ga0495667_0000908 | Ga0495667_0000908_17576_18880 | 394 |
| 353 | 3300046663 | Ga0495635_0011752 | Ga0495635_0011752_1109_2413 | 394 |
| 354 | 3300046675 | Ga0495657_0007099 | Ga0495657_0007099_1605_2909 | 394 |
| 355 | 3300047322 | Ga0495680_0001586 | Ga0495680_0001586_19064_20368 | 394 |
| 356 | 3300048921 | Ga0496118_0051275 | Ga0496118_0051275_639_1952 | 394 |
| 357 | 3300048928 | Ga0496125_0016319 | Ga0496125_0016319_4515_5828 | 394 |
| 358 | 3300053084 | Ga0495595_0024353 | Ga0495595_0024353_1305_2609 | 394 |
| 359 | 3300053085 | Ga0495619_0046837 | Ga0495619_0046837_494_1798 | 394 |
| 360 | 3300053087 | Ga0500643_006474 | Ga0500643_006474_872_2161 | 394 |
| 361 | 3300053131 | Ga0500652_007547 | Ga0500652_007547_2000_3262 | 394 |
| 362 | 3300005458 | Ga0070681_10126386 | Ga0070681_101263862 | 395 |
| 363 | 3300006852 | Ga0075433_10163690 | Ga0075433_101636902 | 395 |
| 364 | 3300007076 | Ga0075435_100107436 | Ga0075435_1001074362 | 395 |
| 365 | 3300025918 | Ga0207662_10004973 | Ga0207662_100049735 | 395 |
| 366 | 3300025929 | Ga0207664_10024393 | Ga0207664_100243933 | 395 |
| 367 | 3300045049 | Ga0466959_0075817 | Ga0466959_0075817_745_2019 | 395 |
| 368 | 3300045836 | Ga0466958_0063732 | Ga0466958_0063732_116_1390 | 395 |
| 369 | 3300046477 | Ga0495664_0039541 | Ga0495664_0039541_902_2299 | 395 |
| 370 | 3300048904 | Ga0496101_0056770 | Ga0496101_0056770_768_2069 | 395 |
| 371 | 3300048906 | Ga0496103_0015572 | Ga0496103_0015572_1783_3063 | 395 |
| 372 | 3300048914 | Ga0496111_0072558 | Ga0496111_0072558_551_1852 | 395 |
| 373 | 3300048922 | Ga0496119_0072685 | Ga0496119_0072685_606_1919 | 395 |
| 374 | 3300048923 | Ga0496120_0001962 | Ga0496120_0001962_1391_2704 | 395 |
| 375 | 3300005468 | Ga0070707_100031450 | Ga0070707_1000314504 | 396 |
| 376 | 3300005539 | Ga0068853_100016775 | Ga0068853_1000167752 | 396 |
| 377 | 3300006028 | Ga0070717_10034864 | Ga0070717_100348643 | 396 |
| 378 | 3300009098 | Ga0105245_10018583 | Ga0105245_100185836 | 396 |
| 379 | 3300009545 | Ga0105237_10051382 | Ga0105237_100513824 | 396 |
| 380 | 3300010375 | Ga0105239_10002879 | Ga0105239_1000287911 | 396 |
| 381 | 3300025922 | Ga0207646_10009346 | Ga0207646_100093468 | 396 |
| 382 | 3300035172 | Ga0373955_0101848 | Ga0373955_0101848_349_1638 | 396 |
| 383 | 3300035410 | Ga0373924_0051869 | Ga0373924_0051869_196_1485 | 396 |
| 384 | 3300037853 | Ga0436364_1421530 | Ga0436364_1421530_1528_2796 | 396 |
| 385 | 3300046507 | Ga0495606_0051487 | Ga0495606_0051487_1118_2368 | 396 |
| 386 | 3300006028 | Ga0070717_10047787 | Ga0070717_100477874 | 397 |
| 387 | 3300006038 | Ga0075365_10015384 | Ga0075365_100153844 | 397 |
| 388 | 3300006051 | Ga0075364_10076198 | Ga0075364_100761982 | 397 |
| 389 | 3300006178 | Ga0075367_10088124 | Ga0075367_100881242 | 397 |
| 390 | 3300006852 | Ga0075433_10012875 | Ga0075433_100128755 | 397 |
| 391 | 3300006871 | Ga0075434_100003943 | Ga0075434_1000039431 | 397 |
| 392 | 3300007076 | Ga0075435_100007491 | Ga0075435_1000074914 | 397 |
| 393 | 3300009553 | Ga0105249_10012184 | Ga0105249_100121844 | 397 |
| 394 | 3300013296 | Ga0157374_10232882 | Ga0157374_102328822 | 397 |
| 395 | 3300013306 | Ga0163162_10027146 | Ga0163162_100271464 | 397 |
| 396 | 3300025914 | Ga0207671_10011790 | Ga0207671_100117904 | 397 |
| 397 | 3300025944 | Ga0207661_10097199 | Ga0207661_100971991 | 397 |
| 398 | 3300037853 | Ga0436364_0841117 | Ga0436364_0841117_1278_2588 | 397 |
| 399 | 3300044658 | Ga0466972_0012299 | Ga0466972_0012299_2055_3308 | 397 |
| 400 | 3300044901 | Ga0466960_0079258 | Ga0466960_0079258_369_1622 | 397 |
| 401 | 3300048907 | Ga0496104_0323470 | Ga0496104_0323470_70_1341 | 397 |
| 402 | 3300048911 | Ga0496108_0028914 | Ga0496108_0028914_216_1589 | 397 |
| 403 | 3300048912 | Ga0496109_0024888 | Ga0496109_0024888_757_2130 | 397 |
| 404 | 3300048913 | Ga0496110_0039235 | Ga0496110_0039235_1214_2587 | 397 |
| 405 | 3300050490 | nmdc:mga03n38_17725_c1 | nmdc:mga03n38_17725_c1_1309_2598 | 397 |
| 406 | 3300050491 | nmdc:mga00v17_17742_c2 | nmdc:mga00v17_17742_c2_1950_3239 | 397 |
| 407 | 3300050492 | nmdc:mga0yw44_15068_c1 | nmdc:mga0yw44_15068_c1_1639_2928 | 397 |
| 408 | 3300002459 | JGI24751J29686_10009198 | JGI24751J29686_100091982 | 398 |
| 409 | 3300005355 | Ga0070671_100013019 | Ga0070671_1000130192 | 398 |
| 410 | 3300005367 | Ga0070667_100105326 | Ga0070667_1001053262 | 398 |
| 411 | 3300005548 | Ga0070665_100009958 | Ga0070665_1000099589 | 398 |
| 412 | 3300005841 | Ga0068863_100001514 | Ga0068863_10000151418 | 398 |
| 413 | 3300005842 | Ga0068858_100080445 | Ga0068858_1000804452 | 398 |
| 414 | 3300014325 | Ga0163163_10002897 | Ga0163163_100028973 | 398 |
| 415 | 3300014745 | Ga0157377_10007912 | Ga0157377_100079122 | 398 |
| 416 | 3300020082 | Ga0206353_11818343 | Ga0206353_118183432 | 398 |
| 417 | 3300025931 | Ga0207644_10005208 | Ga0207644_100052083 | 398 |
| 418 | 3300025986 | Ga0207658_10012179 | Ga0207658_100121793 | 398 |
| 419 | 3300026088 | Ga0207641_10003507 | Ga0207641_100035078 | 398 |
| 420 | 3300028379 | Ga0268266_10246931 | Ga0268266_102469312 | 398 |
| 421 | 3300035086 | Ga0373934_0015454 | Ga0373934_0015454_902_2203 | 398 |
| 422 | 3300035118 | Ga0373954_0035904 | Ga0373954_0035904_26_1327 | 398 |
| 423 | 3300046459 | Ga0495629_0012234 | Ga0495629_0012234_1851_3152 | 398 |
| 424 | 3300047321 | Ga0495676_0040298 | Ga0495676_0040298_1938_3239 | 398 |
| 425 | 3300047472 | Ga0495686_0003330 | Ga0495686_0003330_6292_7587 | 398 |
| 426 | 3300048905 | Ga0496102_0000590 | Ga0496102_0000590_17072_18361 | 398 |
| 427 | 3300048908 | Ga0496105_0182583 | Ga0496105_0182583_330_1601 | 398 |
| 428 | 3300048911 | Ga0496108_0000645 | Ga0496108_0000645_22378_23703 | 398 |
| 429 | 3300048912 | Ga0496109_0016603 | Ga0496109_0016603_4169_5494 | 398 |
| 430 | 3300048913 | Ga0496110_0231112 | Ga0496110_0231112_94_1461 | 398 |
| 431 | 3300048915 | Ga0496112_0005708 | Ga0496112_0005708_405_1730 | 398 |
| 432 | 3300050490 | nmdc:mga03n38_7306_c1 | nmdc:mga03n38_7306_c1_2247_3500 | 398 |
| 433 | 3300050492 | nmdc:mga0yw44_64861_c1 | nmdc:mga0yw44_64861_c1_711_1964 | 398 |
| 434 | 3300044842 | Ga0466957_0043503 | Ga0466957_0043503_20_1327 | 399 |
| 435 | 3300005618 | Ga0068864_100020685 | Ga0068864_1000206853 | 400 |
| 436 | 3300005843 | Ga0068860_100249342 | Ga0068860_1002493422 | 400 |
| 437 | 3300006871 | Ga0075434_100008894 | Ga0075434_1000088943 | 400 |
| 438 | 3300006881 | Ga0068865_100022777 | Ga0068865_1000227773 | 400 |
| 439 | 3300009148 | Ga0105243_10006751 | Ga0105243_100067515 | 400 |
| 440 | 3300009176 | Ga0105242_10052953 | Ga0105242_100529533 | 400 |
| 441 | 3300009177 | Ga0105248_10004419 | Ga0105248_100044195 | 400 |
| 442 | 3300009551 | Ga0105238_10093468 | Ga0105238_100934682 | 400 |
| 443 | 3300014325 | Ga0163163_10032021 | Ga0163163_100320212 | 400 |
| 444 | 3300014969 | Ga0157376_10022035 | Ga0157376_100220354 | 400 |
| 445 | 3300021388 | Ga0213875_10000570 | Ga0213875_1000057019 | 400 |
| 446 | 3300025935 | Ga0207709_10017218 | Ga0207709_100172183 | 400 |
| 447 | 3300025935 | Ga0207709_10196818 | Ga0207709_101968181 | 400 |
| 448 | 3300025938 | Ga0207704_10012981 | Ga0207704_100129813 | 400 |
| 449 | 3300026023 | Ga0207677_10011441 | Ga0207677_100114413 | 400 |
| 450 | 3300026095 | Ga0207676_10016180 | Ga0207676_100161802 | 400 |
| 451 | 3300028800 | Ga0265338_10007886 | Ga0265338_1000788614 | 400 |
| 452 | 3300037853 | Ga0436364_0824111 | Ga0436364_0824111_1497_2804 | 400 |
| 453 | 3300037853 | Ga0436364_1520571 | Ga0436364_1520571_14803_16101 | 400 |
| 454 | 3300046500 | Ga0495596_0029721 | Ga0495596_0029721_372_1640 | 400 |
| 455 | 3300046526 | Ga0495666_0068629 | Ga0495666_0068629_14_1345 | 400 |
| 456 | 3300046531 | Ga0495665_0009444 | Ga0495665_0009444_2580_3908 | 400 |
| 457 | 3300048903 | Ga0496100_0042136 | Ga0496100_0042136_1185_2534 | 400 |
| 458 | 3300048910 | Ga0496107_0016357 | Ga0496107_0016357_3806_5155 | 400 |
| 459 | 3300048914 | Ga0496111_0031195 | Ga0496111_0031195_43_1392 | 400 |
| 460 | 3300048916 | Ga0496113_0032813 | Ga0496113_0032813_1324_2673 | 400 |
| 461 | 3300048917 | Ga0496114_0032144 | Ga0496114_0032144_2396_3745 | 400 |
| 462 | 3300050512 | nmdc:mga0n895_213832_c1 | nmdc:mga0n895_213832_c1_207_1511 | 400 |
| 463 | 3300053078 | Ga0495612_0008199 | Ga0495612_0008199_2656_3957 | 400 |
| 464 | 3300009147 | Ga0114129_10039891 | Ga0114129_100398915 | 401 |
| 465 | 3300028556 | Ga0265337_1000027 | Ga0265337_100002710 | 401 |
| 466 | 3300028558 | Ga0265326_10001234 | Ga0265326_100012348 | 401 |
| 467 | 3300028563 | Ga0265319_1001055 | Ga0265319_100105510 | 401 |
| 468 | 3300028573 | Ga0265334_10000773 | Ga0265334_1000077310 | 401 |
| 469 | 3300028654 | Ga0265322_10001284 | Ga0265322_100012843 | 401 |
| 470 | 3300028666 | Ga0265336_10002288 | Ga0265336_100022883 | 401 |
| 471 | 3300028800 | Ga0265338_10000227 | Ga0265338_1000022782 | 401 |
| 472 | 3300029957 | Ga0265324_10004386 | Ga0265324_100043866 | 401 |
| 473 | 3300031238 | Ga0265332_10001185 | Ga0265332_100011856 | 401 |
| 474 | 3300031241 | Ga0265325_10005218 | Ga0265325_100052185 | 401 |
| 475 | 3300031249 | Ga0265339_10021776 | Ga0265339_100217762 | 401 |
| 476 | 3300031344 | Ga0265316_10007705 | Ga0265316_100077054 | 401 |
| 477 | 3300031595 | Ga0265313_10010516 | Ga0265313_100105163 | 401 |
| 478 | 3300031711 | Ga0265314_10010105 | Ga0265314_100101058 | 401 |
| 479 | 3300050507 | nmdc:mga05p37_47560_c1 | nmdc:mga05p37_47560_c1_3003_4298 | 401 |
| 480 | 3300050512 | nmdc:mga0n895_17799_c1 | nmdc:mga0n895_17799_c1_3440_4735 | 401 |
| 481 | 3300050513 | nmdc:mga0rr50_3260_c1 | nmdc:mga0rr50_3260_c1_3374_4669 | 401 |
| 482 | 3300050515 | nmdc:mga0a205_2637_c1 | nmdc:mga0a205_2637_c1_9340_10635 | 401 |
| 483 | 3300005434 | Ga0070709_10012534 | Ga0070709_100125344 | 402 |
| 484 | 3300005439 | Ga0070711_100004473 | Ga0070711_1000044736 | 402 |
| 485 | 3300005445 | Ga0070708_100287649 | Ga0070708_1002876492 | 402 |
| 486 | 3300006038 | Ga0075365_10090040 | Ga0075365_100900401 | 402 |
| 487 | 3300006048 | Ga0075363_100087743 | Ga0075363_1000877431 | 402 |
| 488 | 3300009098 | Ga0105245_10162114 | Ga0105245_101621141 | 402 |
| 489 | 3300009176 | Ga0105242_10042211 | Ga0105242_100422112 | 402 |
| 490 | 3300013102 | Ga0157371_10099871 | Ga0157371_100998712 | 402 |
| 491 | 3300025303 | Ga0209051_1008439 | Ga0209051_10084395 | 402 |
| 492 | 3300035691 | Ga0373931_0013389 | Ga0373931_0013389_1505_2830 | 402 |
| 493 | 3300037068 | Ga0373925_0010661 | Ga0373925_0010661_680_1978 | 402 |
| 494 | 3300045976 | Ga0466967_0012654 | Ga0466967_0012654_2201_3463 | 402 |
| 495 | 3300046524 | Ga0495648_0005458 | Ga0495648_0005458_5539_6816 | 402 |
| 496 | 3300047320 | Ga0495672_0030900 | Ga0495672_0030900_54_1331 | 402 |
| 497 | 3300047469 | Ga0495673_0001205 | Ga0495673_0001205_5393_6670 | 402 |
| 498 | 3300048909 | Ga0496106_0028783 | Ga0496106_0028783_1721_3046 | 402 |
| 499 | 3300048909 | Ga0496106_0107582 | Ga0496106_0107582_81_1445 | 402 |
| 500 | 3300048910 | Ga0496107_0041137 | Ga0496107_0041137_1920_3245 | 402 |
| 501 | 3300001977 | JGI24746J21847_1000089 | JGI24746J21847_10000893 | 403 |
| 502 | 3300001991 | JGI24743J22301_10000709 | JGI24743J22301_100007092 | 403 |
| 503 | 3300005339 | Ga0070660_100222383 | Ga0070660_1002223831 | 403 |
| 504 | 3300005548 | Ga0070665_100045725 | Ga0070665_1000457254 | 403 |
| 505 | 3300005842 | Ga0068858_100113426 | Ga0068858_1001134262 | 403 |
| 506 | 3300013297 | Ga0157378_10089398 | Ga0157378_100893981 | 403 |
| 507 | 3300025901 | Ga0207688_10014587 | Ga0207688_100145872 | 403 |
| 508 | 3300025919 | Ga0207657_10072009 | Ga0207657_100720092 | 403 |
| 509 | 3300025942 | Ga0207689_10009916 | Ga0207689_100099164 | 403 |
| 510 | 3300026035 | Ga0207703_10018284 | Ga0207703_100182841 | 403 |
| 511 | 3300026075 | Ga0207708_10005234 | Ga0207708_100052344 | 403 |
| 512 | 3300026118 | Ga0207675_100015022 | Ga0207675_1000150222 | 403 |
| 513 | 3300028379 | Ga0268266_10205726 | Ga0268266_102057262 | 403 |
| 514 | 3300035089 | Ga0373944_0000926 | Ga0373944_0000926_204_1511 | 403 |
| 515 | 3300035111 | Ga0373923_0010272 | Ga0373923_0010272_829_2136 | 403 |
| 516 | 3300035113 | Ga0373936_0004471 | Ga0373936_0004471_3603_4910 | 403 |
| 517 | 3300035171 | Ga0373946_0000756 | Ga0373946_0000756_7835_9142 | 403 |
| 518 | 3300035242 | Ga0373962_0007345 | Ga0373962_0007345_67_1389 | 403 |
| 519 | 3300035410 | Ga0373924_0012085 | Ga0373924_0012085_680_1987 | 403 |
| 520 | 3300035692 | Ga0373935_0010760 | Ga0373935_0010760_4137_5444 | 403 |
| 521 | 3300037068 | Ga0373925_0009690 | Ga0373925_0009690_5336_6643 | 403 |
| 522 | 3300037471 | Ga0395905_0047873 | Ga0395905_0047873_1555_2811 | 403 |
| 523 | 3300041411 | Ga0439466_0021262 | Ga0439466_0021262_825_2105 | 403 |
| 524 | 3300041413 | Ga0439465_0000349 | Ga0439465_0000349_4683_5963 | 403 |
| 525 | 3300046461 | Ga0495641_0012394 | Ga0495641_0012394_691_1998 | 403 |
| 526 | 3300046517 | Ga0495630_0011332 | Ga0495630_0011332_3415_4722 | 403 |
| 527 | 3300046535 | Ga0495586_0005340 | Ga0495586_0005340_2058_3365 | 403 |
| 528 | 3300046559 | Ga0495667_0057206 | Ga0495667_0057206_599_1906 | 403 |
| 529 | 3300046642 | Ga0495634_0002700 | Ga0495634_0002700_6170_7477 | 403 |
| 530 | 3300046674 | Ga0495588_0001357 | Ga0495588_0001357_342_1649 | 403 |
| 531 | 3300046683 | Ga0495658_0001438 | Ga0495658_0001438_6027_7334 | 403 |
| 532 | 3300047673 | Ga0495593_0015763 | Ga0495593_0015763_2938_4245 | 403 |
| 533 | 3300048089 | Ga0495614_0001554 | Ga0495614_0001554_5107_6414 | 403 |
| 534 | 3300048903 | Ga0496100_0009450 | Ga0496100_0009450_1966_3255 | 403 |
| 535 | 3300048904 | Ga0496101_0000021 | Ga0496101_0000021_31716_33005 | 403 |
| 536 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_225008_226285 | 403 |
| 537 | 3300048906 | Ga0496103_0000007 | Ga0496103_0000007_129404_130681 | 403 |
| 538 | 3300048909 | Ga0496106_0003386 | Ga0496106_0003386_1656_2945 | 403 |
| 539 | 3300048910 | Ga0496107_0011486 | Ga0496107_0011486_1912_3201 | 403 |
| 540 | 3300048919 | Ga0496116_0000018 | Ga0496116_0000018_188110_189387 | 403 |
| 541 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_356491_357768 | 403 |
| 542 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_356491_357768 | 403 |
| 543 | 3300048923 | Ga0496120_0006298 | Ga0496120_0006298_4053_5330 | 403 |
| 544 | 3300048924 | Ga0496121_0000177 | Ga0496121_0000177_127197_128486 | 403 |
| 545 | 3300048929 | Ga0496126_0001113 | Ga0496126_0001113_33124_34401 | 403 |
| 546 | 3300049744 | Ga0501083_0038734 | Ga0501083_0038734_1312_2616 | 403 |
| 547 | 3300049823 | Ga0501044_0196617 | Ga0501044_0196617_338_1642 | 403 |
| 548 | 3300003792 | Ga0055540_1001155 | Ga0055540_10011556 | 404 |
| 549 | 3300005435 | Ga0070714_100040816 | Ga0070714_1000408162 | 404 |
| 550 | 3300005436 | Ga0070713_100004385 | Ga0070713_1000043853 | 404 |
| 551 | 3300025303 | Ga0209051_1001208 | Ga0209051_100120818 | 404 |
| 552 | 3300025929 | Ga0207664_10002329 | Ga0207664_100023298 | 404 |
| 553 | 3300031901 | Ga0307406_10058952 | Ga0307406_100589522 | 404 |
| 554 | 3300037312 | Ga0395899_0140674 | Ga0395899_0140674_295_1551 | 404 |
| 555 | 3300037466 | Ga0395898_0019897 | Ga0395898_0019897_2145_3401 | 404 |
| 556 | 3300046455 | Ga0495603_0040047 | Ga0495603_0040047_1243_2571 | 404 |
| 557 | 3300046473 | Ga0495582_0027448 | Ga0495582_0027448_11_1249 | 404 |
| 558 | 3300046516 | Ga0495628_0102534 | Ga0495628_0102534_273_1616 | 404 |
| 559 | 3300046536 | Ga0495587_0019393 | Ga0495587_0019393_2310_3653 | 404 |
| 560 | 3300048922 | Ga0496119_0060786 | Ga0496119_0060786_710_1960 | 404 |
| 561 | 3300053080 | Ga0500635_0004952 | Ga0500635_0004952_88_1350 | 404 |
| 562 | 3300002459 | JGI24751J29686_10016832 | JGI24751J29686_100168322 | 405 |
| 563 | 3300005436 | Ga0070713_100113829 | Ga0070713_1001138292 | 405 |
| 564 | 3300005455 | Ga0070663_100140945 | Ga0070663_1001409452 | 405 |
| 565 | 3300006038 | Ga0075365_10140439 | Ga0075365_101404392 | 405 |
| 566 | 3300006186 | Ga0075369_10001370 | Ga0075369_100013707 | 405 |
| 567 | 3300025303 | Ga0209051_1006114 | Ga0209051_10061146 | 405 |
| 568 | 3300025915 | Ga0207693_10089600 | Ga0207693_100896002 | 405 |
| 569 | 3300025925 | Ga0207650_10020009 | Ga0207650_100200093 | 405 |
| 570 | 3300025926 | Ga0207659_10138959 | Ga0207659_101389592 | 405 |
| 571 | 3300025927 | Ga0207687_10165851 | Ga0207687_101658512 | 405 |
| 572 | 3300026067 | Ga0207678_10045686 | Ga0207678_100456862 | 405 |
| 573 | 3300044706 | Ga0466964_0017103 | Ga0466964_0017103_1423_2700 | 405 |
| 574 | 3300045976 | Ga0466967_0056273 | Ga0466967_0056273_713_1990 | 405 |
| 575 | 3300045976 | Ga0466967_0132388 | Ga0466967_0132388_196_1500 | 405 |
| 576 | 3300046523 | Ga0495644_0028662 | Ga0495644_0028662_368_1702 | 405 |
| 577 | 3300046525 | Ga0495663_0006952 | Ga0495663_0006952_939_2273 | 405 |
| 578 | 3300046615 | Ga0495656_0000291 | Ga0495656_0000291_15967_17301 | 405 |
| 579 | 3300046664 | Ga0495659_0000889 | Ga0495659_0000889_46_1380 | 405 |
| 580 | 3300050516 | nmdc:mga0sz30_3201_c1 | nmdc:mga0sz30_3201_c1_3849_5129 | 405 |
| 581 | 3300005434 | Ga0070709_10000794 | Ga0070709_100007945 | 406 |
| 582 | 3300005435 | Ga0070714_100000640 | Ga0070714_1000006409 | 406 |
| 583 | 3300005436 | Ga0070713_100000428 | Ga0070713_1000004285 | 406 |
| 584 | 3300005437 | Ga0070710_10000101 | Ga0070710_1000010121 | 406 |
| 585 | 3300005439 | Ga0070711_100000437 | Ga0070711_1000004377 | 406 |
| 586 | 3300006028 | Ga0070717_10000956 | Ga0070717_100009564 | 406 |
| 587 | 3300006173 | Ga0070716_100000560 | Ga0070716_1000005608 | 406 |
| 588 | 3300006175 | Ga0070712_100002191 | Ga0070712_1000021915 | 406 |
| 589 | 3300009098 | Ga0105245_10116217 | Ga0105245_101162172 | 406 |
| 590 | 3300014968 | Ga0157379_10069475 | Ga0157379_100694752 | 406 |
| 591 | 3300025905 | Ga0207685_10001280 | Ga0207685_100012804 | 406 |
| 592 | 3300025906 | Ga0207699_10000156 | Ga0207699_1000015635 | 406 |
| 593 | 3300025910 | Ga0207684_10057831 | Ga0207684_100578312 | 406 |
| 594 | 3300025915 | Ga0207693_10002490 | Ga0207693_100024908 | 406 |
| 595 | 3300025916 | Ga0207663_10006245 | Ga0207663_100062456 | 406 |
| 596 | 3300025928 | Ga0207700_10000063 | Ga0207700_1000006330 | 406 |
| 597 | 3300025929 | Ga0207664_10000196 | Ga0207664_100001969 | 406 |
| 598 | 3300025939 | Ga0207665_10000226 | Ga0207665_1000022613 | 406 |
| 599 | 3300046516 | Ga0495628_0024834 | Ga0495628_0024834_3374_4681 | 406 |
| 600 | 3300046559 | Ga0495667_0047522 | Ga0495667_0047522_574_1917 | 406 |
| 601 | 3300005435 | Ga0070714_100180693 | Ga0070714_1001806931 | 407 |
| 602 | 3300006175 | Ga0070712_100102759 | Ga0070712_1001027592 | 407 |
| 603 | 3300009147 | Ga0114129_10019233 | Ga0114129_100192337 | 407 |
| 604 | 3300025915 | Ga0207693_10061181 | Ga0207693_100611812 | 407 |
| 605 | 3300025929 | Ga0207664_10044307 | Ga0207664_100443073 | 407 |
| 606 | 3300041410 | Ga0439461_0000217 | Ga0439461_0000217_6554_7837 | 407 |
| 607 | 3300041997 | Ga0439431_0000859 | Ga0439431_0000859_3645_4928 | 407 |
| 608 | 3300045976 | Ga0466967_0111964 | Ga0466967_0111964_431_1726 | 407 |
| 609 | 3300046679 | Ga0495623_0055054 | Ga0495623_0055054_564_1871 | 407 |
| 610 | 3300048913 | Ga0496110_0209617 | Ga0496110_0209617_180_1466 | 407 |
| 611 | 3300050507 | nmdc:mga05p37_11253_c1 | nmdc:mga05p37_11253_c1_2961_4256 | 407 |
| 612 | 3300005434 | Ga0070709_10079546 | Ga0070709_100795462 | 408 |
| 613 | 3300006163 | Ga0070715_10004042 | Ga0070715_100040425 | 408 |
| 614 | 3300006163 | Ga0070715_10023722 | Ga0070715_100237222 | 408 |
| 615 | 3300006175 | Ga0070712_100012459 | Ga0070712_1000124593 | 408 |
| 616 | 3300009551 | Ga0105238_10195444 | Ga0105238_101954441 | 408 |
| 617 | 3300013297 | Ga0157378_10019027 | Ga0157378_100190271 | 408 |
| 618 | 3300017792 | Ga0163161_10171762 | Ga0163161_101717622 | 408 |
| 619 | 3300025900 | Ga0207710_10081651 | Ga0207710_100816512 | 408 |
| 620 | 3300025905 | Ga0207685_10003910 | Ga0207685_100039104 | 408 |
| 621 | 3300025915 | Ga0207693_10000199 | Ga0207693_1000019938 | 408 |
| 622 | 3300025916 | Ga0207663_10001603 | Ga0207663_100016034 | 408 |
| 623 | 3300025933 | Ga0207706_10022575 | Ga0207706_100225755 | 408 |
| 624 | 3300025939 | Ga0207665_10013801 | Ga0207665_100138012 | 408 |
| 625 | 3300025939 | Ga0207665_10067547 | Ga0207665_100675472 | 408 |
| 626 | 3300028800 | Ga0265338_10001512 | Ga0265338_1000151236 | 408 |
| 627 | 3300035083 | Ga0373926_0001462 | Ga0373926_0001462_5634_6971 | 408 |
| 628 | 3300035083 | Ga0373926_0021075 | Ga0373926_0021075_279_1580 | 408 |
| 629 | 3300035111 | Ga0373923_0020707 | Ga0373923_0020707_1029_2330 | 408 |
| 630 | 3300035113 | Ga0373936_0006048 | Ga0373936_0006048_804_2102 | 408 |
| 631 | 3300035113 | Ga0373936_0008708 | Ga0373936_0008708_286_1602 | 408 |
| 632 | 3300035113 | Ga0373936_0014364 | Ga0373936_0014364_675_1976 | 408 |
| 633 | 3300035116 | Ga0373945_0001751 | Ga0373945_0001751_2210_3547 | 408 |
| 634 | 3300035116 | Ga0373945_0014754 | Ga0373945_0014754_694_1995 | 408 |
| 635 | 3300035119 | Ga0373956_0025651 | Ga0373956_0025651_978_2279 | 408 |
| 636 | 3300035120 | Ga0373957_0015658 | Ga0373957_0015658_667_1968 | 408 |
| 637 | 3300035170 | Ga0373943_0000223 | Ga0373943_0000223_979_2277 | 408 |
| 638 | 3300035171 | Ga0373946_0000798 | Ga0373946_0000798_2558_3856 | 408 |
| 639 | 3300035692 | Ga0373935_0004598 | Ga0373935_0004598_5580_6878 | 408 |
| 640 | 3300035695 | Ga0373927_0003276 | Ga0373927_0003276_2880_4217 | 408 |
| 641 | 3300035695 | Ga0373927_0051849 | Ga0373927_0051849_566_1867 | 408 |
| 642 | 3300037068 | Ga0373925_0012062 | Ga0373925_0012062_4002_5300 | 408 |
| 643 | 3300046454 | Ga0495592_0068405 | Ga0495592_0068405_546_1847 | 408 |
| 644 | 3300046455 | Ga0495603_0024918 | Ga0495603_0024918_1948_3249 | 408 |
| 645 | 3300046461 | Ga0495641_0007936 | Ga0495641_0007936_3404_4702 | 408 |
| 646 | 3300046461 | Ga0495641_0044956 | Ga0495641_0044956_35_1336 | 408 |
| 647 | 3300046476 | Ga0495662_0013986 | Ga0495662_0013986_1972_3270 | 408 |
| 648 | 3300046477 | Ga0495664_0000074 | Ga0495664_0000074_18682_19980 | 408 |
| 649 | 3300046477 | Ga0495664_0099478 | Ga0495664_0099478_413_1717 | 408 |
| 650 | 3300046511 | Ga0495608_0018431 | Ga0495608_0018431_519_1820 | 408 |
| 651 | 3300046514 | Ga0495618_0089619 | Ga0495618_0089619_339_1661 | 408 |
| 652 | 3300046516 | Ga0495628_0101290 | Ga0495628_0101290_248_1549 | 408 |
| 653 | 3300046517 | Ga0495630_0009396 | Ga0495630_0009396_674_1975 | 408 |
| 654 | 3300046517 | Ga0495630_0016278 | Ga0495630_0016278_335_1633 | 408 |
| 655 | 3300046526 | Ga0495666_0000996 | Ga0495666_0000996_7794_9131 | 408 |
| 656 | 3300046529 | Ga0495652_0043197 | Ga0495652_0043197_2127_3425 | 408 |
| 657 | 3300046531 | Ga0495665_0013989 | Ga0495665_0013989_927_2228 | 408 |
| 658 | 3300046536 | Ga0495587_0055100 | Ga0495587_0055100_694_1995 | 408 |
| 659 | 3300046543 | Ga0495645_0158078 | Ga0495645_0158078_23_1327 | 408 |
| 660 | 3300046559 | Ga0495667_0029518 | Ga0495667_0029518_1155_2453 | 408 |
| 661 | 3300046559 | Ga0495667_0087160 | Ga0495667_0087160_248_1549 | 408 |
| 662 | 3300046642 | Ga0495634_0056454 | Ga0495634_0056454_599_1897 | 408 |
| 663 | 3300046663 | Ga0495635_0000773 | Ga0495635_0000773_6751_8049 | 408 |
| 664 | 3300046663 | Ga0495635_0063839 | Ga0495635_0063839_1193_2494 | 408 |
| 665 | 3300046675 | Ga0495657_0051040 | Ga0495657_0051040_551_1852 | 408 |
| 666 | 3300046678 | Ga0495599_0053041 | Ga0495599_0053041_694_1995 | 408 |
| 667 | 3300046680 | Ga0495646_0041034 | Ga0495646_0041034_229_1530 | 408 |
| 668 | 3300046681 | Ga0495647_0001537 | Ga0495647_0001537_4181_5518 | 408 |
| 669 | 3300046681 | Ga0495647_0042764 | Ga0495647_0042764_312_1610 | 408 |
| 670 | 3300046690 | Ga0495624_0006757 | Ga0495624_0006757_2991_4289 | 408 |
| 671 | 3300046690 | Ga0495624_0028048 | Ga0495624_0028048_937_2238 | 408 |
| 672 | 3300047315 | Ga0495581_0004943 | Ga0495581_0004943_2564_3901 | 408 |
| 673 | 3300047315 | Ga0495581_0009928 | Ga0495581_0009928_1477_2775 | 408 |
| 674 | 3300047315 | Ga0495581_0036608 | Ga0495581_0036608_993_2294 | 408 |
| 675 | 3300047319 | Ga0495674_0002797 | Ga0495674_0002797_3744_5042 | 408 |
| 676 | 3300047319 | Ga0495674_0041283 | Ga0495674_0041283_1370_2674 | 408 |
| 677 | 3300047321 | Ga0495676_0020287 | Ga0495676_0020287_918_2216 | 408 |
| 678 | 3300047322 | Ga0495680_0029597 | Ga0495680_0029597_1867_3168 | 408 |
| 679 | 3300047322 | Ga0495680_0071146 | Ga0495680_0071146_368_1666 | 408 |
| 680 | 3300047471 | Ga0495684_0005984 | Ga0495684_0005984_4379_5677 | 408 |
| 681 | 3300048088 | Ga0495602_0130474 | Ga0495602_0130474_476_1777 | 408 |
| 682 | 3300048911 | Ga0496108_0127244 | Ga0496108_0127244_191_1492 | 408 |
| 683 | 3300053085 | Ga0495619_0037454 | Ga0495619_0037454_616_1917 | 408 |
| 684 | 3300005545 | Ga0070695_100182054 | Ga0070695_1001820542 | 409 |
| 685 | 3300025939 | Ga0207665_10058954 | Ga0207665_100589542 | 409 |
| 686 | 3300037068 | Ga0373925_0000421 | Ga0373925_0000421_19186_20511 | 409 |
| 687 | 3300005467 | Ga0070706_100003990 | Ga0070706_10000399013 | 410 |
| 688 | 3300005468 | Ga0070707_100000041 | Ga0070707_10000004116 | 410 |
| 689 | 3300005471 | Ga0070698_100000082 | Ga0070698_10000008231 | 410 |
| 690 | 3300025910 | Ga0207684_10000339 | Ga0207684_1000033919 | 410 |
| 691 | 3300025922 | Ga0207646_10000061 | Ga0207646_1000006149 | 410 |
| 692 | 3300005327 | Ga0070658_10093466 | Ga0070658_100934662 | 411 |
| 693 | 3300005334 | Ga0068869_100068037 | Ga0068869_1000680372 | 411 |
| 694 | 3300005336 | Ga0070680_100072410 | Ga0070680_1000724102 | 411 |
| 695 | 3300005337 | Ga0070682_100022719 | Ga0070682_1000227193 | 411 |
| 696 | 3300005344 | Ga0070661_100009141 | Ga0070661_1000091413 | 411 |
| 697 | 3300005347 | Ga0070668_100055714 | Ga0070668_1000557142 | 411 |
| 698 | 3300005354 | Ga0070675_100063813 | Ga0070675_1000638132 | 411 |
| 699 | 3300005355 | Ga0070671_100047247 | Ga0070671_1000472471 | 411 |
| 700 | 3300005364 | Ga0070673_100010279 | Ga0070673_1000102794 | 411 |
| 701 | 3300005434 | Ga0070709_10000243 | Ga0070709_100002436 | 411 |
| 702 | 3300005437 | Ga0070710_10001923 | Ga0070710_100019235 | 411 |
| 703 | 3300005437 | Ga0070710_10003412 | Ga0070710_100034126 | 411 |
| 704 | 3300005438 | Ga0070701_10023934 | Ga0070701_100239342 | 411 |
| 705 | 3300005439 | Ga0070711_100001607 | Ga0070711_1000016078 | 411 |
| 706 | 3300005440 | Ga0070705_100027798 | Ga0070705_1000277983 | 411 |
| 707 | 3300005441 | Ga0070700_100008542 | Ga0070700_1000085423 | 411 |
| 708 | 3300005455 | Ga0070663_100004269 | Ga0070663_1000042696 | 411 |
| 709 | 3300005456 | Ga0070678_100067738 | Ga0070678_1000677382 | 411 |
| 710 | 3300005457 | Ga0070662_100044175 | Ga0070662_1000441752 | 411 |
| 711 | 3300005459 | Ga0068867_100149122 | Ga0068867_1001491221 | 411 |
| 712 | 3300005535 | Ga0070684_100082513 | Ga0070684_1000825132 | 411 |
| 713 | 3300005539 | Ga0068853_100049796 | Ga0068853_1000497962 | 411 |
| 714 | 3300005539 | Ga0068853_100069006 | Ga0068853_1000690062 | 411 |
| 715 | 3300005543 | Ga0070672_100162157 | Ga0070672_1001621571 | 411 |
| 716 | 3300005545 | Ga0070695_100139249 | Ga0070695_1001392492 | 411 |
| 717 | 3300005546 | Ga0070696_100058492 | Ga0070696_1000584922 | 411 |
| 718 | 3300005546 | Ga0070696_100063569 | Ga0070696_1000635692 | 411 |
| 719 | 3300005577 | Ga0068857_100017591 | Ga0068857_1000175914 | 411 |
| 720 | 3300005615 | Ga0070702_100017389 | Ga0070702_1000173892 | 411 |
| 721 | 3300005618 | Ga0068864_100098059 | Ga0068864_1000980592 | 411 |
| 722 | 3300005718 | Ga0068866_10057117 | Ga0068866_100571172 | 411 |
| 723 | 3300005840 | Ga0068870_10029598 | Ga0068870_100295982 | 411 |
| 724 | 3300005844 | Ga0068862_100043121 | Ga0068862_1000431212 | 411 |
| 725 | 3300006173 | Ga0070716_100004017 | Ga0070716_1000040176 | 411 |
| 726 | 3300006173 | Ga0070716_100006565 | Ga0070716_1000065655 | 411 |
| 727 | 3300006175 | Ga0070712_100017727 | Ga0070712_1000177274 | 411 |
| 728 | 3300006881 | Ga0068865_100028975 | Ga0068865_1000289752 | 411 |
| 729 | 3300009101 | Ga0105247_10029448 | Ga0105247_100294483 | 411 |
| 730 | 3300013100 | Ga0157373_10015473 | Ga0157373_100154733 | 411 |
| 731 | 3300013296 | Ga0157374_10067899 | Ga0157374_100678992 | 411 |
| 732 | 3300014325 | Ga0163163_10067769 | Ga0163163_100677692 | 411 |
| 733 | 3300017792 | Ga0163161_10061975 | Ga0163161_100619752 | 411 |
| 734 | 3300025321 | Ga0207656_10030145 | Ga0207656_100301452 | 411 |
| 735 | 3300025898 | Ga0207692_10001870 | Ga0207692_100018708 | 411 |
| 736 | 3300025899 | Ga0207642_10012124 | Ga0207642_100121242 | 411 |
| 737 | 3300025901 | Ga0207688_10001514 | Ga0207688_100015145 | 411 |
| 738 | 3300025904 | Ga0207647_10079885 | Ga0207647_100798852 | 411 |
| 739 | 3300025906 | Ga0207699_10002495 | Ga0207699_100024956 | 411 |
| 740 | 3300025906 | Ga0207699_10028701 | Ga0207699_100287012 | 411 |
| 741 | 3300025908 | Ga0207643_10002720 | Ga0207643_100027204 | 411 |
| 742 | 3300025911 | Ga0207654_10092056 | Ga0207654_100920562 | 411 |
| 743 | 3300025915 | Ga0207693_10001690 | Ga0207693_100016906 | 411 |
| 744 | 3300025915 | Ga0207693_10093630 | Ga0207693_100936302 | 411 |
| 745 | 3300025916 | Ga0207663_10014279 | Ga0207663_100142793 | 411 |
| 746 | 3300025916 | Ga0207663_10017362 | Ga0207663_100173622 | 411 |
| 747 | 3300025919 | Ga0207657_10030438 | Ga0207657_100304382 | 411 |
| 748 | 3300025920 | Ga0207649_10082505 | Ga0207649_100825052 | 411 |
| 749 | 3300025928 | Ga0207700_10016567 | Ga0207700_100165673 | 411 |
| 750 | 3300025928 | Ga0207700_10029504 | Ga0207700_100295042 | 411 |
| 751 | 3300025929 | Ga0207664_10032064 | Ga0207664_100320644 | 411 |
| 752 | 3300025929 | Ga0207664_10047539 | Ga0207664_100475392 | 411 |
| 753 | 3300025929 | Ga0207664_10056440 | Ga0207664_100564402 | 411 |
| 754 | 3300025929 | Ga0207664_10243144 | Ga0207664_102431441 | 411 |
| 755 | 3300025931 | Ga0207644_10031027 | Ga0207644_100310272 | 411 |
| 756 | 3300025932 | Ga0207690_10054150 | Ga0207690_100541501 | 411 |
| 757 | 3300025933 | Ga0207706_10019781 | Ga0207706_100197814 | 411 |
| 758 | 3300025934 | Ga0207686_10037607 | Ga0207686_100376072 | 411 |
| 759 | 3300025937 | Ga0207669_10057020 | Ga0207669_100570202 | 411 |
| 760 | 3300025939 | Ga0207665_10001670 | Ga0207665_100016703 | 411 |
| 761 | 3300025939 | Ga0207665_10059404 | Ga0207665_100594042 | 411 |
| 762 | 3300025940 | Ga0207691_10033981 | Ga0207691_100339814 | 411 |
| 763 | 3300025940 | Ga0207691_10040532 | Ga0207691_100405322 | 411 |
| 764 | 3300025942 | Ga0207689_10002296 | Ga0207689_100022963 | 411 |
| 765 | 3300025960 | Ga0207651_10050424 | Ga0207651_100504242 | 411 |
| 766 | 3300026067 | Ga0207678_10001390 | Ga0207678_100013905 | 411 |
| 767 | 3300026067 | Ga0207678_10016407 | Ga0207678_100164074 | 411 |
| 768 | 3300026075 | Ga0207708_10006707 | Ga0207708_100067078 | 411 |
| 769 | 3300026078 | Ga0207702_10138335 | Ga0207702_101383352 | 411 |
| 770 | 3300026089 | Ga0207648_10026700 | Ga0207648_100267002 | 411 |
| 771 | 3300026089 | Ga0207648_10103641 | Ga0207648_101036412 | 411 |
| 772 | 3300026095 | Ga0207676_10022955 | Ga0207676_100229552 | 411 |
| 773 | 3300026116 | Ga0207674_10010966 | Ga0207674_1001096610 | 411 |
| 774 | 3300026121 | Ga0207683_10008060 | Ga0207683_100080605 | 411 |
| 775 | 3300026121 | Ga0207683_10027425 | Ga0207683_100274252 | 411 |
| 776 | 3300035088 | Ga0373940_0001161 | Ga0373940_0001161_2326_3627 | 411 |
| 777 | 3300035114 | Ga0373939_0005927 | Ga0373939_0005927_928_2229 | 411 |
| 778 | 3300035115 | Ga0373941_0005711 | Ga0373941_0005711_835_2136 | 411 |
| 779 | 3300045976 | Ga0466967_0056739 | Ga0466967_0056739_1602_2918 | 411 |
| 780 | 3300048905 | Ga0496102_0029162 | Ga0496102_0029162_2077_3402 | 411 |
| 781 | 3300048906 | Ga0496103_0074244 | Ga0496103_0074244_693_1994 | 411 |
| 782 | 3300048907 | Ga0496104_0091076 | Ga0496104_0091076_605_1906 | 411 |
| 783 | 3300048911 | Ga0496108_0093677 | Ga0496108_0093677_174_1475 | 411 |
| 784 | 3300050496 | nmdc:mga07m45_69649_c1 | nmdc:mga07m45_69649_c1_38_1291 | 411 |
| 785 | 3300037853 | Ga0436364_1450559 | Ga0436364_1450559_524_1819 | 412 |
| 786 | 3300026118 | Ga0207675_100013054 | Ga0207675_1000130548 | 413 |
| 787 | iso_pu_bacteria | 2738541274 | 2738704647 | 413 |
| 788 | 3300005981 | Ga0081538_10000404 | Ga0081538_1000040429 | 414 |
| 789 | 3300044656 | Ga0466969_0078576 | Ga0466969_0078576_207_1502 | 414 |
| 790 | 3300044694 | Ga0466963_0040770 | Ga0466963_0040770_1143_2438 | 414 |
| 791 | 3300046473 | Ga0495582_0033593 | Ga0495582_0033593_794_2083 | 414 |
| 792 | 3300046491 | Ga0495584_0069862 | Ga0495584_0069862_304_1566 | 414 |
| 793 | 3300046499 | Ga0495594_0100555 | Ga0495594_0100555_156_1445 | 414 |
| 794 | 3300046690 | Ga0495624_0033267 | Ga0495624_0033267_220_1509 | 414 |
| 795 | 3300047319 | Ga0495674_0107812 | Ga0495674_0107812_1009_2298 | 414 |
| 796 | 3300048905 | Ga0496102_0073674 | Ga0496102_0073674_118_1461 | 414 |
| 797 | iso_pu_bacteria | 2643221687 | 2644488274 | 414 |
| 798 | iso_pu_bacteria | 2902837492 | 2902841362 | 414 |
| 799 | iso_pu_bacteria | 2929212328 | 2929216249 | 414 |
| 800 | 3300003659 | JGI25404J52841_10001437 | JGI25404J52841_100014374 | 415 |
| 801 | 3300005563 | Ga0068855_100055086 | Ga0068855_1000550864 | 415 |
| 802 | 3300005983 | Ga0081540_1000505 | Ga0081540_10005053 | 415 |
| 803 | 3300006353 | Ga0075370_10008783 | Ga0075370_100087833 | 415 |
| 804 | 3300009545 | Ga0105237_10000178 | Ga0105237_1000017825 | 415 |
| 805 | 3300009545 | Ga0105237_10002564 | Ga0105237_100025647 | 415 |
| 806 | 3300010375 | Ga0105239_10007516 | Ga0105239_100075164 | 415 |
| 807 | 3300010375 | Ga0105239_10030663 | Ga0105239_100306633 | 415 |
| 808 | 3300014325 | Ga0163163_10385973 | Ga0163163_103859731 | 415 |
| 809 | 3300025914 | Ga0207671_10008270 | Ga0207671_100082704 | 415 |
| 810 | 3300031548 | Ga0307408_100231039 | Ga0307408_1002310392 | 415 |
| 811 | 3300031731 | Ga0307405_10018316 | Ga0307405_100183163 | 415 |
| 812 | 3300032002 | Ga0307416_100017768 | Ga0307416_1000177681 | 415 |
| 813 | 3300032126 | Ga0307415_100027908 | Ga0307415_1000279082 | 415 |
| 814 | 3300037853 | Ga0436364_1107254 | Ga0436364_1107254_109_1401 | 415 |
| 815 | 3300053087 | Ga0500643_001154 | Ga0500643_001154_8527_9876 | 415 |
| 816 | iso_pu_bacteria | 2902810491 | 2902811298 | 415 |
| 817 | 3300005329 | Ga0070683_100199128 | Ga0070683_1001991282 | 416 |
| 818 | 3300006173 | Ga0070716_100005420 | Ga0070716_1000054207 | 416 |
| 819 | 3300025929 | Ga0207664_10272932 | Ga0207664_102729322 | 416 |
| 820 | 3300044684 | Ga0466966_0009549 | Ga0466966_0009549_3852_5126 | 416 |
| 821 | 3300044693 | Ga0466961_0002650 | Ga0466961_0002650_3168_4442 | 416 |
| 822 | 3300044694 | Ga0466963_0005765 | Ga0466963_0005765_1120_2394 | 416 |
| 823 | 3300044706 | Ga0466964_0005286 | Ga0466964_0005286_1859_3133 | 416 |
| 824 | 3300044842 | Ga0466957_0008856 | Ga0466957_0008856_4264_5538 | 416 |
| 825 | 3300045049 | Ga0466959_0001490 | Ga0466959_0001490_10160_11434 | 416 |
| 826 | 3300053087 | Ga0500643_001862 | Ga0500643_001862_6541_7818 | 416 |
| 827 | iso_pu_bacteria | 2902792274 | 2902795187 | 416 |
| 828 | iso_pu_bacteria | 2939582691 | 2939583058 | 416 |
| 829 | 3300003792 | Ga0055540_1002276 | Ga0055540_10022769 | 418 |
| 830 | 3300025303 | Ga0209051_1000528 | Ga0209051_100052833 | 418 |
| 831 | 3300037312 | Ga0395899_0005983 | Ga0395899_0005983_2663_3967 | 418 |
| 832 | 3300037418 | Ga0395900_0033278 | Ga0395900_0033278_1971_3275 | 418 |
| 833 | 3300037466 | Ga0395898_0003800 | Ga0395898_0003800_6070_7374 | 418 |
| 834 | 3300037471 | Ga0395905_0008955 | Ga0395905_0008955_3799_5103 | 418 |
| 835 | 3300038443 | Ga0395901_0032219 | Ga0395901_0032219_3581_4885 | 418 |
| 836 | iso_pu_bacteria | 8055066027 | 8055072402 | 418 |
| 837 | 3300021388 | Ga0213875_10000604 | Ga0213875_100006042 | 419 |
| 838 | 3300022467 | Ga0224712_10065178 | Ga0224712_100651781 | 419 |
| 839 | 3300025915 | Ga0207693_10045359 | Ga0207693_100453593 | 419 |
| 840 | 3300025944 | Ga0207661_10104229 | Ga0207661_101042292 | 419 |
| 841 | 3300037068 | Ga0373925_0081599 | Ga0373925_0081599_571_1884 | 419 |
| 842 | 3300037853 | Ga0436364_1435297 | Ga0436364_1435297_27301_28611 | 419 |
| 843 | 3300045976 | Ga0466967_0010721 | Ga0466967_0010721_676_1974 | 419 |
| 844 | 3300005435 | Ga0070714_100042573 | Ga0070714_1000425732 | 420 |
| 845 | 3300005436 | Ga0070713_100021199 | Ga0070713_1000211992 | 420 |
| 846 | 3300005471 | Ga0070698_100030094 | Ga0070698_1000300942 | 420 |
| 847 | 3300005536 | Ga0070697_100036724 | Ga0070697_1000367243 | 420 |
| 848 | 3300025922 | Ga0207646_10042854 | Ga0207646_100428542 | 420 |
| 849 | 3300035111 | Ga0373923_0009489 | Ga0373923_0009489_1668_2960 | 420 |
| 850 | 3300035113 | Ga0373936_0000519 | Ga0373936_0000519_9158_10450 | 420 |
| 851 | 3300035117 | Ga0373953_0003298 | Ga0373953_0003298_1338_2630 | 420 |
| 852 | 3300035118 | Ga0373954_0014349 | Ga0373954_0014349_738_2030 | 420 |
| 853 | 3300035120 | Ga0373957_0051606 | Ga0373957_0051606_235_1527 | 420 |
| 854 | 3300035692 | Ga0373935_0042798 | Ga0373935_0042798_1504_2796 | 420 |
| 855 | 3300037068 | Ga0373925_0045115 | Ga0373925_0045115_784_2076 | 420 |
| 856 | 3300046454 | Ga0495592_0015925 | Ga0495592_0015925_2402_3694 | 420 |
| 857 | 3300046459 | Ga0495629_0003190 | Ga0495629_0003190_6483_7775 | 420 |
| 858 | 3300046462 | Ga0495651_0059179 | Ga0495651_0059179_58_1350 | 420 |
| 859 | 3300046473 | Ga0495582_0013066 | Ga0495582_0013066_3266_4558 | 420 |
| 860 | 3300046475 | Ga0495639_0019856 | Ga0495639_0019856_573_1865 | 420 |
| 861 | 3300046476 | Ga0495662_0005395 | Ga0495662_0005395_4866_6158 | 420 |
| 862 | 3300046477 | Ga0495664_0003697 | Ga0495664_0003697_5326_6618 | 420 |
| 863 | 3300046514 | Ga0495618_0071028 | Ga0495618_0071028_738_2030 | 420 |
| 864 | 3300046517 | Ga0495630_0032481 | Ga0495630_0032481_738_2030 | 420 |
| 865 | 3300046533 | Ga0495640_0018263 | Ga0495640_0018263_2327_3619 | 420 |
| 866 | 3300046535 | Ga0495586_0107155 | Ga0495586_0107155_46_1338 | 420 |
| 867 | 3300046536 | Ga0495587_0091279 | Ga0495587_0091279_282_1574 | 420 |
| 868 | 3300046559 | Ga0495667_0068884 | Ga0495667_0068884_738_2030 | 420 |
| 869 | 3300046680 | Ga0495646_0018567 | Ga0495646_0018567_1101_2393 | 420 |
| 870 | 3300046683 | Ga0495658_0011377 | Ga0495658_0011377_1861_3153 | 420 |
| 871 | 3300046689 | Ga0495613_0053181 | Ga0495613_0053181_1616_2908 | 420 |
| 872 | 3300047315 | Ga0495581_0008059 | Ga0495581_0008059_13_1305 | 420 |
| 873 | 3300047317 | Ga0495604_0025456 | Ga0495604_0025456_1589_2881 | 420 |
| 874 | 3300047444 | Ga0495675_0005713 | Ga0495675_0005713_2907_4199 | 420 |
| 875 | 3300047673 | Ga0495593_0050767 | Ga0495593_0050767_719_2011 | 420 |
| 876 | 3300053077 | Ga0495601_0015602 | Ga0495601_0015602_2151_3443 | 420 |
| 877 | 3300053084 | Ga0495595_0002988 | Ga0495595_0002988_5228_6520 | 420 |
| 878 | 3300053085 | Ga0495619_0001449 | Ga0495619_0001449_11937_13229 | 420 |
| 879 | 3300005536 | Ga0070697_100049392 | Ga0070697_1000493923 | 421 |
| 880 | 3300022467 | Ga0224712_10040519 | Ga0224712_100405191 | 421 |
| 881 | 3300005471 | Ga0070698_100173688 | Ga0070698_1001736882 | 422 |
| 882 | 3300009147 | Ga0114129_10004398 | Ga0114129_1000439813 | 422 |
| 883 | 3300042993 | Ga0439440_0014134 | Ga0439440_0014134_358_1632 | 423 |
| 884 | 3300009553 | Ga0105249_10108817 | Ga0105249_101088172 | 424 |
| 885 | 3300009553 | Ga0105249_10172159 | Ga0105249_101721592 | 424 |
| 886 | 3300014745 | Ga0157377_10146693 | Ga0157377_101466932 | 424 |
| 887 | 3300037418 | Ga0395900_0125814 | Ga0395900_0125814_454_1731 | 424 |
| 888 | 3300009094 | Ga0111539_10184592 | Ga0111539_101845922 | 425 |
| 889 | 3300046491 | Ga0495584_0037466 | Ga0495584_0037466_491_1768 | 425 |
| 890 | 3300046615 | Ga0495656_0022991 | Ga0495656_0022991_491_1768 | 425 |
| 891 | 3300009011 | Ga0105251_10017533 | Ga0105251_100175332 | 426 |
| 892 | 3300009147 | Ga0114129_10018631 | Ga0114129_100186316 | 426 |
| 893 | 3300014325 | Ga0163163_10021984 | Ga0163163_100219845 | 426 |
| 894 | 3300048916 | Ga0496113_0121038 | Ga0496113_0121038_38_1318 | 426 |
| 895 | 3300005985 | Ga0081539_10021040 | Ga0081539_100210404 | 427 |
| 896 | 3300005354 | Ga0070675_100313505 | Ga0070675_1003135051 | 428 |
| 897 | 3300005444 | Ga0070694_100015852 | Ga0070694_1000158524 | 428 |
| 898 | 3300005471 | Ga0070698_100075801 | Ga0070698_1000758012 | 428 |
| 899 | 3300005549 | Ga0070704_100007803 | Ga0070704_1000078034 | 428 |
| 900 | 3300005719 | Ga0068861_100030613 | Ga0068861_1000306132 | 428 |
| 901 | 3300005937 | Ga0081455_10043919 | Ga0081455_100439194 | 428 |
| 902 | 3300006058 | Ga0075432_10000387 | Ga0075432_1000038710 | 428 |
| 903 | 3300006844 | Ga0075428_100065799 | Ga0075428_1000657994 | 428 |
| 904 | 3300006846 | Ga0075430_100051156 | Ga0075430_1000511562 | 428 |
| 905 | 3300006847 | Ga0075431_100036726 | Ga0075431_1000367262 | 428 |
| 906 | 3300006871 | Ga0075434_100014932 | Ga0075434_1000149325 | 428 |
| 907 | 3300025904 | Ga0207647_10063954 | Ga0207647_100639542 | 428 |
| 908 | 3300025935 | Ga0207709_10023700 | Ga0207709_100237003 | 428 |
| 909 | 3300025961 | Ga0207712_10043419 | Ga0207712_100434192 | 428 |
| 910 | 3300026118 | Ga0207675_100017867 | Ga0207675_1000178676 | 428 |
| 911 | 3300027907 | Ga0207428_10001001 | Ga0207428_1000100130 | 428 |
| 912 | 3300046689 | Ga0495613_0108031 | Ga0495613_0108031_523_1866 | 428 |
| 913 | 3300047318 | Ga0495636_0005073 | Ga0495636_0005073_454_1743 | 428 |
| 914 | 3300005937 | Ga0081455_10003773 | Ga0081455_100037737 | 429 |
| 915 | 3300005937 | Ga0081455_10071142 | Ga0081455_100711422 | 429 |
| 916 | 3300006058 | Ga0075432_10004840 | Ga0075432_100048404 | 429 |
| 917 | 3300006844 | Ga0075428_100089059 | Ga0075428_1000890593 | 429 |
| 918 | 3300006852 | Ga0075433_10005527 | Ga0075433_1000552713 | 429 |
| 919 | 3300006871 | Ga0075434_100005157 | Ga0075434_1000051577 | 429 |
| 920 | 3300009147 | Ga0114129_10026156 | Ga0114129_100261563 | 429 |
| 921 | 3300027907 | Ga0207428_10011760 | Ga0207428_100117605 | 429 |
| 922 | 3300050507 | nmdc:mga05p37_87829_c1 | nmdc:mga05p37_87829_c1_528_1826 | 429 |
| 923 | 3300050508 | nmdc:mga09592_86124_c1 | nmdc:mga09592_86124_c1_793_2091 | 429 |
| 924 | 3300050511 | nmdc:mga08y16_140196_c1 | nmdc:mga08y16_140196_c1_1011_2309 | 429 |
| 925 | 3300050512 | nmdc:mga0n895_16162_c1 | nmdc:mga0n895_16162_c1_3905_5203 | 429 |
| 926 | 3300050512 | nmdc:mga0n895_39305_c1 | nmdc:mga0n895_39305_c1_187_1491 | 429 |
| 927 | 3300001976 | JGI24752J21851_1002611 | JGI24752J21851_10026112 | 430 |
| 928 | 3300002155 | JGI24033J26618_1000486 | JGI24033J26618_10004862 | 430 |
| 929 | 3300002459 | JGI24751J29686_10000684 | JGI24751J29686_100006844 | 430 |
| 930 | 3300005344 | Ga0070661_100005479 | Ga0070661_1000054795 | 430 |
| 931 | 3300005406 | Ga0070703_10010304 | Ga0070703_100103042 | 430 |
| 932 | 3300005441 | Ga0070700_100009104 | Ga0070700_1000091044 | 430 |
| 933 | 3300005455 | Ga0070663_100018208 | Ga0070663_1000182083 | 430 |
| 934 | 3300005467 | Ga0070706_100298265 | Ga0070706_1002982651 | 430 |
| 935 | 3300005535 | Ga0070684_100003351 | Ga0070684_1000033515 | 430 |
| 936 | 3300005564 | Ga0070664_100002582 | Ga0070664_1000025826 | 430 |
| 937 | 3300005618 | Ga0068864_100114068 | Ga0068864_1001140682 | 430 |
| 938 | 3300005841 | Ga0068863_100006801 | Ga0068863_1000068015 | 430 |
| 939 | 3300025885 | Ga0207653_10002058 | Ga0207653_100020584 | 430 |
| 940 | 3300025908 | Ga0207643_10000055 | Ga0207643_1000005579 | 430 |
| 941 | 3300025920 | Ga0207649_10020440 | Ga0207649_100204402 | 430 |
| 942 | 3300025925 | Ga0207650_10001024 | Ga0207650_100010246 | 430 |
| 943 | 3300025945 | Ga0207679_10002946 | Ga0207679_100029469 | 430 |
| 944 | 3300026067 | Ga0207678_10032965 | Ga0207678_100329653 | 430 |
| 945 | 3300026075 | Ga0207708_10005684 | Ga0207708_100056845 | 430 |
| 946 | 3300026088 | Ga0207641_10071720 | Ga0207641_100717203 | 430 |
| 947 | 3300026095 | Ga0207676_10001452 | Ga0207676_1000145216 | 430 |
| 948 | 3300026116 | Ga0207674_10000186 | Ga0207674_1000018679 | 430 |
| 949 | 3300026118 | Ga0207675_100163300 | Ga0207675_1001633002 | 430 |
| 950 | 3300046523 | Ga0495644_0027858 | Ga0495644_0027858_733_2025 | 430 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bvt-assembly1.cif.gz_A | crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis | 0.92 | 35 | 426 |
| 7bvt-assembly1.cif.gz_A | crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis | 0.9109 | 35 | 426 |
| 3uor-assembly2.cif.gz_B | the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri | 0.8823 | 37 | 428 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.8742 | 37 | 428 |
| 1n3x-assembly1.cif.gz_A | ligand-free high-affinity maltose-binding protein | 0.8715 | 38 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uorB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8736 | 37 | 149 | 3.40.190.10 |
| 4hs7A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8679 | 36 | 150 | 3.40.190.10 |
| af_O53485_33_438_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8674 | 38 | 427 | 3.40.190.10 |
| 3n95B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8632 | 38 | 150 | 3.40.190.10 |
| 4rjzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8556 | 37 | 149 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661VLR6-F1-model_v4 | ABC transporter substrate-binding protein | 0.8946 | 129 | 428 |
GO:0030313
|
| AF-A0A0S7XGC0-F1-model_v4 | ABC transporter substrate-binding protein | 0.8942 | 27 | 428 |
GO:0015768
GO:0042956 GO:0055052 GO:1901982 |
| AF-A0A496QBQ7-F1-model_v4 | ABC transporter substrate-binding protein | 0.8915 | 128 | 426 |
GO:0030313
|
| AF-D8H0S8-F1-model_v4 | deleted | 0.8882 | 91 | 429 |
|
| AF-A0A496QBQ7-F1-model_v4 | ABC transporter substrate-binding protein | 0.883 | 128 | 426 |
GO:0030313
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar