F486544

General Info

Members Datasets Scaffolds Average Seq Length
950 392 942 411

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100011909|Ga0068869_1000119094
Length 448
Sequence MRPLAAAIKIRLRECALYIAHSRIILDHTARELRSSTQRTSVPSAHPAPCEGVSTVTRPRLPTKITVWNGWTDVQAENFTRLLDQYNKEHPDVQVTQLVTPSDQVLQKVLTAVRGNSAPDVAYMFGSWSPNIAEIPQVVNMAEYVKQPDWKWDDFYPGERAAATVGDKVVGVPALVDNLAIVYNKTLFEQAGLTPPTSAAAKLTDPAKGQYGWSIPADGSEDTVWHYLPMLWEAGGDLLTPDNQHAAFNSEAGVKALTTLQQMAVTDKSLYVDTTNQEYSKLFTAGKIGMLVTGPWDLGTFSDVDYGVQIMPTYTGSAGGHQTISGPDNWVVFDNGAQRKQAAIDFVKWLTAAPQVKSTSLTTADLPTRISVGDDSAFVAELNEKQPGSEVFVHNLANAQKARPTVSQYPKISEALGQAIVSVLLGKAQPADALNTAAQTTDAALAEK

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
5 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
6 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
7 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
198 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
199 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
382 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
383 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
389 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.63
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 8.32
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002611 3300001976 Bacteria 2399
2 JGI24746J21847_1000089 3300001977 Bacteria 10008
3 JGI24743J22301_10000709 3300001991 Bacteria 4122
4 JGI24033J26618_1000486 3300002155 Bacteria 3902
5 JGI24751J29686_10000684 3300002459 Bacteria 8434
6 JGI24751J29686_10009198 3300002459 Bacteria 2029
7 JGI24751J29686_10016832 3300002459 Bacteria 1509
8 JGI25404J52841_10001437 3300003659 Bacteria 4191
9 Ga0055540_1001155 3300003792 Bacteria 16426
10 Ga0055540_1002276 3300003792 Bacteria 10354
11 Ga0058861_11975033 3300004800 Bacteria 1991
12 Ga0058862_10034740 3300004803 Bacteria 1396
13 Ga0070658_10093466 3300005327 Bacteria 2481
14 Ga0070683_100199128 3300005329 Bacteria 1902
15 Ga0070670_100088619 3300005331 Bacteria 2660
16 Ga0068869_100011909 3300005334 Bacteria 5722
17 Ga0068869_100068037 3300005334 Bacteria 2629
18 Ga0070680_100072410 3300005336 Bacteria 2832
19 Ga0070682_100022719 3300005337 Bacteria 3718
20 Ga0070682_100049408 3300005337 Bacteria 2622
21 Ga0068868_100000529 3300005338 Bacteria 25593
22 Ga0068868_100014372 3300005338 Bacteria 5834
23 Ga0070660_100188515 3300005339 Bacteria 1670
24 Ga0070660_100222383 3300005339 Bacteria 1535
25 Ga0070691_10011823 3300005341 Bacteria 3994
26 Ga0070661_100005479 3300005344 Bacteria 8752
27 Ga0070661_100009141 3300005344 Bacteria 6848
28 Ga0070668_100005441 3300005347 Bacteria 9451
29 Ga0070668_100055714 3300005347 Bacteria 3052
30 Ga0070675_100063813 3300005354 Bacteria 3045
31 Ga0070675_100313505 3300005354 Bacteria 1384
32 Ga0070671_100010460 3300005355 Bacteria 7442
33 Ga0070671_100013019 3300005355 Bacteria 6704
34 Ga0070671_100047247 3300005355 Bacteria 3580
35 Ga0070674_100002482 3300005356 Bacteria 10217
36 Ga0070674_100003430 3300005356 Bacteria 8897
37 Ga0070674_100021807 3300005356 Bacteria 4121
38 Ga0070673_100010279 3300005364 Bacteria 6329
39 Ga0070688_100005859 3300005365 Bacteria 6503
40 Ga0070667_100002267 3300005367 Bacteria 16931
41 Ga0070667_100105326 3300005367 Bacteria 2441
42 Ga0070667_100212282 3300005367 Bacteria 1721
43 Ga0070703_10000001 3300005406 Bacteria 202194
44 Ga0070703_10010304 3300005406 Bacteria 2634
45 Ga0070709_10000243 3300005434 Bacteria 35120
46 Ga0070709_10000794 3300005434 Bacteria 17668
47 Ga0070709_10012534 3300005434 Bacteria 4746
48 Ga0070709_10022973 3300005434 Bacteria 3656
49 Ga0070709_10079546 3300005434 Bacteria 2135
50 Ga0070709_10173787 3300005434 Bacteria 1507
51 Ga0070714_100000640 3300005435 Bacteria 24879
52 Ga0070714_100004478 3300005435 Bacteria 10525
53 Ga0070714_100040816 3300005435 Bacteria 3912
54 Ga0070714_100042573 3300005435 Bacteria 3837
55 Ga0070714_100060030 3300005435 Bacteria 3263
56 Ga0070714_100180351 3300005435 Bacteria 1921
57 Ga0070714_100180693 3300005435 Bacteria 1919
58 Ga0070713_100000428 3300005436 Bacteria 26844
59 Ga0070713_100004385 3300005436 Bacteria 9479
60 Ga0070713_100021199 3300005436 Bacteria 4993
61 Ga0070713_100023985 3300005436 Bacteria 4744
62 Ga0070713_100025930 3300005436 Bacteria 4593
63 Ga0070713_100113829 3300005436 Bacteria 2362
64 Ga0070710_10000101 3300005437 Bacteria 39498
65 Ga0070710_10000900 3300005437 Bacteria 14236
66 Ga0070710_10001923 3300005437 Bacteria 9836
67 Ga0070710_10003412 3300005437 Bacteria 7527
68 Ga0070710_10073616 3300005437 Bacteria 1976
69 Ga0070701_10003486 3300005438 Bacteria 6233
70 Ga0070701_10023934 3300005438 Bacteria 2948
71 Ga0070711_100000437 3300005439 Bacteria 21680
72 Ga0070711_100001095 3300005439 Bacteria 14465
73 Ga0070711_100001607 3300005439 Bacteria 12467
74 Ga0070711_100004296 3300005439 Bacteria 8388
75 Ga0070711_100004473 3300005439 Bacteria 8258
76 Ga0070711_100105261 3300005439 Bacteria 2060
77 Ga0070711_100147979 3300005439 Bacteria 1768
78 Ga0070705_100018343 3300005440 Bacteria 3667
79 Ga0070705_100027798 3300005440 Bacteria 3091
80 Ga0070705_100038364 3300005440 Bacteria 2710
81 Ga0070700_100008542 3300005441 Bacteria 5575
82 Ga0070700_100009104 3300005441 Bacteria 5441
83 Ga0070700_100018846 3300005441 Bacteria 3974
84 Ga0070700_100049200 3300005441 Bacteria 2616
85 Ga0070694_100015852 3300005444 Bacteria 4741
86 Ga0070694_100033732 3300005444 Bacteria 3371
87 Ga0070694_100041620 3300005444 Bacteria 3066
88 Ga0070708_100001067 3300005445 Bacteria 20944
89 Ga0070708_100287649 3300005445 Bacteria 1547
90 Ga0070663_100004269 3300005455 Bacteria 8363
91 Ga0070663_100018208 3300005455 Bacteria 4599
92 Ga0070663_100140945 3300005455 Bacteria 1841
93 Ga0070678_100009361 3300005456 Bacteria 5929
94 Ga0070678_100067738 3300005456 Bacteria 2658
95 Ga0070662_100009027 3300005457 Bacteria 6502
96 Ga0070662_100017040 3300005457 Bacteria 4889
97 Ga0070662_100044175 3300005457 Bacteria 3190
98 Ga0070681_10126386 3300005458 Bacteria 2489
99 Ga0068867_100001323 3300005459 Bacteria 17157
100 Ga0068867_100002000 3300005459 Bacteria 14225
101 Ga0068867_100149122 3300005459 Bacteria 1835
102 Ga0070685_10050343 3300005466 Bacteria 2406
103 Ga0070706_100003990 3300005467 Bacteria 14367
104 Ga0070706_100010233 3300005467 Bacteria 8717
105 Ga0070706_100030567 3300005467 Bacteria 4964
106 Ga0070706_100298265 3300005467 Bacteria 1504
107 Ga0070707_100000041 3300005468 Bacteria 111077
108 Ga0070707_100008503 3300005468 Bacteria 9535
109 Ga0070707_100011276 3300005468 Bacteria 8333
110 Ga0070707_100031450 3300005468 Bacteria 5056
111 Ga0070707_100140216 3300005468 Bacteria 2353
112 Ga0070698_100000082 3300005471 Bacteria 73573
113 Ga0070698_100030094 3300005471 Bacteria 5633
114 Ga0070698_100051050 3300005471 Bacteria 4214
115 Ga0070698_100075801 3300005471 Bacteria 3367
116 Ga0070698_100173688 3300005471 Bacteria 2095
117 Ga0070684_100003351 3300005535 Bacteria 12004
118 Ga0070684_100031025 3300005535 Bacteria 4547
119 Ga0070684_100082513 3300005535 Bacteria 2846
120 Ga0070697_100036724 3300005536 Bacteria 3958
121 Ga0070697_100049392 3300005536 Bacteria 3415
122 Ga0068853_100008397 3300005539 Bacteria 8294
123 Ga0068853_100016775 3300005539 Bacteria 6034
124 Ga0068853_100049796 3300005539 Bacteria 3601
125 Ga0068853_100069006 3300005539 Bacteria 3074
126 Ga0070672_100162157 3300005543 Bacteria 1856
127 Ga0070695_100010024 3300005545 Bacteria 5651
128 Ga0070695_100139249 3300005545 Bacteria 1681
129 Ga0070695_100182054 3300005545 Bacteria 1490
130 Ga0070696_100003305 3300005546 Bacteria 10765
131 Ga0070696_100005272 3300005546 Bacteria 8629
132 Ga0070696_100058492 3300005546 Bacteria 2692
133 Ga0070696_100063569 3300005546 Bacteria 2585
134 Ga0070693_100001858 3300005547 Bacteria 9651
135 Ga0070665_100001745 3300005548 Bacteria 24881
136 Ga0070665_100009958 3300005548 Bacteria 9614
137 Ga0070665_100022355 3300005548 Bacteria 6364
138 Ga0070665_100045725 3300005548 Bacteria 4396
139 Ga0070665_100096225 3300005548 Bacteria 2966
140 Ga0070704_100000706 3300005549 Bacteria 16275
141 Ga0070704_100004595 3300005549 Bacteria 7982
142 Ga0070704_100007803 3300005549 Bacteria 6381
143 Ga0068855_100055086 3300005563 Bacteria 4672
144 Ga0068855_100076751 3300005563 Bacteria 3876
145 Ga0070664_100002582 3300005564 Bacteria 14605
146 Ga0068857_100017591 3300005577 Bacteria 6267
147 Ga0068854_100005243 3300005578 Bacteria 8178
148 Ga0070702_100001404 3300005615 Bacteria 9838
149 Ga0070702_100017389 3300005615 Bacteria 3708
150 Ga0070702_100148897 3300005615 Unclassified 1500
151 Ga0068852_100156097 3300005616 Bacteria 2126
152 Ga0068859_100003134 3300005617 Bacteria 16809
153 Ga0068864_100020685 3300005618 Bacteria 5506
154 Ga0068864_100098059 3300005618 Bacteria 2595
155 Ga0068864_100114068 3300005618 Bacteria 2409
156 Ga0068866_10000376 3300005718 Bacteria 21007
157 Ga0068866_10013060 3300005718 Bacteria 3633
158 Ga0068866_10057117 3300005718 Bacteria 2010
159 Ga0068861_100025534 3300005719 Bacteria 4286
160 Ga0068861_100030613 3300005719 Bacteria 3946
161 Ga0068861_100052331 3300005719 Bacteria 3103
162 Ga0068870_10029598 3300005840 Bacteria 2760
163 Ga0068863_100001514 3300005841 Bacteria 22958
164 Ga0068863_100006801 3300005841 Bacteria 11207
165 Ga0068858_100002465 3300005842 Bacteria 18668
166 Ga0068858_100071177 3300005842 Bacteria 3225
167 Ga0068858_100080445 3300005842 Bacteria 3028
168 Ga0068858_100113426 3300005842 Bacteria 2531
169 Ga0068860_100025928 3300005843 Bacteria 5656
170 Ga0068860_100115207 3300005843 Bacteria 2570
171 Ga0068860_100249342 3300005843 Bacteria 1728
172 Ga0068862_100043121 3300005844 Bacteria 3845
173 Ga0081455_10001614 3300005937 Bacteria 27559
174 Ga0081455_10003773 3300005937 Bacteria 17295
175 Ga0081455_10043919 3300005937 Bacteria 3905
176 Ga0081455_10071142 3300005937 Bacteria 2885
177 Ga0081538_10000404 3300005981 Bacteria 48911
178 Ga0081540_1000505 3300005983 Bacteria 38435
179 Ga0081539_10021040 3300005985 Bacteria 4377
180 Ga0070717_10000956 3300006028 Bacteria 19241
181 Ga0070717_10007851 3300006028 Bacteria 7943
182 Ga0070717_10034864 3300006028 Bacteria 4070
183 Ga0070717_10047787 3300006028 Bacteria 3508
184 Ga0070717_10064802 3300006028 Bacteria 3036
185 Ga0075365_10015384 3300006038 Bacteria 4627
186 Ga0075365_10090040 3300006038 Bacteria 2089
187 Ga0075365_10140439 3300006038 Bacteria 1677
188 Ga0075363_100000787 3300006048 Bacteria 10932
189 Ga0075363_100060987 3300006048 Bacteria 2031
190 Ga0075363_100077904 3300006048 Bacteria 1809
191 Ga0075363_100087743 3300006048 Bacteria 1709
192 Ga0075363_100115160 3300006048 Bacteria 1497
193 Ga0075364_10000184 3300006051 Bacteria 28604
194 Ga0075364_10006965 3300006051 Bacteria 6679
195 Ga0075364_10076198 3300006051 Bacteria 2213
196 Ga0075432_10000387 3300006058 Bacteria 12750
197 Ga0075432_10004840 3300006058 Bacteria 4582
198 Ga0070715_10004042 3300006163 Bacteria 4759
199 Ga0070715_10013894 3300006163 Bacteria 2968
200 Ga0070715_10023722 3300006163 Bacteria 2407
201 Ga0070716_100000560 3300006173 Bacteria 15555
202 Ga0070716_100002661 3300006173 Bacteria 8264
203 Ga0070716_100004017 3300006173 Bacteria 6984
204 Ga0070716_100005420 3300006173 Bacteria 6179
205 Ga0070716_100006565 3300006173 Bacteria 5687
206 Ga0070712_100001062 3300006175 Bacteria 16596
207 Ga0070712_100002191 3300006175 Bacteria 12010
208 Ga0070712_100012459 3300006175 Bacteria 5406
209 Ga0070712_100017727 3300006175 Bacteria 4612
210 Ga0070712_100102759 3300006175 Bacteria 2117
211 Ga0070712_100126999 3300006175 Bacteria 1928
212 Ga0075367_10001919 3300006178 Bacteria 9229
213 Ga0075367_10088124 3300006178 Bacteria 1886
214 Ga0075369_10001370 3300006186 Bacteria 8293
215 Ga0075369_10037641 3300006186 Bacteria 2061
216 Ga0097621_100015140 3300006237 Bacteria 5795
217 Ga0097621_100073596 3300006237 Bacteria 2828
218 Ga0075370_10008783 3300006353 Bacteria 5215
219 Ga0075370_10033932 3300006353 Bacteria 2860
220 Ga0075370_10044383 3300006353 Bacteria 2513
221 Ga0068871_100018339 3300006358 Bacteria 5316
222 Ga0068871_100189674 3300006358 Bacteria 1770
223 Ga0075428_100065799 3300006844 Bacteria 3969
224 Ga0075428_100089059 3300006844 Bacteria 3366
225 Ga0075430_100051156 3300006846 Bacteria 3482
226 Ga0075431_100036726 3300006847 Bacteria 5046
227 Ga0075433_10005527 3300006852 Bacteria 9923
228 Ga0075433_10012875 3300006852 Bacteria 6777
229 Ga0075433_10163690 3300006852 Bacteria 1980
230 Ga0075434_100003943 3300006871 Bacteria 13290
231 Ga0075434_100005157 3300006871 Bacteria 11860
232 Ga0075434_100008894 3300006871 Bacteria 9348
233 Ga0075434_100014932 3300006871 Bacteria 7431
234 Ga0068865_100000828 3300006881 Bacteria 17443
235 Ga0068865_100022777 3300006881 Bacteria 4092
236 Ga0068865_100028975 3300006881 Bacteria 3669
237 Ga0068865_100029811 3300006881 Bacteria 3624
238 Ga0097620_100003133 3300006931 Bacteria 16809
239 Ga0075435_100007491 3300007076 Bacteria 7786
240 Ga0075435_100107436 3300007076 Bacteria 2318
241 Ga0105251_10017533 3300009011 Bacteria 3834
242 Ga0111539_10184592 3300009094 Bacteria 2436
243 Ga0105245_10003220 3300009098 Bacteria 14625
244 Ga0105245_10018583 3300009098 Bacteria 6080
245 Ga0105245_10107688 3300009098 Bacteria 2588
246 Ga0105245_10116217 3300009098 Bacteria 2494
247 Ga0105245_10133233 3300009098 Bacteria 2333
248 Ga0105245_10162114 3300009098 Bacteria 2123
249 Ga0105245_10171307 3300009098 Bacteria 2067
250 Ga0105247_10000334 3300009101 Bacteria 41242
251 Ga0105247_10029448 3300009101 Bacteria 3327
252 Ga0105247_10069989 3300009101 Bacteria 2191
253 Ga0114129_10004398 3300009147 Bacteria 19873
254 Ga0114129_10018631 3300009147 Bacteria 9882
255 Ga0114129_10019233 3300009147 Bacteria 9728
256 Ga0114129_10026156 3300009147 Bacteria 8264
257 Ga0114129_10039891 3300009147 Bacteria 6623
258 Ga0114129_10223859 3300009147 Bacteria 2537
259 Ga0105243_10005418 3300009148 Bacteria 9960
260 Ga0105243_10006751 3300009148 Bacteria 8853
261 Ga0105243_10007191 3300009148 Bacteria 8556
262 Ga0105243_10116559 3300009148 Bacteria 2244
263 Ga0105241_10019951 3300009174 Bacteria 4948
264 Ga0105242_10000620 3300009176 Bacteria 27832
265 Ga0105242_10002226 3300009176 Bacteria 15303
266 Ga0105242_10002528 3300009176 Bacteria 14350
267 Ga0105242_10042211 3300009176 Bacteria 3682
268 Ga0105242_10052953 3300009176 Bacteria 3313
269 Ga0105248_10004419 3300009177 Bacteria 15561
270 Ga0105248_10025304 3300009177 Bacteria 6599
271 Ga0105248_10044839 3300009177 Bacteria 4960
272 Ga0105237_10000178 3300009545 Bacteria 89960
273 Ga0105237_10002564 3300009545 Bacteria 22427
274 Ga0105237_10034235 3300009545 Bacteria 5144
275 Ga0105237_10051382 3300009545 Bacteria 4140
276 Ga0105238_10093468 3300009551 Bacteria 2995
277 Ga0105238_10195444 3300009551 Bacteria 1999
278 Ga0105249_10000767 3300009553 Bacteria 28791
279 Ga0105249_10012184 3300009553 Bacteria 7573
280 Ga0105249_10053836 3300009553 Bacteria 3678
281 Ga0105249_10108817 3300009553 Bacteria 2617
282 Ga0105249_10172159 3300009553 Bacteria 2101
283 Ga0105239_10002879 3300010375 Bacteria 21522
284 Ga0105239_10007516 3300010375 Bacteria 12498
285 Ga0105239_10030663 3300010375 Bacteria 5914
286 Ga0105239_10059987 3300010375 Bacteria 4174
287 Ga0105239_10228472 3300010375 Bacteria 2088
288 Ga0105239_10269472 3300010375 Archaea 1915
289 Ga0105246_10066414 3300011119 Bacteria 2525
290 Ga0105246_10140320 3300011119 Bacteria 1816
291 Ga0157373_10015473 3300013100 Bacteria 5577
292 Ga0157371_10099871 3300013102 Bacteria 2058
293 Ga0157370_10030713 3300013104 Bacteria 5263
294 Ga0157369_10003613 3300013105 Bacteria 18373
295 Ga0157374_10035561 3300013296 Bacteria 4558
296 Ga0157374_10067899 3300013296 Bacteria 3353
297 Ga0157374_10232882 3300013296 Bacteria 1810
298 Ga0157378_10001690 3300013297 Bacteria 19860
299 Ga0157378_10018845 3300013297 Bacteria 6066
300 Ga0157378_10019027 3300013297 Bacteria 6035
301 Ga0157378_10089398 3300013297 Bacteria 2797
302 Ga0163162_10026392 3300013306 Bacteria 5740
303 Ga0163162_10027146 3300013306 Bacteria 5661
304 Ga0163162_10174064 3300013306 Bacteria 2277
305 Ga0163162_10205789 3300013306 Bacteria 2097
306 Ga0157372_10171892 3300013307 Bacteria 2507
307 Ga0157372_10341252 3300013307 Bacteria 1745
308 Ga0157375_10003452 3300013308 Bacteria 13692
309 Ga0157375_10042351 3300013308 Bacteria 4407
310 Ga0157375_10122797 3300013308 Bacteria 2709
311 Ga0163163_10002897 3300014325 Bacteria 14510
312 Ga0163163_10008170 3300014325 Bacteria 9282
313 Ga0163163_10021984 3300014325 Bacteria 6030
314 Ga0163163_10032021 3300014325 Bacteria 5078
315 Ga0163163_10067769 3300014325 Bacteria 3549
316 Ga0163163_10385973 3300014325 Bacteria 1458
317 Ga0157380_10003813 3300014326 Bacteria 10374
318 Ga0157377_10007912 3300014745 Bacteria 5159
319 Ga0157377_10122128 3300014745 Bacteria 1580
320 Ga0157377_10146693 3300014745 Bacteria 1455
321 Ga0157379_10004932 3300014968 Bacteria 11450
322 Ga0157379_10069475 3300014968 Bacteria 3150
323 Ga0157376_10022035 3300014969 Bacteria 4957
324 Ga0157376_10023837 3300014969 Bacteria 4798
325 Ga0157376_10083979 3300014969 Bacteria 2741
326 Ga0163161_10061975 3300017792 Bacteria 2724
327 Ga0163161_10171762 3300017792 Bacteria 1658
328 Ga0206352_10246956 3300020078 Bacteria 1383
329 Ga0206353_11818343 3300020082 Bacteria 4369
330 Ga0213875_10000570 3300021388 Bacteria 30105
331 Ga0213875_10000604 3300021388 Bacteria 29093
332 Ga0224712_10040519 3300022467 Bacteria 1753
333 Ga0224712_10065178 3300022467 Bacteria 1463
334 Ga0209051_1000528 3300025303 Bacteria 47444
335 Ga0209051_1001208 3300025303 Bacteria 23322
336 Ga0209051_1006114 3300025303 Bacteria 6849
337 Ga0209051_1008439 3300025303 Bacteria 5451
338 Ga0209051_1028496 3300025303 Bacteria 2205
339 Ga0207656_10030145 3300025321 Bacteria 2239
340 Ga0207653_10000004 3300025885 Bacteria 263142
341 Ga0207653_10002058 3300025885 Bacteria 6408
342 Ga0207692_10001870 3300025898 Bacteria 7987
343 Ga0207642_10002962 3300025899 Bacteria 5313
344 Ga0207642_10012124 3300025899 Bacteria 3101
345 Ga0207642_10030974 3300025899 Bacteria 2236
346 Ga0207710_10001088 3300025900 Bacteria 13985
347 Ga0207710_10081651 3300025900 Bacteria 1501
348 Ga0207688_10000352 3300025901 Bacteria 21384
349 Ga0207688_10001514 3300025901 Bacteria 12214
350 Ga0207688_10014587 3300025901 Bacteria 4269
351 Ga0207647_10063954 3300025904 Bacteria 2237
352 Ga0207647_10079885 3300025904 Bacteria 1962
353 Ga0207685_10001280 3300025905 Bacteria 5144
354 Ga0207685_10003910 3300025905 Bacteria 3698
355 Ga0207699_10000156 3300025906 Bacteria 42514
356 Ga0207699_10002495 3300025906 Bacteria 8691
357 Ga0207699_10028701 3300025906 Bacteria 3095
358 Ga0207643_10000055 3300025908 Bacteria 73929
359 Ga0207643_10002720 3300025908 Bacteria 9565
360 Ga0207684_10000339 3300025910 Bacteria 65102
361 Ga0207684_10000911 3300025910 Bacteria 33666
362 Ga0207684_10057831 3300025910 Bacteria 3290
363 Ga0207654_10092056 3300025911 Bacteria 1851
364 Ga0207671_10008270 3300025914 Bacteria 8850
365 Ga0207671_10011790 3300025914 Bacteria 7076
366 Ga0207693_10000199 3300025915 Bacteria 54571
367 Ga0207693_10001171 3300025915 Bacteria 23404
368 Ga0207693_10001690 3300025915 Bacteria 19437
369 Ga0207693_10002490 3300025915 Bacteria 16019
370 Ga0207693_10005402 3300025915 Bacteria 10677
371 Ga0207693_10045359 3300025915 Bacteria 3454
372 Ga0207693_10061181 3300025915 Bacteria 2949
373 Ga0207693_10089600 3300025915 Bacteria 2411
374 Ga0207693_10093630 3300025915 Bacteria 2355
375 Ga0207663_10001603 3300025916 Bacteria 10631
376 Ga0207663_10005265 3300025916 Bacteria 6513
377 Ga0207663_10006245 3300025916 Bacteria 6079
378 Ga0207663_10014279 3300025916 Bacteria 4343
379 Ga0207663_10017362 3300025916 Bacteria 4008
380 Ga0207663_10021617 3300025916 Bacteria 3665
381 Ga0207662_10004973 3300025918 Bacteria 7033
382 Ga0207657_10030438 3300025919 Bacteria 4899
383 Ga0207657_10072009 3300025919 Bacteria 2925
384 Ga0207649_10020440 3300025920 Bacteria 3798
385 Ga0207649_10082505 3300025920 Bacteria 2084
386 Ga0207646_10000061 3300025922 Bacteria 151425
387 Ga0207646_10005885 3300025922 Bacteria 12805
388 Ga0207646_10007478 3300025922 Bacteria 11089
389 Ga0207646_10009346 3300025922 Bacteria 9691
390 Ga0207646_10042854 3300025922 Bacteria 4066
391 Ga0207650_10001024 3300025925 Bacteria 20982
392 Ga0207650_10020009 3300025925 Bacteria 4713
393 Ga0207659_10138959 3300025926 Bacteria 1884
394 Ga0207687_10001147 3300025927 Bacteria 18035
395 Ga0207687_10029528 3300025927 Bacteria 3689
396 Ga0207687_10165851 3300025927 Bacteria 1699
397 Ga0207700_10000063 3300025928 Bacteria 65696
398 Ga0207700_10016567 3300025928 Bacteria 4900
399 Ga0207700_10026919 3300025928 Bacteria 4018
400 Ga0207700_10029262 3300025928 Bacteria 3884
401 Ga0207700_10029504 3300025928 Bacteria 3871
402 Ga0207700_10055669 3300025928 Bacteria 2974
403 Ga0207700_10109651 3300025928 Bacteria 2219
404 Ga0207664_10000196 3300025929 Bacteria 45388
405 Ga0207664_10001029 3300025929 Bacteria 18674
406 Ga0207664_10002329 3300025929 Bacteria 12548
407 Ga0207664_10021830 3300025929 Bacteria 4770
408 Ga0207664_10024393 3300025929 Bacteria 4544
409 Ga0207664_10032064 3300025929 Bacteria 4025
410 Ga0207664_10044307 3300025929 Bacteria 3483
411 Ga0207664_10047539 3300025929 Bacteria 3371
412 Ga0207664_10056440 3300025929 Bacteria 3119
413 Ga0207664_10243144 3300025929 Bacteria 1568
414 Ga0207664_10272932 3300025929 Bacteria 1482
415 Ga0207664_10331043 3300025929 Bacteria 1345
416 Ga0207644_10005208 3300025931 Bacteria 8493
417 Ga0207644_10031027 3300025931 Bacteria 3721
418 Ga0207644_10103641 3300025931 Bacteria 2141
419 Ga0207690_10028152 3300025932 Bacteria 3559
420 Ga0207690_10054150 3300025932 Bacteria 2696
421 Ga0207706_10001128 3300025933 Bacteria 27189
422 Ga0207706_10009818 3300025933 Bacteria 8781
423 Ga0207706_10019781 3300025933 Bacteria 6054
424 Ga0207706_10022575 3300025933 Bacteria 5647
425 Ga0207686_10002468 3300025934 Bacteria 10044
426 Ga0207686_10005839 3300025934 Bacteria 6603
427 Ga0207686_10006248 3300025934 Bacteria 6406
428 Ga0207686_10037607 3300025934 Bacteria 2922
429 Ga0207709_10007186 3300025935 Bacteria 6215
430 Ga0207709_10017218 3300025935 Bacteria 4030
431 Ga0207709_10023700 3300025935 Bacteria 3496
432 Ga0207709_10034736 3300025935 Bacteria 2975
433 Ga0207709_10196818 3300025935 Unclassified 1436
434 Ga0207670_10127309 3300025936 Bacteria 1860
435 Ga0207669_10032348 3300025937 Bacteria 2936
436 Ga0207669_10057020 3300025937 Bacteria 2376
437 Ga0207669_10058311 3300025937 Bacteria 2355
438 Ga0207704_10000377 3300025938 Bacteria 20506
439 Ga0207704_10012981 3300025938 Bacteria 4153
440 Ga0207704_10044070 3300025938 Bacteria 2640
441 Ga0207704_10132560 3300025938 Bacteria 1729
442 Ga0207665_10000226 3300025939 Bacteria 38498
443 Ga0207665_10001670 3300025939 Bacteria 14929
444 Ga0207665_10005772 3300025939 Bacteria 8231
445 Ga0207665_10013801 3300025939 Bacteria 5314
446 Ga0207665_10056850 3300025939 Bacteria 2642
447 Ga0207665_10058954 3300025939 Bacteria 2597
448 Ga0207665_10059404 3300025939 Bacteria 2588
449 Ga0207665_10067547 3300025939 Bacteria 2435
450 Ga0207665_10073331 3300025939 Bacteria 2341
451 Ga0207691_10033981 3300025940 Bacteria 4746
452 Ga0207691_10040532 3300025940 Bacteria 4302
453 Ga0207711_10108185 3300025941 Bacteria 2469
454 Ga0207711_10165028 3300025941 Bacteria 2007
455 Ga0207689_10002296 3300025942 Bacteria 17905
456 Ga0207689_10009916 3300025942 Bacteria 8213
457 Ga0207689_10025969 3300025942 Bacteria 4905
458 Ga0207661_10082020 3300025944 Bacteria 2665
459 Ga0207661_10097199 3300025944 Bacteria 2465
460 Ga0207661_10104229 3300025944 Bacteria 2388
461 Ga0207679_10002946 3300025945 Bacteria 10545
462 Ga0207679_10169321 3300025945 Bacteria 1797
463 Ga0207667_10107381 3300025949 Bacteria 2880
464 Ga0207651_10050424 3300025960 Bacteria 2826
465 Ga0207712_10006309 3300025961 Bacteria 7477
466 Ga0207712_10043419 3300025961 Bacteria 3101
467 Ga0207668_10056080 3300025972 Bacteria 2742
468 Ga0207640_10003409 3300025981 Bacteria 8561
469 Ga0207658_10012179 3300025986 Bacteria 5867
470 Ga0207677_10011441 3300026023 Bacteria 5061
471 Ga0207703_10014135 3300026035 Bacteria 6223
472 Ga0207703_10018284 3300026035 Bacteria 5473
473 Ga0207703_10053855 3300026035 Bacteria 3271
474 Ga0207678_10001390 3300026067 Bacteria 22261
475 Ga0207678_10016407 3300026067 Bacteria 6503
476 Ga0207678_10032965 3300026067 Bacteria 4513
477 Ga0207678_10045686 3300026067 Bacteria 3787
478 Ga0207708_10003968 3300026075 Bacteria 10890
479 Ga0207708_10005234 3300026075 Bacteria 9557
480 Ga0207708_10005684 3300026075 Bacteria 9215
481 Ga0207708_10006707 3300026075 Bacteria 8516
482 Ga0207702_10138335 3300026078 Bacteria 2200
483 Ga0207641_10003507 3300026088 Bacteria 13886
484 Ga0207641_10071720 3300026088 Bacteria 2980
485 Ga0207648_10001355 3300026089 Bacteria 27091
486 Ga0207648_10004217 3300026089 Bacteria 14857
487 Ga0207648_10026700 3300026089 Bacteria 5129
488 Ga0207648_10103641 3300026089 Bacteria 2495
489 Ga0207676_10001452 3300026095 Bacteria 17629
490 Ga0207676_10016180 3300026095 Bacteria 5399
491 Ga0207676_10022955 3300026095 Bacteria 4594
492 Ga0207674_10000186 3300026116 Bacteria 75904
493 Ga0207674_10010966 3300026116 Bacteria 10198
494 Ga0207674_10150848 3300026116 Bacteria 2282
495 Ga0207675_100013054 3300026118 Bacteria 7753
496 Ga0207675_100015022 3300026118 Bacteria 7224
497 Ga0207675_100017867 3300026118 Bacteria 6615
498 Ga0207675_100040429 3300026118 Bacteria 4355
499 Ga0207675_100078529 3300026118 Bacteria 3092
500 Ga0207675_100163300 3300026118 Bacteria 2126
501 Ga0207683_10000201 3300026121 Bacteria 51559
502 Ga0207683_10008060 3300026121 Bacteria 9009
503 Ga0207683_10027425 3300026121 Bacteria 4922
504 Ga0207698_10205597 3300026142 Bacteria 1767
505 Ga0207428_10001001 3300027907 Bacteria 31346
506 Ga0207428_10011760 3300027907 Bacteria 7719
507 Ga0268266_10007843 3300028379 Bacteria 9563
508 Ga0268266_10065058 3300028379 Bacteria 3152
509 Ga0268266_10188837 3300028379 Bacteria 1880
510 Ga0268266_10205726 3300028379 Bacteria 1803
511 Ga0268266_10246931 3300028379 Bacteria 1649
512 Ga0268265_10121015 3300028380 Bacteria 2156
513 Ga0268264_10114403 3300028381 Bacteria 2368
514 Ga0265337_1000027 3300028556 Bacteria 68392
515 Ga0265326_10001234 3300028558 Bacteria 9119
516 Ga0265319_1001055 3300028563 Bacteria 17217
517 Ga0265334_10000773 3300028573 Bacteria 16014
518 Ga0265322_10001284 3300028654 Bacteria 8433
519 Ga0265336_10002288 3300028666 Bacteria 8003
520 Ga0265338_10000227 3300028800 Bacteria 104795
521 Ga0265338_10001512 3300028800 Bacteria 37550
522 Ga0265338_10007886 3300028800 Bacteria 13062
523 Ga0265338_10011419 3300028800 Bacteria 10257
524 Ga0265324_10004386 3300029957 Bacteria 6400
525 Ga0265332_10001185 3300031238 Bacteria 15099
526 Ga0265325_10005218 3300031241 Bacteria 8066
527 Ga0265339_10021776 3300031249 Bacteria 3723
528 Ga0265327_10008031 3300031251 Bacteria 7964
529 Ga0265316_10007705 3300031344 Bacteria 10091
530 Ga0307408_100231039 3300031548 Bacteria 1515
531 Ga0265313_10010516 3300031595 Bacteria 5839
532 Ga0265314_10010105 3300031711 Bacteria 7910
533 Ga0307405_10018316 3300031731 Bacteria 3860
534 Ga0307406_10058952 3300031901 Bacteria 2469
535 Ga0307409_100226090 3300031995 Bacteria 1693
536 Ga0307416_100017768 3300032002 Bacteria 4988
537 Ga0307415_100027908 3300032126 Bacteria 3583
538 Ga0373926_0001462 3300035083 Bacteria 7192
539 Ga0373926_0021075 3300035083 Bacteria 2254
540 Ga0373926_0032850 3300035083 Bacteria 1832
541 Ga0373934_0015454 3300035086 Bacteria 2895
542 Ga0373940_0001161 3300035088 Bacteria 4616
543 Ga0373944_0000926 3300035089 Bacteria 7259
544 Ga0373923_0009489 3300035111 Bacteria 3512
545 Ga0373923_0010272 3300035111 Bacteria 3401
546 Ga0373923_0020707 3300035111 Bacteria 2558
547 Ga0373936_0000519 3300035113 Bacteria 13160
548 Ga0373936_0004471 3300035113 Bacteria 5286
549 Ga0373936_0006048 3300035113 Bacteria 4562
550 Ga0373936_0008708 3300035113 Bacteria 3820
551 Ga0373936_0014364 3300035113 Bacteria 3025
552 Ga0373939_0005927 3300035114 Bacteria 2926
553 Ga0373941_0005711 3300035115 Bacteria 2950
554 Ga0373945_0001751 3300035116 Bacteria 6703
555 Ga0373945_0014754 3300035116 Bacteria 2622
556 Ga0373953_0003298 3300035117 Bacteria 5010
557 Ga0373954_0014349 3300035118 Bacteria 3533
558 Ga0373954_0035904 3300035118 Bacteria 2299
559 Ga0373956_0025651 3300035119 Bacteria 2549
560 Ga0373957_0015658 3300035120 Bacteria 2613
561 Ga0373957_0051606 3300035120 Bacteria 1573
562 Ga0373943_0000223 3300035170 Bacteria 23116
563 Ga0373946_0000756 3300035171 Bacteria 10990
564 Ga0373946_0000798 3300035171 Bacteria 10747
565 Ga0373955_0021637 3300035172 Bacteria 3250
566 Ga0373955_0101848 3300035172 Bacteria 1650
567 Ga0373962_0007345 3300035242 Bacteria 2697
568 Ga0373924_0008387 3300035410 Bacteria 3752
569 Ga0373924_0012085 3300035410 Bacteria 3220
570 Ga0373924_0051869 3300035410 Bacteria 1702
571 Ga0373931_0013389 3300035691 Bacteria 3994
572 Ga0373931_0022723 3300035691 Bacteria 3159
573 Ga0373935_0004598 3300035692 Bacteria 8110
574 Ga0373935_0010760 3300035692 Bacteria 5494
575 Ga0373935_0042798 3300035692 Bacteria 2848
576 Ga0373927_0003276 3300035695 Bacteria 11646
577 Ga0373927_0051849 3300035695 Bacteria 2653
578 Ga0373947_0000014 3300035725 Bacteria 135749
579 Ga0373937_0065515 3300036401 Bacteria 3344
580 Ga0373925_0000421 3300037068 Bacteria 43136
581 Ga0373925_0009690 3300037068 Bacteria 7009
582 Ga0373925_0010661 3300037068 Bacteria 6665
583 Ga0373925_0012062 3300037068 Bacteria 6257
584 Ga0373925_0045115 3300037068 Bacteria 3274
585 Ga0373925_0081599 3300037068 Bacteria 2459
586 Ga0395899_0005983 3300037312 Bacteria 9447
587 Ga0395899_0140674 3300037312 Unclassified 1717
588 Ga0395900_0033278 3300037418 Bacteria 5306
589 Ga0395900_0125814 3300037418 Bacteria 2629
590 Ga0395898_0003800 3300037466 Bacteria 16715
591 Ga0395898_0019897 3300037466 Bacteria 6826
592 Ga0395898_0019979 3300037466 Bacteria 6812
593 Ga0395905_0008955 3300037471 Bacteria 9823
594 Ga0395905_0047873 3300037471 Bacteria 4006
595 Ga0436364_0485851 3300037853 Bacteria 2704
596 Ga0436364_0824111 3300037853 Bacteria 10643
597 Ga0436364_0841117 3300037853 Bacteria 5270
598 Ga0436364_1107254 3300037853 Bacteria 1626
599 Ga0436364_1421530 3300037853 Bacteria 3172
600 Ga0436364_1435297 3300037853 Bacteria 74939
601 Ga0436364_1450559 3300037853 Bacteria 2346
602 Ga0436364_1520571 3300037853 Bacteria 46168
603 Ga0395901_0032219 3300038443 Bacteria 5408
604 Ga0439461_0000217 3300041410 Bacteria 8182
605 Ga0439466_0021262 3300041411 Bacteria 2303
606 Ga0439465_0000349 3300041413 Bacteria 13257
607 Ga0439431_0000859 3300041997 Bacteria 6579
608 Ga0439440_0014134 3300042993 Bacteria 1720
609 Ga0466969_0078576 3300044656 Bacteria 1578
610 Ga0466972_0012299 3300044658 Bacteria 4302
611 Ga0466965_0002177 3300044683 Bacteria 8246
612 Ga0466965_0022873 3300044683 Bacteria 3015
613 Ga0466966_0009549 3300044684 Bacteria 6420
614 Ga0466961_0002650 3300044693 Bacteria 11103
615 Ga0466963_0005765 3300044694 Bacteria 7282
616 Ga0466963_0040770 3300044694 Bacteria 3044
617 Ga0466964_0005286 3300044706 Bacteria 4789
618 Ga0466964_0017103 3300044706 Bacteria 2774
619 Ga0466968_0001088 3300044735 Bacteria 9619
620 Ga0466970_0016640 3300044765 Bacteria 3794
621 Ga0466957_0008856 3300044842 Bacteria 5731
622 Ga0466957_0043503 3300044842 Bacteria 2720
623 Ga0466960_0079258 3300044901 Bacteria 1651
624 Ga0466959_0001490 3300045049 Bacteria 14375
625 Ga0466959_0027893 3300045049 Bacteria 4188
626 Ga0466959_0075817 3300045049 Bacteria 2429
627 Ga0466958_0063732 3300045836 Bacteria 2248
628 Ga0466967_0010721 3300045976 Bacteria 6891
629 Ga0466967_0012654 3300045976 Bacteria 6471
630 Ga0466967_0036069 3300045976 Bacteria 4218
631 Ga0466967_0056273 3300045976 Bacteria 3467
632 Ga0466967_0056739 3300045976 Bacteria 3455
633 Ga0466967_0111964 3300045976 Bacteria 2509
634 Ga0466967_0113400 3300045976 Bacteria 2494
635 Ga0466967_0132388 3300045976 Bacteria 2316
636 Ga0466967_0158221 3300045976 Bacteria 2124
637 Ga0495592_0000455 3300046454 Bacteria 30633
638 Ga0495592_0015925 3300046454 Bacteria 5704
639 Ga0495592_0025553 3300046454 Bacteria 4482
640 Ga0495592_0068405 3300046454 Bacteria 2592
641 Ga0495603_0001901 3300046455 Bacteria 12324
642 Ga0495603_0006218 3300046455 Bacteria 7140
643 Ga0495603_0024918 3300046455 Bacteria 3618
644 Ga0495603_0040047 3300046455 Bacteria 2806
645 Ga0495603_0122091 3300046455 Bacteria 1518
646 Ga0495629_0003190 3300046459 Bacteria 12420
647 Ga0495629_0012234 3300046459 Bacteria 6215
648 Ga0495629_0190503 3300046459 Bacteria 1419
649 Ga0495638_0002264 3300046460 Bacteria 15935
650 Ga0495641_0007936 3300046461 Bacteria 6551
651 Ga0495641_0012394 3300046461 Bacteria 4773
652 Ga0495641_0044956 3300046461 Bacteria 2034
653 Ga0495651_0000174 3300046462 Bacteria 47579
654 Ga0495651_0007208 3300046462 Bacteria 8501
655 Ga0495651_0059179 3300046462 Bacteria 2938
656 Ga0495653_0000414 3300046463 Bacteria 34250
657 Ga0495580_0206685 3300046472 Unclassified 1352
658 Ga0495582_0013066 3300046473 Bacteria 4571
659 Ga0495582_0027448 3300046473 Bacteria 3121
660 Ga0495582_0033593 3300046473 Bacteria 2820
661 Ga0495582_0036446 3300046473 Bacteria 2706
662 Ga0495582_0155062 3300046473 Unclassified 1301
663 Ga0495605_0139752 3300046474 Unclassified 1087
664 Ga0495639_0019856 3300046475 Bacteria 2933
665 Ga0495662_0005395 3300046476 Bacteria 6399
666 Ga0495662_0013986 3300046476 Bacteria 3907
667 Ga0495662_0027687 3300046476 Bacteria 2738
668 Ga0495664_0000074 3300046477 Bacteria 48269
669 Ga0495664_0003697 3300046477 Bacteria 8341
670 Ga0495664_0039541 3300046477 Bacteria 2787
671 Ga0495664_0099478 3300046477 Bacteria 1751
672 Ga0495664_0113788 3300046477 Bacteria 1634
673 Ga0495664_0136094 3300046477 Unclassified 1488
674 Ga0495584_0037466 3300046491 Bacteria 2451
675 Ga0495584_0069862 3300046491 Unclassified 1765
676 Ga0495584_0089727 3300046491 Bacteria 1550
677 Ga0495594_0100555 3300046499 Bacteria 1626
678 Ga0495596_0029721 3300046500 Bacteria 2190
679 Ga0495606_0051487 3300046507 Bacteria 2685
680 Ga0495608_0000410 3300046511 Bacteria 29942
681 Ga0495608_0010194 3300046511 Bacteria 6558
682 Ga0495608_0018431 3300046511 Bacteria 4815
683 Ga0495618_0039001 3300046514 Bacteria 2986
684 Ga0495618_0071028 3300046514 Bacteria 2214
685 Ga0495618_0089619 3300046514 Bacteria 1967
686 Ga0495628_0000444 3300046516 Bacteria 37801
687 Ga0495628_0024834 3300046516 Bacteria 4902
688 Ga0495628_0101290 3300046516 Bacteria 2222
689 Ga0495628_0102534 3300046516 Bacteria 2207
690 Ga0495630_0009396 3300046517 Bacteria 7025
691 Ga0495630_0011332 3300046517 Bacteria 6451
692 Ga0495630_0016278 3300046517 Bacteria 5433
693 Ga0495630_0032481 3300046517 Bacteria 3889
694 Ga0495631_0051413 3300046518 Bacteria 1801
695 Ga0495644_0027858 3300046523 Bacteria 2139
696 Ga0495644_0028662 3300046523 Bacteria 2106
697 Ga0495648_0005458 3300046524 Bacteria 10554
698 Ga0495663_0006952 3300046525 Bacteria 3122
699 Ga0495666_0000996 3300046526 Bacteria 13421
700 Ga0495666_0068629 3300046526 Bacteria 1688
701 Ga0495652_0000665 3300046529 Bacteria 39849
702 Ga0495652_0043197 3300046529 Bacteria 3884
703 Ga0495654_0081550 3300046530 Bacteria 1516
704 Ga0495665_0009444 3300046531 Bacteria 5280
705 Ga0495665_0013989 3300046531 Bacteria 4333
706 Ga0495665_0061076 3300046531 Bacteria 1990
707 Ga0495640_0006097 3300046533 Bacteria 9555
708 Ga0495640_0018263 3300046533 Bacteria 5207
709 Ga0495586_0005340 3300046535 Bacteria 6874
710 Ga0495586_0107155 3300046535 Bacteria 1554
711 Ga0495587_0002878 3300046536 Bacteria 11528
712 Ga0495587_0019393 3300046536 Bacteria 4209
713 Ga0495587_0055100 3300046536 Bacteria 2342
714 Ga0495587_0091279 3300046536 Bacteria 1759
715 Ga0495609_0051361 3300046538 Bacteria 1836
716 Ga0495621_0023587 3300046539 Bacteria 2048
717 Ga0495645_0001127 3300046543 Bacteria 18070
718 Ga0495645_0158078 3300046543 Bacteria 1569
719 Ga0495667_0000117 3300046559 Bacteria 57725
720 Ga0495667_0000908 3300046559 Bacteria 19115
721 Ga0495667_0029518 3300046559 Bacteria 3691
722 Ga0495667_0047522 3300046559 Bacteria 2835
723 Ga0495667_0057206 3300046559 Bacteria 2564
724 Ga0495667_0068884 3300046559 Bacteria 2309
725 Ga0495667_0087160 3300046559 Bacteria 2024
726 Ga0495656_0000291 3300046615 Bacteria 17446
727 Ga0495656_0022991 3300046615 Bacteria 2448
728 Ga0495634_0001586 3300046642 Bacteria 19947
729 Ga0495634_0002700 3300046642 Bacteria 14596
730 Ga0495634_0056454 3300046642 Bacteria 2623
731 Ga0495635_0000773 3300046663 Bacteria 20815
732 Ga0495635_0011752 3300046663 Bacteria 6139
733 Ga0495635_0063839 3300046663 Bacteria 2528
734 Ga0495635_0173446 3300046663 Bacteria 1466
735 Ga0495659_0000889 3300046664 Bacteria 10637
736 Ga0495588_0001357 3300046674 Bacteria 10445
737 Ga0495657_0006991 3300046675 Bacteria 8754
738 Ga0495657_0007099 3300046675 Bacteria 8687
739 Ga0495657_0051040 3300046675 Bacteria 2778
740 Ga0495599_0000185 3300046678 Bacteria 40953
741 Ga0495599_0053041 3300046678 Bacteria 2540
742 Ga0495623_0055054 3300046679 Bacteria 2508
743 Ga0495646_0000628 3300046680 Bacteria 19227
744 Ga0495646_0018567 3300046680 Bacteria 4403
745 Ga0495646_0041034 3300046680 Bacteria 2845
746 Ga0495647_0001537 3300046681 Bacteria 7126
747 Ga0495647_0042764 3300046681 Bacteria 1731
748 Ga0495647_0058534 3300046681 Bacteria 1515
749 Ga0495658_0001438 3300046683 Bacteria 12529
750 Ga0495658_0011377 3300046683 Bacteria 4475
751 Ga0495613_0053181 3300046689 Bacteria 2980
752 Ga0495613_0108031 3300046689 Bacteria 2007
753 Ga0495624_0006757 3300046690 Bacteria 8106
754 Ga0495624_0028048 3300046690 Bacteria 3681
755 Ga0495624_0033267 3300046690 Bacteria 3339
756 Ga0495624_0086899 3300046690 Bacteria 1931
757 Ga0495671_0034988 3300046692 Bacteria 2553
758 Ga0495589_0007696 3300046794 Bacteria 5639
759 Ga0495600_0014669 3300046809 Bacteria 4940
760 Ga0495581_0004943 3300047315 Bacteria 7715
761 Ga0495581_0008059 3300047315 Bacteria 6097
762 Ga0495581_0009928 3300047315 Bacteria 5508
763 Ga0495581_0036608 3300047315 Bacteria 2839
764 Ga0495604_0016061 3300047317 Bacteria 5979
765 Ga0495604_0025456 3300047317 Bacteria 4715
766 Ga0495636_0005073 3300047318 Bacteria 5170
767 Ga0495674_0000984 3300047319 Bacteria 27406
768 Ga0495674_0002797 3300047319 Bacteria 16935
769 Ga0495674_0041283 3300047319 Bacteria 4122
770 Ga0495674_0050652 3300047319 Bacteria 3664
771 Ga0495674_0054886 3300047319 Bacteria 3497
772 Ga0495674_0107812 3300047319 Bacteria 2364
773 Ga0495672_0030900 3300047320 Bacteria 3350
774 Ga0495676_0020287 3300047321 Bacteria 5835
775 Ga0495676_0040298 3300047321 Bacteria 3856
776 Ga0495680_0000401 3300047322 Bacteria 48480
777 Ga0495680_0001586 3300047322 Bacteria 24314
778 Ga0495680_0029597 3300047322 Bacteria 4483
779 Ga0495680_0071146 3300047322 Bacteria 2649
780 Ga0495680_0167712 3300047322 Bacteria 1591
781 Ga0495675_0005713 3300047444 Bacteria 7607
782 Ga0495675_0009139 3300047444 Bacteria 6161
783 Ga0495673_0001205 3300047469 Bacteria 21534
784 Ga0495684_0000598 3300047471 Bacteria 29035
785 Ga0495684_0005984 3300047471 Bacteria 9451
786 Ga0495686_0003330 3300047472 Bacteria 14025
787 Ga0495686_0058912 3300047472 Bacteria 2393
788 Ga0495593_0015763 3300047673 Bacteria 4272
789 Ga0495593_0050767 3300047673 Bacteria 2196
790 Ga0495602_0002949 3300048088 Bacteria 17454
791 Ga0495602_0130474 3300048088 Bacteria 2005
792 Ga0495614_0001554 3300048089 Bacteria 9962
793 Ga0496100_0004799 3300048903 Bacteria 7220
794 Ga0496100_0006150 3300048903 Bacteria 6531
795 Ga0496100_0009450 3300048903 Bacteria 5482
796 Ga0496100_0042136 3300048903 Bacteria 2914
797 Ga0496100_0083030 3300048903 Bacteria 2168
798 Ga0496101_0000021 3300048904 Bacteria 217090
799 Ga0496101_0001613 3300048904 Bacteria 13562
800 Ga0496101_0056770 3300048904 Bacteria 2830
801 Ga0496102_0000001 3300048905 Bacteria 873433
802 Ga0496102_0000590 3300048905 Bacteria 38332
803 Ga0496102_0001309 3300048905 Bacteria 22360
804 Ga0496102_0010316 3300048905 Bacteria 8034
805 Ga0496102_0029162 3300048905 Bacteria 4935
806 Ga0496102_0073674 3300048905 Bacteria 3138
807 Ga0496103_0000007 3300048906 Bacteria 354915
808 Ga0496103_0015572 3300048906 Bacteria 4529
809 Ga0496103_0019054 3300048906 Bacteria 4120
810 Ga0496103_0041252 3300048906 Bacteria 2837
811 Ga0496103_0074244 3300048906 Bacteria 2131
812 Ga0496103_0156782 3300048906 Bacteria 1459
813 Ga0496104_0010504 3300048907 Bacteria 8271
814 Ga0496104_0011782 3300048907 Bacteria 7846
815 Ga0496104_0020133 3300048907 Bacteria 6112
816 Ga0496104_0091076 3300048907 Bacteria 2914
817 Ga0496104_0187398 3300048907 Bacteria 1980
818 Ga0496104_0323470 3300048907 Bacteria 1455
819 Ga0496105_0015872 3300048908 Bacteria 6008
820 Ga0496105_0031392 3300048908 Bacteria 4355
821 Ga0496105_0057685 3300048908 Bacteria 3205
822 Ga0496105_0182583 3300048908 Bacteria 1718
823 Ga0496106_0002503 3300048909 Bacteria 13678
824 Ga0496106_0003195 3300048909 Bacteria 12259
825 Ga0496106_0003386 3300048909 Bacteria 11881
826 Ga0496106_0028783 3300048909 Bacteria 4139
827 Ga0496106_0065366 3300048909 Bacteria 2769
828 Ga0496106_0107582 3300048909 Bacteria 2169
829 Ga0496107_0000321 3300048910 Bacteria 25887
830 Ga0496107_0003559 3300048910 Bacteria 10431
831 Ga0496107_0011486 3300048910 Bacteria 6170
832 Ga0496107_0016357 3300048910 Bacteria 5206
833 Ga0496107_0040227 3300048910 Bacteria 3355
834 Ga0496107_0041137 3300048910 Bacteria 3318
835 Ga0496107_0074185 3300048910 Bacteria 2475
836 Ga0496108_0000645 3300048911 Bacteria 27126
837 Ga0496108_0020996 3300048911 Bacteria 5368
838 Ga0496108_0021599 3300048911 Bacteria 5289
839 Ga0496108_0028914 3300048911 Bacteria 4587
840 Ga0496108_0093677 3300048911 Bacteria 2555
841 Ga0496108_0127244 3300048911 Bacteria 2188
842 Ga0496108_0132006 3300048911 Bacteria 2147
843 Ga0496108_0143694 3300048911 Bacteria 2056
844 Ga0496109_0016603 3300048912 Bacteria 6438
845 Ga0496109_0024888 3300048912 Bacteria 5329
846 Ga0496109_0053112 3300048912 Bacteria 3694
847 Ga0496109_0280463 3300048912 Bacteria 1570
848 Ga0496110_0002173 3300048913 Bacteria 14645
849 Ga0496110_0034997 3300048913 Bacteria 4354
850 Ga0496110_0039235 3300048913 Bacteria 4123
851 Ga0496110_0209617 3300048913 Bacteria 1771
852 Ga0496110_0231112 3300048913 Bacteria 1682
853 Ga0496111_0025718 3300048914 Bacteria 4154
854 Ga0496111_0031195 3300048914 Bacteria 3795
855 Ga0496111_0043019 3300048914 Bacteria 3245
856 Ga0496111_0072558 3300048914 Bacteria 2505
857 Ga0496111_0078746 3300048914 Bacteria 2403
858 Ga0496111_0117387 3300048914 Bacteria 1963
859 Ga0496112_0005708 3300048915 Bacteria 10813
860 Ga0496112_0117982 3300048915 Bacteria 2624
861 Ga0496113_0013407 3300048916 Bacteria 5553
862 Ga0496113_0032813 3300048916 Bacteria 3775
863 Ga0496113_0121038 3300048916 Bacteria 2046
864 Ga0496114_0000495 3300048917 Bacteria 28787
865 Ga0496114_0002288 3300048917 Bacteria 14597
866 Ga0496114_0032144 3300048917 Bacteria 4318
867 Ga0496114_0041127 3300048917 Bacteria 3830
868 Ga0496115_0001075 3300048918 Bacteria 19794
869 Ga0496115_0003085 3300048918 Bacteria 11965
870 Ga0496115_0014339 3300048918 Bacteria 6000
871 Ga0496115_0101112 3300048918 Bacteria 2363
872 Ga0496116_0000018 3300048919 Bacteria 545877
873 Ga0496116_0000166 3300048919 Bacteria 133474
874 Ga0496117_0000015 3300048920 Bacteria 583316
875 Ga0496118_0000012 3300048921 Bacteria 583316
876 Ga0496118_0051275 3300048921 Bacteria 3158
877 Ga0496119_0000454 3300048922 Bacteria 56086
878 Ga0496119_0060786 3300048922 Bacteria 2260
879 Ga0496119_0072685 3300048922 Bacteria 2008
880 Ga0496120_0001962 3300048923 Bacteria 22491
881 Ga0496120_0006298 3300048923 Bacteria 9148
882 Ga0496121_0000177 3300048924 Bacteria 141456
883 Ga0496125_0016319 3300048928 Bacteria 7136
884 Ga0496126_0001113 3300048929 Bacteria 45012
885 Ga0501034_0127982 3300049571 Bacteria 2524
886 Ga0501038_0121932 3300049574 Bacteria 2149
887 Ga0501067_0004530 3300049583 Bacteria 7678
888 Ga0501068_0110415 3300049584 Bacteria 1709
889 Ga0501070_0040248 3300049586 Bacteria 3897
890 Ga0501073_0100478 3300049589 Bacteria 2008
891 Ga0501074_0062711 3300049590 Bacteria 2677
892 Ga0501074_0133790 3300049590 Bacteria 1773
893 Ga0501077_0028597 3300049593 Bacteria 3543
894 Ga0501080_0516152 3300049742 Bacteria 1066
895 Ga0501083_0016126 3300049744 Bacteria 5233
896 Ga0501083_0038734 3300049744 Bacteria 3239
897 Ga0501044_0196617 3300049823 Bacteria 1976
898 nmdc:mga03683_3552_c1 3300050489 Bacteria 5050
899 nmdc:mga03n38_17725_c1 3300050490 Bacteria 2795
900 nmdc:mga03n38_7306_c1 3300050490 Bacteria 3903
901 nmdc:mga03n38_9110_c1 3300050490 Bacteria 3593
902 nmdc:mga00v17_1369_c1 3300050491 Bacteria 12779
903 nmdc:mga00v17_17742_c2 3300050491 Bacteria 3508
904 nmdc:mga00v17_5888_c1 3300050491 Bacteria 6476
905 nmdc:mga0yw44_15068_c1 3300050492 Bacteria 4128
906 nmdc:mga0yw44_64861_c1 3300050492 Bacteria 2249
907 nmdc:mga07m45_24287_c1 3300050496 Bacteria 3319
908 nmdc:mga07m45_69649_c1 3300050496 Bacteria 2000
909 nmdc:mga05p37_11253_c1 3300050507 Bacteria 10641
910 nmdc:mga05p37_47560_c1 3300050507 Bacteria 5275
911 nmdc:mga05p37_87829_c1 3300050507 Bacteria 3833
912 nmdc:mga09592_86124_c1 3300050508 Bacteria 2681
913 nmdc:mga08y16_140196_c1 3300050511 Bacteria 2514
914 nmdc:mga0n895_16162_c1 3300050512 Bacteria 6841
915 nmdc:mga0n895_17799_c1 3300050512 Bacteria 6560
916 nmdc:mga0n895_213832_c1 3300050512 Bacteria 1958
917 nmdc:mga0n895_39305_c1 3300050512 Bacteria 4590
918 nmdc:mga0rr50_3260_c1 3300050513 Bacteria 9300
919 nmdc:mga0a205_2637_c1 3300050515 Bacteria 15841
920 nmdc:mga0sz30_3201_c1 3300050516 Bacteria 5873
921 nmdc:mga0sz30_42494_c1 3300050516 Bacteria 1912
922 nmdc:mga0sz30_88335_c1 3300050516 Bacteria 1347
923 Ga0495601_0015602 3300053077 Bacteria 4592
924 Ga0495601_0085524 3300053077 Unclassified 2026
925 Ga0495612_0008199 3300053078 Bacteria 4245
926 Ga0500635_0004952 3300053080 Bacteria 3464
927 Ga0495655_0001501 3300053083 Bacteria 3589
928 Ga0495595_0002988 3300053084 Bacteria 6681
929 Ga0495595_0024353 3300053084 Bacteria 2674
930 Ga0495619_0001449 3300053085 Bacteria 15619
931 Ga0495619_0037454 3300053085 Bacteria 3161
932 Ga0495619_0046837 3300053085 Bacteria 2845
933 Ga0495619_0063206 3300053085 Bacteria 2466
934 Ga0500643_001154 3300053087 Bacteria 15747
935 Ga0500643_001862 3300053087 Bacteria 11500
936 Ga0500643_006474 3300053087 Bacteria 4886
937 Ga0500643_007970 3300053087 Bacteria 4207
938 Ga0500556_0001572 3300053104 Bacteria 9240
939 Ga0500562_005490 3300053108 Bacteria 3182
940 Ga0500652_007547 3300053131 Bacteria 3567
941 Ga0500645_000035 3300053730 Bacteria 113679
942 Ga0501082_0022336 3300060353 Bacteria 5450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0127982 Ga0501034_0127982_1505_2509 316
2 3300050516 nmdc:mga0sz30_88335_c1 nmdc:mga0sz30_88335_c1_294_1298 318
3 3300049742 Ga0501080_0516152 Ga0501080_0516152_17_1021 321
4 3300050516 nmdc:mga0sz30_42494_c1 nmdc:mga0sz30_42494_c1_32_1114 344
5 3300050489 nmdc:mga03683_3552_c1 nmdc:mga03683_3552_c1_23_1120 345
6 3300046474 Ga0495605_0139752 Ga0495605_0139752_31_1077 346
7 3300046794 Ga0495589_0007696 Ga0495589_0007696_2503_3549 346
8 3300046473 Ga0495582_0155062 Ga0495582_0155062_53_1246 352
9 3300005843 Ga0068860_100115207 Ga0068860_1001152071 354
10 3300046518 Ga0495631_0051413 Ga0495631_0051413_45_1247 358
11 3300046663 Ga0495635_0173446 Ga0495635_0173446_349_1440 360
12 3300025945 Ga0207679_10169321 Ga0207679_101693212 364
13 3300053083 Ga0495655_0001501 Ga0495655_0001501_93_1424 365
14 3300046491 Ga0495584_0089727 Ga0495584_0089727_31_1362 368
15 3300005331 Ga0070670_100088619 Ga0070670_1000886192 370
16 3300046538 Ga0495609_0051361 Ga0495609_0051361_378_1712 370
17 3300046539 Ga0495621_0023587 Ga0495621_0023587_335_1669 370
18 3300046690 Ga0495624_0086899 Ga0495624_0086899_159_1487 375
19 3300046476 Ga0495662_0027687 Ga0495662_0027687_219_1565 376
20 3300046681 Ga0495647_0058534 Ga0495647_0058534_111_1463 378
21 3300005338 Ga0068868_100014372 Ga0068868_1000143725 379
22 3300005356 Ga0070674_100002482 Ga0070674_10000248210 379
23 3300005440 Ga0070705_100018343 Ga0070705_1000183433 379
24 3300005444 Ga0070694_100041620 Ga0070694_1000416202 379
25 3300005459 Ga0068867_100002000 Ga0068867_1000020008 379
26 3300005468 Ga0070707_100140216 Ga0070707_1001402161 379
27 3300005545 Ga0070695_100010024 Ga0070695_1000100244 379
28 3300005549 Ga0070704_100004595 Ga0070704_1000045954 379
29 3300005615 Ga0070702_100148897 Ga0070702_1001488972 379
30 3300005842 Ga0068858_100071177 Ga0068858_1000711771 379
31 3300006237 Ga0097621_100073596 Ga0097621_1000735963 379
32 3300006358 Ga0068871_100018339 Ga0068871_1000183393 379
33 3300006881 Ga0068865_100029811 Ga0068865_1000298114 379
34 3300009101 Ga0105247_10069989 Ga0105247_100699892 379
35 3300009176 Ga0105242_10002528 Ga0105242_100025289 379
36 3300009177 Ga0105248_10025304 Ga0105248_100253046 379
37 3300010375 Ga0105239_10059987 Ga0105239_100599874 379
38 3300011119 Ga0105246_10066414 Ga0105246_100664142 379
39 3300013104 Ga0157370_10030713 Ga0157370_100307134 379
40 3300013296 Ga0157374_10035561 Ga0157374_100355615 379
41 3300013306 Ga0163162_10174064 Ga0163162_101740642 379
42 3300013308 Ga0157375_10042351 Ga0157375_100423512 379
43 3300014325 Ga0163163_10008170 Ga0163163_100081702 379
44 3300014968 Ga0157379_10004932 Ga0157379_100049325 379
45 3300014969 Ga0157376_10023837 Ga0157376_100238374 379
46 3300025934 Ga0207686_10005839 Ga0207686_100058394 379
47 3300025937 Ga0207669_10058311 Ga0207669_100583112 379
48 3300025938 Ga0207704_10044070 Ga0207704_100440702 379
49 3300025939 Ga0207665_10073331 Ga0207665_100733312 379
50 3300025949 Ga0207667_10107381 Ga0207667_101073812 379
51 3300026035 Ga0207703_10053855 Ga0207703_100538551 379
52 3300026089 Ga0207648_10004217 Ga0207648_100042177 379
53 3300026116 Ga0207674_10150848 Ga0207674_101508482 379
54 3300048903 Ga0496100_0083030 Ga0496100_0083030_725_2014 379
55 3300048905 Ga0496102_0010316 Ga0496102_0010316_2965_4290 379
56 3300048906 Ga0496103_0156782 Ga0496103_0156782_34_1359 379
57 3300048907 Ga0496104_0020133 Ga0496104_0020133_2854_4143 379
58 3300048908 Ga0496105_0015872 Ga0496105_0015872_2311_3600 379
59 3300048911 Ga0496108_0020996 Ga0496108_0020996_2399_3688 379
60 3300048913 Ga0496110_0002173 Ga0496110_0002173_3282_4571 379
61 3300048914 Ga0496111_0043019 Ga0496111_0043019_1143_2432 379
62 3300048916 Ga0496113_0013407 Ga0496113_0013407_3548_4837 379
63 3300049584 Ga0501068_0110415 Ga0501068_0110415_29_1207 379
64 3300049586 Ga0501070_0040248 Ga0501070_0040248_1415_2704 379
65 3300049589 Ga0501073_0100478 Ga0501073_0100478_538_1827 379
66 3300049590 Ga0501074_0062711 Ga0501074_0062711_1317_2606 379
67 3300060353 Ga0501082_0022336 Ga0501082_0022336_1480_2769 379
68 3300005434 Ga0070709_10173787 Ga0070709_101737872 380
69 3300025928 Ga0207700_10026919 Ga0207700_100269192 380
70 3300035172 Ga0373955_0021637 Ga0373955_0021637_1615_2904 380
71 3300035410 Ga0373924_0008387 Ga0373924_0008387_2447_3736 380
72 3300036401 Ga0373937_0065515 Ga0373937_0065515_670_1959 380
73 3300045976 Ga0466967_0158221 Ga0466967_0158221_58_1326 380
74 3300046454 Ga0495592_0000455 Ga0495592_0000455_15091_16380 380
75 3300046462 Ga0495651_0000174 Ga0495651_0000174_13444_14733 380
76 3300046463 Ga0495653_0000414 Ga0495653_0000414_93_1382 380
77 3300046477 Ga0495664_0136094 Ga0495664_0136094_152_1441 380
78 3300046511 Ga0495608_0000410 Ga0495608_0000410_17204_18493 380
79 3300046514 Ga0495618_0039001 Ga0495618_0039001_501_1790 380
80 3300046516 Ga0495628_0000444 Ga0495628_0000444_25113_26402 380
81 3300046529 Ga0495652_0000665 Ga0495652_0000665_13468_14757 380
82 3300046531 Ga0495665_0061076 Ga0495665_0061076_284_1573 380
83 3300046533 Ga0495640_0006097 Ga0495640_0006097_1495_2784 380
84 3300046536 Ga0495587_0002878 Ga0495587_0002878_2685_3974 380
85 3300046543 Ga0495645_0001127 Ga0495645_0001127_12571_13860 380
86 3300046559 Ga0495667_0000117 Ga0495667_0000117_31104_32393 380
87 3300046642 Ga0495634_0001586 Ga0495634_0001586_14707_15996 380
88 3300046675 Ga0495657_0006991 Ga0495657_0006991_3569_4858 380
89 3300046678 Ga0495599_0000185 Ga0495599_0000185_25112_26401 380
90 3300046680 Ga0495646_0000628 Ga0495646_0000628_16509_17798 380
91 3300046809 Ga0495600_0014669 Ga0495600_0014669_2717_4006 380
92 3300047317 Ga0495604_0016061 Ga0495604_0016061_2010_3299 380
93 3300047319 Ga0495674_0000984 Ga0495674_0000984_13470_14759 380
94 3300047322 Ga0495680_0000401 Ga0495680_0000401_32875_34164 380
95 3300047444 Ga0495675_0009139 Ga0495675_0009139_3636_4925 380
96 3300047471 Ga0495684_0000598 Ga0495684_0000598_2647_3936 380
97 3300048088 Ga0495602_0002949 Ga0495602_0002949_2694_3983 380
98 3300053077 Ga0495601_0085524 Ga0495601_0085524_110_1399 380
99 3300005436 Ga0070713_100023985 Ga0070713_1000239852 381
100 3300006028 Ga0070717_10007851 Ga0070717_100078514 381
101 3300025928 Ga0207700_10055669 Ga0207700_100556692 381
102 3300037466 Ga0395898_0019979 Ga0395898_0019979_4380_5738 381
103 3300047319 Ga0495674_0050652 Ga0495674_0050652_2217_3476 381
104 3300005441 Ga0070700_100018846 Ga0070700_1000188461 382
105 3300013307 Ga0157372_10341252 Ga0157372_103412522 382
106 3300044683 Ga0466965_0002177 Ga0466965_0002177_3501_4754 382
107 3300044735 Ga0466968_0001088 Ga0466968_0001088_867_2120 382
108 3300044765 Ga0466970_0016640 Ga0466970_0016640_1925_3178 382
109 3300045049 Ga0466959_0027893 Ga0466959_0027893_499_1752 382
110 3300049574 Ga0501038_0121932 Ga0501038_0121932_799_2091 382
111 3300006028 Ga0070717_10064802 Ga0070717_100648023 383
112 3300009177 Ga0105248_10044839 Ga0105248_100448392 383
113 3300031995 Ga0307409_100226090 Ga0307409_1002260902 383
114 3300048903 Ga0496100_0006150 Ga0496100_0006150_760_2016 383
115 3300048907 Ga0496104_0010504 Ga0496104_0010504_2940_4196 383
116 3300048909 Ga0496106_0003195 Ga0496106_0003195_5466_6722 383
117 3300048910 Ga0496107_0003559 Ga0496107_0003559_3635_4891 383
118 3300048917 Ga0496114_0002288 Ga0496114_0002288_9086_10342 383
119 3300005548 Ga0070665_100001745 Ga0070665_10000174525 384
120 3300009176 Ga0105242_10000620 Ga0105242_1000062013 384
121 3300028379 Ga0268266_10007843 Ga0268266_100078433 384
122 3300048906 Ga0496103_0019054 Ga0496103_0019054_2808_4076 384
123 3300048908 Ga0496105_0031392 Ga0496105_0031392_126_1427 384
124 3300005337 Ga0070682_100049408 Ga0070682_1000494082 385
125 3300005339 Ga0070660_100188515 Ga0070660_1001885152 385
126 3300005535 Ga0070684_100031025 Ga0070684_1000310252 385
127 3300005548 Ga0070665_100096225 Ga0070665_1000962251 385
128 3300005616 Ga0068852_100156097 Ga0068852_1001560972 385
129 3300006048 Ga0075363_100077904 Ga0075363_1000779042 385
130 3300009098 Ga0105245_10107688 Ga0105245_101076882 385
131 3300009098 Ga0105245_10171307 Ga0105245_101713072 385
132 3300010375 Ga0105239_10228472 Ga0105239_102284722 385
133 3300025929 Ga0207664_10021830 Ga0207664_100218303 385
134 3300025938 Ga0207704_10132560 Ga0207704_101325602 385
135 3300025944 Ga0207661_10082020 Ga0207661_100820202 385
136 3300026142 Ga0207698_10205597 Ga0207698_102055972 385
137 3300037853 Ga0436364_0485851 Ga0436364_0485851_638_1960 385
138 3300047322 Ga0495680_0167712 Ga0495680_0167712_104_1405 385
139 3300048911 Ga0496108_0143694 Ga0496108_0143694_526_1809 385
140 3300048912 Ga0496109_0280463 Ga0496109_0280463_166_1449 385
141 3300048914 Ga0496111_0117387 Ga0496111_0117387_259_1542 385
142 3300005937 Ga0081455_10001614 Ga0081455_1000161416 386
143 3300046472 Ga0495580_0206685 Ga0495580_0206685_32_1333 386
144 3300005334 Ga0068869_100011909 Ga0068869_1000119094 387
145 3300005338 Ga0068868_100000529 Ga0068868_10000052914 387
146 3300005341 Ga0070691_10011823 Ga0070691_100118232 387
147 3300005347 Ga0070668_100005441 Ga0070668_1000054415 387
148 3300005355 Ga0070671_100010460 Ga0070671_1000104602 387
149 3300005356 Ga0070674_100003430 Ga0070674_1000034303 387
150 3300005365 Ga0070688_100005859 Ga0070688_1000058593 387
151 3300005367 Ga0070667_100002267 Ga0070667_10000226711 387
152 3300005434 Ga0070709_10022973 Ga0070709_100229733 387
153 3300005437 Ga0070710_10000900 Ga0070710_1000090012 387
154 3300005438 Ga0070701_10003486 Ga0070701_100034864 387
155 3300005439 Ga0070711_100001095 Ga0070711_1000010952 387
156 3300005440 Ga0070705_100038364 Ga0070705_1000383642 387
157 3300005456 Ga0070678_100009361 Ga0070678_1000093616 387
158 3300005457 Ga0070662_100017040 Ga0070662_1000170404 387
159 3300005459 Ga0068867_100001323 Ga0068867_1000013237 387
160 3300005466 Ga0070685_10050343 Ga0070685_100503432 387
161 3300005539 Ga0068853_100008397 Ga0068853_1000083977 387
162 3300005546 Ga0070696_100003305 Ga0070696_1000033059 387
163 3300005547 Ga0070693_100001858 Ga0070693_1000018582 387
164 3300005548 Ga0070665_100022355 Ga0070665_1000223556 387
165 3300005549 Ga0070704_100000706 Ga0070704_1000007062 387
166 3300005563 Ga0068855_100076751 Ga0068855_1000767512 387
167 3300005578 Ga0068854_100005243 Ga0068854_1000052437 387
168 3300005615 Ga0070702_100001404 Ga0070702_1000014048 387
169 3300005617 Ga0068859_100003134 Ga0068859_1000031347 387
170 3300005718 Ga0068866_10000376 Ga0068866_1000037620 387
171 3300005842 Ga0068858_100002465 Ga0068858_1000024651 387
172 3300005843 Ga0068860_100025928 Ga0068860_1000259282 387
173 3300006048 Ga0075363_100060987 Ga0075363_1000609872 387
174 3300006173 Ga0070716_100002661 Ga0070716_1000026616 387
175 3300006175 Ga0070712_100001062 Ga0070712_10000106216 387
176 3300006237 Ga0097621_100015140 Ga0097621_1000151402 387
177 3300006358 Ga0068871_100189674 Ga0068871_1001896742 387
178 3300006881 Ga0068865_100000828 Ga0068865_1000008282 387
179 3300006931 Ga0097620_100003133 Ga0097620_10000313312 387
180 3300009098 Ga0105245_10003220 Ga0105245_100032204 387
181 3300009101 Ga0105247_10000334 Ga0105247_100003342 387
182 3300009147 Ga0114129_10223859 Ga0114129_102238592 387
183 3300009148 Ga0105243_10005418 Ga0105243_100054182 387
184 3300009174 Ga0105241_10019951 Ga0105241_100199512 387
185 3300009545 Ga0105237_10034235 Ga0105237_100342354 387
186 3300009553 Ga0105249_10000767 Ga0105249_1000076717 387
187 3300011119 Ga0105246_10140320 Ga0105246_101403202 387
188 3300013297 Ga0157378_10001690 Ga0157378_1000169016 387
189 3300013308 Ga0157375_10003452 Ga0157375_1000345213 387
190 3300013308 Ga0157375_10122797 Ga0157375_101227973 387
191 3300014326 Ga0157380_10003813 Ga0157380_100038134 387
192 3300014745 Ga0157377_10122128 Ga0157377_101221282 387
193 3300014969 Ga0157376_10083979 Ga0157376_100839792 387
194 3300025899 Ga0207642_10002962 Ga0207642_100029622 387
195 3300025900 Ga0207710_10001088 Ga0207710_100010883 387
196 3300025901 Ga0207688_10000352 Ga0207688_1000035216 387
197 3300025915 Ga0207693_10001171 Ga0207693_100011717 387
198 3300025916 Ga0207663_10005265 Ga0207663_100052652 387
199 3300025927 Ga0207687_10001147 Ga0207687_1000114717 387
200 3300025928 Ga0207700_10109651 Ga0207700_101096512 387
201 3300025931 Ga0207644_10103641 Ga0207644_101036412 387
202 3300025932 Ga0207690_10028152 Ga0207690_100281522 387
203 3300025933 Ga0207706_10001128 Ga0207706_1000112826 387
204 3300025934 Ga0207686_10002468 Ga0207686_100024688 387
205 3300025935 Ga0207709_10007186 Ga0207709_100071866 387
206 3300025936 Ga0207670_10127309 Ga0207670_101273092 387
207 3300025938 Ga0207704_10000377 Ga0207704_1000037718 387
208 3300025939 Ga0207665_10005772 Ga0207665_100057723 387
209 3300025941 Ga0207711_10108185 Ga0207711_101081852 387
210 3300025942 Ga0207689_10025969 Ga0207689_100259693 387
211 3300025961 Ga0207712_10006309 Ga0207712_100063092 387
212 3300025972 Ga0207668_10056080 Ga0207668_100560802 387
213 3300025981 Ga0207640_10003409 Ga0207640_100034097 387
214 3300026035 Ga0207703_10014135 Ga0207703_100141352 387
215 3300026089 Ga0207648_10001355 Ga0207648_1000135519 387
216 3300026121 Ga0207683_10000201 Ga0207683_1000020140 387
217 3300028379 Ga0268266_10188837 Ga0268266_101888372 387
218 3300028380 Ga0268265_10121015 Ga0268265_101210152 387
219 3300028381 Ga0268264_10114403 Ga0268264_101144032 387
220 3300035691 Ga0373931_0022723 Ga0373931_0022723_890_2341 387
221 3300046455 Ga0495603_0001901 Ga0495603_0001901_11058_12254 387
222 3300046459 Ga0495629_0190503 Ga0495629_0190503_171_1370 387
223 3300046473 Ga0495582_0036446 Ga0495582_0036446_54_1340 387
224 3300048903 Ga0496100_0004799 Ga0496100_0004799_5326_6777 387
225 3300048904 Ga0496101_0001613 Ga0496101_0001613_577_2028 387
226 3300048905 Ga0496102_0001309 Ga0496102_0001309_12349_13800 387
227 3300048909 Ga0496106_0002503 Ga0496106_0002503_10656_12107 387
228 3300048910 Ga0496107_0000321 Ga0496107_0000321_13495_14946 387
229 3300048917 Ga0496114_0000495 Ga0496114_0000495_20995_22446 387
230 3300048918 Ga0496115_0003085 Ga0496115_0003085_4764_5987 387
231 3300049583 Ga0501067_0004530 Ga0501067_0004530_5701_6993 387
232 3300049590 Ga0501074_0133790 Ga0501074_0133790_297_1589 387
233 3300049593 Ga0501077_0028597 Ga0501077_0028597_505_1797 387
234 3300049744 Ga0501083_0016126 Ga0501083_0016126_3175_4467 387
235 3300046455 Ga0495603_0122091 Ga0495603_0122091_81_1382 388
236 3300046460 Ga0495638_0002264 Ga0495638_0002264_7663_8943 388
237 3300046530 Ga0495654_0081550 Ga0495654_0081550_280_1455 388
238 3300046692 Ga0495671_0034988 Ga0495671_0034988_564_1844 388
239 3300047319 Ga0495674_0054886 Ga0495674_0054886_1809_3110 388
240 3300053104 Ga0500556_0001572 Ga0500556_0001572_4725_6005 388
241 3300006048 Ga0075363_100000787 Ga0075363_1000007879 389
242 3300006051 Ga0075364_10000184 Ga0075364_1000018415 389
243 3300006051 Ga0075364_10006965 Ga0075364_100069652 389
244 3300006178 Ga0075367_10001919 Ga0075367_100019197 389
245 3300006353 Ga0075370_10044383 Ga0075370_100443832 389
246 3300025303 Ga0209051_1028496 Ga0209051_10284962 389
247 3300045976 Ga0466967_0036069 Ga0466967_0036069_2838_4088 389
248 3300045976 Ga0466967_0113400 Ga0466967_0113400_194_1426 389
249 3300048907 Ga0496104_0011782 Ga0496104_0011782_5794_7095 389
250 3300050490 nmdc:mga03n38_9110_c1 nmdc:mga03n38_9110_c1_1894_3174 389
251 3300050491 nmdc:mga00v17_1369_c1 nmdc:mga00v17_1369_c1_10169_11449 389
252 3300050491 nmdc:mga00v17_5888_c1 nmdc:mga00v17_5888_c1_2416_3696 389
253 3300050496 nmdc:mga07m45_24287_c1 nmdc:mga07m45_24287_c1_498_1778 389
254 3300005356 Ga0070674_100021807 Ga0070674_1000218073 390
255 3300005406 Ga0070703_10000001 Ga0070703_10000001122 390
256 3300005444 Ga0070694_100033732 Ga0070694_1000337322 390
257 3300005445 Ga0070708_100001067 Ga0070708_1000010671 390
258 3300005467 Ga0070706_100010233 Ga0070706_1000102338 390
259 3300005468 Ga0070707_100008503 Ga0070707_1000085035 390
260 3300005471 Ga0070698_100051050 Ga0070698_1000510504 390
261 3300005546 Ga0070696_100005272 Ga0070696_1000052723 390
262 3300005718 Ga0068866_10013060 Ga0068866_100130602 390
263 3300005719 Ga0068861_100052331 Ga0068861_1000523313 390
264 3300006048 Ga0075363_100115160 Ga0075363_1001151601 390
265 3300006186 Ga0075369_10037641 Ga0075369_100376412 390
266 3300006353 Ga0075370_10033932 Ga0075370_100339322 390
267 3300009098 Ga0105245_10133233 Ga0105245_101332332 390
268 3300009148 Ga0105243_10007191 Ga0105243_100071918 390
269 3300009176 Ga0105242_10002226 Ga0105242_100022263 390
270 3300009553 Ga0105249_10053836 Ga0105249_100538363 390
271 3300010375 Ga0105239_10269472 Ga0105239_102694722 390
272 3300013297 Ga0157378_10018845 Ga0157378_100188453 390
273 3300013306 Ga0163162_10026392 Ga0163162_100263922 390
274 3300025885 Ga0207653_10000004 Ga0207653_10000004123 390
275 3300025899 Ga0207642_10030974 Ga0207642_100309742 390
276 3300025910 Ga0207684_10000911 Ga0207684_1000091116 390
277 3300025922 Ga0207646_10007478 Ga0207646_1000747811 390
278 3300025934 Ga0207686_10006248 Ga0207686_100062483 390
279 3300025935 Ga0207709_10034736 Ga0207709_100347362 390
280 3300025937 Ga0207669_10032348 Ga0207669_100323482 390
281 3300025941 Ga0207711_10165028 Ga0207711_101650282 390
282 3300026118 Ga0207675_100078529 Ga0207675_1000785293 390
283 3300044683 Ga0466965_0022873 Ga0466965_0022873_1345_2673 390
284 3300048909 Ga0496106_0065366 Ga0496106_0065366_282_1595 390
285 3300048910 Ga0496107_0040227 Ga0496107_0040227_911_2224 390
286 3300048914 Ga0496111_0025718 Ga0496111_0025718_210_1523 390
287 3300053085 Ga0495619_0063206 Ga0495619_0063206_767_2038 390
288 3300005437 Ga0070710_10073616 Ga0070710_100736162 391
289 3300005439 Ga0070711_100147979 Ga0070711_1001479791 391
290 3300013306 Ga0163162_10205789 Ga0163162_102057892 391
291 3300047472 Ga0495686_0058912 Ga0495686_0058912_766_2019 391
292 3300048918 Ga0496115_0101112 Ga0496115_0101112_69_1379 391
293 3300053108 Ga0500562_005490 Ga0500562_005490_794_2074 391
294 3300053730 Ga0500645_000035 Ga0500645_000035_50657_51925 391
295 3300005435 Ga0070714_100004478 Ga0070714_1000044789 392
296 3300005436 Ga0070713_100025930 Ga0070713_1000259304 392
297 3300005439 Ga0070711_100004296 Ga0070711_1000042964 392
298 3300006175 Ga0070712_100126999 Ga0070712_1001269992 392
299 3300013105 Ga0157369_10003613 Ga0157369_1000361313 392
300 3300025915 Ga0207693_10005402 Ga0207693_1000540213 392
301 3300025916 Ga0207663_10021617 Ga0207663_100216172 392
302 3300025928 Ga0207700_10029262 Ga0207700_100292624 392
303 3300025929 Ga0207664_10001029 Ga0207664_100010292 392
304 3300028800 Ga0265338_10011419 Ga0265338_1001141910 392
305 3300031251 Ga0265327_10008031 Ga0265327_100080313 392
306 3300046455 Ga0495603_0006218 Ga0495603_0006218_2716_4050 392
307 3300048906 Ga0496103_0041252 Ga0496103_0041252_1026_2387 392
308 3300048907 Ga0496104_0187398 Ga0496104_0187398_485_1786 392
309 3300048908 Ga0496105_0057685 Ga0496105_0057685_219_1580 392
310 3300048910 Ga0496107_0074185 Ga0496107_0074185_969_2330 392
311 3300048911 Ga0496108_0021599 Ga0496108_0021599_3167_4528 392
312 3300048911 Ga0496108_0132006 Ga0496108_0132006_590_1879 392
313 3300048912 Ga0496109_0053112 Ga0496109_0053112_486_1847 392
314 3300048913 Ga0496110_0034997 Ga0496110_0034997_2900_4261 392
315 3300048914 Ga0496111_0078746 Ga0496111_0078746_144_1505 392
316 3300048915 Ga0496112_0117982 Ga0496112_0117982_52_1413 392
317 3300048917 Ga0496114_0041127 Ga0496114_0041127_333_1694 392
318 3300048918 Ga0496115_0001075 Ga0496115_0001075_13844_15145 392
319 3300048918 Ga0496115_0014339 Ga0496115_0014339_1921_3282 392
320 3300048919 Ga0496116_0000166 Ga0496116_0000166_120358_121680 392
321 3300048922 Ga0496119_0000454 Ga0496119_0000454_11694_13016 392
322 3300053087 Ga0500643_007970 Ga0500643_007970_1202_2527 392
323 3300004800 Ga0058861_11975033 Ga0058861_119750332 393
324 3300004803 Ga0058862_10034740 Ga0058862_100347401 393
325 3300005441 Ga0070700_100049200 Ga0070700_1000492002 393
326 3300005719 Ga0068861_100025534 Ga0068861_1000255343 393
327 3300013307 Ga0157372_10171892 Ga0157372_101718922 393
328 3300025927 Ga0207687_10029528 Ga0207687_100295282 393
329 3300026075 Ga0207708_10003968 Ga0207708_100039688 393
330 3300026118 Ga0207675_100040429 Ga0207675_1000404292 393
331 3300028379 Ga0268266_10065058 Ga0268266_100650583 393
332 3300005367 Ga0070667_100212282 Ga0070667_1002122822 394
333 3300005435 Ga0070714_100060030 Ga0070714_1000600302 394
334 3300005435 Ga0070714_100180351 Ga0070714_1001803511 394
335 3300005439 Ga0070711_100105261 Ga0070711_1001052611 394
336 3300005457 Ga0070662_100009027 Ga0070662_1000090274 394
337 3300005467 Ga0070706_100030567 Ga0070706_1000305673 394
338 3300005468 Ga0070707_100011276 Ga0070707_1000112762 394
339 3300006163 Ga0070715_10013894 Ga0070715_100138942 394
340 3300009148 Ga0105243_10116559 Ga0105243_101165592 394
341 3300020078 Ga0206352_10246956 Ga0206352_102469561 394
342 3300025922 Ga0207646_10005885 Ga0207646_100058852 394
343 3300025929 Ga0207664_10331043 Ga0207664_103310431 394
344 3300025933 Ga0207706_10009818 Ga0207706_1000981811 394
345 3300025939 Ga0207665_10056850 Ga0207665_100568503 394
346 3300035083 Ga0373926_0032850 Ga0373926_0032850_434_1723 394
347 3300035725 Ga0373947_0000014 Ga0373947_0000014_127127_128416 394
348 3300046454 Ga0495592_0025553 Ga0495592_0025553_2685_3989 394
349 3300046462 Ga0495651_0007208 Ga0495651_0007208_3796_5100 394
350 3300046477 Ga0495664_0113788 Ga0495664_0113788_84_1388 394
351 3300046511 Ga0495608_0010194 Ga0495608_0010194_1774_3078 394
352 3300046559 Ga0495667_0000908 Ga0495667_0000908_17576_18880 394
353 3300046663 Ga0495635_0011752 Ga0495635_0011752_1109_2413 394
354 3300046675 Ga0495657_0007099 Ga0495657_0007099_1605_2909 394
355 3300047322 Ga0495680_0001586 Ga0495680_0001586_19064_20368 394
356 3300048921 Ga0496118_0051275 Ga0496118_0051275_639_1952 394
357 3300048928 Ga0496125_0016319 Ga0496125_0016319_4515_5828 394
358 3300053084 Ga0495595_0024353 Ga0495595_0024353_1305_2609 394
359 3300053085 Ga0495619_0046837 Ga0495619_0046837_494_1798 394
360 3300053087 Ga0500643_006474 Ga0500643_006474_872_2161 394
361 3300053131 Ga0500652_007547 Ga0500652_007547_2000_3262 394
362 3300005458 Ga0070681_10126386 Ga0070681_101263862 395
363 3300006852 Ga0075433_10163690 Ga0075433_101636902 395
364 3300007076 Ga0075435_100107436 Ga0075435_1001074362 395
365 3300025918 Ga0207662_10004973 Ga0207662_100049735 395
366 3300025929 Ga0207664_10024393 Ga0207664_100243933 395
367 3300045049 Ga0466959_0075817 Ga0466959_0075817_745_2019 395
368 3300045836 Ga0466958_0063732 Ga0466958_0063732_116_1390 395
369 3300046477 Ga0495664_0039541 Ga0495664_0039541_902_2299 395
370 3300048904 Ga0496101_0056770 Ga0496101_0056770_768_2069 395
371 3300048906 Ga0496103_0015572 Ga0496103_0015572_1783_3063 395
372 3300048914 Ga0496111_0072558 Ga0496111_0072558_551_1852 395
373 3300048922 Ga0496119_0072685 Ga0496119_0072685_606_1919 395
374 3300048923 Ga0496120_0001962 Ga0496120_0001962_1391_2704 395
375 3300005468 Ga0070707_100031450 Ga0070707_1000314504 396
376 3300005539 Ga0068853_100016775 Ga0068853_1000167752 396
377 3300006028 Ga0070717_10034864 Ga0070717_100348643 396
378 3300009098 Ga0105245_10018583 Ga0105245_100185836 396
379 3300009545 Ga0105237_10051382 Ga0105237_100513824 396
380 3300010375 Ga0105239_10002879 Ga0105239_1000287911 396
381 3300025922 Ga0207646_10009346 Ga0207646_100093468 396
382 3300035172 Ga0373955_0101848 Ga0373955_0101848_349_1638 396
383 3300035410 Ga0373924_0051869 Ga0373924_0051869_196_1485 396
384 3300037853 Ga0436364_1421530 Ga0436364_1421530_1528_2796 396
385 3300046507 Ga0495606_0051487 Ga0495606_0051487_1118_2368 396
386 3300006028 Ga0070717_10047787 Ga0070717_100477874 397
387 3300006038 Ga0075365_10015384 Ga0075365_100153844 397
388 3300006051 Ga0075364_10076198 Ga0075364_100761982 397
389 3300006178 Ga0075367_10088124 Ga0075367_100881242 397
390 3300006852 Ga0075433_10012875 Ga0075433_100128755 397
391 3300006871 Ga0075434_100003943 Ga0075434_1000039431 397
392 3300007076 Ga0075435_100007491 Ga0075435_1000074914 397
393 3300009553 Ga0105249_10012184 Ga0105249_100121844 397
394 3300013296 Ga0157374_10232882 Ga0157374_102328822 397
395 3300013306 Ga0163162_10027146 Ga0163162_100271464 397
396 3300025914 Ga0207671_10011790 Ga0207671_100117904 397
397 3300025944 Ga0207661_10097199 Ga0207661_100971991 397
398 3300037853 Ga0436364_0841117 Ga0436364_0841117_1278_2588 397
399 3300044658 Ga0466972_0012299 Ga0466972_0012299_2055_3308 397
400 3300044901 Ga0466960_0079258 Ga0466960_0079258_369_1622 397
401 3300048907 Ga0496104_0323470 Ga0496104_0323470_70_1341 397
402 3300048911 Ga0496108_0028914 Ga0496108_0028914_216_1589 397
403 3300048912 Ga0496109_0024888 Ga0496109_0024888_757_2130 397
404 3300048913 Ga0496110_0039235 Ga0496110_0039235_1214_2587 397
405 3300050490 nmdc:mga03n38_17725_c1 nmdc:mga03n38_17725_c1_1309_2598 397
406 3300050491 nmdc:mga00v17_17742_c2 nmdc:mga00v17_17742_c2_1950_3239 397
407 3300050492 nmdc:mga0yw44_15068_c1 nmdc:mga0yw44_15068_c1_1639_2928 397
408 3300002459 JGI24751J29686_10009198 JGI24751J29686_100091982 398
409 3300005355 Ga0070671_100013019 Ga0070671_1000130192 398
410 3300005367 Ga0070667_100105326 Ga0070667_1001053262 398
411 3300005548 Ga0070665_100009958 Ga0070665_1000099589 398
412 3300005841 Ga0068863_100001514 Ga0068863_10000151418 398
413 3300005842 Ga0068858_100080445 Ga0068858_1000804452 398
414 3300014325 Ga0163163_10002897 Ga0163163_100028973 398
415 3300014745 Ga0157377_10007912 Ga0157377_100079122 398
416 3300020082 Ga0206353_11818343 Ga0206353_118183432 398
417 3300025931 Ga0207644_10005208 Ga0207644_100052083 398
418 3300025986 Ga0207658_10012179 Ga0207658_100121793 398
419 3300026088 Ga0207641_10003507 Ga0207641_100035078 398
420 3300028379 Ga0268266_10246931 Ga0268266_102469312 398
421 3300035086 Ga0373934_0015454 Ga0373934_0015454_902_2203 398
422 3300035118 Ga0373954_0035904 Ga0373954_0035904_26_1327 398
423 3300046459 Ga0495629_0012234 Ga0495629_0012234_1851_3152 398
424 3300047321 Ga0495676_0040298 Ga0495676_0040298_1938_3239 398
425 3300047472 Ga0495686_0003330 Ga0495686_0003330_6292_7587 398
426 3300048905 Ga0496102_0000590 Ga0496102_0000590_17072_18361 398
427 3300048908 Ga0496105_0182583 Ga0496105_0182583_330_1601 398
428 3300048911 Ga0496108_0000645 Ga0496108_0000645_22378_23703 398
429 3300048912 Ga0496109_0016603 Ga0496109_0016603_4169_5494 398
430 3300048913 Ga0496110_0231112 Ga0496110_0231112_94_1461 398
431 3300048915 Ga0496112_0005708 Ga0496112_0005708_405_1730 398
432 3300050490 nmdc:mga03n38_7306_c1 nmdc:mga03n38_7306_c1_2247_3500 398
433 3300050492 nmdc:mga0yw44_64861_c1 nmdc:mga0yw44_64861_c1_711_1964 398
434 3300044842 Ga0466957_0043503 Ga0466957_0043503_20_1327 399
435 3300005618 Ga0068864_100020685 Ga0068864_1000206853 400
436 3300005843 Ga0068860_100249342 Ga0068860_1002493422 400
437 3300006871 Ga0075434_100008894 Ga0075434_1000088943 400
438 3300006881 Ga0068865_100022777 Ga0068865_1000227773 400
439 3300009148 Ga0105243_10006751 Ga0105243_100067515 400
440 3300009176 Ga0105242_10052953 Ga0105242_100529533 400
441 3300009177 Ga0105248_10004419 Ga0105248_100044195 400
442 3300009551 Ga0105238_10093468 Ga0105238_100934682 400
443 3300014325 Ga0163163_10032021 Ga0163163_100320212 400
444 3300014969 Ga0157376_10022035 Ga0157376_100220354 400
445 3300021388 Ga0213875_10000570 Ga0213875_1000057019 400
446 3300025935 Ga0207709_10017218 Ga0207709_100172183 400
447 3300025935 Ga0207709_10196818 Ga0207709_101968181 400
448 3300025938 Ga0207704_10012981 Ga0207704_100129813 400
449 3300026023 Ga0207677_10011441 Ga0207677_100114413 400
450 3300026095 Ga0207676_10016180 Ga0207676_100161802 400
451 3300028800 Ga0265338_10007886 Ga0265338_1000788614 400
452 3300037853 Ga0436364_0824111 Ga0436364_0824111_1497_2804 400
453 3300037853 Ga0436364_1520571 Ga0436364_1520571_14803_16101 400
454 3300046500 Ga0495596_0029721 Ga0495596_0029721_372_1640 400
455 3300046526 Ga0495666_0068629 Ga0495666_0068629_14_1345 400
456 3300046531 Ga0495665_0009444 Ga0495665_0009444_2580_3908 400
457 3300048903 Ga0496100_0042136 Ga0496100_0042136_1185_2534 400
458 3300048910 Ga0496107_0016357 Ga0496107_0016357_3806_5155 400
459 3300048914 Ga0496111_0031195 Ga0496111_0031195_43_1392 400
460 3300048916 Ga0496113_0032813 Ga0496113_0032813_1324_2673 400
461 3300048917 Ga0496114_0032144 Ga0496114_0032144_2396_3745 400
462 3300050512 nmdc:mga0n895_213832_c1 nmdc:mga0n895_213832_c1_207_1511 400
463 3300053078 Ga0495612_0008199 Ga0495612_0008199_2656_3957 400
464 3300009147 Ga0114129_10039891 Ga0114129_100398915 401
465 3300028556 Ga0265337_1000027 Ga0265337_100002710 401
466 3300028558 Ga0265326_10001234 Ga0265326_100012348 401
467 3300028563 Ga0265319_1001055 Ga0265319_100105510 401
468 3300028573 Ga0265334_10000773 Ga0265334_1000077310 401
469 3300028654 Ga0265322_10001284 Ga0265322_100012843 401
470 3300028666 Ga0265336_10002288 Ga0265336_100022883 401
471 3300028800 Ga0265338_10000227 Ga0265338_1000022782 401
472 3300029957 Ga0265324_10004386 Ga0265324_100043866 401
473 3300031238 Ga0265332_10001185 Ga0265332_100011856 401
474 3300031241 Ga0265325_10005218 Ga0265325_100052185 401
475 3300031249 Ga0265339_10021776 Ga0265339_100217762 401
476 3300031344 Ga0265316_10007705 Ga0265316_100077054 401
477 3300031595 Ga0265313_10010516 Ga0265313_100105163 401
478 3300031711 Ga0265314_10010105 Ga0265314_100101058 401
479 3300050507 nmdc:mga05p37_47560_c1 nmdc:mga05p37_47560_c1_3003_4298 401
480 3300050512 nmdc:mga0n895_17799_c1 nmdc:mga0n895_17799_c1_3440_4735 401
481 3300050513 nmdc:mga0rr50_3260_c1 nmdc:mga0rr50_3260_c1_3374_4669 401
482 3300050515 nmdc:mga0a205_2637_c1 nmdc:mga0a205_2637_c1_9340_10635 401
483 3300005434 Ga0070709_10012534 Ga0070709_100125344 402
484 3300005439 Ga0070711_100004473 Ga0070711_1000044736 402
485 3300005445 Ga0070708_100287649 Ga0070708_1002876492 402
486 3300006038 Ga0075365_10090040 Ga0075365_100900401 402
487 3300006048 Ga0075363_100087743 Ga0075363_1000877431 402
488 3300009098 Ga0105245_10162114 Ga0105245_101621141 402
489 3300009176 Ga0105242_10042211 Ga0105242_100422112 402
490 3300013102 Ga0157371_10099871 Ga0157371_100998712 402
491 3300025303 Ga0209051_1008439 Ga0209051_10084395 402
492 3300035691 Ga0373931_0013389 Ga0373931_0013389_1505_2830 402
493 3300037068 Ga0373925_0010661 Ga0373925_0010661_680_1978 402
494 3300045976 Ga0466967_0012654 Ga0466967_0012654_2201_3463 402
495 3300046524 Ga0495648_0005458 Ga0495648_0005458_5539_6816 402
496 3300047320 Ga0495672_0030900 Ga0495672_0030900_54_1331 402
497 3300047469 Ga0495673_0001205 Ga0495673_0001205_5393_6670 402
498 3300048909 Ga0496106_0028783 Ga0496106_0028783_1721_3046 402
499 3300048909 Ga0496106_0107582 Ga0496106_0107582_81_1445 402
500 3300048910 Ga0496107_0041137 Ga0496107_0041137_1920_3245 402
501 3300001977 JGI24746J21847_1000089 JGI24746J21847_10000893 403
502 3300001991 JGI24743J22301_10000709 JGI24743J22301_100007092 403
503 3300005339 Ga0070660_100222383 Ga0070660_1002223831 403
504 3300005548 Ga0070665_100045725 Ga0070665_1000457254 403
505 3300005842 Ga0068858_100113426 Ga0068858_1001134262 403
506 3300013297 Ga0157378_10089398 Ga0157378_100893981 403
507 3300025901 Ga0207688_10014587 Ga0207688_100145872 403
508 3300025919 Ga0207657_10072009 Ga0207657_100720092 403
509 3300025942 Ga0207689_10009916 Ga0207689_100099164 403
510 3300026035 Ga0207703_10018284 Ga0207703_100182841 403
511 3300026075 Ga0207708_10005234 Ga0207708_100052344 403
512 3300026118 Ga0207675_100015022 Ga0207675_1000150222 403
513 3300028379 Ga0268266_10205726 Ga0268266_102057262 403
514 3300035089 Ga0373944_0000926 Ga0373944_0000926_204_1511 403
515 3300035111 Ga0373923_0010272 Ga0373923_0010272_829_2136 403
516 3300035113 Ga0373936_0004471 Ga0373936_0004471_3603_4910 403
517 3300035171 Ga0373946_0000756 Ga0373946_0000756_7835_9142 403
518 3300035242 Ga0373962_0007345 Ga0373962_0007345_67_1389 403
519 3300035410 Ga0373924_0012085 Ga0373924_0012085_680_1987 403
520 3300035692 Ga0373935_0010760 Ga0373935_0010760_4137_5444 403
521 3300037068 Ga0373925_0009690 Ga0373925_0009690_5336_6643 403
522 3300037471 Ga0395905_0047873 Ga0395905_0047873_1555_2811 403
523 3300041411 Ga0439466_0021262 Ga0439466_0021262_825_2105 403
524 3300041413 Ga0439465_0000349 Ga0439465_0000349_4683_5963 403
525 3300046461 Ga0495641_0012394 Ga0495641_0012394_691_1998 403
526 3300046517 Ga0495630_0011332 Ga0495630_0011332_3415_4722 403
527 3300046535 Ga0495586_0005340 Ga0495586_0005340_2058_3365 403
528 3300046559 Ga0495667_0057206 Ga0495667_0057206_599_1906 403
529 3300046642 Ga0495634_0002700 Ga0495634_0002700_6170_7477 403
530 3300046674 Ga0495588_0001357 Ga0495588_0001357_342_1649 403
531 3300046683 Ga0495658_0001438 Ga0495658_0001438_6027_7334 403
532 3300047673 Ga0495593_0015763 Ga0495593_0015763_2938_4245 403
533 3300048089 Ga0495614_0001554 Ga0495614_0001554_5107_6414 403
534 3300048903 Ga0496100_0009450 Ga0496100_0009450_1966_3255 403
535 3300048904 Ga0496101_0000021 Ga0496101_0000021_31716_33005 403
536 3300048905 Ga0496102_0000001 Ga0496102_0000001_225008_226285 403
537 3300048906 Ga0496103_0000007 Ga0496103_0000007_129404_130681 403
538 3300048909 Ga0496106_0003386 Ga0496106_0003386_1656_2945 403
539 3300048910 Ga0496107_0011486 Ga0496107_0011486_1912_3201 403
540 3300048919 Ga0496116_0000018 Ga0496116_0000018_188110_189387 403
541 3300048920 Ga0496117_0000015 Ga0496117_0000015_356491_357768 403
542 3300048921 Ga0496118_0000012 Ga0496118_0000012_356491_357768 403
543 3300048923 Ga0496120_0006298 Ga0496120_0006298_4053_5330 403
544 3300048924 Ga0496121_0000177 Ga0496121_0000177_127197_128486 403
545 3300048929 Ga0496126_0001113 Ga0496126_0001113_33124_34401 403
546 3300049744 Ga0501083_0038734 Ga0501083_0038734_1312_2616 403
547 3300049823 Ga0501044_0196617 Ga0501044_0196617_338_1642 403
548 3300003792 Ga0055540_1001155 Ga0055540_10011556 404
549 3300005435 Ga0070714_100040816 Ga0070714_1000408162 404
550 3300005436 Ga0070713_100004385 Ga0070713_1000043853 404
551 3300025303 Ga0209051_1001208 Ga0209051_100120818 404
552 3300025929 Ga0207664_10002329 Ga0207664_100023298 404
553 3300031901 Ga0307406_10058952 Ga0307406_100589522 404
554 3300037312 Ga0395899_0140674 Ga0395899_0140674_295_1551 404
555 3300037466 Ga0395898_0019897 Ga0395898_0019897_2145_3401 404
556 3300046455 Ga0495603_0040047 Ga0495603_0040047_1243_2571 404
557 3300046473 Ga0495582_0027448 Ga0495582_0027448_11_1249 404
558 3300046516 Ga0495628_0102534 Ga0495628_0102534_273_1616 404
559 3300046536 Ga0495587_0019393 Ga0495587_0019393_2310_3653 404
560 3300048922 Ga0496119_0060786 Ga0496119_0060786_710_1960 404
561 3300053080 Ga0500635_0004952 Ga0500635_0004952_88_1350 404
562 3300002459 JGI24751J29686_10016832 JGI24751J29686_100168322 405
563 3300005436 Ga0070713_100113829 Ga0070713_1001138292 405
564 3300005455 Ga0070663_100140945 Ga0070663_1001409452 405
565 3300006038 Ga0075365_10140439 Ga0075365_101404392 405
566 3300006186 Ga0075369_10001370 Ga0075369_100013707 405
567 3300025303 Ga0209051_1006114 Ga0209051_10061146 405
568 3300025915 Ga0207693_10089600 Ga0207693_100896002 405
569 3300025925 Ga0207650_10020009 Ga0207650_100200093 405
570 3300025926 Ga0207659_10138959 Ga0207659_101389592 405
571 3300025927 Ga0207687_10165851 Ga0207687_101658512 405
572 3300026067 Ga0207678_10045686 Ga0207678_100456862 405
573 3300044706 Ga0466964_0017103 Ga0466964_0017103_1423_2700 405
574 3300045976 Ga0466967_0056273 Ga0466967_0056273_713_1990 405
575 3300045976 Ga0466967_0132388 Ga0466967_0132388_196_1500 405
576 3300046523 Ga0495644_0028662 Ga0495644_0028662_368_1702 405
577 3300046525 Ga0495663_0006952 Ga0495663_0006952_939_2273 405
578 3300046615 Ga0495656_0000291 Ga0495656_0000291_15967_17301 405
579 3300046664 Ga0495659_0000889 Ga0495659_0000889_46_1380 405
580 3300050516 nmdc:mga0sz30_3201_c1 nmdc:mga0sz30_3201_c1_3849_5129 405
581 3300005434 Ga0070709_10000794 Ga0070709_100007945 406
582 3300005435 Ga0070714_100000640 Ga0070714_1000006409 406
583 3300005436 Ga0070713_100000428 Ga0070713_1000004285 406
584 3300005437 Ga0070710_10000101 Ga0070710_1000010121 406
585 3300005439 Ga0070711_100000437 Ga0070711_1000004377 406
586 3300006028 Ga0070717_10000956 Ga0070717_100009564 406
587 3300006173 Ga0070716_100000560 Ga0070716_1000005608 406
588 3300006175 Ga0070712_100002191 Ga0070712_1000021915 406
589 3300009098 Ga0105245_10116217 Ga0105245_101162172 406
590 3300014968 Ga0157379_10069475 Ga0157379_100694752 406
591 3300025905 Ga0207685_10001280 Ga0207685_100012804 406
592 3300025906 Ga0207699_10000156 Ga0207699_1000015635 406
593 3300025910 Ga0207684_10057831 Ga0207684_100578312 406
594 3300025915 Ga0207693_10002490 Ga0207693_100024908 406
595 3300025916 Ga0207663_10006245 Ga0207663_100062456 406
596 3300025928 Ga0207700_10000063 Ga0207700_1000006330 406
597 3300025929 Ga0207664_10000196 Ga0207664_100001969 406
598 3300025939 Ga0207665_10000226 Ga0207665_1000022613 406
599 3300046516 Ga0495628_0024834 Ga0495628_0024834_3374_4681 406
600 3300046559 Ga0495667_0047522 Ga0495667_0047522_574_1917 406
601 3300005435 Ga0070714_100180693 Ga0070714_1001806931 407
602 3300006175 Ga0070712_100102759 Ga0070712_1001027592 407
603 3300009147 Ga0114129_10019233 Ga0114129_100192337 407
604 3300025915 Ga0207693_10061181 Ga0207693_100611812 407
605 3300025929 Ga0207664_10044307 Ga0207664_100443073 407
606 3300041410 Ga0439461_0000217 Ga0439461_0000217_6554_7837 407
607 3300041997 Ga0439431_0000859 Ga0439431_0000859_3645_4928 407
608 3300045976 Ga0466967_0111964 Ga0466967_0111964_431_1726 407
609 3300046679 Ga0495623_0055054 Ga0495623_0055054_564_1871 407
610 3300048913 Ga0496110_0209617 Ga0496110_0209617_180_1466 407
611 3300050507 nmdc:mga05p37_11253_c1 nmdc:mga05p37_11253_c1_2961_4256 407
612 3300005434 Ga0070709_10079546 Ga0070709_100795462 408
613 3300006163 Ga0070715_10004042 Ga0070715_100040425 408
614 3300006163 Ga0070715_10023722 Ga0070715_100237222 408
615 3300006175 Ga0070712_100012459 Ga0070712_1000124593 408
616 3300009551 Ga0105238_10195444 Ga0105238_101954441 408
617 3300013297 Ga0157378_10019027 Ga0157378_100190271 408
618 3300017792 Ga0163161_10171762 Ga0163161_101717622 408
619 3300025900 Ga0207710_10081651 Ga0207710_100816512 408
620 3300025905 Ga0207685_10003910 Ga0207685_100039104 408
621 3300025915 Ga0207693_10000199 Ga0207693_1000019938 408
622 3300025916 Ga0207663_10001603 Ga0207663_100016034 408
623 3300025933 Ga0207706_10022575 Ga0207706_100225755 408
624 3300025939 Ga0207665_10013801 Ga0207665_100138012 408
625 3300025939 Ga0207665_10067547 Ga0207665_100675472 408
626 3300028800 Ga0265338_10001512 Ga0265338_1000151236 408
627 3300035083 Ga0373926_0001462 Ga0373926_0001462_5634_6971 408
628 3300035083 Ga0373926_0021075 Ga0373926_0021075_279_1580 408
629 3300035111 Ga0373923_0020707 Ga0373923_0020707_1029_2330 408
630 3300035113 Ga0373936_0006048 Ga0373936_0006048_804_2102 408
631 3300035113 Ga0373936_0008708 Ga0373936_0008708_286_1602 408
632 3300035113 Ga0373936_0014364 Ga0373936_0014364_675_1976 408
633 3300035116 Ga0373945_0001751 Ga0373945_0001751_2210_3547 408
634 3300035116 Ga0373945_0014754 Ga0373945_0014754_694_1995 408
635 3300035119 Ga0373956_0025651 Ga0373956_0025651_978_2279 408
636 3300035120 Ga0373957_0015658 Ga0373957_0015658_667_1968 408
637 3300035170 Ga0373943_0000223 Ga0373943_0000223_979_2277 408
638 3300035171 Ga0373946_0000798 Ga0373946_0000798_2558_3856 408
639 3300035692 Ga0373935_0004598 Ga0373935_0004598_5580_6878 408
640 3300035695 Ga0373927_0003276 Ga0373927_0003276_2880_4217 408
641 3300035695 Ga0373927_0051849 Ga0373927_0051849_566_1867 408
642 3300037068 Ga0373925_0012062 Ga0373925_0012062_4002_5300 408
643 3300046454 Ga0495592_0068405 Ga0495592_0068405_546_1847 408
644 3300046455 Ga0495603_0024918 Ga0495603_0024918_1948_3249 408
645 3300046461 Ga0495641_0007936 Ga0495641_0007936_3404_4702 408
646 3300046461 Ga0495641_0044956 Ga0495641_0044956_35_1336 408
647 3300046476 Ga0495662_0013986 Ga0495662_0013986_1972_3270 408
648 3300046477 Ga0495664_0000074 Ga0495664_0000074_18682_19980 408
649 3300046477 Ga0495664_0099478 Ga0495664_0099478_413_1717 408
650 3300046511 Ga0495608_0018431 Ga0495608_0018431_519_1820 408
651 3300046514 Ga0495618_0089619 Ga0495618_0089619_339_1661 408
652 3300046516 Ga0495628_0101290 Ga0495628_0101290_248_1549 408
653 3300046517 Ga0495630_0009396 Ga0495630_0009396_674_1975 408
654 3300046517 Ga0495630_0016278 Ga0495630_0016278_335_1633 408
655 3300046526 Ga0495666_0000996 Ga0495666_0000996_7794_9131 408
656 3300046529 Ga0495652_0043197 Ga0495652_0043197_2127_3425 408
657 3300046531 Ga0495665_0013989 Ga0495665_0013989_927_2228 408
658 3300046536 Ga0495587_0055100 Ga0495587_0055100_694_1995 408
659 3300046543 Ga0495645_0158078 Ga0495645_0158078_23_1327 408
660 3300046559 Ga0495667_0029518 Ga0495667_0029518_1155_2453 408
661 3300046559 Ga0495667_0087160 Ga0495667_0087160_248_1549 408
662 3300046642 Ga0495634_0056454 Ga0495634_0056454_599_1897 408
663 3300046663 Ga0495635_0000773 Ga0495635_0000773_6751_8049 408
664 3300046663 Ga0495635_0063839 Ga0495635_0063839_1193_2494 408
665 3300046675 Ga0495657_0051040 Ga0495657_0051040_551_1852 408
666 3300046678 Ga0495599_0053041 Ga0495599_0053041_694_1995 408
667 3300046680 Ga0495646_0041034 Ga0495646_0041034_229_1530 408
668 3300046681 Ga0495647_0001537 Ga0495647_0001537_4181_5518 408
669 3300046681 Ga0495647_0042764 Ga0495647_0042764_312_1610 408
670 3300046690 Ga0495624_0006757 Ga0495624_0006757_2991_4289 408
671 3300046690 Ga0495624_0028048 Ga0495624_0028048_937_2238 408
672 3300047315 Ga0495581_0004943 Ga0495581_0004943_2564_3901 408
673 3300047315 Ga0495581_0009928 Ga0495581_0009928_1477_2775 408
674 3300047315 Ga0495581_0036608 Ga0495581_0036608_993_2294 408
675 3300047319 Ga0495674_0002797 Ga0495674_0002797_3744_5042 408
676 3300047319 Ga0495674_0041283 Ga0495674_0041283_1370_2674 408
677 3300047321 Ga0495676_0020287 Ga0495676_0020287_918_2216 408
678 3300047322 Ga0495680_0029597 Ga0495680_0029597_1867_3168 408
679 3300047322 Ga0495680_0071146 Ga0495680_0071146_368_1666 408
680 3300047471 Ga0495684_0005984 Ga0495684_0005984_4379_5677 408
681 3300048088 Ga0495602_0130474 Ga0495602_0130474_476_1777 408
682 3300048911 Ga0496108_0127244 Ga0496108_0127244_191_1492 408
683 3300053085 Ga0495619_0037454 Ga0495619_0037454_616_1917 408
684 3300005545 Ga0070695_100182054 Ga0070695_1001820542 409
685 3300025939 Ga0207665_10058954 Ga0207665_100589542 409
686 3300037068 Ga0373925_0000421 Ga0373925_0000421_19186_20511 409
687 3300005467 Ga0070706_100003990 Ga0070706_10000399013 410
688 3300005468 Ga0070707_100000041 Ga0070707_10000004116 410
689 3300005471 Ga0070698_100000082 Ga0070698_10000008231 410
690 3300025910 Ga0207684_10000339 Ga0207684_1000033919 410
691 3300025922 Ga0207646_10000061 Ga0207646_1000006149 410
692 3300005327 Ga0070658_10093466 Ga0070658_100934662 411
693 3300005334 Ga0068869_100068037 Ga0068869_1000680372 411
694 3300005336 Ga0070680_100072410 Ga0070680_1000724102 411
695 3300005337 Ga0070682_100022719 Ga0070682_1000227193 411
696 3300005344 Ga0070661_100009141 Ga0070661_1000091413 411
697 3300005347 Ga0070668_100055714 Ga0070668_1000557142 411
698 3300005354 Ga0070675_100063813 Ga0070675_1000638132 411
699 3300005355 Ga0070671_100047247 Ga0070671_1000472471 411
700 3300005364 Ga0070673_100010279 Ga0070673_1000102794 411
701 3300005434 Ga0070709_10000243 Ga0070709_100002436 411
702 3300005437 Ga0070710_10001923 Ga0070710_100019235 411
703 3300005437 Ga0070710_10003412 Ga0070710_100034126 411
704 3300005438 Ga0070701_10023934 Ga0070701_100239342 411
705 3300005439 Ga0070711_100001607 Ga0070711_1000016078 411
706 3300005440 Ga0070705_100027798 Ga0070705_1000277983 411
707 3300005441 Ga0070700_100008542 Ga0070700_1000085423 411
708 3300005455 Ga0070663_100004269 Ga0070663_1000042696 411
709 3300005456 Ga0070678_100067738 Ga0070678_1000677382 411
710 3300005457 Ga0070662_100044175 Ga0070662_1000441752 411
711 3300005459 Ga0068867_100149122 Ga0068867_1001491221 411
712 3300005535 Ga0070684_100082513 Ga0070684_1000825132 411
713 3300005539 Ga0068853_100049796 Ga0068853_1000497962 411
714 3300005539 Ga0068853_100069006 Ga0068853_1000690062 411
715 3300005543 Ga0070672_100162157 Ga0070672_1001621571 411
716 3300005545 Ga0070695_100139249 Ga0070695_1001392492 411
717 3300005546 Ga0070696_100058492 Ga0070696_1000584922 411
718 3300005546 Ga0070696_100063569 Ga0070696_1000635692 411
719 3300005577 Ga0068857_100017591 Ga0068857_1000175914 411
720 3300005615 Ga0070702_100017389 Ga0070702_1000173892 411
721 3300005618 Ga0068864_100098059 Ga0068864_1000980592 411
722 3300005718 Ga0068866_10057117 Ga0068866_100571172 411
723 3300005840 Ga0068870_10029598 Ga0068870_100295982 411
724 3300005844 Ga0068862_100043121 Ga0068862_1000431212 411
725 3300006173 Ga0070716_100004017 Ga0070716_1000040176 411
726 3300006173 Ga0070716_100006565 Ga0070716_1000065655 411
727 3300006175 Ga0070712_100017727 Ga0070712_1000177274 411
728 3300006881 Ga0068865_100028975 Ga0068865_1000289752 411
729 3300009101 Ga0105247_10029448 Ga0105247_100294483 411
730 3300013100 Ga0157373_10015473 Ga0157373_100154733 411
731 3300013296 Ga0157374_10067899 Ga0157374_100678992 411
732 3300014325 Ga0163163_10067769 Ga0163163_100677692 411
733 3300017792 Ga0163161_10061975 Ga0163161_100619752 411
734 3300025321 Ga0207656_10030145 Ga0207656_100301452 411
735 3300025898 Ga0207692_10001870 Ga0207692_100018708 411
736 3300025899 Ga0207642_10012124 Ga0207642_100121242 411
737 3300025901 Ga0207688_10001514 Ga0207688_100015145 411
738 3300025904 Ga0207647_10079885 Ga0207647_100798852 411
739 3300025906 Ga0207699_10002495 Ga0207699_100024956 411
740 3300025906 Ga0207699_10028701 Ga0207699_100287012 411
741 3300025908 Ga0207643_10002720 Ga0207643_100027204 411
742 3300025911 Ga0207654_10092056 Ga0207654_100920562 411
743 3300025915 Ga0207693_10001690 Ga0207693_100016906 411
744 3300025915 Ga0207693_10093630 Ga0207693_100936302 411
745 3300025916 Ga0207663_10014279 Ga0207663_100142793 411
746 3300025916 Ga0207663_10017362 Ga0207663_100173622 411
747 3300025919 Ga0207657_10030438 Ga0207657_100304382 411
748 3300025920 Ga0207649_10082505 Ga0207649_100825052 411
749 3300025928 Ga0207700_10016567 Ga0207700_100165673 411
750 3300025928 Ga0207700_10029504 Ga0207700_100295042 411
751 3300025929 Ga0207664_10032064 Ga0207664_100320644 411
752 3300025929 Ga0207664_10047539 Ga0207664_100475392 411
753 3300025929 Ga0207664_10056440 Ga0207664_100564402 411
754 3300025929 Ga0207664_10243144 Ga0207664_102431441 411
755 3300025931 Ga0207644_10031027 Ga0207644_100310272 411
756 3300025932 Ga0207690_10054150 Ga0207690_100541501 411
757 3300025933 Ga0207706_10019781 Ga0207706_100197814 411
758 3300025934 Ga0207686_10037607 Ga0207686_100376072 411
759 3300025937 Ga0207669_10057020 Ga0207669_100570202 411
760 3300025939 Ga0207665_10001670 Ga0207665_100016703 411
761 3300025939 Ga0207665_10059404 Ga0207665_100594042 411
762 3300025940 Ga0207691_10033981 Ga0207691_100339814 411
763 3300025940 Ga0207691_10040532 Ga0207691_100405322 411
764 3300025942 Ga0207689_10002296 Ga0207689_100022963 411
765 3300025960 Ga0207651_10050424 Ga0207651_100504242 411
766 3300026067 Ga0207678_10001390 Ga0207678_100013905 411
767 3300026067 Ga0207678_10016407 Ga0207678_100164074 411
768 3300026075 Ga0207708_10006707 Ga0207708_100067078 411
769 3300026078 Ga0207702_10138335 Ga0207702_101383352 411
770 3300026089 Ga0207648_10026700 Ga0207648_100267002 411
771 3300026089 Ga0207648_10103641 Ga0207648_101036412 411
772 3300026095 Ga0207676_10022955 Ga0207676_100229552 411
773 3300026116 Ga0207674_10010966 Ga0207674_1001096610 411
774 3300026121 Ga0207683_10008060 Ga0207683_100080605 411
775 3300026121 Ga0207683_10027425 Ga0207683_100274252 411
776 3300035088 Ga0373940_0001161 Ga0373940_0001161_2326_3627 411
777 3300035114 Ga0373939_0005927 Ga0373939_0005927_928_2229 411
778 3300035115 Ga0373941_0005711 Ga0373941_0005711_835_2136 411
779 3300045976 Ga0466967_0056739 Ga0466967_0056739_1602_2918 411
780 3300048905 Ga0496102_0029162 Ga0496102_0029162_2077_3402 411
781 3300048906 Ga0496103_0074244 Ga0496103_0074244_693_1994 411
782 3300048907 Ga0496104_0091076 Ga0496104_0091076_605_1906 411
783 3300048911 Ga0496108_0093677 Ga0496108_0093677_174_1475 411
784 3300050496 nmdc:mga07m45_69649_c1 nmdc:mga07m45_69649_c1_38_1291 411
785 3300037853 Ga0436364_1450559 Ga0436364_1450559_524_1819 412
786 3300026118 Ga0207675_100013054 Ga0207675_1000130548 413
787 iso_pu_bacteria 2738541274 2738704647 413
788 3300005981 Ga0081538_10000404 Ga0081538_1000040429 414
789 3300044656 Ga0466969_0078576 Ga0466969_0078576_207_1502 414
790 3300044694 Ga0466963_0040770 Ga0466963_0040770_1143_2438 414
791 3300046473 Ga0495582_0033593 Ga0495582_0033593_794_2083 414
792 3300046491 Ga0495584_0069862 Ga0495584_0069862_304_1566 414
793 3300046499 Ga0495594_0100555 Ga0495594_0100555_156_1445 414
794 3300046690 Ga0495624_0033267 Ga0495624_0033267_220_1509 414
795 3300047319 Ga0495674_0107812 Ga0495674_0107812_1009_2298 414
796 3300048905 Ga0496102_0073674 Ga0496102_0073674_118_1461 414
797 iso_pu_bacteria 2643221687 2644488274 414
798 iso_pu_bacteria 2902837492 2902841362 414
799 iso_pu_bacteria 2929212328 2929216249 414
800 3300003659 JGI25404J52841_10001437 JGI25404J52841_100014374 415
801 3300005563 Ga0068855_100055086 Ga0068855_1000550864 415
802 3300005983 Ga0081540_1000505 Ga0081540_10005053 415
803 3300006353 Ga0075370_10008783 Ga0075370_100087833 415
804 3300009545 Ga0105237_10000178 Ga0105237_1000017825 415
805 3300009545 Ga0105237_10002564 Ga0105237_100025647 415
806 3300010375 Ga0105239_10007516 Ga0105239_100075164 415
807 3300010375 Ga0105239_10030663 Ga0105239_100306633 415
808 3300014325 Ga0163163_10385973 Ga0163163_103859731 415
809 3300025914 Ga0207671_10008270 Ga0207671_100082704 415
810 3300031548 Ga0307408_100231039 Ga0307408_1002310392 415
811 3300031731 Ga0307405_10018316 Ga0307405_100183163 415
812 3300032002 Ga0307416_100017768 Ga0307416_1000177681 415
813 3300032126 Ga0307415_100027908 Ga0307415_1000279082 415
814 3300037853 Ga0436364_1107254 Ga0436364_1107254_109_1401 415
815 3300053087 Ga0500643_001154 Ga0500643_001154_8527_9876 415
816 iso_pu_bacteria 2902810491 2902811298 415
817 3300005329 Ga0070683_100199128 Ga0070683_1001991282 416
818 3300006173 Ga0070716_100005420 Ga0070716_1000054207 416
819 3300025929 Ga0207664_10272932 Ga0207664_102729322 416
820 3300044684 Ga0466966_0009549 Ga0466966_0009549_3852_5126 416
821 3300044693 Ga0466961_0002650 Ga0466961_0002650_3168_4442 416
822 3300044694 Ga0466963_0005765 Ga0466963_0005765_1120_2394 416
823 3300044706 Ga0466964_0005286 Ga0466964_0005286_1859_3133 416
824 3300044842 Ga0466957_0008856 Ga0466957_0008856_4264_5538 416
825 3300045049 Ga0466959_0001490 Ga0466959_0001490_10160_11434 416
826 3300053087 Ga0500643_001862 Ga0500643_001862_6541_7818 416
827 iso_pu_bacteria 2902792274 2902795187 416
828 iso_pu_bacteria 2939582691 2939583058 416
829 3300003792 Ga0055540_1002276 Ga0055540_10022769 418
830 3300025303 Ga0209051_1000528 Ga0209051_100052833 418
831 3300037312 Ga0395899_0005983 Ga0395899_0005983_2663_3967 418
832 3300037418 Ga0395900_0033278 Ga0395900_0033278_1971_3275 418
833 3300037466 Ga0395898_0003800 Ga0395898_0003800_6070_7374 418
834 3300037471 Ga0395905_0008955 Ga0395905_0008955_3799_5103 418
835 3300038443 Ga0395901_0032219 Ga0395901_0032219_3581_4885 418
836 iso_pu_bacteria 8055066027 8055072402 418
837 3300021388 Ga0213875_10000604 Ga0213875_100006042 419
838 3300022467 Ga0224712_10065178 Ga0224712_100651781 419
839 3300025915 Ga0207693_10045359 Ga0207693_100453593 419
840 3300025944 Ga0207661_10104229 Ga0207661_101042292 419
841 3300037068 Ga0373925_0081599 Ga0373925_0081599_571_1884 419
842 3300037853 Ga0436364_1435297 Ga0436364_1435297_27301_28611 419
843 3300045976 Ga0466967_0010721 Ga0466967_0010721_676_1974 419
844 3300005435 Ga0070714_100042573 Ga0070714_1000425732 420
845 3300005436 Ga0070713_100021199 Ga0070713_1000211992 420
846 3300005471 Ga0070698_100030094 Ga0070698_1000300942 420
847 3300005536 Ga0070697_100036724 Ga0070697_1000367243 420
848 3300025922 Ga0207646_10042854 Ga0207646_100428542 420
849 3300035111 Ga0373923_0009489 Ga0373923_0009489_1668_2960 420
850 3300035113 Ga0373936_0000519 Ga0373936_0000519_9158_10450 420
851 3300035117 Ga0373953_0003298 Ga0373953_0003298_1338_2630 420
852 3300035118 Ga0373954_0014349 Ga0373954_0014349_738_2030 420
853 3300035120 Ga0373957_0051606 Ga0373957_0051606_235_1527 420
854 3300035692 Ga0373935_0042798 Ga0373935_0042798_1504_2796 420
855 3300037068 Ga0373925_0045115 Ga0373925_0045115_784_2076 420
856 3300046454 Ga0495592_0015925 Ga0495592_0015925_2402_3694 420
857 3300046459 Ga0495629_0003190 Ga0495629_0003190_6483_7775 420
858 3300046462 Ga0495651_0059179 Ga0495651_0059179_58_1350 420
859 3300046473 Ga0495582_0013066 Ga0495582_0013066_3266_4558 420
860 3300046475 Ga0495639_0019856 Ga0495639_0019856_573_1865 420
861 3300046476 Ga0495662_0005395 Ga0495662_0005395_4866_6158 420
862 3300046477 Ga0495664_0003697 Ga0495664_0003697_5326_6618 420
863 3300046514 Ga0495618_0071028 Ga0495618_0071028_738_2030 420
864 3300046517 Ga0495630_0032481 Ga0495630_0032481_738_2030 420
865 3300046533 Ga0495640_0018263 Ga0495640_0018263_2327_3619 420
866 3300046535 Ga0495586_0107155 Ga0495586_0107155_46_1338 420
867 3300046536 Ga0495587_0091279 Ga0495587_0091279_282_1574 420
868 3300046559 Ga0495667_0068884 Ga0495667_0068884_738_2030 420
869 3300046680 Ga0495646_0018567 Ga0495646_0018567_1101_2393 420
870 3300046683 Ga0495658_0011377 Ga0495658_0011377_1861_3153 420
871 3300046689 Ga0495613_0053181 Ga0495613_0053181_1616_2908 420
872 3300047315 Ga0495581_0008059 Ga0495581_0008059_13_1305 420
873 3300047317 Ga0495604_0025456 Ga0495604_0025456_1589_2881 420
874 3300047444 Ga0495675_0005713 Ga0495675_0005713_2907_4199 420
875 3300047673 Ga0495593_0050767 Ga0495593_0050767_719_2011 420
876 3300053077 Ga0495601_0015602 Ga0495601_0015602_2151_3443 420
877 3300053084 Ga0495595_0002988 Ga0495595_0002988_5228_6520 420
878 3300053085 Ga0495619_0001449 Ga0495619_0001449_11937_13229 420
879 3300005536 Ga0070697_100049392 Ga0070697_1000493923 421
880 3300022467 Ga0224712_10040519 Ga0224712_100405191 421
881 3300005471 Ga0070698_100173688 Ga0070698_1001736882 422
882 3300009147 Ga0114129_10004398 Ga0114129_1000439813 422
883 3300042993 Ga0439440_0014134 Ga0439440_0014134_358_1632 423
884 3300009553 Ga0105249_10108817 Ga0105249_101088172 424
885 3300009553 Ga0105249_10172159 Ga0105249_101721592 424
886 3300014745 Ga0157377_10146693 Ga0157377_101466932 424
887 3300037418 Ga0395900_0125814 Ga0395900_0125814_454_1731 424
888 3300009094 Ga0111539_10184592 Ga0111539_101845922 425
889 3300046491 Ga0495584_0037466 Ga0495584_0037466_491_1768 425
890 3300046615 Ga0495656_0022991 Ga0495656_0022991_491_1768 425
891 3300009011 Ga0105251_10017533 Ga0105251_100175332 426
892 3300009147 Ga0114129_10018631 Ga0114129_100186316 426
893 3300014325 Ga0163163_10021984 Ga0163163_100219845 426
894 3300048916 Ga0496113_0121038 Ga0496113_0121038_38_1318 426
895 3300005985 Ga0081539_10021040 Ga0081539_100210404 427
896 3300005354 Ga0070675_100313505 Ga0070675_1003135051 428
897 3300005444 Ga0070694_100015852 Ga0070694_1000158524 428
898 3300005471 Ga0070698_100075801 Ga0070698_1000758012 428
899 3300005549 Ga0070704_100007803 Ga0070704_1000078034 428
900 3300005719 Ga0068861_100030613 Ga0068861_1000306132 428
901 3300005937 Ga0081455_10043919 Ga0081455_100439194 428
902 3300006058 Ga0075432_10000387 Ga0075432_1000038710 428
903 3300006844 Ga0075428_100065799 Ga0075428_1000657994 428
904 3300006846 Ga0075430_100051156 Ga0075430_1000511562 428
905 3300006847 Ga0075431_100036726 Ga0075431_1000367262 428
906 3300006871 Ga0075434_100014932 Ga0075434_1000149325 428
907 3300025904 Ga0207647_10063954 Ga0207647_100639542 428
908 3300025935 Ga0207709_10023700 Ga0207709_100237003 428
909 3300025961 Ga0207712_10043419 Ga0207712_100434192 428
910 3300026118 Ga0207675_100017867 Ga0207675_1000178676 428
911 3300027907 Ga0207428_10001001 Ga0207428_1000100130 428
912 3300046689 Ga0495613_0108031 Ga0495613_0108031_523_1866 428
913 3300047318 Ga0495636_0005073 Ga0495636_0005073_454_1743 428
914 3300005937 Ga0081455_10003773 Ga0081455_100037737 429
915 3300005937 Ga0081455_10071142 Ga0081455_100711422 429
916 3300006058 Ga0075432_10004840 Ga0075432_100048404 429
917 3300006844 Ga0075428_100089059 Ga0075428_1000890593 429
918 3300006852 Ga0075433_10005527 Ga0075433_1000552713 429
919 3300006871 Ga0075434_100005157 Ga0075434_1000051577 429
920 3300009147 Ga0114129_10026156 Ga0114129_100261563 429
921 3300027907 Ga0207428_10011760 Ga0207428_100117605 429
922 3300050507 nmdc:mga05p37_87829_c1 nmdc:mga05p37_87829_c1_528_1826 429
923 3300050508 nmdc:mga09592_86124_c1 nmdc:mga09592_86124_c1_793_2091 429
924 3300050511 nmdc:mga08y16_140196_c1 nmdc:mga08y16_140196_c1_1011_2309 429
925 3300050512 nmdc:mga0n895_16162_c1 nmdc:mga0n895_16162_c1_3905_5203 429
926 3300050512 nmdc:mga0n895_39305_c1 nmdc:mga0n895_39305_c1_187_1491 429
927 3300001976 JGI24752J21851_1002611 JGI24752J21851_10026112 430
928 3300002155 JGI24033J26618_1000486 JGI24033J26618_10004862 430
929 3300002459 JGI24751J29686_10000684 JGI24751J29686_100006844 430
930 3300005344 Ga0070661_100005479 Ga0070661_1000054795 430
931 3300005406 Ga0070703_10010304 Ga0070703_100103042 430
932 3300005441 Ga0070700_100009104 Ga0070700_1000091044 430
933 3300005455 Ga0070663_100018208 Ga0070663_1000182083 430
934 3300005467 Ga0070706_100298265 Ga0070706_1002982651 430
935 3300005535 Ga0070684_100003351 Ga0070684_1000033515 430
936 3300005564 Ga0070664_100002582 Ga0070664_1000025826 430
937 3300005618 Ga0068864_100114068 Ga0068864_1001140682 430
938 3300005841 Ga0068863_100006801 Ga0068863_1000068015 430
939 3300025885 Ga0207653_10002058 Ga0207653_100020584 430
940 3300025908 Ga0207643_10000055 Ga0207643_1000005579 430
941 3300025920 Ga0207649_10020440 Ga0207649_100204402 430
942 3300025925 Ga0207650_10001024 Ga0207650_100010246 430
943 3300025945 Ga0207679_10002946 Ga0207679_100029469 430
944 3300026067 Ga0207678_10032965 Ga0207678_100329653 430
945 3300026075 Ga0207708_10005684 Ga0207708_100056845 430
946 3300026088 Ga0207641_10071720 Ga0207641_100717203 430
947 3300026095 Ga0207676_10001452 Ga0207676_1000145216 430
948 3300026116 Ga0207674_10000186 Ga0207674_1000018679 430
949 3300026118 Ga0207675_100163300 Ga0207675_1001633002 430
950 3300046523 Ga0495644_0027858 Ga0495644_0027858_733_2025 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

72

357

0.92

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

81

386

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvt-assembly1.cif.gz_A crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis 0.92 35 426
7bvt-assembly1.cif.gz_A crystal structure of cyclic alpha-maltosyl-1,6-maltose binding protein from arthrobacter globiformis 0.9109 35 426
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.8823 37 428
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.8742 37 428
1n3x-assembly1.cif.gz_A ligand-free high-affinity maltose-binding protein 0.8715 38 423
ID Description Score Start End Superfamily
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8736 37 149 3.40.190.10
4hs7A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8679 36 150 3.40.190.10
af_O53485_33_438_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8674 38 427 3.40.190.10
3n95B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8632 38 150 3.40.190.10
4rjzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8556 37 149 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A661VLR6-F1-model_v4 ABC transporter substrate-binding protein 0.8946 129 428 GO:0030313
AF-A0A0S7XGC0-F1-model_v4 ABC transporter substrate-binding protein 0.8942 27 428 GO:0015768
GO:0042956
GO:0055052
GO:1901982
AF-A0A496QBQ7-F1-model_v4 ABC transporter substrate-binding protein 0.8915 128 426 GO:0030313
AF-D8H0S8-F1-model_v4 deleted 0.8882 91 429
AF-A0A496QBQ7-F1-model_v4 ABC transporter substrate-binding protein 0.883 128 426 GO:0030313

Feature Viewer

pLDDT pTM Quality
89.98 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map