F486548

General Info

Members Datasets Scaffolds Average Seq Length
950 321 1900 157

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100165198|Ga0070706_1001651984
Length 175
Sequence MPCAVSWSMSSTATPPEGPAPSESARWHWRALEGLYASAPVNRLFRSELQITEEGRSRIVFEIDESCFHAAGAAHGTIYFKMLDDAAFYAANTLVTDRFLLTTQFNLQFLRPIRSGTVIAEGRWISGKRRVFVAESRLVDDEGEEIGRGTGTFMRSHIALGGLPGYAAGLAAALG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
152 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
192 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
265 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
268 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
269 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
270 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
290 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
291 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
292 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
293 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
300 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
307 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
312 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
313 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
314 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
315 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
316 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
317 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
318 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
319 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
320 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
321 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0.11
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.58
Nodule 0.53
Rhizoplane 2.32
Rhizosphere 82.84
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100165198 3300005467 Bacteria 2067
2 SwRhRL2b_contig_780398 2162886007 Bacteria 36690
3 JGI24746J21847_1018157 3300001977 Bacteria 996
4 JGI24738J21930_10106070 3300002075 Bacteria 603
5 JGI24749J21850_1001467 3300002076 Bacteria 3331
6 JGI24034J26672_10020598 3300002239 Bacteria 1034
7 JGI24742J22300_10076019 3300002244 Bacteria 630
8 JGI24751J29686_10005560 3300002459 Bacteria 2565
9 JGI24751J29686_10008598 3300002459 Bacteria 2090
10 JGI24751J29686_10116665 3300002459 Bacteria 560
11 Ga0055530_10068401 3300003791 Bacteria 772
12 Ga0065714_10221447 3300005288 Bacteria 839
13 Ga0065704_10070157 3300005289 Bacteria 211668
14 Ga0065704_10157456 3300005289 Bacteria 1380
15 Ga0065715_10000565 3300005293 Bacteria 10505
16 Ga0065707_10116514 3300005295 Bacteria 2235
17 Ga0065707_10561390 3300005295 Bacteria 707
18 Ga0070658_10000003 3300005327 Bacteria 465963
19 Ga0070658_10405327 3300005327 Bacteria 1171
20 Ga0070676_10047460 3300005328 Bacteria 2508
21 Ga0070676_10052842 3300005328 Bacteria 2390
22 Ga0070683_100312421 3300005329 Bacteria 1495
23 Ga0070670_100005390 3300005331 Bacteria 10797
24 Ga0070670_100007610 3300005331 Bacteria 9199
25 Ga0070670_100110695 3300005331 Bacteria 2366
26 Ga0070670_100137168 3300005331 Bacteria 2114
27 Ga0070670_100302468 3300005331 Bacteria 1399
28 Ga0070670_100631029 3300005331 Bacteria 960
29 Ga0070677_10005158 3300005333 Bacteria 4293
30 Ga0070677_10159157 3300005333 Bacteria 1058
31 Ga0070666_10106154 3300005335 Bacteria 1940
32 Ga0070666_10250404 3300005335 Bacteria 1254
33 Ga0070666_10376061 3300005335 Bacteria 1019
34 Ga0070680_100000263 3300005336 Bacteria 34685
35 Ga0068868_100469744 3300005338 Bacteria 1097
36 Ga0070660_100000747 3300005339 Bacteria 21579
37 Ga0070689_101454454 3300005340 Bacteria 620
38 Ga0070687_100227237 3300005343 Bacteria 1146
39 Ga0070661_100000261 3300005344 Bacteria 43151
40 Ga0070692_10004480 3300005345 Bacteria 5844
41 Ga0070668_100000007 3300005347 Bacteria 150621
42 Ga0070668_100007118 3300005347 Bacteria 8289
43 Ga0070668_100072380 3300005347 Bacteria 2686
44 Ga0070668_100073108 3300005347 Bacteria 2673
45 Ga0070668_100090717 3300005347 Bacteria 2408
46 Ga0070668_100321918 3300005347 Bacteria 1302
47 Ga0070668_100332242 3300005347 Bacteria 1282
48 Ga0070668_101234482 3300005347 Bacteria 678
49 Ga0070669_100002210 3300005353 Bacteria 14103
50 Ga0070669_100005425 3300005353 Bacteria 9200
51 Ga0070669_100040027 3300005353 Bacteria 3406
52 Ga0070669_100049290 3300005353 Bacteria 3075
53 Ga0070669_100112668 3300005353 Bacteria 2066
54 Ga0070669_100133365 3300005353 Bacteria 1908
55 Ga0070669_100218650 3300005353 Bacteria 1506
56 Ga0070669_100249072 3300005353 Bacteria 1414
57 Ga0070669_100300945 3300005353 Bacteria 1290
58 Ga0070669_100888335 3300005353 Bacteria 761
59 Ga0070675_100005450 3300005354 Bacteria 9731
60 Ga0070675_100072583 3300005354 Bacteria 2857
61 Ga0070675_100183136 3300005354 Bacteria 1812
62 Ga0070671_100002408 3300005355 Bacteria 14460
63 Ga0070671_100022991 3300005355 Bacteria 5094
64 Ga0070671_100084758 3300005355 Bacteria 2650
65 Ga0070671_100596896 3300005355 Bacteria 954
66 Ga0070674_100868269 3300005356 Bacteria 784
67 Ga0070673_100003783 3300005364 Bacteria 9492
68 Ga0070673_100121757 3300005364 Bacteria 2178
69 Ga0070673_100499556 3300005364 Bacteria 1100
70 Ga0070659_100002534 3300005366 Bacteria 12987
71 Ga0070659_100005495 3300005366 Bacteria 9107
72 Ga0070659_100418601 3300005366 Bacteria 1133
73 Ga0070667_100108674 3300005367 Bacteria 2403
74 Ga0070667_100207591 3300005367 Bacteria 1740
75 Ga0070667_100241088 3300005367 Bacteria 1614
76 Ga0070667_100801420 3300005367 Bacteria 874
77 Ga0070701_10537970 3300005438 Bacteria 764
78 Ga0070700_100008201 3300005441 Bacteria 5684
79 Ga0070663_100072340 3300005455 Bacteria 2511
80 Ga0070663_100460585 3300005455 Bacteria 1050
81 Ga0070678_100039998 3300005456 Bacteria 3314
82 Ga0070678_100346952 3300005456 Bacteria 1275
83 Ga0070662_100000350 3300005457 Bacteria 27678
84 Ga0070662_100416974 3300005457 Bacteria 1110
85 Ga0068867_100017538 3300005459 Bacteria 5084
86 Ga0068867_100053572 3300005459 Bacteria 2980
87 Ga0070685_11051102 3300005466 Bacteria 613
88 Ga0070707_100215669 3300005468 Bacteria 1870
89 Ga0070679_100000001 3300005530 Bacteria 764811
90 Ga0068853_100130997 3300005539 Bacteria 2245
91 Ga0068853_100163003 3300005539 Bacteria 2013
92 Ga0068853_100501238 3300005539 Bacteria 1146
93 Ga0068853_100571895 3300005539 Bacteria 1072
94 Ga0068853_101222788 3300005539 Bacteria 725
95 Ga0070672_100004066 3300005543 Bacteria 9547
96 Ga0070672_100197272 3300005543 Bacteria 1682
97 Ga0070672_100314568 3300005543 Bacteria 1330
98 Ga0070672_100549802 3300005543 Bacteria 1002
99 Ga0070672_100553094 3300005543 Bacteria 999
100 Ga0070672_101071041 3300005543 Bacteria 716
101 Ga0070686_100000191 3300005544 Bacteria 42686
102 Ga0070665_100000101 3300005548 Bacteria 159353
103 Ga0070665_100000168 3300005548 Bacteria 119133
104 Ga0070665_100087112 3300005548 Bacteria 3128
105 Ga0070664_100064156 3300005564 Bacteria 3133
106 Ga0068857_100300499 3300005577 Bacteria 1479
107 Ga0068854_100016037 3300005578 Bacteria 4985
108 Ga0068854_100028892 3300005578 Bacteria 3835
109 Ga0068854_100496422 3300005578 Bacteria 1027
110 Ga0068852_100672585 3300005616 Bacteria 1044
111 Ga0068859_100005659 3300005617 Bacteria 12722
112 Ga0068859_100010321 3300005617 Bacteria 9401
113 Ga0068859_100023169 3300005617 Bacteria 6229
114 Ga0068859_100107336 3300005617 Bacteria 2852
115 Ga0068859_100220738 3300005617 Bacteria 1983
116 Ga0068864_100010591 3300005618 Bacteria 7624
117 Ga0068864_100046836 3300005618 Bacteria 3711
118 Ga0068864_100259106 3300005618 Bacteria 1617
119 Ga0068866_10492935 3300005718 Bacteria 809
120 Ga0068861_100232238 3300005719 Bacteria 1565
121 Ga0068863_100000027 3300005841 Bacteria 181884
122 Ga0068863_100002604 3300005841 Bacteria 17894
123 Ga0068863_100002810 3300005841 Bacteria 17249
124 Ga0068863_100046477 3300005841 Bacteria 4120
125 Ga0068863_100625819 3300005841 Bacteria 1066
126 Ga0068863_101195751 3300005841 Bacteria 766
127 Ga0068858_100010173 3300005842 Bacteria 8928
128 Ga0068858_100233300 3300005842 Bacteria 1745
129 Ga0068860_100000391 3300005843 Bacteria 57332
130 Ga0068860_100023485 3300005843 Bacteria 5959
131 Ga0068860_100030314 3300005843 Bacteria 5203
132 Ga0068860_100061179 3300005843 Bacteria 3578
133 Ga0068860_100147432 3300005843 Bacteria 2265
134 Ga0068860_100201985 3300005843 Bacteria 1926
135 Ga0068862_100000014 3300005844 Bacteria 251552
136 Ga0068862_100003219 3300005844 Bacteria 14138
137 Ga0068862_100011300 3300005844 Bacteria 7372
138 Ga0068862_100011857 3300005844 Bacteria 7198
139 Ga0068862_100027405 3300005844 Bacteria 4796
140 Ga0068862_100048244 3300005844 Bacteria 3635
141 Ga0068862_100324092 3300005844 Bacteria 1423
142 Ga0068862_100660570 3300005844 Bacteria 1009
143 Ga0068862_101227666 3300005844 Bacteria 749
144 Ga0081539_10020337 3300005985 Bacteria 4492
145 Ga0081539_10198856 3300005985 Bacteria 927
146 Ga0075365_10056973 3300006038 Bacteria 2599
147 Ga0075368_10001348 3300006042 Bacteria 7811
148 Ga0075368_10092364 3300006042 Bacteria 1238
149 Ga0075363_100002455 3300006048 Bacteria 7580
150 Ga0075363_100028458 3300006048 Bacteria 2875
151 Ga0075364_10000854 3300006051 Bacteria 16048
152 Ga0075364_10006492 3300006051 Bacteria 6875
153 Ga0075364_10026011 3300006051 Bacteria 3730
154 Ga0075362_10000110 3300006177 Bacteria 22774
155 Ga0075362_10001068 3300006177 Bacteria 8470
156 Ga0075362_10003739 3300006177 Bacteria 5381
157 Ga0075362_10036945 3300006177 Bacteria 2139
158 Ga0075367_10008038 3300006178 Bacteria 5440
159 Ga0075367_10047582 3300006178 Bacteria 2524
160 Ga0075369_10001156 3300006186 Bacteria 8910
161 Ga0075369_10015984 3300006186 Bacteria 3021
162 Ga0075369_10023219 3300006186 Bacteria 2563
163 Ga0075366_10000832 3300006195 Bacteria 14827
164 Ga0075366_10003725 3300006195 Bacteria 8098
165 Ga0075366_10112411 3300006195 Bacteria 1639
166 Ga0075366_10306845 3300006195 Bacteria 971
167 Ga0097621_100257556 3300006237 Bacteria 1530
168 Ga0075370_10002158 3300006353 Bacteria 9010
169 Ga0075370_10002739 3300006353 Bacteria 8256
170 Ga0075370_10003733 3300006353 Bacteria 7288
171 Ga0075370_10028750 3300006353 Bacteria 3092
172 Ga0075370_10060854 3300006353 Bacteria 2151
173 Ga0075370_10131526 3300006353 Bacteria 1460
174 Ga0075370_10181696 3300006353 Bacteria 1238
175 Ga0068871_100445265 3300006358 Bacteria 1160
176 Ga0075430_100038130 3300006846 Bacteria 4073
177 Ga0075431_100090974 3300006847 Bacteria 3149
178 Ga0068865_100468855 3300006881 Unclassified 1044
179 Ga0097620_100005660 3300006931 Bacteria 12722
180 Ga0097620_100010321 3300006931 Bacteria 9401
181 Ga0097620_100023168 3300006931 Bacteria 6229
182 Ga0097620_100107336 3300006931 Bacteria 2852
183 Ga0097620_100220727 3300006931 Bacteria 1983
184 Ga0079104_1007184 3300006946 Bacteria 4079
185 Ga0079104_1009226 3300006946 Bacteria 3359
186 Ga0079104_1023151 3300006946 Bacteria 1657
187 Ga0075435_100122396 3300007076 Bacteria 2172
188 Ga0105251_10009998 3300009011 Bacteria 5548
189 Ga0111539_10679540 3300009094 Bacteria 1199
190 Ga0105247_10058983 3300009101 Bacteria 2375
191 Ga0105247_10103886 3300009101 Bacteria 1820
192 Ga0105243_10010410 3300009148 Bacteria 7062
193 Ga0105243_10833751 3300009148 Bacteria 912
194 Ga0105241_10862883 3300009174 Bacteria 838
195 Ga0105248_10076884 3300009177 Bacteria 3752
196 Ga0105248_10143634 3300009177 Bacteria 2693
197 Ga0105248_10157907 3300009177 Bacteria 2559
198 Ga0105237_12043655 3300009545 Bacteria 582
199 Ga0105238_11808322 3300009551 Bacteria 643
200 Ga0105249_10000002 3300009553 Bacteria 376207
201 Ga0105249_10001466 3300009553 Bacteria 20693
202 Ga0105249_10033520 3300009553 Bacteria 4649
203 Ga0105249_10089940 3300009553 Bacteria 2870
204 Ga0105249_10438337 3300009553 Bacteria 1343
205 Ga0105249_10967768 3300009553 Bacteria 919
206 Ga0105249_12759211 3300009553 Bacteria 563
207 Ga0157371_10025908 3300013102 Bacteria 4267
208 Ga0157370_11317728 3300013104 Bacteria 650
209 Ga0157369_10022391 3300013105 Bacteria 7052
210 Ga0157369_11380134 3300013105 Bacteria 717
211 Ga0163162_10008235 3300013306 Bacteria 10177
212 Ga0163162_10025560 3300013306 Bacteria 5836
213 Ga0157372_10364488 3300013307 Bacteria 1684
214 Ga0157375_10217852 3300013308 Bacteria 2067
215 Ga0157375_10711853 3300013308 Bacteria 1157
216 Ga0157375_12633177 3300013308 Bacteria 601
217 Ga0163163_10212089 3300014325 Bacteria 1986
218 Ga0163163_10267802 3300014325 Bacteria 1759
219 Ga0157380_10000710 3300014326 Bacteria 20822
220 Ga0157380_10013753 3300014326 Bacteria 5909
221 Ga0157380_10018361 3300014326 Bacteria 5190
222 Ga0157380_10022254 3300014326 Bacteria 4768
223 Ga0157380_10038572 3300014326 Bacteria 3710
224 Ga0157380_10071136 3300014326 Bacteria 2814
225 Ga0157380_10108083 3300014326 Bacteria 2331
226 Ga0157380_10230462 3300014326 Bacteria 1663
227 Ga0157380_10899795 3300014326 Bacteria 911
228 Ga0157380_11000748 3300014326 Bacteria 869
229 Ga0157380_11237729 3300014326 Bacteria 791
230 Ga0163161_10002075 3300017792 Bacteria 14527
231 Ga0163161_10017590 3300017792 Bacteria 5005
232 Ga0163161_10069791 3300017792 Bacteria 2569
233 Ga0163161_11235184 3300017792 Bacteria 647
234 Ga0206356_11066624 3300020070 Bacteria 1326
235 Ga0213873_10000216 3300021358 Bacteria 10215
236 Ga0213876_10000056 3300021384 Bacteria 135017
237 Ga0213876_10000258 3300021384 Bacteria 49441
238 Ga0209050_1000474 3300025298 Bacteria 71192
239 Ga0207697_10007313 3300025315 Bacteria 4932
240 Ga0207713_1002253 3300025735 Bacteria 14260
241 Ga0207682_10000923 3300025893 Bacteria 13618
242 Ga0207682_10378407 3300025893 Bacteria 668
243 Ga0207710_10034986 3300025900 Bacteria 2209
244 Ga0207710_10098805 3300025900 Bacteria 1374
245 Ga0207688_10012090 3300025901 Bacteria 4695
246 Ga0207680_10192593 3300025903 Bacteria 1385
247 Ga0207680_10237799 3300025903 Bacteria 1254
248 Ga0207680_10274014 3300025903 Bacteria 1171
249 Ga0207647_10394684 3300025904 Bacteria 780
250 Ga0207645_10011115 3300025907 Bacteria 6159
251 Ga0207645_10054971 3300025907 Bacteria 2542
252 Ga0207645_10410480 3300025907 Bacteria 911
253 Ga0207705_10000005 3300025909 Bacteria 673478
254 Ga0207705_10183344 3300025909 Bacteria 1580
255 Ga0207654_11208160 3300025911 Bacteria 551
256 Ga0207660_10000246 3300025917 Bacteria 35132
257 Ga0207662_10362044 3300025918 Bacteria 976
258 Ga0207657_10011954 3300025919 Bacteria 8590
259 Ga0207657_10047650 3300025919 Bacteria 3745
260 Ga0207649_10000016 3300025920 Bacteria 243843
261 Ga0207652_10000002 3300025921 Bacteria 878035
262 Ga0207681_10000224 3300025923 Bacteria 44695
263 Ga0207681_10001743 3300025923 Bacteria 13962
264 Ga0207681_10008452 3300025923 Bacteria 6292
265 Ga0207681_10024789 3300025923 Bacteria 3852
266 Ga0207681_10030526 3300025923 Bacteria 3514
267 Ga0207681_10091559 3300025923 Bacteria 2173
268 Ga0207681_10260268 3300025923 Bacteria 1358
269 Ga0207681_10318889 3300025923 Bacteria 1235
270 Ga0207650_10003361 3300025925 Bacteria 11007
271 Ga0207650_10050584 3300025925 Bacteria 3074
272 Ga0207650_10183798 3300025925 Bacteria 1667
273 Ga0207650_10306946 3300025925 Bacteria 1297
274 Ga0207650_10309673 3300025925 Bacteria 1291
275 Ga0207650_10360214 3300025925 Bacteria 1198
276 Ga0207650_10375983 3300025925 Bacteria 1173
277 Ga0207650_10388809 3300025925 Bacteria 1153
278 Ga0207650_11028126 3300025925 Bacteria 701
279 Ga0207650_11112960 3300025925 Bacteria 672
280 Ga0207659_10016247 3300025926 Bacteria 4840
281 Ga0207659_10159221 3300025926 Bacteria 1771
282 Ga0207687_10268357 3300025927 Bacteria 1363
283 Ga0207687_10832541 3300025927 Bacteria 788
284 Ga0207644_10000111 3300025931 Bacteria 60737
285 Ga0207644_10008009 3300025931 Bacteria 6909
286 Ga0207644_10052625 3300025931 Bacteria 2927
287 Ga0207644_10053613 3300025931 Bacteria 2902
288 Ga0207644_10122961 3300025931 Bacteria 1978
289 Ga0207644_10449099 3300025931 Bacteria 1059
290 Ga0207644_10687473 3300025931 Bacteria 853
291 Ga0207690_10002957 3300025932 Bacteria 10230
292 Ga0207690_10003851 3300025932 Bacteria 8874
293 Ga0207690_10574830 3300025932 Bacteria 918
294 Ga0207706_10000276 3300025933 Bacteria 55889
295 Ga0207706_10133077 3300025933 Bacteria 2187
296 Ga0207706_10281440 3300025933 Bacteria 1450
297 Ga0207709_10010411 3300025935 Bacteria 5120
298 Ga0207709_10034745 3300025935 Bacteria 2974
299 Ga0207669_10238701 3300025937 Bacteria 1346
300 Ga0207669_10857155 3300025937 Bacteria 756
301 Ga0207669_11085994 3300025937 Bacteria 675
302 Ga0207704_10785687 3300025938 Unclassified 794
303 Ga0207691_10014857 3300025940 Bacteria 7421
304 Ga0207691_10106124 3300025940 Bacteria 2502
305 Ga0207691_10205854 3300025940 Bacteria 1711
306 Ga0207691_10308405 3300025940 Bacteria 1359
307 Ga0207691_10337086 3300025940 Bacteria 1291
308 Ga0207691_10398372 3300025940 Bacteria 1174
309 Ga0207711_10004284 3300025941 Bacteria 12191
310 Ga0207711_10165700 3300025941 Bacteria 2003
311 Ga0207711_10374983 3300025941 Bacteria 1320
312 Ga0207661_11658443 3300025944 Bacteria 584
313 Ga0207679_10010549 3300025945 Bacteria 5954
314 Ga0207679_10284750 3300025945 Bacteria 1419
315 Ga0207651_10007898 3300025960 Bacteria 5700
316 Ga0207651_10433962 3300025960 Bacteria 1124
317 Ga0207712_10000002 3300025961 Bacteria 706628
318 Ga0207712_10032962 3300025961 Bacteria 3499
319 Ga0207712_10110079 3300025961 Bacteria 2064
320 Ga0207712_10130400 3300025961 Bacteria 1915
321 Ga0207712_10482262 3300025961 Bacteria 1057
322 Ga0207668_10000054 3300025972 Bacteria 95426
323 Ga0207668_10002327 3300025972 Bacteria 11097
324 Ga0207668_10022255 3300025972 Bacteria 4055
325 Ga0207668_10054668 3300025972 Bacteria 2772
326 Ga0207668_10062265 3300025972 Bacteria 2627
327 Ga0207668_10121946 3300025972 Bacteria 1975
328 Ga0207668_10128887 3300025972 Bacteria 1929
329 Ga0207668_10291377 3300025972 Bacteria 1343
330 Ga0207668_10615329 3300025972 Bacteria 947
331 Ga0207640_10006878 3300025981 Bacteria 6255
332 Ga0207640_10291476 3300025981 Bacteria 1287
333 Ga0207658_10010132 3300025986 Bacteria 6403
334 Ga0207658_10108633 3300025986 Bacteria 2188
335 Ga0207658_10555842 3300025986 Bacteria 1027
336 Ga0207703_10005939 3300026035 Bacteria 9782
337 Ga0207703_10695200 3300026035 Bacteria 967
338 Ga0207703_11220084 3300026035 Bacteria 723
339 Ga0207703_11405960 3300026035 Bacteria 671
340 Ga0207639_10076765 3300026041 Bacteria 2631
341 Ga0207639_10205224 3300026041 Bacteria 1693
342 Ga0207639_10452009 3300026041 Bacteria 1166
343 Ga0207678_10043681 3300026067 Bacteria 3878
344 Ga0207678_10424751 3300026067 Bacteria 1153
345 Ga0207641_10000045 3300026088 Bacteria 181882
346 Ga0207641_10004364 3300026088 Bacteria 12251
347 Ga0207641_10009028 3300026088 Bacteria 8235
348 Ga0207641_10010357 3300026088 Bacteria 7664
349 Ga0207641_10725668 3300026088 Bacteria 980
350 Ga0207641_10930851 3300026088 Bacteria 864
351 Ga0207648_10015998 3300026089 Bacteria 6874
352 Ga0207648_10072006 3300026089 Bacteria 3012
353 Ga0207676_10031593 3300026095 Bacteria 3983
354 Ga0207676_10048188 3300026095 Bacteria 3307
355 Ga0207676_10052019 3300026095 Bacteria 3200
356 Ga0207676_10449358 3300026095 Bacteria 1215
357 Ga0207676_11241397 3300026095 Bacteria 739
358 Ga0207674_10008177 3300026116 Bacteria 12127
359 Ga0207674_10163736 3300026116 Bacteria 2178
360 Ga0207674_11444847 3300026116 Bacteria 657
361 Ga0207675_100001317 3300026118 Bacteria 24894
362 Ga0207675_100132779 3300026118 Bacteria 2361
363 Ga0207675_100870022 3300026118 Bacteria 917
364 Ga0207683_10044948 3300026121 Bacteria 3862
365 Ga0209281_1012035 3300027111 Bacteria 1915
366 Ga0209281_1025320 3300027111 Bacteria 1106
367 Ga0209983_1010759 3300027665 Bacteria 1870
368 Ga0209813_10000027 3300027866 Bacteria 69637
369 Ga0209974_10009642 3300027876 Bacteria 3276
370 Ga0209974_10031012 3300027876 Bacteria 1770
371 Ga0268266_10000130 3300028379 Bacteria 147912
372 Ga0268266_10001320 3300028379 Bacteria 30084
373 Ga0268266_10567503 3300028379 Bacteria 1088
374 Ga0268265_10000607 3300028380 Bacteria 35893
375 Ga0268265_10012660 3300028380 Bacteria 5723
376 Ga0268265_10013350 3300028380 Bacteria 5580
377 Ga0268265_10013973 3300028380 Bacteria 5467
378 Ga0268265_10015482 3300028380 Bacteria 5220
379 Ga0268265_10167855 3300028380 Bacteria 1872
380 Ga0268265_10627409 3300028380 Bacteria 1030
381 Ga0268264_10000634 3300028381 Bacteria 41826
382 Ga0268264_10002547 3300028381 Bacteria 15981
383 Ga0268264_10013326 3300028381 Bacteria 6768
384 Ga0268264_10065563 3300028381 Bacteria 3060
385 Ga0268264_10111204 3300028381 Bacteria 2400
386 Ga0268264_11370376 3300028381 Bacteria 718
387 Ga0316177_1190548 3300030731 Bacteria 903
388 Ga0316179_1110524 3300030734 Bacteria 759
389 Ga0316180_1085882 3300030736 Bacteria 1638
390 Ga0316180_1174327 3300030736 Bacteria 743
391 Ga0307513_10370800 3300031456 Bacteria 1174
392 Ga0307513_10416085 3300031456 Bacteria 1075
393 Ga0307408_100013328 3300031548 Bacteria 5456
394 Ga0307408_100018967 3300031548 Bacteria 4625
395 Ga0307408_100035222 3300031548 Bacteria 3511
396 Ga0307408_100065642 3300031548 Bacteria 2662
397 Ga0307408_100069951 3300031548 Bacteria 2590
398 Ga0307408_100071967 3300031548 Bacteria 2558
399 Ga0307408_100081110 3300031548 Bacteria 2424
400 Ga0307408_100089395 3300031548 Bacteria 2321
401 Ga0307408_100123957 3300031548 Bacteria 2006
402 Ga0307408_100224252 3300031548 Bacteria 1535
403 Ga0307408_100307185 3300031548 Bacteria 1331
404 Ga0307408_100351817 3300031548 Bacteria 1250
405 Ga0307408_100373227 3300031548 Bacteria 1217
406 Ga0307408_100477026 3300031548 Bacteria 1087
407 Ga0307408_100594744 3300031548 Bacteria 982
408 Ga0307408_100619921 3300031548 Bacteria 963
409 Ga0307408_100938730 3300031548 Bacteria 794
410 Ga0316576_10744900 3300031727 Bacteria 708
411 Ga0307405_10003917 3300031731 Bacteria 6951
412 Ga0307405_10004331 3300031731 Bacteria 6689
413 Ga0307405_10006541 3300031731 Bacteria 5741
414 Ga0307405_10013101 3300031731 Bacteria 4414
415 Ga0307405_10029271 3300031731 Bacteria 3218
416 Ga0307405_10050193 3300031731 Bacteria 2582
417 Ga0307405_10054582 3300031731 Bacteria 2495
418 Ga0307405_10058768 3300031731 Bacteria 2421
419 Ga0307405_10098140 3300031731 Bacteria 1957
420 Ga0307405_10357930 3300031731 Bacteria 1128
421 Ga0307405_10422666 3300031731 Bacteria 1049
422 Ga0307405_10460238 3300031731 Bacteria 1011
423 Ga0307405_10697225 3300031731 Bacteria 840
424 Ga0307405_10967247 3300031731 Bacteria 724
425 Ga0307405_11069772 3300031731 Bacteria 692
426 Ga0307405_11097337 3300031731 Bacteria 684
427 Ga0307405_11276775 3300031731 Bacteria 638
428 Ga0307413_10001416 3300031824 Bacteria 9062
429 Ga0307413_10006305 3300031824 Bacteria 5395
430 Ga0307413_10010707 3300031824 Bacteria 4466
431 Ga0307413_10012453 3300031824 Bacteria 4236
432 Ga0307413_10023067 3300031824 Bacteria 3367
433 Ga0307413_10032501 3300031824 Bacteria 2958
434 Ga0307413_10038961 3300031824 Bacteria 2759
435 Ga0307413_10040847 3300031824 Bacteria 2711
436 Ga0307413_10066641 3300031824 Bacteria 2248
437 Ga0307413_10109720 3300031824 Bacteria 1844
438 Ga0307413_10133837 3300031824 Bacteria 1701
439 Ga0307413_10207848 3300031824 Bacteria 1419
440 Ga0307413_10210950 3300031824 Bacteria 1410
441 Ga0307413_10221143 3300031824 Bacteria 1383
442 Ga0307413_10305504 3300031824 Bacteria 1208
443 Ga0307413_10320666 3300031824 Bacteria 1183
444 Ga0307413_10435972 3300031824 Bacteria 1036
445 Ga0307413_10467974 3300031824 Bacteria 1004
446 Ga0307413_10527628 3300031824 Bacteria 953
447 Ga0307413_10569579 3300031824 Bacteria 922
448 Ga0307413_10633826 3300031824 Bacteria 879
449 Ga0307413_10638946 3300031824 Bacteria 876
450 Ga0307413_10640439 3300031824 Bacteria 875
451 Ga0307413_10671571 3300031824 Bacteria 857
452 Ga0307413_10691514 3300031824 Bacteria 846
453 Ga0307413_10916029 3300031824 Bacteria 746
454 Ga0307413_11173678 3300031824 Bacteria 666
455 Ga0307413_11727455 3300031824 Bacteria 559
456 Ga0307410_10001524 3300031852 Bacteria 10547
457 Ga0307410_10002509 3300031852 Bacteria 8873
458 Ga0307410_10002567 3300031852 Bacteria 8807
459 Ga0307410_10005057 3300031852 Bacteria 6929
460 Ga0307410_10006267 3300031852 Bacteria 6404
461 Ga0307410_10023494 3300031852 Bacteria 3833
462 Ga0307410_10024407 3300031852 Bacteria 3776
463 Ga0307410_10041289 3300031852 Bacteria 3041
464 Ga0307410_10063930 3300031852 Bacteria 2526
465 Ga0307410_10074090 3300031852 Bacteria 2370
466 Ga0307410_10076541 3300031852 Bacteria 2336
467 Ga0307410_10112007 3300031852 Bacteria 1976
468 Ga0307410_10194708 3300031852 Bacteria 1543
469 Ga0307410_10248424 3300031852 Bacteria 1382
470 Ga0307410_10261699 3300031852 Bacteria 1349
471 Ga0307410_10325862 3300031852 Bacteria 1220
472 Ga0307410_10344824 3300031852 Bacteria 1188
473 Ga0307410_10417332 3300031852 Bacteria 1088
474 Ga0307410_11541367 3300031852 Bacteria 586
475 Ga0307406_10006924 3300031901 Bacteria 6279
476 Ga0307406_10014014 3300031901 Bacteria 4605
477 Ga0307406_10014511 3300031901 Bacteria 4536
478 Ga0307406_10018259 3300031901 Bacteria 4095
479 Ga0307406_10018370 3300031901 Bacteria 4085
480 Ga0307406_10047204 3300031901 Bacteria 2713
481 Ga0307406_10056469 3300031901 Bacteria 2514
482 Ga0307406_10088744 3300031901 Bacteria 2075
483 Ga0307406_10109970 3300031901 Bacteria 1895
484 Ga0307406_10192489 3300031901 Bacteria 1494
485 Ga0307406_10193384 3300031901 Bacteria 1491
486 Ga0307406_10235574 3300031901 Bacteria 1370
487 Ga0307406_10307167 3300031901 Bacteria 1221
488 Ga0307406_10311481 3300031901 Bacteria 1214
489 Ga0307406_10453409 3300031901 Bacteria 1029
490 Ga0307406_10717165 3300031901 Bacteria 836
491 Ga0307406_10892508 3300031901 Bacteria 756
492 Ga0307406_10930103 3300031901 Bacteria 742
493 Ga0307406_11174139 3300031901 Bacteria 665
494 Ga0307407_10001255 3300031903 Bacteria 9038
495 Ga0307407_10003308 3300031903 Bacteria 6581
496 Ga0307407_10003757 3300031903 Bacteria 6307
497 Ga0307407_10013405 3300031903 Bacteria 3978
498 Ga0307407_10031325 3300031903 Bacteria 2879
499 Ga0307407_10040708 3300031903 Bacteria 2593
500 Ga0307407_10056619 3300031903 Bacteria 2271
501 Ga0307407_10091639 3300031903 Bacteria 1864
502 Ga0307407_10157609 3300031903 Bacteria 1482
503 Ga0307407_10304123 3300031903 Bacteria 1113
504 Ga0307407_10361740 3300031903 Bacteria 1030
505 Ga0307407_10420357 3300031903 Bacteria 963
506 Ga0307407_10534522 3300031903 Bacteria 864
507 Ga0307407_10553969 3300031903 Bacteria 850
508 Ga0307407_10969408 3300031903 Bacteria 656
509 Ga0307407_11019597 3300031903 Bacteria 640
510 Ga0307412_10002333 3300031911 Bacteria 10511
511 Ga0307412_10003753 3300031911 Bacteria 8444
512 Ga0307412_10004147 3300031911 Bacteria 8072
513 Ga0307412_10009369 3300031911 Bacteria 5617
514 Ga0307412_10046779 3300031911 Bacteria 2837
515 Ga0307412_10086771 3300031911 Bacteria 2179
516 Ga0307412_10090073 3300031911 Bacteria 2143
517 Ga0307412_10091691 3300031911 Bacteria 2127
518 Ga0307412_10105697 3300031911 Bacteria 2000
519 Ga0307412_10110635 3300031911 Bacteria 1961
520 Ga0307412_10112454 3300031911 Bacteria 1946
521 Ga0307412_10124408 3300031911 Bacteria 1862
522 Ga0307412_10134338 3300031911 Bacteria 1802
523 Ga0307412_10138385 3300031911 Bacteria 1779
524 Ga0307412_10139953 3300031911 Bacteria 1771
525 Ga0307412_10148541 3300031911 Bacteria 1726
526 Ga0307412_10178906 3300031911 Bacteria 1593
527 Ga0307412_10247204 3300031911 Bacteria 1383
528 Ga0307412_10310562 3300031911 Bacteria 1250
529 Ga0307412_10313819 3300031911 Bacteria 1244
530 Ga0307412_10484607 3300031911 Bacteria 1026
531 Ga0307412_10580106 3300031911 Bacteria 946
532 Ga0307412_10589530 3300031911 Bacteria 940
533 Ga0307412_10969541 3300031911 Bacteria 749
534 Ga0307409_100006322 3300031995 Bacteria 6944
535 Ga0307409_100020016 3300031995 Bacteria 4548
536 Ga0307409_100023061 3300031995 Bacteria 4304
537 Ga0307409_100047750 3300031995 Bacteria 3252
538 Ga0307409_100058676 3300031995 Bacteria 2990
539 Ga0307409_100066667 3300031995 Bacteria 2839
540 Ga0307409_100146053 3300031995 Bacteria 2046
541 Ga0307409_100181994 3300031995 Bacteria 1861
542 Ga0307409_100188464 3300031995 Bacteria 1833
543 Ga0307409_100257201 3300031995 Bacteria 1600
544 Ga0307409_100291800 3300031995 Bacteria 1513
545 Ga0307409_100431144 3300031995 Bacteria 1267
546 Ga0307409_100434710 3300031995 Bacteria 1262
547 Ga0307409_100451758 3300031995 Bacteria 1240
548 Ga0307409_100534772 3300031995 Bacteria 1148
549 Ga0307409_100535820 3300031995 Bacteria 1147
550 Ga0307409_100629276 3300031995 Bacteria 1064
551 Ga0307409_100636386 3300031995 Bacteria 1059
552 Ga0307409_100682995 3300031995 Bacteria 1024
553 Ga0307409_100736521 3300031995 Bacteria 988
554 Ga0307409_100742783 3300031995 Bacteria 984
555 Ga0307409_100792213 3300031995 Bacteria 955
556 Ga0307409_100820267 3300031995 Bacteria 939
557 Ga0307409_100910532 3300031995 Bacteria 893
558 Ga0307409_101086548 3300031995 Bacteria 821
559 Ga0307409_101140948 3300031995 Bacteria 801
560 Ga0307409_101178084 3300031995 Bacteria 789
561 Ga0307409_101453696 3300031995 Bacteria 712
562 Ga0307409_101901854 3300031995 Bacteria 624
563 Ga0307416_100013987 3300032002 Bacteria 5476
564 Ga0307416_100018028 3300032002 Bacteria 4960
565 Ga0307416_100030377 3300032002 Bacteria 4053
566 Ga0307416_100036533 3300032002 Bacteria 3768
567 Ga0307416_100083762 3300032002 Bacteria 2707
568 Ga0307416_100089834 3300032002 Bacteria 2632
569 Ga0307416_100123551 3300032002 Bacteria 2313
570 Ga0307416_100139651 3300032002 Bacteria 2199
571 Ga0307416_100151165 3300032002 Bacteria 2129
572 Ga0307416_100156596 3300032002 Bacteria 2098
573 Ga0307416_100177719 3300032002 Bacteria 1991
574 Ga0307416_100304647 3300032002 Bacteria 1586
575 Ga0307416_100309869 3300032002 Bacteria 1574
576 Ga0307416_100343180 3300032002 Bacteria 1507
577 Ga0307416_100401743 3300032002 Bacteria 1408
578 Ga0307416_100428379 3300032002 Bacteria 1369
579 Ga0307416_100468809 3300032002 Bacteria 1316
580 Ga0307416_100550425 3300032002 Bacteria 1227
581 Ga0307416_100672219 3300032002 Bacteria 1122
582 Ga0307416_100708110 3300032002 Bacteria 1096
583 Ga0307416_100771495 3300032002 Bacteria 1055
584 Ga0307416_100798750 3300032002 Bacteria 1039
585 Ga0307416_100856849 3300032002 Bacteria 1007
586 Ga0307416_100915074 3300032002 Bacteria 978
587 Ga0307416_101028951 3300032002 Bacteria 927
588 Ga0307416_101142352 3300032002 Bacteria 884
589 Ga0307416_101264730 3300032002 Bacteria 844
590 Ga0307416_101332417 3300032002 Bacteria 824
591 Ga0307416_101601378 3300032002 Bacteria 756
592 Ga0307416_102600384 3300032002 Bacteria 604
593 Ga0307414_10001742 3300032004 Bacteria 11289
594 Ga0307414_10001927 3300032004 Bacteria 10746
595 Ga0307414_10005262 3300032004 Bacteria 7112
596 Ga0307414_10007634 3300032004 Bacteria 6087
597 Ga0307414_10011130 3300032004 Bacteria 5262
598 Ga0307414_10015446 3300032004 Bacteria 4609
599 Ga0307414_10015785 3300032004 Bacteria 4571
600 Ga0307414_10018780 3300032004 Bacteria 4267
601 Ga0307414_10019093 3300032004 Bacteria 4240
602 Ga0307414_10023564 3300032004 Bacteria 3907
603 Ga0307414_10034156 3300032004 Bacteria 3368
604 Ga0307414_10034942 3300032004 Bacteria 3339
605 Ga0307414_10052670 3300032004 Bacteria 2834
606 Ga0307414_10062337 3300032004 Bacteria 2645
607 Ga0307414_10074919 3300032004 Bacteria 2454
608 Ga0307414_10113162 3300032004 Bacteria 2071
609 Ga0307414_10163601 3300032004 Bacteria 1770
610 Ga0307414_10206462 3300032004 Bacteria 1602
611 Ga0307414_10208154 3300032004 Bacteria 1596
612 Ga0307414_10209996 3300032004 Bacteria 1590
613 Ga0307414_10212112 3300032004 Bacteria 1583
614 Ga0307414_10240076 3300032004 Bacteria 1499
615 Ga0307414_10263496 3300032004 Bacteria 1439
616 Ga0307414_10291758 3300032004 Bacteria 1375
617 Ga0307414_10305417 3300032004 Bacteria 1348
618 Ga0307414_10329713 3300032004 Bacteria 1302
619 Ga0307414_10350694 3300032004 Bacteria 1266
620 Ga0307414_10398953 3300032004 Bacteria 1194
621 Ga0307414_10404297 3300032004 Bacteria 1187
622 Ga0307414_10445303 3300032004 Bacteria 1135
623 Ga0307414_10512333 3300032004 Bacteria 1063
624 Ga0307414_10535171 3300032004 Bacteria 1042
625 Ga0307414_10569936 3300032004 Bacteria 1011
626 Ga0307414_10577344 3300032004 Bacteria 1005
627 Ga0307414_10610885 3300032004 Bacteria 979
628 Ga0307414_10703685 3300032004 Bacteria 915
629 Ga0307414_10886205 3300032004 Bacteria 817
630 Ga0307414_10892571 3300032004 Bacteria 815
631 Ga0307414_11054970 3300032004 Bacteria 749
632 Ga0307414_11878793 3300032004 Bacteria 559
633 Ga0307411_10000336 3300032005 Bacteria 15766
634 Ga0307411_10001853 3300032005 Bacteria 8986
635 Ga0307411_10002454 3300032005 Bacteria 8199
636 Ga0307411_10005387 3300032005 Bacteria 6280
637 Ga0307411_10005481 3300032005 Bacteria 6239
638 Ga0307411_10006739 3300032005 Bacteria 5776
639 Ga0307411_10007044 3300032005 Bacteria 5686
640 Ga0307411_10017019 3300032005 Bacteria 4129
641 Ga0307411_10030058 3300032005 Bacteria 3326
642 Ga0307411_10033608 3300032005 Bacteria 3183
643 Ga0307411_10034071 3300032005 Bacteria 3165
644 Ga0307411_10044244 3300032005 Bacteria 2854
645 Ga0307411_10049671 3300032005 Bacteria 2727
646 Ga0307411_10054128 3300032005 Bacteria 2633
647 Ga0307411_10058040 3300032005 Bacteria 2559
648 Ga0307411_10086288 3300032005 Bacteria 2177
649 Ga0307411_10102552 3300032005 Bacteria 2028
650 Ga0307411_10193416 3300032005 Bacteria 1555
651 Ga0307411_10240396 3300032005 Bacteria 1417
652 Ga0307411_10246115 3300032005 Bacteria 1403
653 Ga0307411_10271766 3300032005 Bacteria 1344
654 Ga0307411_10282551 3300032005 Bacteria 1322
655 Ga0307411_10310567 3300032005 Bacteria 1268
656 Ga0307411_10311679 3300032005 Bacteria 1266
657 Ga0307411_10311680 3300032005 Bacteria 1266
658 Ga0307411_10338584 3300032005 Bacteria 1222
659 Ga0307411_10338833 3300032005 Bacteria 1221
660 Ga0307411_10381041 3300032005 Bacteria 1160
661 Ga0307411_10400124 3300032005 Bacteria 1135
662 Ga0307411_10410920 3300032005 Bacteria 1121
663 Ga0307411_10420347 3300032005 Bacteria 1110
664 Ga0307411_10451627 3300032005 Bacteria 1075
665 Ga0307411_10485474 3300032005 Bacteria 1041
666 Ga0307411_10520525 3300032005 Bacteria 1009
667 Ga0307411_10657213 3300032005 Bacteria 908
668 Ga0307411_11093023 3300032005 Bacteria 718
669 Ga0307411_11376675 3300032005 Bacteria 645
670 Ga0307411_11538107 3300032005 Bacteria 612
671 Ga0307411_11773479 3300032005 Bacteria 572
672 Ga0307415_100012229 3300032126 Bacteria 4956
673 Ga0307415_100018344 3300032126 Bacteria 4223
674 Ga0307415_100020434 3300032126 Bacteria 4044
675 Ga0307415_100035274 3300032126 Bacteria 3266
676 Ga0307415_100042418 3300032126 Bacteria 3027
677 Ga0307415_100050757 3300032126 Bacteria 2812
678 Ga0307415_100110903 3300032126 Bacteria 2035
679 Ga0307415_100113299 3300032126 Bacteria 2017
680 Ga0307415_100125609 3300032126 Bacteria 1933
681 Ga0307415_100153505 3300032126 Bacteria 1775
682 Ga0307415_100265302 3300032126 Bacteria 1403
683 Ga0307415_100375211 3300032126 Bacteria 1206
684 Ga0307415_100494950 3300032126 Bacteria 1067
685 Ga0307415_100665577 3300032126 Bacteria 935
686 Ga0307415_100713914 3300032126 Bacteria 906
687 Ga0307415_100914550 3300032126 Bacteria 810
688 Ga0307415_101044361 3300032126 Bacteria 762
689 Ga0307415_102040373 3300032126 Bacteria 559
690 Ga0373930_0138025 3300034816 Bacteria 604
691 Ga0373931_0038570 3300035691 Bacteria 2500
692 Ga0373937_1475418 3300036401 Bacteria 628
693 Ga0395899_0152656 3300037312 Bacteria 1636
694 Ga0395900_0001407 3300037418 Bacteria 28797
695 Ga0395905_0000541 3300037471 Bacteria 51481
696 Ga0395905_0459179 3300037471 Bacteria 1172
697 Ga0436364_1162477 3300037853 Unclassified 632
698 Ga0395901_0036664 3300038443 Bacteria 5068
699 Ga0436365_0083543 3300039437 Bacteria 85224
700 Ga0436365_0456925 3300039437 Bacteria 13529
701 Ga0436362_0527241 3300039453 Bacteria 595
702 Ga0436362_0957441 3300039453 Bacteria 603
703 Ga0436362_1001952 3300039453 Bacteria 11094
704 Ga0439447_049342 3300041407 Bacteria 1008
705 Ga0439453_0007534 3300041408 Bacteria 1729
706 Ga0451789_1248675 3300041443 Bacteria 527
707 Ga0451800_0510992 3300041459 Bacteria 590
708 Ga0451807_1480564 3300041486 Bacteria 990
709 Ga0451833_1239628 3300041491 Bacteria 618
710 Ga0451843_1568534 3300041509 Bacteria 898
711 Ga0451853_1131984 3300041512 Bacteria 1806
712 Ga0451853_1258367 3300041512 Bacteria 1172
713 Ga0439441_043449 3300042001 Bacteria 907
714 Ga0439441_098899 3300042001 Bacteria 652
715 Ga0439443_002190 3300042003 Bacteria 2304
716 Ga0439432_047881 3300042006 Bacteria 1340
717 Ga0439449_0127066 3300042007 Bacteria 947
718 Ga0439449_0144383 3300042007 Bacteria 887
719 Ga0439452_030278 3300042010 Bacteria 1336
720 Ga0439462_0000184 3300042015 Bacteria 10614
721 Ga0439462_0074256 3300042015 Bacteria 925
722 Ga0450912_002265 3300042116 Bacteria 1278
723 Ga0450898_020795 3300042134 Bacteria 1153
724 Ga0439446_0046524 3300042156 Bacteria 1289
725 Ga0439434_0145900 3300042435 Bacteria 782
726 Ga0439435_0003482 3300042436 Bacteria 3280
727 Ga0466960_0118514 3300044901 Bacteria 1384
728 Ga0451576_0000024 3300045051 Bacteria 470499
729 Ga0495627_000198 3300046453 Bacteria 65997
730 Ga0495638_0060967 3300046460 Bacteria 2332
731 Ga0495650_0003812 3300046471 Bacteria 10726
732 Ga0495605_0199242 3300046474 Bacteria 873
733 Ga0495585_0198396 3300046492 Bacteria 1023
734 Ga0495596_0001077 3300046500 Bacteria 16192
735 Ga0495596_0098014 3300046500 Bacteria 1138
736 Ga0495607_0003215 3300046501 Bacteria 12623
737 Ga0495583_0086327 3300046506 Bacteria 1357
738 Ga0495606_0006170 3300046507 Bacteria 11153
739 Ga0495610_0000050 3300046512 Bacteria 143781
740 Ga0495610_0000352 3300046512 Bacteria 48332
741 Ga0495610_0005889 3300046512 Bacteria 8590
742 Ga0495620_0053711 3300046515 Bacteria 1705
743 Ga0495620_0067469 3300046515 Bacteria 1472
744 Ga0495632_0003354 3300046519 Bacteria 11413
745 Ga0495632_0008427 3300046519 Bacteria 6328
746 Ga0495643_0000036 3300046522 Bacteria 238374
747 Ga0495643_0014146 3300046522 Bacteria 4755
748 Ga0495643_0043693 3300046522 Bacteria 2437
749 Ga0495663_0010909 3300046525 Bacteria 2527
750 Ga0495663_0014172 3300046525 Bacteria 2233
751 Ga0495663_0018935 3300046525 Bacteria 1964
752 Ga0495663_0023912 3300046525 Bacteria 1773
753 Ga0495642_0024686 3300046528 Bacteria 2379
754 Ga0495654_0002383 3300046530 Bacteria 12125
755 Ga0495654_0076719 3300046530 Bacteria 1574
756 Ga0495598_0051772 3300046537 Bacteria 1238
757 Ga0495598_0111766 3300046537 Bacteria 916
758 Ga0495598_0182314 3300046537 Bacteria 750
759 Ga0495598_0234550 3300046537 Bacteria 674
760 Ga0495609_0005187 3300046538 Bacteria 6934
761 Ga0495621_0002308 3300046539 Bacteria 5118
762 Ga0495621_0004360 3300046539 Bacteria 3973
763 Ga0495621_0006702 3300046539 Bacteria 3375
764 Ga0495621_0010072 3300046539 Bacteria 2884
765 Ga0495621_0019816 3300046539 Bacteria 2200
766 Ga0495621_0030921 3300046539 Bacteria 1833
767 Ga0495597_0077133 3300046542 Bacteria 1429
768 Ga0495645_0792906 3300046543 Bacteria 569
769 Ga0495633_0020520 3300046558 Bacteria 3322
770 Ga0495633_0021195 3300046558 Bacteria 3253
771 Ga0495633_0154096 3300046558 Bacteria 1061
772 Ga0495633_0419894 3300046558 Bacteria 605
773 Ga0495656_0299499 3300046615 Bacteria 824
774 Ga0495668_0001218 3300046616 Bacteria 26031
775 Ga0495668_0005147 3300046616 Bacteria 8979
776 Ga0495668_0497251 3300046616 Bacteria 672
777 Ga0495625_0007251 3300046660 Bacteria 9701
778 Ga0495625_0277924 3300046660 Bacteria 1078
779 Ga0495659_0076279 3300046664 Bacteria 1264
780 Ga0495659_0107750 3300046664 Bacteria 1085
781 Ga0495588_0199715 3300046674 Bacteria 1056
782 Ga0495669_0001697 3300046684 Bacteria 9017
783 Ga0495669_0003949 3300046684 Bacteria 6106
784 Ga0495669_0215806 3300046684 Bacteria 919
785 Ga0495670_0008719 3300046691 Bacteria 4991
786 Ga0495670_0027370 3300046691 Bacteria 2824
787 Ga0495670_0107941 3300046691 Bacteria 1438
788 Ga0495670_0369068 3300046691 Bacteria 773
789 Ga0495670_0455493 3300046691 Bacteria 693
790 Ga0495649_0266008 3300046694 Bacteria 878
791 Ga0495589_0028954 3300046794 Bacteria 2793
792 Ga0495676_0273590 3300047321 Bacteria 1145
793 Ga0495677_0073462 3300047445 Bacteria 1276
794 Ga0495685_139252 3300047447 Bacteria 791
795 Ga0495685_182872 3300047447 Bacteria 675
796 Ga0495681_0000095 3300047470 Bacteria 76975
797 Ga0495615_0000158 3300048090 Bacteria 17114
798 Ga0495615_0007619 3300048090 Bacteria 2062
799 Ga0495626_0000585 3300048091 Bacteria 36107
800 Ga0496100_0970183 3300048903 Bacteria 668
801 Ga0496101_0608030 3300048904 Bacteria 864
802 Ga0496101_1391614 3300048904 Bacteria 547
803 Ga0496102_0091237 3300048905 Bacteria 2820
804 Ga0496103_0008694 3300048906 Bacteria 6027
805 Ga0496107_0098158 3300048910 Bacteria 2145
806 Ga0496107_0567765 3300048910 Bacteria 840
807 Ga0496108_0696598 3300048911 Bacteria 881
808 Ga0496109_0037244 3300048912 Bacteria 4395
809 Ga0496109_0106437 3300048912 Bacteria 2605
810 Ga0496109_1884820 3300048912 Bacteria 530
811 Ga0496110_0010491 3300048913 Bacteria 7540
812 Ga0496110_0112270 3300048913 Bacteria 2450
813 Ga0496111_0049638 3300048914 Bacteria 3026
814 Ga0496111_0220705 3300048914 Bacteria 1408
815 Ga0496114_0044120 3300048917 Bacteria 3698
816 Ga0496114_0296338 3300048917 Bacteria 1428
817 Ga0496114_0383353 3300048917 Bacteria 1244
818 Ga0496115_0124127 3300048918 Bacteria 2126
819 Ga0496116_0000149 3300048919 Bacteria 141841
820 Ga0496116_0042762 3300048919 Bacteria 3093
821 Ga0496116_0350233 3300048919 Bacteria 677
822 Ga0496117_0021674 3300048920 Bacteria 5186
823 Ga0496117_0191331 3300048920 Bacteria 1165
824 Ga0496118_0029070 3300048921 Bacteria 4642
825 Ga0496118_0104594 3300048921 Bacteria 1900
826 Ga0496118_0216450 3300048921 Bacteria 1119
827 Ga0496119_0214261 3300048922 Bacteria 989
828 Ga0496121_0000024 3300048924 Bacteria 462959
829 Ga0496121_0001202 3300048924 Bacteria 45329
830 Ga0496121_0001791 3300048924 Bacteria 34731
831 Ga0496121_0041098 3300048924 Bacteria 4047
832 Ga0496121_0045484 3300048924 Bacteria 3771
833 Ga0496122_0006339 3300048925 Bacteria 13611
834 Ga0496122_0025675 3300048925 Bacteria 5108
835 Ga0496123_0000830 3300048926 Bacteria 49505
836 Ga0496123_0004529 3300048926 Bacteria 14518
837 Ga0496123_0377515 3300048926 Bacteria 651
838 Ga0496124_0004393 3300048927 Bacteria 16474
839 Ga0496124_0078153 3300048927 Bacteria 2727
840 Ga0496124_0089188 3300048927 Bacteria 2518
841 Ga0496125_0027330 3300048928 Bacteria 5174
842 Ga0496125_0140470 3300048928 Bacteria 1680
843 Ga0496125_0178119 3300048928 Bacteria 1420
844 Ga0496126_0000261 3300048929 Bacteria 112027
845 Ga0496126_0003215 3300048929 Bacteria 20931
846 Ga0496126_0031424 3300048929 Bacteria 5017
847 Ga0496126_0078350 3300048929 Bacteria 2928
848 Ga0501034_0067976 3300049571 Bacteria 3574
849 Ga0501034_0171152 3300049571 Bacteria 2139
850 Ga0501034_0351126 3300049571 Bacteria 1403
851 Ga0501034_1239417 3300049571 Bacteria 624
852 Ga0501037_0189659 3300049573 Bacteria 1456
853 Ga0501039_0419635 3300049575 Bacteria 1051
854 Ga0501043_0311710 3300049579 Bacteria 1201
855 Ga0501047_0166213 3300049581 Bacteria 2077
856 Ga0501047_0342666 3300049581 Bacteria 1332
857 Ga0501047_0805500 3300049581 Bacteria 754
858 Ga0501047_0928574 3300049581 Bacteria 683
859 Ga0501069_0007096 3300049585 Bacteria 5868
860 Ga0501069_0834765 3300049585 Bacteria 559
861 Ga0501070_0026161 3300049586 Bacteria 4897
862 Ga0501217_212872 3300049661 Bacteria 607
863 Ga0501230_007534 3300049667 Bacteria 1617
864 Ga0501242_004305 3300049674 Bacteria 1575
865 Ga0501249_004480 3300049679 Bacteria 2837
866 Ga0501253_057192 3300049683 Bacteria 832
867 Ga0501267_028003 3300049764 Bacteria 652
868 Ga0501268_005635 3300049765 Bacteria 1808
869 Ga0501270_029915 3300049767 Bacteria 892
870 Ga0501035_0368232 3300049822 Bacteria 1200
871 Ga0501044_0003900 3300049823 Bacteria 16715
872 Ga0501044_0998403 3300049823 Bacteria 709
873 nmdc:mga03683_12096_c1 3300050489 Bacteria 3142
874 nmdc:mga03683_2944_c1 3300050489 Bacteria 5381
875 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
876 nmdc:mga03683_94_c1 3300050489 Bacteria 32220
877 nmdc:mga03n38_591_c1 3300050490 Bacteria 7911
878 nmdc:mga00v17_1706_c2 3300050491 Bacteria 8146
879 nmdc:mga00v17_2789_c1 3300050491 Bacteria 8971
880 nmdc:mga00v17_36230_c1 3300050491 Bacteria 2940
881 nmdc:mga0k408_13169_c1 3300050493 Bacteria 4531
882 nmdc:mga0k408_242286_c1 3300050493 Bacteria 1077
883 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
884 nmdc:mga0k408_307200_c1 3300050493 Bacteria 947
885 nmdc:mga0k408_30931_c1 3300050493 Bacteria 3054
886 nmdc:mga0k408_5427_c1 3300050493 Bacteria 6783
887 nmdc:mga06z11_248777_c1 3300050494 Bacteria 1046
888 nmdc:mga06z11_300_c1 3300050494 Bacteria 19031
889 nmdc:mga04h51_3092_c1 3300050495 Bacteria 4018
890 nmdc:mga07m45_169705_c1 3300050496 Bacteria 1268
891 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
892 nmdc:mga07m45_28948_c1 3300050496 Bacteria 3059
893 nmdc:mga07m45_3826_c1 3300050496 Bacteria 7288
894 nmdc:mga07m45_63394_c1 3300050496 Bacteria 2096
895 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
896 nmdc:mga0qj67_70722_c1 3300050509 Bacteria 2784
897 nmdc:mga06r32_189931_c1 3300050510 Bacteria 2042
898 nmdc:mga08y16_340585_c1 3300050511 Bacteria 1541
899 nmdc:mga08y16_490379_c1 3300050511 Bacteria 1249
900 nmdc:mga0n895_198823_c1 3300050512 Bacteria 2036
901 nmdc:mga0sz30_1249_c1 3300050516 Bacteria 9100
902 nmdc:mga0sz30_50_c1 3300050516 Bacteria 43433
903 nmdc:mga0sz30_84_c1 3300050516 Bacteria 36247
904 Ga0500643_003354 3300053087 Bacteria 7748
905 Ga0500647_0087296 3300053091 Bacteria 1495
906 Ga0500566_0077481 3300053094 Bacteria 1856
907 Ga0500641_0344104 3300053096 Bacteria 601
908 Ga0500648_249686 3300053097 Bacteria 836
909 Ga0500592_001568 3300053116 Bacteria 3695
910 Ga0500592_038829 3300053116 Bacteria 770
911 Ga0500607_000473 3300053121 Bacteria 38991
912 Ga0500607_001970 3300053121 Bacteria 17449
913 Ga0500608_000392 3300053122 Bacteria 16811
914 Ga0500608_013864 3300053122 Bacteria 3584
915 Ga0500614_003373 3300053123 Bacteria 3444
916 Ga0500618_001796 3300053125 Bacteria 9055
917 Ga0500618_015502 3300053125 Bacteria 1925
918 Ga0500559_0001290 3300053136 Bacteria 14517
919 Ga0500559_0050119 3300053136 Bacteria 1841
920 Ga0500559_0074164 3300053136 Bacteria 1537
921 Ga0500564_095944 3300053138 Bacteria 1315
922 Ga0500564_127052 3300053138 Bacteria 1106
923 Ga0500568_0001125 3300053139 Bacteria 17965
924 Ga0500588_0093069 3300053146 Bacteria 1027
925 Ga0500590_000274 3300053148 Bacteria 16192
926 Ga0500604_0010361 3300053151 Bacteria 2493
927 Ga0500604_0031599 3300053151 Bacteria 1555
928 Ga0500616_0000161 3300053153 Bacteria 111424
929 Ga0500622_0197434 3300053156 Bacteria 918
930 Ga0500627_0010203 3300053158 Bacteria 3416
931 Ga0500636_0204662 3300053177 Bacteria 1041
932 Ga0500637_0001632 3300053178 Bacteria 9626
933 Ga0500567_000200 3300053723 Bacteria 17563
934 Ga0500625_000014 3300053729 Bacteria 109364
935 Ga0500645_002935 3300053730 Bacteria 7259
936 Ga0500645_005870 3300053730 Bacteria 4454
937 Ga0500645_037248 3300053730 Bacteria 1445
938 Ga0590071_131142 3300059421 Bacteria 644
939 Ga0590075_038455 3300059424 Bacteria 1221
940 2511129824 2510917021 Bacteria 5705459
941 2643951106 2643221588 Bacteria 3692460
942 2739650846 2739367664 Bacteria 4114334
943 2740029319 2739367865 Bacteria 4114482
944 2819551066 2818991438 Bacteria 5793701
945 2882809263 2882806704 Bacteria 3007728
946 2895881051 2895880812 Bacteria 11255272
947 2896186160 2896184354 Bacteria 3258548
948 2896253500 2896253425 Bacteria 3418029
949 2896431813 2896429255 Bacteria 2557483
950 3000867406 3000865235 Bacteria 3106258
951 Ga0070706_100165198
952 SwRhRL2b_contig_780398
953 JGI24746J21847_1018157
954 JGI24738J21930_10106070
955 JGI24749J21850_1001467
956 JGI24034J26672_10020598
957 JGI24742J22300_10076019
958 JGI24751J29686_10005560
959 JGI24751J29686_10008598
960 JGI24751J29686_10116665
961 Ga0055530_10068401
962 Ga0065714_10221447
963 Ga0065704_10070157
964 Ga0065704_10157456
965 Ga0065715_10000565
966 Ga0065707_10116514
967 Ga0065707_10561390
968 Ga0070658_10000003
969 Ga0070658_10405327
970 Ga0070676_10047460
971 Ga0070676_10052842
972 Ga0070683_100312421
973 Ga0070670_100005390
974 Ga0070670_100007610
975 Ga0070670_100110695
976 Ga0070670_100137168
977 Ga0070670_100302468
978 Ga0070670_100631029
979 Ga0070677_10005158
980 Ga0070677_10159157
981 Ga0070666_10106154
982 Ga0070666_10250404
983 Ga0070666_10376061
984 Ga0070680_100000263
985 Ga0068868_100469744
986 Ga0070660_100000747
987 Ga0070689_101454454
988 Ga0070687_100227237
989 Ga0070661_100000261
990 Ga0070692_10004480
991 Ga0070668_100000007
992 Ga0070668_100007118
993 Ga0070668_100072380
994 Ga0070668_100073108
995 Ga0070668_100090717
996 Ga0070668_100321918
997 Ga0070668_100332242
998 Ga0070668_101234482
999 Ga0070669_100002210
1000 Ga0070669_100005425
1001 Ga0070669_100040027
1002 Ga0070669_100049290
1003 Ga0070669_100112668
1004 Ga0070669_100133365
1005 Ga0070669_100218650
1006 Ga0070669_100249072
1007 Ga0070669_100300945
1008 Ga0070669_100888335
1009 Ga0070675_100005450
1010 Ga0070675_100072583
1011 Ga0070675_100183136
1012 Ga0070671_100002408
1013 Ga0070671_100022991
1014 Ga0070671_100084758
1015 Ga0070671_100596896
1016 Ga0070674_100868269
1017 Ga0070673_100003783
1018 Ga0070673_100121757
1019 Ga0070673_100499556
1020 Ga0070659_100002534
1021 Ga0070659_100005495
1022 Ga0070659_100418601
1023 Ga0070667_100108674
1024 Ga0070667_100207591
1025 Ga0070667_100241088
1026 Ga0070667_100801420
1027 Ga0070701_10537970
1028 Ga0070700_100008201
1029 Ga0070663_100072340
1030 Ga0070663_100460585
1031 Ga0070678_100039998
1032 Ga0070678_100346952
1033 Ga0070662_100000350
1034 Ga0070662_100416974
1035 Ga0068867_100017538
1036 Ga0068867_100053572
1037 Ga0070685_11051102
1038 Ga0070707_100215669
1039 Ga0070679_100000001
1040 Ga0068853_100130997
1041 Ga0068853_100163003
1042 Ga0068853_100501238
1043 Ga0068853_100571895
1044 Ga0068853_101222788
1045 Ga0070672_100004066
1046 Ga0070672_100197272
1047 Ga0070672_100314568
1048 Ga0070672_100549802
1049 Ga0070672_100553094
1050 Ga0070672_101071041
1051 Ga0070686_100000191
1052 Ga0070665_100000101
1053 Ga0070665_100000168
1054 Ga0070665_100087112
1055 Ga0070664_100064156
1056 Ga0068857_100300499
1057 Ga0068854_100016037
1058 Ga0068854_100028892
1059 Ga0068854_100496422
1060 Ga0068852_100672585
1061 Ga0068859_100005659
1062 Ga0068859_100010321
1063 Ga0068859_100023169
1064 Ga0068859_100107336
1065 Ga0068859_100220738
1066 Ga0068864_100010591
1067 Ga0068864_100046836
1068 Ga0068864_100259106
1069 Ga0068866_10492935
1070 Ga0068861_100232238
1071 Ga0068863_100000027
1072 Ga0068863_100002604
1073 Ga0068863_100002810
1074 Ga0068863_100046477
1075 Ga0068863_100625819
1076 Ga0068863_101195751
1077 Ga0068858_100010173
1078 Ga0068858_100233300
1079 Ga0068860_100000391
1080 Ga0068860_100023485
1081 Ga0068860_100030314
1082 Ga0068860_100061179
1083 Ga0068860_100147432
1084 Ga0068860_100201985
1085 Ga0068862_100000014
1086 Ga0068862_100003219
1087 Ga0068862_100011300
1088 Ga0068862_100011857
1089 Ga0068862_100027405
1090 Ga0068862_100048244
1091 Ga0068862_100324092
1092 Ga0068862_100660570
1093 Ga0068862_101227666
1094 Ga0081539_10020337
1095 Ga0081539_10198856
1096 Ga0075365_10056973
1097 Ga0075368_10001348
1098 Ga0075368_10092364
1099 Ga0075363_100002455
1100 Ga0075363_100028458
1101 Ga0075364_10000854
1102 Ga0075364_10006492
1103 Ga0075364_10026011
1104 Ga0075362_10000110
1105 Ga0075362_10001068
1106 Ga0075362_10003739
1107 Ga0075362_10036945
1108 Ga0075367_10008038
1109 Ga0075367_10047582
1110 Ga0075369_10001156
1111 Ga0075369_10015984
1112 Ga0075369_10023219
1113 Ga0075366_10000832
1114 Ga0075366_10003725
1115 Ga0075366_10112411
1116 Ga0075366_10306845
1117 Ga0097621_100257556
1118 Ga0075370_10002158
1119 Ga0075370_10002739
1120 Ga0075370_10003733
1121 Ga0075370_10028750
1122 Ga0075370_10060854
1123 Ga0075370_10131526
1124 Ga0075370_10181696
1125 Ga0068871_100445265
1126 Ga0075430_100038130
1127 Ga0075431_100090974
1128 Ga0068865_100468855
1129 Ga0097620_100005660
1130 Ga0097620_100010321
1131 Ga0097620_100023168
1132 Ga0097620_100107336
1133 Ga0097620_100220727
1134 Ga0079104_1007184
1135 Ga0079104_1009226
1136 Ga0079104_1023151
1137 Ga0075435_100122396
1138 Ga0105251_10009998
1139 Ga0111539_10679540
1140 Ga0105247_10058983
1141 Ga0105247_10103886
1142 Ga0105243_10010410
1143 Ga0105243_10833751
1144 Ga0105241_10862883
1145 Ga0105248_10076884
1146 Ga0105248_10143634
1147 Ga0105248_10157907
1148 Ga0105237_12043655
1149 Ga0105238_11808322
1150 Ga0105249_10000002
1151 Ga0105249_10001466
1152 Ga0105249_10033520
1153 Ga0105249_10089940
1154 Ga0105249_10438337
1155 Ga0105249_10967768
1156 Ga0105249_12759211
1157 Ga0157371_10025908
1158 Ga0157370_11317728
1159 Ga0157369_10022391
1160 Ga0157369_11380134
1161 Ga0163162_10008235
1162 Ga0163162_10025560
1163 Ga0157372_10364488
1164 Ga0157375_10217852
1165 Ga0157375_10711853
1166 Ga0157375_12633177
1167 Ga0163163_10212089
1168 Ga0163163_10267802
1169 Ga0157380_10000710
1170 Ga0157380_10013753
1171 Ga0157380_10018361
1172 Ga0157380_10022254
1173 Ga0157380_10038572
1174 Ga0157380_10071136
1175 Ga0157380_10108083
1176 Ga0157380_10230462
1177 Ga0157380_10899795
1178 Ga0157380_11000748
1179 Ga0157380_11237729
1180 Ga0163161_10002075
1181 Ga0163161_10017590
1182 Ga0163161_10069791
1183 Ga0163161_11235184
1184 Ga0206356_11066624
1185 Ga0213873_10000216
1186 Ga0213876_10000056
1187 Ga0213876_10000258
1188 Ga0209050_1000474
1189 Ga0207697_10007313
1190 Ga0207713_1002253
1191 Ga0207682_10000923
1192 Ga0207682_10378407
1193 Ga0207710_10034986
1194 Ga0207710_10098805
1195 Ga0207688_10012090
1196 Ga0207680_10192593
1197 Ga0207680_10237799
1198 Ga0207680_10274014
1199 Ga0207647_10394684
1200 Ga0207645_10011115
1201 Ga0207645_10054971
1202 Ga0207645_10410480
1203 Ga0207705_10000005
1204 Ga0207705_10183344
1205 Ga0207654_11208160
1206 Ga0207660_10000246
1207 Ga0207662_10362044
1208 Ga0207657_10011954
1209 Ga0207657_10047650
1210 Ga0207649_10000016
1211 Ga0207652_10000002
1212 Ga0207681_10000224
1213 Ga0207681_10001743
1214 Ga0207681_10008452
1215 Ga0207681_10024789
1216 Ga0207681_10030526
1217 Ga0207681_10091559
1218 Ga0207681_10260268
1219 Ga0207681_10318889
1220 Ga0207650_10003361
1221 Ga0207650_10050584
1222 Ga0207650_10183798
1223 Ga0207650_10306946
1224 Ga0207650_10309673
1225 Ga0207650_10360214
1226 Ga0207650_10375983
1227 Ga0207650_10388809
1228 Ga0207650_11028126
1229 Ga0207650_11112960
1230 Ga0207659_10016247
1231 Ga0207659_10159221
1232 Ga0207687_10268357
1233 Ga0207687_10832541
1234 Ga0207644_10000111
1235 Ga0207644_10008009
1236 Ga0207644_10052625
1237 Ga0207644_10053613
1238 Ga0207644_10122961
1239 Ga0207644_10449099
1240 Ga0207644_10687473
1241 Ga0207690_10002957
1242 Ga0207690_10003851
1243 Ga0207690_10574830
1244 Ga0207706_10000276
1245 Ga0207706_10133077
1246 Ga0207706_10281440
1247 Ga0207709_10010411
1248 Ga0207709_10034745
1249 Ga0207669_10238701
1250 Ga0207669_10857155
1251 Ga0207669_11085994
1252 Ga0207704_10785687
1253 Ga0207691_10014857
1254 Ga0207691_10106124
1255 Ga0207691_10205854
1256 Ga0207691_10308405
1257 Ga0207691_10337086
1258 Ga0207691_10398372
1259 Ga0207711_10004284
1260 Ga0207711_10165700
1261 Ga0207711_10374983
1262 Ga0207661_11658443
1263 Ga0207679_10010549
1264 Ga0207679_10284750
1265 Ga0207651_10007898
1266 Ga0207651_10433962
1267 Ga0207712_10000002
1268 Ga0207712_10032962
1269 Ga0207712_10110079
1270 Ga0207712_10130400
1271 Ga0207712_10482262
1272 Ga0207668_10000054
1273 Ga0207668_10002327
1274 Ga0207668_10022255
1275 Ga0207668_10054668
1276 Ga0207668_10062265
1277 Ga0207668_10121946
1278 Ga0207668_10128887
1279 Ga0207668_10291377
1280 Ga0207668_10615329
1281 Ga0207640_10006878
1282 Ga0207640_10291476
1283 Ga0207658_10010132
1284 Ga0207658_10108633
1285 Ga0207658_10555842
1286 Ga0207703_10005939
1287 Ga0207703_10695200
1288 Ga0207703_11220084
1289 Ga0207703_11405960
1290 Ga0207639_10076765
1291 Ga0207639_10205224
1292 Ga0207639_10452009
1293 Ga0207678_10043681
1294 Ga0207678_10424751
1295 Ga0207641_10000045
1296 Ga0207641_10004364
1297 Ga0207641_10009028
1298 Ga0207641_10010357
1299 Ga0207641_10725668
1300 Ga0207641_10930851
1301 Ga0207648_10015998
1302 Ga0207648_10072006
1303 Ga0207676_10031593
1304 Ga0207676_10048188
1305 Ga0207676_10052019
1306 Ga0207676_10449358
1307 Ga0207676_11241397
1308 Ga0207674_10008177
1309 Ga0207674_10163736
1310 Ga0207674_11444847
1311 Ga0207675_100001317
1312 Ga0207675_100132779
1313 Ga0207675_100870022
1314 Ga0207683_10044948
1315 Ga0209281_1012035
1316 Ga0209281_1025320
1317 Ga0209983_1010759
1318 Ga0209813_10000027
1319 Ga0209974_10009642
1320 Ga0209974_10031012
1321 Ga0268266_10000130
1322 Ga0268266_10001320
1323 Ga0268266_10567503
1324 Ga0268265_10000607
1325 Ga0268265_10012660
1326 Ga0268265_10013350
1327 Ga0268265_10013973
1328 Ga0268265_10015482
1329 Ga0268265_10167855
1330 Ga0268265_10627409
1331 Ga0268264_10000634
1332 Ga0268264_10002547
1333 Ga0268264_10013326
1334 Ga0268264_10065563
1335 Ga0268264_10111204
1336 Ga0268264_11370376
1337 Ga0316177_1190548
1338 Ga0316179_1110524
1339 Ga0316180_1085882
1340 Ga0316180_1174327
1341 Ga0307513_10370800
1342 Ga0307513_10416085
1343 Ga0307408_100013328
1344 Ga0307408_100018967
1345 Ga0307408_100035222
1346 Ga0307408_100065642
1347 Ga0307408_100069951
1348 Ga0307408_100071967
1349 Ga0307408_100081110
1350 Ga0307408_100089395
1351 Ga0307408_100123957
1352 Ga0307408_100224252
1353 Ga0307408_100307185
1354 Ga0307408_100351817
1355 Ga0307408_100373227
1356 Ga0307408_100477026
1357 Ga0307408_100594744
1358 Ga0307408_100619921
1359 Ga0307408_100938730
1360 Ga0316576_10744900
1361 Ga0307405_10003917
1362 Ga0307405_10004331
1363 Ga0307405_10006541
1364 Ga0307405_10013101
1365 Ga0307405_10029271
1366 Ga0307405_10050193
1367 Ga0307405_10054582
1368 Ga0307405_10058768
1369 Ga0307405_10098140
1370 Ga0307405_10357930
1371 Ga0307405_10422666
1372 Ga0307405_10460238
1373 Ga0307405_10697225
1374 Ga0307405_10967247
1375 Ga0307405_11069772
1376 Ga0307405_11097337
1377 Ga0307405_11276775
1378 Ga0307413_10001416
1379 Ga0307413_10006305
1380 Ga0307413_10010707
1381 Ga0307413_10012453
1382 Ga0307413_10023067
1383 Ga0307413_10032501
1384 Ga0307413_10038961
1385 Ga0307413_10040847
1386 Ga0307413_10066641
1387 Ga0307413_10109720
1388 Ga0307413_10133837
1389 Ga0307413_10207848
1390 Ga0307413_10210950
1391 Ga0307413_10221143
1392 Ga0307413_10305504
1393 Ga0307413_10320666
1394 Ga0307413_10435972
1395 Ga0307413_10467974
1396 Ga0307413_10527628
1397 Ga0307413_10569579
1398 Ga0307413_10633826
1399 Ga0307413_10638946
1400 Ga0307413_10640439
1401 Ga0307413_10671571
1402 Ga0307413_10691514
1403 Ga0307413_10916029
1404 Ga0307413_11173678
1405 Ga0307413_11727455
1406 Ga0307410_10001524
1407 Ga0307410_10002509
1408 Ga0307410_10002567
1409 Ga0307410_10005057
1410 Ga0307410_10006267
1411 Ga0307410_10023494
1412 Ga0307410_10024407
1413 Ga0307410_10041289
1414 Ga0307410_10063930
1415 Ga0307410_10074090
1416 Ga0307410_10076541
1417 Ga0307410_10112007
1418 Ga0307410_10194708
1419 Ga0307410_10248424
1420 Ga0307410_10261699
1421 Ga0307410_10325862
1422 Ga0307410_10344824
1423 Ga0307410_10417332
1424 Ga0307410_11541367
1425 Ga0307406_10006924
1426 Ga0307406_10014014
1427 Ga0307406_10014511
1428 Ga0307406_10018259
1429 Ga0307406_10018370
1430 Ga0307406_10047204
1431 Ga0307406_10056469
1432 Ga0307406_10088744
1433 Ga0307406_10109970
1434 Ga0307406_10192489
1435 Ga0307406_10193384
1436 Ga0307406_10235574
1437 Ga0307406_10307167
1438 Ga0307406_10311481
1439 Ga0307406_10453409
1440 Ga0307406_10717165
1441 Ga0307406_10892508
1442 Ga0307406_10930103
1443 Ga0307406_11174139
1444 Ga0307407_10001255
1445 Ga0307407_10003308
1446 Ga0307407_10003757
1447 Ga0307407_10013405
1448 Ga0307407_10031325
1449 Ga0307407_10040708
1450 Ga0307407_10056619
1451 Ga0307407_10091639
1452 Ga0307407_10157609
1453 Ga0307407_10304123
1454 Ga0307407_10361740
1455 Ga0307407_10420357
1456 Ga0307407_10534522
1457 Ga0307407_10553969
1458 Ga0307407_10969408
1459 Ga0307407_11019597
1460 Ga0307412_10002333
1461 Ga0307412_10003753
1462 Ga0307412_10004147
1463 Ga0307412_10009369
1464 Ga0307412_10046779
1465 Ga0307412_10086771
1466 Ga0307412_10090073
1467 Ga0307412_10091691
1468 Ga0307412_10105697
1469 Ga0307412_10110635
1470 Ga0307412_10112454
1471 Ga0307412_10124408
1472 Ga0307412_10134338
1473 Ga0307412_10138385
1474 Ga0307412_10139953
1475 Ga0307412_10148541
1476 Ga0307412_10178906
1477 Ga0307412_10247204
1478 Ga0307412_10310562
1479 Ga0307412_10313819
1480 Ga0307412_10484607
1481 Ga0307412_10580106
1482 Ga0307412_10589530
1483 Ga0307412_10969541
1484 Ga0307409_100006322
1485 Ga0307409_100020016
1486 Ga0307409_100023061
1487 Ga0307409_100047750
1488 Ga0307409_100058676
1489 Ga0307409_100066667
1490 Ga0307409_100146053
1491 Ga0307409_100181994
1492 Ga0307409_100188464
1493 Ga0307409_100257201
1494 Ga0307409_100291800
1495 Ga0307409_100431144
1496 Ga0307409_100434710
1497 Ga0307409_100451758
1498 Ga0307409_100534772
1499 Ga0307409_100535820
1500 Ga0307409_100629276
1501 Ga0307409_100636386
1502 Ga0307409_100682995
1503 Ga0307409_100736521
1504 Ga0307409_100742783
1505 Ga0307409_100792213
1506 Ga0307409_100820267
1507 Ga0307409_100910532
1508 Ga0307409_101086548
1509 Ga0307409_101140948
1510 Ga0307409_101178084
1511 Ga0307409_101453696
1512 Ga0307409_101901854
1513 Ga0307416_100013987
1514 Ga0307416_100018028
1515 Ga0307416_100030377
1516 Ga0307416_100036533
1517 Ga0307416_100083762
1518 Ga0307416_100089834
1519 Ga0307416_100123551
1520 Ga0307416_100139651
1521 Ga0307416_100151165
1522 Ga0307416_100156596
1523 Ga0307416_100177719
1524 Ga0307416_100304647
1525 Ga0307416_100309869
1526 Ga0307416_100343180
1527 Ga0307416_100401743
1528 Ga0307416_100428379
1529 Ga0307416_100468809
1530 Ga0307416_100550425
1531 Ga0307416_100672219
1532 Ga0307416_100708110
1533 Ga0307416_100771495
1534 Ga0307416_100798750
1535 Ga0307416_100856849
1536 Ga0307416_100915074
1537 Ga0307416_101028951
1538 Ga0307416_101142352
1539 Ga0307416_101264730
1540 Ga0307416_101332417
1541 Ga0307416_101601378
1542 Ga0307416_102600384
1543 Ga0307414_10001742
1544 Ga0307414_10001927
1545 Ga0307414_10005262
1546 Ga0307414_10007634
1547 Ga0307414_10011130
1548 Ga0307414_10015446
1549 Ga0307414_10015785
1550 Ga0307414_10018780
1551 Ga0307414_10019093
1552 Ga0307414_10023564
1553 Ga0307414_10034156
1554 Ga0307414_10034942
1555 Ga0307414_10052670
1556 Ga0307414_10062337
1557 Ga0307414_10074919
1558 Ga0307414_10113162
1559 Ga0307414_10163601
1560 Ga0307414_10206462
1561 Ga0307414_10208154
1562 Ga0307414_10209996
1563 Ga0307414_10212112
1564 Ga0307414_10240076
1565 Ga0307414_10263496
1566 Ga0307414_10291758
1567 Ga0307414_10305417
1568 Ga0307414_10329713
1569 Ga0307414_10350694
1570 Ga0307414_10398953
1571 Ga0307414_10404297
1572 Ga0307414_10445303
1573 Ga0307414_10512333
1574 Ga0307414_10535171
1575 Ga0307414_10569936
1576 Ga0307414_10577344
1577 Ga0307414_10610885
1578 Ga0307414_10703685
1579 Ga0307414_10886205
1580 Ga0307414_10892571
1581 Ga0307414_11054970
1582 Ga0307414_11878793
1583 Ga0307411_10000336
1584 Ga0307411_10001853
1585 Ga0307411_10002454
1586 Ga0307411_10005387
1587 Ga0307411_10005481
1588 Ga0307411_10006739
1589 Ga0307411_10007044
1590 Ga0307411_10017019
1591 Ga0307411_10030058
1592 Ga0307411_10033608
1593 Ga0307411_10034071
1594 Ga0307411_10044244
1595 Ga0307411_10049671
1596 Ga0307411_10054128
1597 Ga0307411_10058040
1598 Ga0307411_10086288
1599 Ga0307411_10102552
1600 Ga0307411_10193416
1601 Ga0307411_10240396
1602 Ga0307411_10246115
1603 Ga0307411_10271766
1604 Ga0307411_10282551
1605 Ga0307411_10310567
1606 Ga0307411_10311679
1607 Ga0307411_10311680
1608 Ga0307411_10338584
1609 Ga0307411_10338833
1610 Ga0307411_10381041
1611 Ga0307411_10400124
1612 Ga0307411_10410920
1613 Ga0307411_10420347
1614 Ga0307411_10451627
1615 Ga0307411_10485474
1616 Ga0307411_10520525
1617 Ga0307411_10657213
1618 Ga0307411_11093023
1619 Ga0307411_11376675
1620 Ga0307411_11538107
1621 Ga0307411_11773479
1622 Ga0307415_100012229
1623 Ga0307415_100018344
1624 Ga0307415_100020434
1625 Ga0307415_100035274
1626 Ga0307415_100042418
1627 Ga0307415_100050757
1628 Ga0307415_100110903
1629 Ga0307415_100113299
1630 Ga0307415_100125609
1631 Ga0307415_100153505
1632 Ga0307415_100265302
1633 Ga0307415_100375211
1634 Ga0307415_100494950
1635 Ga0307415_100665577
1636 Ga0307415_100713914
1637 Ga0307415_100914550
1638 Ga0307415_101044361
1639 Ga0307415_102040373
1640 Ga0373930_0138025
1641 Ga0373931_0038570
1642 Ga0373937_1475418
1643 Ga0395899_0152656
1644 Ga0395900_0001407
1645 Ga0395905_0000541
1646 Ga0395905_0459179
1647 Ga0436364_1162477
1648 Ga0395901_0036664
1649 Ga0436365_0083543
1650 Ga0436365_0456925
1651 Ga0436362_0527241
1652 Ga0436362_0957441
1653 Ga0436362_1001952
1654 Ga0439447_049342
1655 Ga0439453_0007534
1656 Ga0451789_1248675
1657 Ga0451800_0510992
1658 Ga0451807_1480564
1659 Ga0451833_1239628
1660 Ga0451843_1568534
1661 Ga0451853_1131984
1662 Ga0451853_1258367
1663 Ga0439441_043449
1664 Ga0439441_098899
1665 Ga0439443_002190
1666 Ga0439432_047881
1667 Ga0439449_0127066
1668 Ga0439449_0144383
1669 Ga0439452_030278
1670 Ga0439462_0000184
1671 Ga0439462_0074256
1672 Ga0450912_002265
1673 Ga0450898_020795
1674 Ga0439446_0046524
1675 Ga0439434_0145900
1676 Ga0439435_0003482
1677 Ga0466960_0118514
1678 Ga0451576_0000024
1679 Ga0495627_000198
1680 Ga0495638_0060967
1681 Ga0495650_0003812
1682 Ga0495605_0199242
1683 Ga0495585_0198396
1684 Ga0495596_0001077
1685 Ga0495596_0098014
1686 Ga0495607_0003215
1687 Ga0495583_0086327
1688 Ga0495606_0006170
1689 Ga0495610_0000050
1690 Ga0495610_0000352
1691 Ga0495610_0005889
1692 Ga0495620_0053711
1693 Ga0495620_0067469
1694 Ga0495632_0003354
1695 Ga0495632_0008427
1696 Ga0495643_0000036
1697 Ga0495643_0014146
1698 Ga0495643_0043693
1699 Ga0495663_0010909
1700 Ga0495663_0014172
1701 Ga0495663_0018935
1702 Ga0495663_0023912
1703 Ga0495642_0024686
1704 Ga0495654_0002383
1705 Ga0495654_0076719
1706 Ga0495598_0051772
1707 Ga0495598_0111766
1708 Ga0495598_0182314
1709 Ga0495598_0234550
1710 Ga0495609_0005187
1711 Ga0495621_0002308
1712 Ga0495621_0004360
1713 Ga0495621_0006702
1714 Ga0495621_0010072
1715 Ga0495621_0019816
1716 Ga0495621_0030921
1717 Ga0495597_0077133
1718 Ga0495645_0792906
1719 Ga0495633_0020520
1720 Ga0495633_0021195
1721 Ga0495633_0154096
1722 Ga0495633_0419894
1723 Ga0495656_0299499
1724 Ga0495668_0001218
1725 Ga0495668_0005147
1726 Ga0495668_0497251
1727 Ga0495625_0007251
1728 Ga0495625_0277924
1729 Ga0495659_0076279
1730 Ga0495659_0107750
1731 Ga0495588_0199715
1732 Ga0495669_0001697
1733 Ga0495669_0003949
1734 Ga0495669_0215806
1735 Ga0495670_0008719
1736 Ga0495670_0027370
1737 Ga0495670_0107941
1738 Ga0495670_0369068
1739 Ga0495670_0455493
1740 Ga0495649_0266008
1741 Ga0495589_0028954
1742 Ga0495676_0273590
1743 Ga0495677_0073462
1744 Ga0495685_139252
1745 Ga0495685_182872
1746 Ga0495681_0000095
1747 Ga0495615_0000158
1748 Ga0495615_0007619
1749 Ga0495626_0000585
1750 Ga0496100_0970183
1751 Ga0496101_0608030
1752 Ga0496101_1391614
1753 Ga0496102_0091237
1754 Ga0496103_0008694
1755 Ga0496107_0098158
1756 Ga0496107_0567765
1757 Ga0496108_0696598
1758 Ga0496109_0037244
1759 Ga0496109_0106437
1760 Ga0496109_1884820
1761 Ga0496110_0010491
1762 Ga0496110_0112270
1763 Ga0496111_0049638
1764 Ga0496111_0220705
1765 Ga0496114_0044120
1766 Ga0496114_0296338
1767 Ga0496114_0383353
1768 Ga0496115_0124127
1769 Ga0496116_0000149
1770 Ga0496116_0042762
1771 Ga0496116_0350233
1772 Ga0496117_0021674
1773 Ga0496117_0191331
1774 Ga0496118_0029070
1775 Ga0496118_0104594
1776 Ga0496118_0216450
1777 Ga0496119_0214261
1778 Ga0496121_0000024
1779 Ga0496121_0001202
1780 Ga0496121_0001791
1781 Ga0496121_0041098
1782 Ga0496121_0045484
1783 Ga0496122_0006339
1784 Ga0496122_0025675
1785 Ga0496123_0000830
1786 Ga0496123_0004529
1787 Ga0496123_0377515
1788 Ga0496124_0004393
1789 Ga0496124_0078153
1790 Ga0496124_0089188
1791 Ga0496125_0027330
1792 Ga0496125_0140470
1793 Ga0496125_0178119
1794 Ga0496126_0000261
1795 Ga0496126_0003215
1796 Ga0496126_0031424
1797 Ga0496126_0078350
1798 Ga0501034_0067976
1799 Ga0501034_0171152
1800 Ga0501034_0351126
1801 Ga0501034_1239417
1802 Ga0501037_0189659
1803 Ga0501039_0419635
1804 Ga0501043_0311710
1805 Ga0501047_0166213
1806 Ga0501047_0342666
1807 Ga0501047_0805500
1808 Ga0501047_0928574
1809 Ga0501069_0007096
1810 Ga0501069_0834765
1811 Ga0501070_0026161
1812 Ga0501217_212872
1813 Ga0501230_007534
1814 Ga0501242_004305
1815 Ga0501249_004480
1816 Ga0501253_057192
1817 Ga0501267_028003
1818 Ga0501268_005635
1819 Ga0501270_029915
1820 Ga0501035_0368232
1821 Ga0501044_0003900
1822 Ga0501044_0998403
1823 nmdc:mga03683_12096_c1
1824 nmdc:mga03683_2944_c1
1825 nmdc:mga03683_3_c1
1826 nmdc:mga03683_94_c1
1827 nmdc:mga03n38_591_c1
1828 nmdc:mga00v17_1706_c2
1829 nmdc:mga00v17_2789_c1
1830 nmdc:mga00v17_36230_c1
1831 nmdc:mga0k408_13169_c1
1832 nmdc:mga0k408_242286_c1
1833 nmdc:mga0k408_2_c1
1834 nmdc:mga0k408_307200_c1
1835 nmdc:mga0k408_30931_c1
1836 nmdc:mga0k408_5427_c1
1837 nmdc:mga06z11_248777_c1
1838 nmdc:mga06z11_300_c1
1839 nmdc:mga04h51_3092_c1
1840 nmdc:mga07m45_169705_c1
1841 nmdc:mga07m45_1_c1
1842 nmdc:mga07m45_28948_c1
1843 nmdc:mga07m45_3826_c1
1844 nmdc:mga07m45_63394_c1
1845 nmdc:mga07m45_9_c1
1846 nmdc:mga0qj67_70722_c1
1847 nmdc:mga06r32_189931_c1
1848 nmdc:mga08y16_340585_c1
1849 nmdc:mga08y16_490379_c1
1850 nmdc:mga0n895_198823_c1
1851 nmdc:mga0sz30_1249_c1
1852 nmdc:mga0sz30_50_c1
1853 nmdc:mga0sz30_84_c1
1854 Ga0500643_003354
1855 Ga0500647_0087296
1856 Ga0500566_0077481
1857 Ga0500641_0344104
1858 Ga0500648_249686
1859 Ga0500592_001568
1860 Ga0500592_038829
1861 Ga0500607_000473
1862 Ga0500607_001970
1863 Ga0500608_000392
1864 Ga0500608_013864
1865 Ga0500614_003373
1866 Ga0500618_001796
1867 Ga0500618_015502
1868 Ga0500559_0001290
1869 Ga0500559_0050119
1870 Ga0500559_0074164
1871 Ga0500564_095944
1872 Ga0500564_127052
1873 Ga0500568_0001125
1874 Ga0500588_0093069
1875 Ga0500590_000274
1876 Ga0500604_0010361
1877 Ga0500604_0031599
1878 Ga0500616_0000161
1879 Ga0500622_0197434
1880 Ga0500627_0010203
1881 Ga0500636_0204662
1882 Ga0500637_0001632
1883 Ga0500567_000200
1884 Ga0500625_000014
1885 Ga0500645_002935
1886 Ga0500645_005870
1887 Ga0500645_037248
1888 Ga0590071_131142
1889 Ga0590075_038455
1890 2511129824
1891 2643951106
1892 2739650846
1893 2740029319
1894 2819551066
1895 2882809263
1896 2895881051
1897 2896186160
1898 2896253500
1899 2896431813
1900 3000867406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

71

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9319 31 147
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9308 32 149
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9277 32 149
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9265 34 149
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9251 32 147
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9308 32 149 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9277 32 147 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9163 40 149 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9134 31 147 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9083 32 149 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4D7DBM5-F1-model_v4 PaaI family thioesterase 0.9933 17 160 GO:0016289
AF-A0A4R7DF13-F1-model_v4 deleted 0.9926 17 160
AF-A0A2E2IUI4-F1-model_v4 Thioesterase 0.9915 17 161 GO:0016289
AF-A0A7G5IHG7-F1-model_v4 PaaI family thioesterase 0.9904 18 159 GO:0016289
AF-A0A7Y1ZPX8-F1-model_v4 PaaI family thioesterase 0.9892 20 159 GO:0016289

Map