F486551

General Info

Members Datasets Scaffolds Average Seq Length
950 478 1864 193

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10223694|Ga0099794_102236942
Length 209
Sequence MKKKKMSTAMSQPLLIAFVMFAAVMFFTPGPNNIMLLSSGLTYGFRPTLPHIAGITFGFAFMIGVVGLGLGTIFITYPVLQTILKYAGVAYLIYLAAAIAMSGPVKPDHDNRRGPMTFWGAAMFQWINAKGWVMVIGTITAYAGIASFPWNITIQVMLSLVLGAVSCSAWALFGTALRPLLTSPRLVRTFNIVMAVLLLASLYPVFMDA

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
94 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
95 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
254 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
255 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
256 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
336 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
368 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
398 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
405 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
406 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
407 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
408 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
409 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
410 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
411 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
414 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
419 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
420 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
421 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
422 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
423 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
427 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
432 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
433 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
434 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
435 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
436 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
437 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
438 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
439 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
440 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
441 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
442 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
443 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
444 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
445 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
446 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
447 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
448 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
449 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
450 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
451 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
452 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
453 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
454 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
455 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
456 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
457 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
458 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
459 2904699407
460 2906610324
461 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
462 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
463 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
464 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
465 2922425934
466 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
467 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
468 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
469 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
470 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
471 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
472 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
473 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
474 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
475 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
476 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
477 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
478 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 0.11
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 3.68
Rhizoplane 5.26
Rhizosphere 69.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10223694 3300007265 Bacteria 967
2 JGI24739J22299_10012951 3300001989 Bacteria 3052
3 JGI24737J22298_10016177 3300001990 Bacteria 2409
4 JGI24735J21928_10016953 3300002067 Bacteria 2255
5 JGI24742J22300_10012308 3300002244 Bacteria 1425
6 JGI25406J46586_10000721 3300003203 Bacteria 15439
7 JGI25406J46586_10008215 3300003203 Bacteria 4737
8 JGI25406J46586_10017054 3300003203 Bacteria 3009
9 JGI25153J46596_10000738 3300003215 Bacteria 20026
10 rootH2_10077708 3300003320 Bacteria 1427
11 JGI25160J50197_1029660 3300003354 Bacteria 1441
12 JGI25404J52841_10015813 3300003659 Bacteria 1637
13 JGI25404J52841_10047108 3300003659 Bacteria 909
14 JGI25405J52794_10061750 3300003911 Bacteria 811
15 Ga0065165_1009382 3300005262 Bacteria 4396
16 Ga0070658_10562246 3300005327 Bacteria 987
17 Ga0070676_10212565 3300005328 Bacteria 1274
18 Ga0070683_100017126 3300005329 Bacteria 6399
19 Ga0070683_100521531 3300005329 Bacteria 1135
20 Ga0070690_100647479 3300005330 Bacteria 807
21 Ga0068869_100064859 3300005334 Bacteria 2687
22 Ga0068869_100381851 3300005334 Bacteria 1155
23 Ga0070680_100061117 3300005336 Bacteria 3084
24 Ga0068868_100130295 3300005338 Bacteria 2057
25 Ga0068868_100137064 3300005338 Bacteria 2006
26 Ga0068868_100747279 3300005338 Bacteria 879
27 Ga0070660_100884856 3300005339 Bacteria 753
28 Ga0070689_100504881 3300005340 Bacteria 1036
29 Ga0070691_10055133 3300005341 Bacteria 1903
30 Ga0070687_100189376 3300005343 Bacteria 1238
31 Ga0070661_100205620 3300005344 Bacteria 1506
32 Ga0070668_100050535 3300005347 Bacteria 3201
33 Ga0070668_100152569 3300005347 Bacteria 1869
34 Ga0070669_100236187 3300005353 Bacteria 1451
35 Ga0070671_100160005 3300005355 Bacteria 1903
36 Ga0070671_100501845 3300005355 Bacteria 1044
37 Ga0070674_100062001 3300005356 Bacteria 2612
38 Ga0070688_100109774 3300005365 Bacteria 1833
39 Ga0070688_100172809 3300005365 Bacteria 1493
40 Ga0070659_100251243 3300005366 Bacteria 1465
41 Ga0070659_100383741 3300005366 Bacteria 1184
42 Ga0070659_100668052 3300005366 Bacteria 897
43 Ga0070667_101255141 3300005367 Bacteria 694
44 Ga0070703_10198342 3300005406 Bacteria 786
45 Ga0070709_10001764 3300005434 Bacteria 11754
46 Ga0070709_10153975 3300005434 Bacteria 1591
47 Ga0070714_100051653 3300005435 Bacteria 3506
48 Ga0070714_100547529 3300005435 Bacteria 1107
49 Ga0070713_100061144 3300005436 Bacteria 3151
50 Ga0070713_100211833 3300005436 Bacteria 1754
51 Ga0070713_100228238 3300005436 Bacteria 1691
52 Ga0070713_100378511 3300005436 Bacteria 1318
53 Ga0070713_100835486 3300005436 Bacteria 884
54 Ga0070710_10001695 3300005437 Bacteria 10382
55 Ga0070710_10527186 3300005437 Bacteria 812
56 Ga0070711_100020703 3300005439 Bacteria 4243
57 Ga0070711_100044852 3300005439 Bacteria 3003
58 Ga0070711_100712389 3300005439 Bacteria 846
59 Ga0070711_100773988 3300005439 Bacteria 812
60 Ga0070708_101169909 3300005445 Bacteria 720
61 Ga0070663_100018549 3300005455 Bacteria 4566
62 Ga0070663_100053867 3300005455 Bacteria 2873
63 Ga0070663_100685201 3300005455 Bacteria 870
64 Ga0070678_100198168 3300005456 Bacteria 1655
65 Ga0070678_100371820 3300005456 Bacteria 1234
66 Ga0070678_100383583 3300005456 Bacteria 1216
67 Ga0070662_100050768 3300005457 Bacteria 2992
68 Ga0070662_100190683 3300005457 Bacteria 1621
69 Ga0070662_100483100 3300005457 Bacteria 1031
70 Ga0070681_10463553 3300005458 Bacteria 1179
71 Ga0068867_100111788 3300005459 Bacteria 2099
72 Ga0068867_100349335 3300005459 Bacteria 1234
73 Ga0070706_100129052 3300005467 Bacteria 2359
74 Ga0070706_100260542 3300005467 Bacteria 1619
75 Ga0070707_100119818 3300005468 Bacteria 2555
76 Ga0070698_100197239 3300005471 Bacteria 1949
77 Ga0070698_100617451 3300005471 Bacteria 1025
78 Ga0070697_100238054 3300005536 Bacteria 1554
79 Ga0068853_100097793 3300005539 Bacteria 2592
80 Ga0068853_100262428 3300005539 Bacteria 1588
81 Ga0068853_101018183 3300005539 Bacteria 798
82 Ga0070672_100109452 3300005543 Bacteria 2250
83 Ga0070672_100154769 3300005543 Bacteria 1898
84 Ga0070686_100356428 3300005544 Bacteria 1100
85 Ga0070695_100094980 3300005545 Bacteria 1997
86 Ga0070695_100542236 3300005545 Bacteria 906
87 Ga0070696_100473956 3300005546 Bacteria 992
88 Ga0070665_100088043 3300005548 Bacteria 3111
89 Ga0070665_100174517 3300005548 Bacteria 2150
90 Ga0070665_100701082 3300005548 Bacteria 1025
91 Ga0070704_100583576 3300005549 Bacteria 980
92 Ga0070704_100666847 3300005549 Bacteria 919
93 Ga0068855_100050191 3300005563 Bacteria 4918
94 Ga0068855_100053959 3300005563 Bacteria 4727
95 Ga0068855_100508206 3300005563 Bacteria 1309
96 Ga0068855_100531771 3300005563 Bacteria 1274
97 Ga0070664_100432562 3300005564 Bacteria 1206
98 Ga0068857_100014952 3300005577 Bacteria 6770
99 Ga0068857_100165432 3300005577 Bacteria 2008
100 Ga0068857_100548812 3300005577 Bacteria 1089
101 Ga0068854_100021501 3300005578 Bacteria 4379
102 Ga0068854_100364401 3300005578 Bacteria 1186
103 Ga0068854_101195812 3300005578 Bacteria 681
104 Ga0068856_100002538 3300005614 Bacteria 18824
105 Ga0068856_100100529 3300005614 Bacteria 2884
106 Ga0068856_100289594 3300005614 Bacteria 1654
107 Ga0068856_100444122 3300005614 Bacteria 1318
108 Ga0068852_100008462 3300005616 Bacteria 7583
109 Ga0068852_100660284 3300005616 Bacteria 1054
110 Ga0068852_100757318 3300005616 Bacteria 983
111 Ga0068852_100782486 3300005616 Bacteria 968
112 Ga0068859_100668110 3300005617 Bacteria 1130
113 Ga0068859_101197883 3300005617 Bacteria 836
114 Ga0068864_100128028 3300005618 Bacteria 2277
115 Ga0068864_100556159 3300005618 Bacteria 1110
116 Ga0068864_100748175 3300005618 Bacteria 958
117 Ga0068866_10046902 3300005718 Bacteria 2175
118 Ga0068861_100030335 3300005719 Bacteria 3961
119 Ga0068861_100046881 3300005719 Bacteria 3260
120 Ga0068861_100572507 3300005719 Bacteria 1032
121 Ga0068870_10242840 3300005840 Bacteria 1113
122 Ga0068863_100243895 3300005841 Bacteria 1734
123 Ga0068863_100394052 3300005841 Bacteria 1353
124 Ga0068858_100239469 3300005842 Bacteria 1721
125 Ga0068858_100420222 3300005842 Bacteria 1286
126 Ga0068858_100766265 3300005842 Bacteria 941
127 Ga0068860_100000533 3300005843 Bacteria 46479
128 Ga0068860_100134467 3300005843 Bacteria 2374
129 Ga0068862_100265752 3300005844 Bacteria 1567
130 Ga0068862_100569862 3300005844 Bacteria 1083
131 Ga0081455_10070768 3300005937 Bacteria 2895
132 Ga0081455_10380199 3300005937 Bacteria 987
133 Ga0081540_1002213 3300005983 Bacteria 16044
134 Ga0081540_1005827 3300005983 Bacteria 9115
135 Ga0081540_1012712 3300005983 Bacteria 5519
136 Ga0081540_1017590 3300005983 Bacteria 4418
137 Ga0081540_1024174 3300005983 Bacteria 3532
138 Ga0081540_1025572 3300005983 Bacteria 3392
139 Ga0081540_1052500 3300005983 Bacteria 2006
140 Ga0081539_10000748 3300005985 Bacteria 64594
141 Ga0081539_10001829 3300005985 Bacteria 33573
142 Ga0070717_10133966 3300006028 Bacteria 2132
143 Ga0070717_10257705 3300006028 Bacteria 1543
144 Ga0075365_10027753 3300006038 Bacteria 3605
145 Ga0075365_10039617 3300006038 Bacteria 3069
146 Ga0075365_10126465 3300006038 Bacteria 1766
147 Ga0075365_10296614 3300006038 Bacteria 1137
148 Ga0075365_10358222 3300006038 Bacteria 1028
149 Ga0075365_10479718 3300006038 Bacteria 878
150 Ga0075368_10020977 3300006042 Bacteria 2478
151 Ga0075368_10030204 3300006042 Bacteria 2098
152 Ga0075363_100023427 3300006048 Bacteria 3129
153 Ga0075363_100052487 3300006048 Bacteria 2176
154 Ga0075363_100448932 3300006048 Bacteria 761
155 Ga0075364_10281885 3300006051 Bacteria 1130
156 Ga0075432_10127059 3300006058 Bacteria 962
157 Ga0070715_10001014 3300006163 Bacteria 7909
158 Ga0070716_100019284 3300006173 Bacteria 3563
159 Ga0070716_100399010 3300006173 Bacteria 988
160 Ga0070716_100442075 3300006173 Bacteria 946
161 Ga0070712_100029479 3300006175 Bacteria 3678
162 Ga0070712_100573429 3300006175 Bacteria 953
163 Ga0070712_100755187 3300006175 Bacteria 832
164 Ga0075362_10094934 3300006177 Bacteria 1388
165 Ga0075367_10089243 3300006178 Bacteria 1874
166 Ga0075367_10119054 3300006178 Bacteria 1626
167 Ga0075367_10151217 3300006178 Bacteria 1440
168 Ga0075367_10176008 3300006178 Bacteria 1333
169 Ga0075367_10384087 3300006178 Bacteria 887
170 Ga0075369_10065856 3300006186 Bacteria 1588
171 Ga0075369_10293403 3300006186 Bacteria 759
172 Ga0075369_10340714 3300006186 Bacteria 703
173 Ga0075366_10409780 3300006195 Bacteria 834
174 Ga0075366_10465306 3300006195 Bacteria 781
175 Ga0097621_100156156 3300006237 Bacteria 1958
176 Ga0097621_100273661 3300006237 Bacteria 1484
177 Ga0075370_10055472 3300006353 Bacteria 2251
178 Ga0075370_10105899 3300006353 Bacteria 1630
179 Ga0075370_10152099 3300006353 Bacteria 1356
180 Ga0075370_10477048 3300006353 Bacteria 752
181 Ga0068871_100235438 3300006358 Bacteria 1590
182 Ga0068871_100267565 3300006358 Bacteria 1493
183 Ga0068871_100349535 3300006358 Bacteria 1307
184 Ga0075428_100084451 3300006844 Bacteria 3464
185 Ga0075434_100395193 3300006871 Bacteria 1403
186 Ga0068865_100059062 3300006881 Bacteria 2681
187 Ga0068865_100122589 3300006881 Bacteria 1935
188 Ga0068865_100678081 3300006881 Bacteria 878
189 Ga0097620_100668134 3300006931 Bacteria 1130
190 Ga0097620_101197797 3300006931 Bacteria 836
191 Ga0099825_1032872 3300006941 Bacteria 2064
192 Ga0099824_1014525 3300006942 Bacteria 7787
193 Ga0099822_1005034 3300006943 Bacteria 17247
194 Ga0075435_100401054 3300007076 Bacteria 1179
195 Ga0099794_10029066 3300007265 Bacteria 2574
196 Ga0099794_10141477 3300007265 Bacteria 1218
197 Ga0099794_10148055 3300007265 Bacteria 1191
198 Ga0099795_10032744 3300007788 Bacteria 1800
199 Ga0105240_10030327 3300009093 Bacteria 7028
200 Ga0105240_10036581 3300009093 Bacteria 6313
201 Ga0105240_10141354 3300009093 Bacteria 2878
202 Ga0105240_11578733 3300009093 Bacteria 687
203 Ga0111539_10163191 3300009094 Bacteria 2606
204 Ga0111539_10255594 3300009094 Bacteria 2040
205 Ga0105245_10046675 3300009098 Bacteria 3871
206 Ga0105245_10801445 3300009098 Bacteria 980
207 Ga0105247_10036617 3300009101 Bacteria 2991
208 Ga0105247_10159250 3300009101 Bacteria 1493
209 Ga0105247_10206883 3300009101 Bacteria 1322
210 Ga0105247_10420080 3300009101 Bacteria 957
211 Ga0105243_10275580 3300009148 Bacteria 1513
212 Ga0105243_10420205 3300009148 Bacteria 1247
213 Ga0105243_10742634 3300009148 Bacteria 961
214 Ga0105241_10117846 3300009174 Bacteria 2134
215 Ga0105241_11096257 3300009174 Bacteria 749
216 Ga0105242_10195163 3300009176 Bacteria 1795
217 Ga0105242_10707278 3300009176 Bacteria 987
218 Ga0105242_10894335 3300009176 Bacteria 887
219 Ga0105248_10498772 3300009177 Bacteria 1372
220 Ga0105248_11061362 3300009177 Bacteria 915
221 Ga0105248_11700760 3300009177 Bacteria 715
222 Ga0105237_10066154 3300009545 Bacteria 3610
223 Ga0105237_10124394 3300009545 Bacteria 2574
224 Ga0105237_10770205 3300009545 Bacteria 969
225 Ga0105237_10885744 3300009545 Bacteria 899
226 Ga0105238_10008344 3300009551 Bacteria 10365
227 Ga0105249_10821648 3300009553 Bacteria 994
228 Ga0105249_11153238 3300009553 Bacteria 846
229 Ga0105249_11378852 3300009553 Bacteria 777
230 Ga0105249_12059108 3300009553 Bacteria 643
231 Ga0099796_10082966 3300010159 Bacteria 1178
232 Ga0099796_10091940 3300010159 Bacteria 1129
233 Ga0099796_10198341 3300010159 Bacteria 813
234 Ga0105239_10007487 3300010375 Bacteria 12527
235 Ga0105239_10165019 3300010375 Bacteria 2476
236 Ga0105246_10180621 3300011119 Bacteria 1624
237 Ga0157370_10081244 3300013104 Bacteria 3050
238 Ga0157370_10519025 3300013104 Bacteria 1093
239 Ga0157374_10131890 3300013296 Bacteria 2418
240 Ga0157378_10133193 3300013297 Bacteria 2303
241 Ga0157378_10140689 3300013297 Bacteria 2241
242 Ga0157378_10496294 3300013297 Bacteria 1219
243 Ga0157378_10697539 3300013297 Bacteria 1034
244 Ga0157378_10740440 3300013297 Bacteria 1005
245 Ga0157378_10798558 3300013297 Bacteria 969
246 Ga0163162_10561879 3300013306 Bacteria 1269
247 Ga0157372_10719819 3300013307 Bacteria 1161
248 Ga0157375_10281247 3300013308 Bacteria 1827
249 Ga0157375_10564644 3300013308 Bacteria 1299
250 Ga0157375_10595944 3300013308 Bacteria 1265
251 Ga0157375_10750967 3300013308 Bacteria 1127
252 Ga0163163_10069119 3300014325 Bacteria 3516
253 Ga0163163_10126403 3300014325 Bacteria 2595
254 Ga0157380_10586871 3300014326 Bacteria 1100
255 Ga0157380_10857288 3300014326 Bacteria 931
256 Ga0157377_10176996 3300014745 Bacteria 1338
257 Ga0157379_10018767 3300014968 Bacteria 6098
258 Ga0157379_10387674 3300014968 Bacteria 1283
259 Ga0157379_10562057 3300014968 Bacteria 1062
260 Ga0163161_10822778 3300017792 Bacteria 782
261 Ga0213873_10035460 3300021358 Bacteria 1262
262 Ga0213872_10194607 3300021361 Bacteria 871
263 Ga0213876_10096501 3300021384 Bacteria 1566
264 Ga0213876_10367531 3300021384 Bacteria 765
265 Ga0213871_10005944 3300021441 Bacteria 2552
266 Ga0209677_100642 3300025253 Bacteria 18518
267 Ga0209148_1015784 3300025254 Bacteria 1311
268 Ga0209233_1004646 3300025261 Bacteria 4640
269 Ga0209233_1009366 3300025261 Bacteria 2984
270 Ga0209455_1007059 3300025272 Bacteria 3224
271 Ga0209758_1036446 3300025297 Bacteria 1919
272 Ga0207426_1015827 3300025302 Bacteria 2727
273 Ga0207697_10261027 3300025315 Bacteria 767
274 Ga0207696_1022802 3300025711 Bacteria 1983
275 Ga0207713_1148801 3300025735 Bacteria 758
276 Ga0207653_10180814 3300025885 Bacteria 789
277 Ga0207692_10008094 3300025898 Bacteria 4339
278 Ga0207692_10123298 3300025898 Bacteria 1454
279 Ga0207710_10073815 3300025900 Bacteria 1569
280 Ga0207710_10135880 3300025900 Bacteria 1184
281 Ga0207710_10274996 3300025900 Bacteria 846
282 Ga0207688_10067411 3300025901 Bacteria 2025
283 Ga0207688_10260136 3300025901 Bacteria 1053
284 Ga0207688_10278162 3300025901 Bacteria 1019
285 Ga0207688_10314184 3300025901 Bacteria 960
286 Ga0207680_10377489 3300025903 Bacteria 999
287 Ga0207647_10001257 3300025904 Bacteria 19505
288 Ga0207647_10162990 3300025904 Bacteria 1300
289 Ga0207685_10019456 3300025905 Bacteria 2239
290 Ga0207685_10103387 3300025905 Bacteria 1222
291 Ga0207699_10014446 3300025906 Bacteria 4071
292 Ga0207645_10753394 3300025907 Bacteria 662
293 Ga0207643_10101886 3300025908 Bacteria 1684
294 Ga0207643_10113831 3300025908 Bacteria 1596
295 Ga0207684_10236553 3300025910 Bacteria 1576
296 Ga0207695_10054115 3300025913 Bacteria 4194
297 Ga0207695_10322828 3300025913 Bacteria 1433
298 Ga0207671_10034203 3300025914 Bacteria 3778
299 Ga0207671_10166650 3300025914 Bacteria 1709
300 Ga0207671_10466978 3300025914 Bacteria 1006
301 Ga0207693_10017003 3300025915 Bacteria 5807
302 Ga0207693_10097945 3300025915 Bacteria 2300
303 Ga0207693_10142022 3300025915 Bacteria 1888
304 Ga0207693_10162362 3300025915 Bacteria 1758
305 Ga0207693_10691375 3300025915 Bacteria 790
306 Ga0207663_10012346 3300025916 Bacteria 4617
307 Ga0207663_10124585 3300025916 Bacteria 1770
308 Ga0207663_10414156 3300025916 Bacteria 1033
309 Ga0207660_10465140 3300025917 Bacteria 1024
310 Ga0207662_10092971 3300025918 Bacteria 1858
311 Ga0207657_10167355 3300025919 Bacteria 1782
312 Ga0207649_10355527 3300025920 Bacteria 1085
313 Ga0207646_10141882 3300025922 Bacteria 2164
314 Ga0207681_10595647 3300025923 Bacteria 913
315 Ga0207694_10103075 3300025924 Bacteria 2262
316 Ga0207694_10219612 3300025924 Bacteria 1550
317 Ga0207694_10586258 3300025924 Bacteria 937
318 Ga0207650_10614695 3300025925 Bacteria 914
319 Ga0207687_10749336 3300025927 Bacteria 831
320 Ga0207700_10005365 3300025928 Bacteria 7655
321 Ga0207700_10109507 3300025928 Bacteria 2220
322 Ga0207700_10138887 3300025928 Bacteria 1994
323 Ga0207700_10324013 3300025928 Bacteria 1336
324 Ga0207664_10039186 3300025929 Bacteria 3678
325 Ga0207664_10048347 3300025929 Bacteria 3344
326 Ga0207664_10903405 3300025929 Bacteria 793
327 Ga0207644_10157199 3300025931 Bacteria 1764
328 Ga0207690_10647708 3300025932 Bacteria 865
329 Ga0207706_10119813 3300025933 Bacteria 2314
330 Ga0207706_10403780 3300025933 Bacteria 1184
331 Ga0207706_10470132 3300025933 Bacteria 1087
332 Ga0207706_10582197 3300025933 Bacteria 962
333 Ga0207686_10691379 3300025934 Bacteria 810
334 Ga0207686_10905074 3300025934 Bacteria 712
335 Ga0207709_10031008 3300025935 Bacteria 3117
336 Ga0207709_10632096 3300025935 Bacteria 851
337 Ga0207669_10060589 3300025937 Bacteria 2321
338 Ga0207669_10098745 3300025937 Bacteria 1923
339 Ga0207669_10129629 3300025937 Bacteria 1730
340 Ga0207669_10360764 3300025937 Bacteria 1126
341 Ga0207669_10859103 3300025937 Bacteria 756
342 Ga0207704_10598304 3300025938 Bacteria 902
343 Ga0207665_10226175 3300025939 Bacteria 1373
344 Ga0207691_10162587 3300025940 Bacteria 1958
345 Ga0207691_10344192 3300025940 Bacteria 1276
346 Ga0207711_10028488 3300025941 Bacteria 4699
347 Ga0207689_10120260 3300025942 Bacteria 2161
348 Ga0207689_10136439 3300025942 Bacteria 2020
349 Ga0207689_10362997 3300025942 Bacteria 1204
350 Ga0207679_10253509 3300025945 Bacteria 1497
351 Ga0207679_10348912 3300025945 Bacteria 1289
352 Ga0207667_10082489 3300025949 Bacteria 3330
353 Ga0207667_10396432 3300025949 Bacteria 1405
354 Ga0207667_10903591 3300025949 Bacteria 875
355 Ga0207712_10037317 3300025961 Bacteria 3315
356 Ga0207712_10080536 3300025961 Bacteria 2369
357 Ga0207712_10972498 3300025961 Bacteria 752
358 Ga0207668_10035131 3300025972 Bacteria 3334
359 Ga0207668_10142225 3300025972 Bacteria 1846
360 Ga0207668_10145956 3300025972 Bacteria 1825
361 Ga0207668_10453057 3300025972 Bacteria 1095
362 Ga0207640_10041115 3300025981 Bacteria 2938
363 Ga0207658_10191212 3300025986 Bacteria 1701
364 Ga0207658_10511636 3300025986 Bacteria 1071
365 Ga0207658_11009216 3300025986 Bacteria 759
366 Ga0207677_10124631 3300026023 Bacteria 1944
367 Ga0207677_10431955 3300026023 Bacteria 1124
368 Ga0207703_10240546 3300026035 Bacteria 1627
369 Ga0207703_11286334 3300026035 Bacteria 703
370 Ga0207639_10091983 3300026041 Bacteria 2430
371 Ga0207639_10345083 3300026041 Bacteria 1328
372 Ga0207639_10418683 3300026041 Bacteria 1211
373 Ga0207678_10032160 3300026067 Bacteria 4572
374 Ga0207678_10053178 3300026067 Bacteria 3491
375 Ga0207678_10253016 3300026067 Bacteria 1509
376 Ga0207708_10409201 3300026075 Bacteria 1123
377 Ga0207708_10727809 3300026075 Bacteria 850
378 Ga0207702_10005495 3300026078 Bacteria 11083
379 Ga0207702_10092121 3300026078 Bacteria 2656
380 Ga0207702_10174308 3300026078 Bacteria 1975
381 Ga0207702_10633658 3300026078 Bacteria 1051
382 Ga0207641_10025466 3300026088 Bacteria 4879
383 Ga0207648_10059634 3300026089 Bacteria 3328
384 Ga0207676_10196235 3300026095 Bacteria 1780
385 Ga0207676_10284766 3300026095 Bacteria 1502
386 Ga0207674_10091312 3300026116 Bacteria 3035
387 Ga0207675_100110100 3300026118 Bacteria 2599
388 Ga0207675_100147251 3300026118 Bacteria 2240
389 Ga0207675_100263571 3300026118 Bacteria 1671
390 Ga0207675_101345103 3300026118 Bacteria 735
391 Ga0207675_101692571 3300026118 Bacteria 652
392 Ga0207683_10055231 3300026121 Bacteria 3483
393 Ga0207683_10138242 3300026121 Bacteria 2194
394 Ga0207683_10506705 3300026121 Bacteria 1115
395 Ga0207683_11096467 3300026121 Bacteria 739
396 Ga0207698_10120875 3300026142 Bacteria 2216
397 Ga0207698_10211220 3300026142 Bacteria 1746
398 Ga0207698_10298222 3300026142 Bacteria 1499
399 Ga0209589_1000006 3300027357 Bacteria 436292
400 Ga0209489_100007 3300027361 Bacteria 436292
401 Ga0209700_100008 3300027363 Bacteria 436292
402 Ga0209813_10042489 3300027866 Bacteria 1389
403 Ga0207428_10291146 3300027907 Bacteria 1210
404 Ga0268266_10020468 3300028379 Bacteria 5638
405 Ga0268266_10080867 3300028379 Bacteria 2831
406 Ga0268266_10300834 3300028379 Bacteria 1496
407 Ga0268266_10316897 3300028379 Bacteria 1458
408 Ga0268266_10449676 3300028379 Bacteria 1224
409 Ga0268266_10667140 3300028379 Bacteria 1001
410 Ga0268265_10131809 3300028380 Bacteria 2078
411 Ga0268264_10000038 3300028381 Bacteria 383623
412 Ga0268264_10441281 3300028381 Bacteria 1259
413 Ga0268264_10554606 3300028381 Bacteria 1127
414 Ga0268264_11287691 3300028381 Bacteria 741
415 Ga0307517_10000085 3300028786 Bacteria 131200
416 Ga0307517_10261092 3300028786 Bacteria 1006
417 Ga0307515_10011214 3300028794 Bacteria 17023
418 Ga0307511_10213126 3300030521 Bacteria 982
419 Ga0265330_10037533 3300031235 Bacteria 2156
420 Ga0265332_10011292 3300031238 Bacteria 3971
421 Ga0307513_10238049 3300031456 Bacteria 1628
422 Ga0307513_10314383 3300031456 Bacteria 1327
423 Ga0307509_10097844 3300031507 Bacteria 2981
424 Ga0307509_10345403 3300031507 Bacteria 1214
425 Ga0307509_10523554 3300031507 Bacteria 866
426 Ga0307408_101032590 3300031548 Bacteria 759
427 Ga0307508_10000034 3300031616 Bacteria 160115
428 Ga0307508_10210415 3300031616 Bacteria 1545
429 Ga0307508_10452355 3300031616 Bacteria 877
430 Ga0265314_10004394 3300031711 Bacteria 13098
431 Ga0307516_10012741 3300031730 Bacteria 9038
432 Ga0307516_10032981 3300031730 Bacteria 5214
433 Ga0307516_10065038 3300031730 Bacteria 3524
434 Ga0307516_10252513 3300031730 Bacteria 1457
435 Ga0307405_10698883 3300031731 Bacteria 839
436 Ga0307410_10233930 3300031852 Bacteria 1420
437 Ga0307406_10101760 3300031901 Bacteria 1959
438 Ga0307406_10444783 3300031901 Bacteria 1038
439 Ga0307412_10213504 3300031911 Bacteria 1474
440 Ga0307409_100054772 3300031995 Bacteria 3074
441 Ga0307414_10374532 3300032004 Bacteria 1229
442 Ga0307411_10144349 3300032005 Bacteria 1759
443 Ga0307415_100150032 3300032126 Bacteria 1793
444 Ga0307415_100854509 3300032126 Bacteria 835
445 Ga0307507_10154469 3300033179 Bacteria 1715
446 Ga0307510_10003336 3300033180 Bacteria 18711
447 Ga0307510_10066449 3300033180 Bacteria 3641
448 Ga0307510_10084996 3300033180 Bacteria 3044
449 Ga0315911_1000010 3300033442 Bacteria 322197
450 Ga0373926_0117731 3300035083 Bacteria 1000
451 Ga0373934_0018370 3300035086 Bacteria 2674
452 Ga0373934_0023403 3300035086 Bacteria 2387
453 Ga0373934_0116398 3300035086 Bacteria 1086
454 Ga0373923_0002503 3300035111 Bacteria 5676
455 Ga0373936_0005856 3300035113 Bacteria 4630
456 Ga0373936_0012112 3300035113 Bacteria 3275
457 Ga0373936_0072403 3300035113 Bacteria 1423
458 Ga0373936_0097159 3300035113 Bacteria 1240
459 Ga0373936_0168920 3300035113 Bacteria 956
460 Ga0373936_0172971 3300035113 Bacteria 945
461 Ga0373945_0162233 3300035116 Bacteria 912
462 Ga0373953_0001969 3300035117 Bacteria 6108
463 Ga0373954_0005665 3300035118 Bacteria 5414
464 Ga0373954_0084697 3300035118 Bacteria 1517
465 Ga0373956_0095529 3300035119 Bacteria 1374
466 Ga0373957_0000736 3300035120 Bacteria 8502
467 Ga0373943_0003952 3300035170 Bacteria 6748
468 Ga0373943_0059547 3300035170 Bacteria 1904
469 Ga0373943_0140225 3300035170 Bacteria 1302
470 Ga0373946_0028442 3300035171 Bacteria 2218
471 Ga0373955_0005145 3300035172 Bacteria 5849
472 Ga0373955_0054932 3300035172 Bacteria 2179
473 Ga0373955_0122066 3300035172 Bacteria 1515
474 Ga0373961_0233487 3300035241 Bacteria 660
475 Ga0373924_0049264 3300035410 Bacteria 1743
476 Ga0373924_0095738 3300035410 Bacteria 1273
477 Ga0373931_0045962 3300035691 Bacteria 2307
478 Ga0373931_0388267 3300035691 Bacteria 881
479 Ga0373935_0000757 3300035692 Bacteria 17195
480 Ga0373935_0252555 3300035692 Bacteria 1234
481 Ga0373935_1033344 3300035692 Bacteria 611
482 Ga0373927_0001989 3300035695 Bacteria 15069
483 Ga0373927_0005694 3300035695 Bacteria 8555
484 Ga0373927_0110911 3300035695 Bacteria 1787
485 Ga0373927_0366000 3300035695 Bacteria 950
486 Ga0373933_0001305 3300035724 Bacteria 14682
487 Ga0373933_0024456 3300035724 Bacteria 3458
488 Ga0373933_0069371 3300035724 Bacteria 2142
489 Ga0373933_0359702 3300035724 Bacteria 946
490 Ga0373947_0008292 3300035725 Bacteria 5987
491 Ga0373947_0010080 3300035725 Bacteria 5424
492 Ga0373947_0137760 3300035725 Bacteria 1563
493 Ga0373947_0323315 3300035725 Bacteria 1032
494 Ga0373937_0036098 3300036401 Bacteria 4503
495 Ga0373937_0047886 3300036401 Bacteria 3911
496 Ga0373937_0460668 3300036401 Bacteria 1208
497 Ga0310109_024739 3300036534 Bacteria 805
498 Ga0373925_0002155 3300037068 Bacteria 16079
499 Ga0373925_0112186 3300037068 Bacteria 2108
500 Ga0373925_0245252 3300037068 Bacteria 1436
501 Ga0395900_0277762 3300037418 Bacteria 1668
502 Ga0395905_0417554 3300037471 Bacteria 1237
503 Ga0436364_0160837 3300037853 Bacteria 2904
504 Ga0395901_0264121 3300038443 Bacteria 1791
505 Ga0436365_0207937 3300039437 Bacteria 18457
506 Ga0436365_0526074 3300039437 Bacteria 1963
507 Ga0436365_0797860 3300039437 Bacteria 2322
508 Ga0436365_1353163 3300039437 Bacteria 1631
509 Ga0436360_0124501 3300039438 Bacteria 2440
510 Ga0436360_0223651 3300039438 Bacteria 1228
511 Ga0436360_0668865 3300039438 Bacteria 2351
512 Ga0436361_0550718 3300039447 Bacteria 2128
513 Ga0436361_0619086 3300039447 Bacteria 1844
514 Ga0436361_0737425 3300039447 Bacteria 3002
515 Ga0436363_0989765 3300039450 Bacteria 714
516 Ga0436362_0051863 3300039453 Bacteria 1655
517 Ga0436362_0128483 3300039453 Bacteria 4975
518 Ga0451791_0424928 3300041451 Bacteria 1289
519 Ga0451797_1273054 3300041453 Bacteria 886
520 Ga0451802_1317356 3300041460 Bacteria 826
521 Ga0451855_1672864 3300041511 Bacteria 736
522 Ga0466969_0460354 3300044656 Bacteria 579
523 Ga0466966_0326218 3300044684 Bacteria 922
524 Ga0466966_0405775 3300044684 Bacteria 819
525 Ga0466963_0310919 3300044694 Bacteria 1109
526 Ga0466963_0632677 3300044694 Bacteria 755
527 Ga0466964_0295022 3300044706 Bacteria 815
528 Ga0466968_0101836 3300044735 Bacteria 1283
529 Ga0466970_0188141 3300044765 Bacteria 1147
530 Ga0466959_0216038 3300045049 Bacteria 1331
531 Ga0466967_0274971 3300045976 Bacteria 1615
532 Ga0495617_034968 3300046452 Bacteria 1687
533 Ga0495627_098624 3300046453 Bacteria 836
534 Ga0495592_0027847 3300046454 Bacteria 4280
535 Ga0495592_0395414 3300046454 Bacteria 876
536 Ga0495592_0464859 3300046454 Bacteria 790
537 Ga0495603_0000064 3300046455 Bacteria 46716
538 Ga0495603_0019088 3300046455 Bacteria 4150
539 Ga0495603_0033019 3300046455 Bacteria 3114
540 Ga0495603_0034710 3300046455 Bacteria 3031
541 Ga0495603_0038842 3300046455 Bacteria 2853
542 Ga0495629_0004224 3300046459 Bacteria 10777
543 Ga0495629_0043875 3300046459 Bacteria 3139
544 Ga0495629_0090717 3300046459 Bacteria 2132
545 Ga0495629_0245663 3300046459 Bacteria 1232
546 Ga0495638_0072979 3300046460 Bacteria 2095
547 Ga0495638_0220774 3300046460 Bacteria 1059
548 Ga0495641_0020444 3300046461 Bacteria 3356
549 Ga0495641_0063503 3300046461 Bacteria 1664
550 Ga0495651_0021786 3300046462 Bacteria 4982
551 Ga0495651_0109822 3300046462 Bacteria 2041
552 Ga0495653_0003792 3300046463 Bacteria 12222
553 Ga0495653_0152036 3300046463 Bacteria 1616
554 Ga0495650_0146722 3300046471 Bacteria 850
555 Ga0495580_0002461 3300046472 Bacteria 16173
556 Ga0495580_0276473 3300046472 Bacteria 1146
557 Ga0495582_0000197 3300046473 Bacteria 33437
558 Ga0495582_0060111 3300046473 Bacteria 2097
559 Ga0495605_0156289 3300046474 Bacteria 1014
560 Ga0495605_0203257 3300046474 Bacteria 862
561 Ga0495639_0000218 3300046475 Bacteria 29492
562 Ga0495639_0131118 3300046475 Bacteria 1200
563 Ga0495639_0435893 3300046475 Bacteria 665
564 Ga0495639_0495160 3300046475 Bacteria 624
565 Ga0495662_0000732 3300046476 Bacteria 15694
566 Ga0495662_0122431 3300046476 Bacteria 1277
567 Ga0495664_0009846 3300046477 Bacteria 5359
568 Ga0495664_0045608 3300046477 Bacteria 2600
569 Ga0495664_0209359 3300046477 Bacteria 1181
570 Ga0495664_0331204 3300046477 Bacteria 918
571 Ga0495584_0201231 3300046491 Bacteria 1012
572 Ga0495584_0220792 3300046491 Bacteria 963
573 Ga0495584_0227339 3300046491 Bacteria 948
574 Ga0495594_0002513 3300046499 Bacteria 9558
575 Ga0495594_0051126 3300046499 Bacteria 2274
576 Ga0495583_0121704 3300046506 Bacteria 1098
577 Ga0495606_0000976 3300046507 Bacteria 41812
578 Ga0495606_0103261 3300046507 Bacteria 1732
579 Ga0495608_0006251 3300046511 Bacteria 8454
580 Ga0495608_0151565 3300046511 Bacteria 1477
581 Ga0495610_0106976 3300046512 Bacteria 1244
582 Ga0495616_0160909 3300046513 Bacteria 1010
583 Ga0495618_0085231 3300046514 Bacteria 2019
584 Ga0495620_0183965 3300046515 Bacteria 807
585 Ga0495628_0020250 3300046516 Bacteria 5491
586 Ga0495628_0036805 3300046516 Bacteria 3925
587 Ga0495628_0086580 3300046516 Bacteria 2429
588 Ga0495628_0319043 3300046516 Bacteria 1147
589 Ga0495630_0004218 3300046517 Bacteria 10069
590 Ga0495630_0139522 3300046517 Bacteria 1843
591 Ga0495631_0064932 3300046518 Bacteria 1580
592 Ga0495632_0120324 3300046519 Bacteria 1227
593 Ga0495632_0147885 3300046519 Bacteria 1087
594 Ga0495648_0001038 3300046524 Bacteria 28176
595 Ga0495666_0066999 3300046526 Bacteria 1711
596 Ga0495666_0267223 3300046526 Bacteria 777
597 Ga0495652_0111215 3300046529 Bacteria 2203
598 Ga0495652_0122095 3300046529 Bacteria 2075
599 Ga0495652_0129640 3300046529 Bacteria 1998
600 Ga0495652_0688806 3300046529 Bacteria 689
601 Ga0495665_0000531 3300046531 Bacteria 19287
602 Ga0495665_0125401 3300046531 Bacteria 1345
603 Ga0495640_0001572 3300046533 Bacteria 17991
604 Ga0495640_0055146 3300046533 Bacteria 2719
605 Ga0495640_0059939 3300046533 Bacteria 2590
606 Ga0495640_0264149 3300046533 Bacteria 1075
607 Ga0495640_0439086 3300046533 Bacteria 798
608 Ga0495586_0341001 3300046535 Bacteria 860
609 Ga0495587_0073220 3300046536 Bacteria 1990
610 Ga0495587_0142881 3300046536 Bacteria 1365
611 Ga0495587_0357461 3300046536 Bacteria 813
612 Ga0495598_0030150 3300046537 Bacteria 1517
613 Ga0495609_0055347 3300046538 Bacteria 1760
614 Ga0495645_0066733 3300046543 Bacteria 2599
615 Ga0495645_0189922 3300046543 Bacteria 1401
616 Ga0495622_0014503 3300046557 Bacteria 3659
617 Ga0495622_0067417 3300046557 Bacteria 1653
618 Ga0495622_0137244 3300046557 Bacteria 1111
619 Ga0495667_0036833 3300046559 Bacteria 3262
620 Ga0495667_0037334 3300046559 Bacteria 3238
621 Ga0495656_0025190 3300046615 Bacteria 2356
622 Ga0495656_0047390 3300046615 Bacteria 1822
623 Ga0495656_0141490 3300046615 Bacteria 1154
624 Ga0495668_0082544 3300046616 Bacteria 1763
625 Ga0495668_0111202 3300046616 Bacteria 1498
626 Ga0495668_0216782 3300046616 Bacteria 1048
627 Ga0495668_0360483 3300046616 Bacteria 798
628 Ga0495668_0492791 3300046616 Bacteria 675
629 Ga0495634_0032723 3300046642 Bacteria 3574
630 Ga0495634_0045928 3300046642 Bacteria 2950
631 Ga0495634_0382784 3300046642 Bacteria 838
632 Ga0495611_0163675 3300046648 Bacteria 1040
633 Ga0495611_0290356 3300046648 Bacteria 754
634 Ga0495625_0185670 3300046660 Bacteria 1380
635 Ga0495625_0214035 3300046660 Bacteria 1265
636 Ga0495625_0358749 3300046660 Bacteria 919
637 Ga0495625_0368236 3300046660 Bacteria 904
638 Ga0495635_0000356 3300046663 Bacteria 29094
639 Ga0495635_0009382 3300046663 Bacteria 6840
640 Ga0495635_0308362 3300046663 Bacteria 1061
641 Ga0495635_0522968 3300046663 Bacteria 779
642 Ga0495659_0074733 3300046664 Bacteria 1275
643 Ga0495588_0005017 3300046674 Bacteria 5877
644 Ga0495588_0129229 3300046674 Bacteria 1332
645 Ga0495657_0042456 3300046675 Bacteria 3104
646 Ga0495599_0008747 3300046678 Bacteria 6165
647 Ga0495599_0142463 3300046678 Bacteria 1487
648 Ga0495623_0102188 3300046679 Bacteria 1745
649 Ga0495646_0019745 3300046680 Bacteria 4261
650 Ga0495647_0038637 3300046681 Bacteria 1805
651 Ga0495647_0231668 3300046681 Bacteria 818
652 Ga0495658_0001357 3300046683 Bacteria 12840
653 Ga0495658_0171387 3300046683 Bacteria 1343
654 Ga0495658_0309361 3300046683 Bacteria 1000
655 Ga0495658_0616318 3300046683 Bacteria 695
656 Ga0495669_0141445 3300046684 Bacteria 1136
657 Ga0495669_0322155 3300046684 Bacteria 746
658 Ga0495613_0001784 3300046689 Bacteria 16356
659 Ga0495613_0027914 3300046689 Bacteria 4202
660 Ga0495624_0003608 3300046690 Bacteria 11462
661 Ga0495624_0402922 3300046690 Bacteria 821
662 Ga0495670_0238679 3300046691 Bacteria 967
663 Ga0495671_0031809 3300046692 Bacteria 2696
664 Ga0495671_0204737 3300046692 Bacteria 957
665 Ga0495589_0093356 3300046794 Bacteria 1461
666 Ga0495600_0028015 3300046809 Bacteria 3643
667 Ga0495581_0001121 3300047315 Bacteria 14654
668 Ga0495604_0024387 3300047317 Bacteria 4825
669 Ga0495604_0365405 3300047317 Bacteria 956
670 Ga0495636_0060684 3300047318 Bacteria 1598
671 Ga0495636_0394425 3300047318 Bacteria 658
672 Ga0495674_0000910 3300047319 Bacteria 28292
673 Ga0495674_0023623 3300047319 Bacteria 5662
674 Ga0495674_0312652 3300047319 Bacteria 1281
675 Ga0495672_0033942 3300047320 Bacteria 3157
676 Ga0495672_0194269 3300047320 Bacteria 1018
677 Ga0495680_0054687 3300047322 Bacteria 3098
678 Ga0495680_0058904 3300047322 Bacteria 2966
679 Ga0495680_0144985 3300047322 Bacteria 1735
680 Ga0495675_0009561 3300047444 Bacteria 6038
681 Ga0495675_0060330 3300047444 Bacteria 2404
682 Ga0495677_0034533 3300047445 Bacteria 1845
683 Ga0495677_0080280 3300047445 Bacteria 1222
684 Ga0495677_0145479 3300047445 Bacteria 911
685 Ga0495685_059848 3300047447 Bacteria 1285
686 Ga0495685_149195 3300047447 Bacteria 760
687 Ga0495673_0038103 3300047469 Bacteria 2190
688 Ga0495673_0094597 3300047469 Bacteria 1216
689 Ga0495681_0103225 3300047470 Bacteria 1244
690 Ga0495684_0001020 3300047471 Bacteria 22754
691 Ga0495684_0383689 3300047471 Bacteria 990
692 Ga0495593_0000053 3300047673 Bacteria 47697
693 Ga0495593_0007888 3300047673 Bacteria 6199
694 Ga0495593_0242344 3300047673 Bacteria 903
695 Ga0495602_0077062 3300048088 Bacteria 2822
696 Ga0495614_0180337 3300048089 Bacteria 950
697 Ga0495614_0203854 3300048089 Bacteria 896
698 Ga0496100_0060633 3300048903 Bacteria 2490
699 Ga0496100_0148326 3300048903 Bacteria 1670
700 Ga0496101_0090913 3300048904 Bacteria 2271
701 Ga0496102_0625952 3300048905 Bacteria 999
702 Ga0496102_0626103 3300048905 Bacteria 999
703 Ga0496102_0702912 3300048905 Bacteria 934
704 Ga0496102_0925518 3300048905 Bacteria 793
705 Ga0496102_0940500 3300048905 Bacteria 785
706 Ga0496103_0220729 3300048906 Bacteria 1219
707 Ga0496103_0255405 3300048906 Bacteria 1128
708 Ga0496103_0306827 3300048906 Bacteria 1021
709 Ga0496104_0368281 3300048907 Bacteria 1349
710 Ga0496104_0424482 3300048907 Bacteria 1241
711 Ga0496104_0677574 3300048907 Bacteria 939
712 Ga0496105_0057058 3300048908 Bacteria 3224
713 Ga0496105_0415518 3300048908 Bacteria 1066
714 Ga0496105_0495984 3300048908 Bacteria 959
715 Ga0496106_0050763 3300048909 Bacteria 3126
716 Ga0496106_0054025 3300048909 Bacteria 3034
717 Ga0496106_0280571 3300048909 Bacteria 1335
718 Ga0496106_0349821 3300048909 Bacteria 1187
719 Ga0496106_0801556 3300048909 Bacteria 747
720 Ga0496107_0108637 3300048910 Bacteria 2037
721 Ga0496107_0369921 3300048910 Bacteria 1066
722 Ga0496107_0966489 3300048910 Bacteria 619
723 Ga0496108_0043253 3300048911 Bacteria 3763
724 Ga0496108_0634035 3300048911 Bacteria 930
725 Ga0496108_0786655 3300048911 Bacteria 821
726 Ga0496109_0052114 3300048912 Bacteria 3729
727 Ga0496109_0368697 3300048912 Bacteria 1356
728 Ga0496109_1271712 3300048912 Bacteria 672
729 Ga0496110_0425738 3300048913 Bacteria 1210
730 Ga0496110_0439236 3300048913 Bacteria 1189
731 Ga0496110_0563044 3300048913 Bacteria 1035
732 Ga0496111_0254025 3300048914 Bacteria 1304
733 Ga0496111_0672150 3300048914 Bacteria 755
734 Ga0496112_0000008 3300048915 Bacteria 310323
735 Ga0496112_0017278 3300048915 Bacteria 6774
736 Ga0496112_0552225 3300048915 Bacteria 1085
737 Ga0496112_0921247 3300048915 Bacteria 795
738 Ga0496113_0108920 3300048916 Bacteria 2154
739 Ga0496113_0118535 3300048916 Bacteria 2067
740 Ga0496113_0346479 3300048916 Bacteria 1191
741 Ga0496114_0036626 3300048917 Bacteria 4055
742 Ga0496115_0047118 3300048918 Bacteria 3446
743 Ga0496115_0054879 3300048918 Bacteria 3200
744 Ga0496117_0025346 3300048920 Bacteria 4665
745 Ga0496117_0224367 3300048920 Bacteria 1043
746 Ga0496118_0018656 3300048921 Bacteria 6238
747 Ga0496118_0137994 3300048921 Bacteria 1552
748 Ga0496118_0179292 3300048921 Bacteria 1282
749 Ga0496118_0220837 3300048921 Bacteria 1103
750 Ga0496118_0383114 3300048921 Bacteria 737
751 Ga0496119_0052904 3300048922 Bacteria 2484
752 Ga0496119_0088159 3300048922 Bacteria 1770
753 Ga0496120_0163118 3300048923 Bacteria 1109
754 Ga0496121_0000178 3300048924 Bacteria 141429
755 Ga0496121_0000381 3300048924 Bacteria 90593
756 Ga0496121_0001606 3300048924 Bacteria 37522
757 Ga0496121_0065155 3300048924 Bacteria 2966
758 Ga0496121_0074199 3300048924 Bacteria 2723
759 Ga0496121_0094181 3300048924 Bacteria 2331
760 Ga0496121_0122575 3300048924 Bacteria 1960
761 Ga0496121_0144549 3300048924 Bacteria 1759
762 Ga0496121_0251455 3300048924 Bacteria 1225
763 Ga0496121_0438888 3300048924 Bacteria 844
764 Ga0496121_0448240 3300048924 Bacteria 832
765 Ga0496121_0455858 3300048924 Bacteria 823
766 Ga0496123_0311933 3300048926 Bacteria 746
767 Ga0496124_0057960 3300048927 Bacteria 3260
768 Ga0496124_0227694 3300048927 Bacteria 1396
769 Ga0496125_0172081 3300048928 Bacteria 1454
770 Ga0496126_0072513 3300048929 Bacteria 3063
771 Ga0496126_0135415 3300048929 Bacteria 2125
772 Ga0496126_0145644 3300048929 Bacteria 2034
773 Ga0496126_0169885 3300048929 Bacteria 1858
774 Ga0496126_0180012 3300048929 Bacteria 1796
775 Ga0496126_0218646 3300048929 Bacteria 1601
776 Ga0496126_0507847 3300048929 Bacteria 962
777 Ga0496126_0512153 3300048929 Bacteria 957
778 Ga0495678_169183 3300049459 Bacteria 693
779 Ga0495682_0207520 3300049460 Bacteria 694
780 Ga0501033_0058655 3300049570 Bacteria 2843
781 Ga0501034_0907848 3300049571 Bacteria 768
782 Ga0501036_0658356 3300049572 Bacteria 867
783 Ga0501039_0800798 3300049575 Bacteria 735
784 Ga0501043_0062269 3300049579 Bacteria 2929
785 Ga0501046_0116454 3300049580 Bacteria 2037
786 Ga0501070_0071621 3300049586 Bacteria 2870
787 Ga0501073_0282758 3300049589 Bacteria 1145
788 Ga0501075_0940531 3300049591 Bacteria 657
789 Ga0501076_0942825 3300049592 Bacteria 711
790 Ga0501035_0205489 3300049822 Bacteria 1687
791 Ga0501044_0056597 3300049823 Bacteria 4026
792 Ga0501044_0433402 3300049823 Bacteria 1223
793 nmdc:mga03683_190444_c1 3300050489 Bacteria 938
794 nmdc:mga03683_26098_c1 3300050489 Bacteria 2302
795 nmdc:mga03n38_77539_c1 3300050490 Bacteria 1553
796 nmdc:mga00v17_150838_c1 3300050491 Bacteria 1494
797 nmdc:mga00v17_464079_c1 3300050491 Bacteria 822
798 nmdc:mga00v17_651583_c1 3300050491 Bacteria 677
799 nmdc:mga0yw44_28665_c1 3300050492 Bacteria 3206
800 nmdc:mga0yw44_95359_c1 3300050492 Bacteria 1887
801 nmdc:mga0k408_192270_c1 3300050493 Bacteria 1218
802 nmdc:mga0k408_199632_c1 3300050493 Bacteria 1194
803 nmdc:mga0k408_302495_c1 3300050493 Bacteria 955
804 nmdc:mga0k408_562543_c1 3300050493 Bacteria 674
805 nmdc:mga06z11_180894_c1 3300050494 Bacteria 1216
806 nmdc:mga06z11_26727_c1 3300050494 Bacteria 2750
807 nmdc:mga04h51_50942_c1 3300050495 Bacteria 1389
808 nmdc:mga07m45_134023_c1 3300050496 Bacteria 1434
809 nmdc:mga07m45_40462_c1 3300050496 Bacteria 2608
810 nmdc:mga07m45_40483_c1 3300050496 Bacteria 2607
811 nmdc:mga07m45_496790_c1 3300050496 Bacteria 706
812 nmdc:mga07m45_536427_c1 3300050496 Bacteria 677
813 nmdc:mga05p37_284592_c1 3300050507 Bacteria 1970
814 nmdc:mga09592_1025960_c1 3300050508 Bacteria 688
815 nmdc:mga0qj67_179462_c1 3300050509 Bacteria 1719
816 nmdc:mga08y16_82751_c1 3300050511 Bacteria 3346
817 nmdc:mga0n895_730985_c1 3300050512 Bacteria 984
818 nmdc:mga0rr50_219099_c1 3300050513 Bacteria 1571
819 nmdc:mga0sz30_65860_c1 3300050516 Bacteria 1554
820 Ga0495601_0085617 3300053077 Bacteria 2025
821 Ga0495601_0231351 3300053077 Bacteria 1207
822 Ga0500635_0016572 3300053080 Bacteria 2194
823 Ga0500635_0049093 3300053080 Bacteria 1439
824 Ga0500635_0268516 3300053080 Bacteria 671
825 Ga0495655_0027175 3300053083 Bacteria 1355
826 Ga0495655_0066725 3300053083 Bacteria 996
827 Ga0495655_0116550 3300053083 Bacteria 809
828 Ga0495595_0006351 3300053084 Bacteria 4815
829 Ga0495595_0120918 3300053084 Bacteria 1275
830 Ga0495619_0004452 3300053085 Bacteria 8941
831 Ga0495619_0024318 3300053085 Bacteria 3884
832 Ga0500643_079256 3300053087 Bacteria 904
833 Ga0500651_0030081 3300053093 Bacteria 3415
834 Ga0500651_0226076 3300053093 Bacteria 1096
835 Ga0500651_0424996 3300053093 Bacteria 743
836 Ga0500566_0000008 3300053094 Bacteria 143641
837 Ga0500566_0042489 3300053094 Bacteria 2622
838 Ga0500566_0151274 3300053094 Bacteria 1220
839 Ga0500640_005945 3300053095 Bacteria 4612
840 Ga0500641_0017543 3300053096 Bacteria 2679
841 Ga0500641_0019512 3300053096 Bacteria 2564
842 Ga0500641_0055829 3300053096 Bacteria 1635
843 Ga0500650_0363481 3300053098 Bacteria 631
844 Ga0500554_016759 3300053102 Bacteria 1944
845 Ga0500556_0035598 3300053104 Bacteria 1721
846 Ga0500572_001569 3300053111 Bacteria 6087
847 Ga0500572_002289 3300053111 Bacteria 4637
848 Ga0500591_110620 3300053115 Bacteria 1152
849 Ga0500594_0042046 3300053118 Bacteria 1254
850 Ga0500595_001022 3300053119 Bacteria 15703
851 Ga0500595_001796 3300053119 Bacteria 11140
852 Ga0500595_022869 3300053119 Bacteria 2204
853 Ga0500595_129974 3300053119 Bacteria 709
854 Ga0500597_217313 3300053120 Bacteria 796
855 Ga0500608_013208 3300053122 Bacteria 3653
856 Ga0500642_0009310 3300053130 Bacteria 3404
857 Ga0500655_034038 3300053133 Bacteria 987
858 Ga0500559_0001443 3300053136 Bacteria 13494
859 Ga0500559_0002991 3300053136 Bacteria 8472
860 Ga0500559_0170543 3300053136 Bacteria 1023
861 Ga0500561_0088660 3300053137 Bacteria 912
862 Ga0500577_0045825 3300053142 Bacteria 1618
863 Ga0500588_0076954 3300053146 Bacteria 1108
864 Ga0500588_0283379 3300053146 Bacteria 626
865 Ga0500589_052332 3300053147 Bacteria 1891
866 Ga0500589_136364 3300053147 Bacteria 1018
867 Ga0500590_062564 3300053148 Bacteria 1867
868 Ga0500603_001477 3300053150 Bacteria 5364
869 Ga0500603_001591 3300053150 Bacteria 5129
870 Ga0500603_126041 3300053150 Bacteria 779
871 Ga0500616_0227389 3300053153 Bacteria 810
872 Ga0500627_0197623 3300053158 Bacteria 902
873 Ga0500630_032400 3300053159 Bacteria 2566
874 Ga0500638_000896 3300053162 Bacteria 8428
875 Ga0500638_127630 3300053162 Bacteria 1157
876 Ga0500639_000010 3300053163 Bacteria 136747
877 Ga0500639_011164 3300053163 Bacteria 4712
878 Ga0500639_096015 3300053163 Bacteria 1468
879 Ga0500636_0194460 3300053177 Bacteria 1078
880 Ga0500636_0328676 3300053177 Bacteria 739
881 Ga0500637_0041226 3300053178 Bacteria 2609
882 Ga0500637_0068610 3300053178 Bacteria 2037
883 Ga0500637_0306450 3300053178 Bacteria 863
884 Ga0500576_038374 3300053725 Bacteria 2162
885 Ga0500596_001566 3300053735 Bacteria 4640
886 Ga0500596_001917 3300053735 Bacteria 4173
887 Ga0500661_001842 3300055283 Bacteria 4003
888 2509147153 2508501128 Bacteria 8613869
889 2513654945 2513237096 Bacteria 8722461
890 2513671135 2513237098 Bacteria 9902361
891 2513697349 2513237101 Bacteria 7952346
892 2513861259 2513237137 Bacteria 9558895
893 2513916032 2513237145 Bacteria 8979722
894 2517894664 2517572143 Bacteria 9484767
895 2524464004 2524023210 Bacteria 9029266
896 2524534404 2524023228 Bacteria 10118060
897 2671119086 2667528175 Bacteria 7532676
898 2723843155 2721755755 Bacteria 8322773
899 2728747677 2728368998 Bacteria 8720350
900 2793071134 2791355197 Bacteria 8420563
901 2824618957 2824617872 Bacteria 8814715
902 2824627523 2824626560 Bacteria 8813858
903 2824638848 2824635225 Bacteria 8785348
904 2824647650 2824644064 Bacteria 8743947
905 2824716461 2824714736 Bacteria 8717648
906 2824726407 2824723954 Bacteria 8758240
907 2874612513 2874604998 Bacteria 7834745
908 2885382418 2885374607 Bacteria 8927485
909 2885389047 2885383462 Bacteria 9473874
910 2903757852 2903748898 Bacteria 9972761
911 2903773578 2903768456 Bacteria 9749579
912 2904697002 2904690495 Bacteria 9412302
913 2904705697
914 2906611391
915 2906641571 2906635258 Bacteria 8601019
916 2906661275 2906660503 Bacteria 8595048
917 2908744977 2908739725 Bacteria 8628932
918 2908762730 2908756301 Bacteria 8864324
919 2922427977
920 2935632105 2935630451 Bacteria 8169952
921 2941508053 2941507105 Bacteria 8166816
922 2941515442 2941515067 Bacteria 8166720
923 2941523983 2941523033 Bacteria 8169134
924 3005477684 3005474847 Bacteria 9259049
925 8006933534 8006933436 Bacteria 10410654
926 8006983207 8006973647 Bacteria 10679141
927 8006989279 8006984368 Bacteria 9651211
928 8006997756 8006994254 Bacteria 8309700
929 8019559458 8019555841 Bacteria 9642137
930 8019569560 8019565922 Bacteria 9639779
931 8019693989 8019687851 Bacteria 8712826
932 8056695092 8056689827 Bacteria 6712655
933 Ga0099794_10223694
934 JGI24739J22299_10012951
935 JGI24737J22298_10016177
936 JGI24735J21928_10016953
937 JGI24742J22300_10012308
938 JGI25406J46586_10000721
939 JGI25406J46586_10008215
940 JGI25406J46586_10017054
941 JGI25153J46596_10000738
942 rootH2_10077708
943 JGI25160J50197_1029660
944 JGI25404J52841_10015813
945 JGI25404J52841_10047108
946 JGI25405J52794_10061750
947 Ga0065165_1009382
948 Ga0070658_10562246
949 Ga0070676_10212565
950 Ga0070683_100017126
951 Ga0070683_100521531
952 Ga0070690_100647479
953 Ga0068869_100064859
954 Ga0068869_100381851
955 Ga0070680_100061117
956 Ga0068868_100130295
957 Ga0068868_100137064
958 Ga0068868_100747279
959 Ga0070660_100884856
960 Ga0070689_100504881
961 Ga0070691_10055133
962 Ga0070687_100189376
963 Ga0070661_100205620
964 Ga0070668_100050535
965 Ga0070668_100152569
966 Ga0070669_100236187
967 Ga0070671_100160005
968 Ga0070671_100501845
969 Ga0070674_100062001
970 Ga0070688_100109774
971 Ga0070688_100172809
972 Ga0070659_100251243
973 Ga0070659_100383741
974 Ga0070659_100668052
975 Ga0070667_101255141
976 Ga0070703_10198342
977 Ga0070709_10001764
978 Ga0070709_10153975
979 Ga0070714_100051653
980 Ga0070714_100547529
981 Ga0070713_100061144
982 Ga0070713_100211833
983 Ga0070713_100228238
984 Ga0070713_100378511
985 Ga0070713_100835486
986 Ga0070710_10001695
987 Ga0070710_10527186
988 Ga0070711_100020703
989 Ga0070711_100044852
990 Ga0070711_100712389
991 Ga0070711_100773988
992 Ga0070708_101169909
993 Ga0070663_100018549
994 Ga0070663_100053867
995 Ga0070663_100685201
996 Ga0070678_100198168
997 Ga0070678_100371820
998 Ga0070678_100383583
999 Ga0070662_100050768
1000 Ga0070662_100190683
1001 Ga0070662_100483100
1002 Ga0070681_10463553
1003 Ga0068867_100111788
1004 Ga0068867_100349335
1005 Ga0070706_100129052
1006 Ga0070706_100260542
1007 Ga0070707_100119818
1008 Ga0070698_100197239
1009 Ga0070698_100617451
1010 Ga0070697_100238054
1011 Ga0068853_100097793
1012 Ga0068853_100262428
1013 Ga0068853_101018183
1014 Ga0070672_100109452
1015 Ga0070672_100154769
1016 Ga0070686_100356428
1017 Ga0070695_100094980
1018 Ga0070695_100542236
1019 Ga0070696_100473956
1020 Ga0070665_100088043
1021 Ga0070665_100174517
1022 Ga0070665_100701082
1023 Ga0070704_100583576
1024 Ga0070704_100666847
1025 Ga0068855_100050191
1026 Ga0068855_100053959
1027 Ga0068855_100508206
1028 Ga0068855_100531771
1029 Ga0070664_100432562
1030 Ga0068857_100014952
1031 Ga0068857_100165432
1032 Ga0068857_100548812
1033 Ga0068854_100021501
1034 Ga0068854_100364401
1035 Ga0068854_101195812
1036 Ga0068856_100002538
1037 Ga0068856_100100529
1038 Ga0068856_100289594
1039 Ga0068856_100444122
1040 Ga0068852_100008462
1041 Ga0068852_100660284
1042 Ga0068852_100757318
1043 Ga0068852_100782486
1044 Ga0068859_100668110
1045 Ga0068859_101197883
1046 Ga0068864_100128028
1047 Ga0068864_100556159
1048 Ga0068864_100748175
1049 Ga0068866_10046902
1050 Ga0068861_100030335
1051 Ga0068861_100046881
1052 Ga0068861_100572507
1053 Ga0068870_10242840
1054 Ga0068863_100243895
1055 Ga0068863_100394052
1056 Ga0068858_100239469
1057 Ga0068858_100420222
1058 Ga0068858_100766265
1059 Ga0068860_100000533
1060 Ga0068860_100134467
1061 Ga0068862_100265752
1062 Ga0068862_100569862
1063 Ga0081455_10070768
1064 Ga0081455_10380199
1065 Ga0081540_1002213
1066 Ga0081540_1005827
1067 Ga0081540_1012712
1068 Ga0081540_1017590
1069 Ga0081540_1024174
1070 Ga0081540_1025572
1071 Ga0081540_1052500
1072 Ga0081539_10000748
1073 Ga0081539_10001829
1074 Ga0070717_10133966
1075 Ga0070717_10257705
1076 Ga0075365_10027753
1077 Ga0075365_10039617
1078 Ga0075365_10126465
1079 Ga0075365_10296614
1080 Ga0075365_10358222
1081 Ga0075365_10479718
1082 Ga0075368_10020977
1083 Ga0075368_10030204
1084 Ga0075363_100023427
1085 Ga0075363_100052487
1086 Ga0075363_100448932
1087 Ga0075364_10281885
1088 Ga0075432_10127059
1089 Ga0070715_10001014
1090 Ga0070716_100019284
1091 Ga0070716_100399010
1092 Ga0070716_100442075
1093 Ga0070712_100029479
1094 Ga0070712_100573429
1095 Ga0070712_100755187
1096 Ga0075362_10094934
1097 Ga0075367_10089243
1098 Ga0075367_10119054
1099 Ga0075367_10151217
1100 Ga0075367_10176008
1101 Ga0075367_10384087
1102 Ga0075369_10065856
1103 Ga0075369_10293403
1104 Ga0075369_10340714
1105 Ga0075366_10409780
1106 Ga0075366_10465306
1107 Ga0097621_100156156
1108 Ga0097621_100273661
1109 Ga0075370_10055472
1110 Ga0075370_10105899
1111 Ga0075370_10152099
1112 Ga0075370_10477048
1113 Ga0068871_100235438
1114 Ga0068871_100267565
1115 Ga0068871_100349535
1116 Ga0075428_100084451
1117 Ga0075434_100395193
1118 Ga0068865_100059062
1119 Ga0068865_100122589
1120 Ga0068865_100678081
1121 Ga0097620_100668134
1122 Ga0097620_101197797
1123 Ga0099825_1032872
1124 Ga0099824_1014525
1125 Ga0099822_1005034
1126 Ga0075435_100401054
1127 Ga0099794_10029066
1128 Ga0099794_10141477
1129 Ga0099794_10148055
1130 Ga0099795_10032744
1131 Ga0105240_10030327
1132 Ga0105240_10036581
1133 Ga0105240_10141354
1134 Ga0105240_11578733
1135 Ga0111539_10163191
1136 Ga0111539_10255594
1137 Ga0105245_10046675
1138 Ga0105245_10801445
1139 Ga0105247_10036617
1140 Ga0105247_10159250
1141 Ga0105247_10206883
1142 Ga0105247_10420080
1143 Ga0105243_10275580
1144 Ga0105243_10420205
1145 Ga0105243_10742634
1146 Ga0105241_10117846
1147 Ga0105241_11096257
1148 Ga0105242_10195163
1149 Ga0105242_10707278
1150 Ga0105242_10894335
1151 Ga0105248_10498772
1152 Ga0105248_11061362
1153 Ga0105248_11700760
1154 Ga0105237_10066154
1155 Ga0105237_10124394
1156 Ga0105237_10770205
1157 Ga0105237_10885744
1158 Ga0105238_10008344
1159 Ga0105249_10821648
1160 Ga0105249_11153238
1161 Ga0105249_11378852
1162 Ga0105249_12059108
1163 Ga0099796_10082966
1164 Ga0099796_10091940
1165 Ga0099796_10198341
1166 Ga0105239_10007487
1167 Ga0105239_10165019
1168 Ga0105246_10180621
1169 Ga0157370_10081244
1170 Ga0157370_10519025
1171 Ga0157374_10131890
1172 Ga0157378_10133193
1173 Ga0157378_10140689
1174 Ga0157378_10496294
1175 Ga0157378_10697539
1176 Ga0157378_10740440
1177 Ga0157378_10798558
1178 Ga0163162_10561879
1179 Ga0157372_10719819
1180 Ga0157375_10281247
1181 Ga0157375_10564644
1182 Ga0157375_10595944
1183 Ga0157375_10750967
1184 Ga0163163_10069119
1185 Ga0163163_10126403
1186 Ga0157380_10586871
1187 Ga0157380_10857288
1188 Ga0157377_10176996
1189 Ga0157379_10018767
1190 Ga0157379_10387674
1191 Ga0157379_10562057
1192 Ga0163161_10822778
1193 Ga0213873_10035460
1194 Ga0213872_10194607
1195 Ga0213876_10096501
1196 Ga0213876_10367531
1197 Ga0213871_10005944
1198 Ga0209677_100642
1199 Ga0209148_1015784
1200 Ga0209233_1004646
1201 Ga0209233_1009366
1202 Ga0209455_1007059
1203 Ga0209758_1036446
1204 Ga0207426_1015827
1205 Ga0207697_10261027
1206 Ga0207696_1022802
1207 Ga0207713_1148801
1208 Ga0207653_10180814
1209 Ga0207692_10008094
1210 Ga0207692_10123298
1211 Ga0207710_10073815
1212 Ga0207710_10135880
1213 Ga0207710_10274996
1214 Ga0207688_10067411
1215 Ga0207688_10260136
1216 Ga0207688_10278162
1217 Ga0207688_10314184
1218 Ga0207680_10377489
1219 Ga0207647_10001257
1220 Ga0207647_10162990
1221 Ga0207685_10019456
1222 Ga0207685_10103387
1223 Ga0207699_10014446
1224 Ga0207645_10753394
1225 Ga0207643_10101886
1226 Ga0207643_10113831
1227 Ga0207684_10236553
1228 Ga0207695_10054115
1229 Ga0207695_10322828
1230 Ga0207671_10034203
1231 Ga0207671_10166650
1232 Ga0207671_10466978
1233 Ga0207693_10017003
1234 Ga0207693_10097945
1235 Ga0207693_10142022
1236 Ga0207693_10162362
1237 Ga0207693_10691375
1238 Ga0207663_10012346
1239 Ga0207663_10124585
1240 Ga0207663_10414156
1241 Ga0207660_10465140
1242 Ga0207662_10092971
1243 Ga0207657_10167355
1244 Ga0207649_10355527
1245 Ga0207646_10141882
1246 Ga0207681_10595647
1247 Ga0207694_10103075
1248 Ga0207694_10219612
1249 Ga0207694_10586258
1250 Ga0207650_10614695
1251 Ga0207687_10749336
1252 Ga0207700_10005365
1253 Ga0207700_10109507
1254 Ga0207700_10138887
1255 Ga0207700_10324013
1256 Ga0207664_10039186
1257 Ga0207664_10048347
1258 Ga0207664_10903405
1259 Ga0207644_10157199
1260 Ga0207690_10647708
1261 Ga0207706_10119813
1262 Ga0207706_10403780
1263 Ga0207706_10470132
1264 Ga0207706_10582197
1265 Ga0207686_10691379
1266 Ga0207686_10905074
1267 Ga0207709_10031008
1268 Ga0207709_10632096
1269 Ga0207669_10060589
1270 Ga0207669_10098745
1271 Ga0207669_10129629
1272 Ga0207669_10360764
1273 Ga0207669_10859103
1274 Ga0207704_10598304
1275 Ga0207665_10226175
1276 Ga0207691_10162587
1277 Ga0207691_10344192
1278 Ga0207711_10028488
1279 Ga0207689_10120260
1280 Ga0207689_10136439
1281 Ga0207689_10362997
1282 Ga0207679_10253509
1283 Ga0207679_10348912
1284 Ga0207667_10082489
1285 Ga0207667_10396432
1286 Ga0207667_10903591
1287 Ga0207712_10037317
1288 Ga0207712_10080536
1289 Ga0207712_10972498
1290 Ga0207668_10035131
1291 Ga0207668_10142225
1292 Ga0207668_10145956
1293 Ga0207668_10453057
1294 Ga0207640_10041115
1295 Ga0207658_10191212
1296 Ga0207658_10511636
1297 Ga0207658_11009216
1298 Ga0207677_10124631
1299 Ga0207677_10431955
1300 Ga0207703_10240546
1301 Ga0207703_11286334
1302 Ga0207639_10091983
1303 Ga0207639_10345083
1304 Ga0207639_10418683
1305 Ga0207678_10032160
1306 Ga0207678_10053178
1307 Ga0207678_10253016
1308 Ga0207708_10409201
1309 Ga0207708_10727809
1310 Ga0207702_10005495
1311 Ga0207702_10092121
1312 Ga0207702_10174308
1313 Ga0207702_10633658
1314 Ga0207641_10025466
1315 Ga0207648_10059634
1316 Ga0207676_10196235
1317 Ga0207676_10284766
1318 Ga0207674_10091312
1319 Ga0207675_100110100
1320 Ga0207675_100147251
1321 Ga0207675_100263571
1322 Ga0207675_101345103
1323 Ga0207675_101692571
1324 Ga0207683_10055231
1325 Ga0207683_10138242
1326 Ga0207683_10506705
1327 Ga0207683_11096467
1328 Ga0207698_10120875
1329 Ga0207698_10211220
1330 Ga0207698_10298222
1331 Ga0209589_1000006
1332 Ga0209489_100007
1333 Ga0209700_100008
1334 Ga0209813_10042489
1335 Ga0207428_10291146
1336 Ga0268266_10020468
1337 Ga0268266_10080867
1338 Ga0268266_10300834
1339 Ga0268266_10316897
1340 Ga0268266_10449676
1341 Ga0268266_10667140
1342 Ga0268265_10131809
1343 Ga0268264_10000038
1344 Ga0268264_10441281
1345 Ga0268264_10554606
1346 Ga0268264_11287691
1347 Ga0307517_10000085
1348 Ga0307517_10261092
1349 Ga0307515_10011214
1350 Ga0307511_10213126
1351 Ga0265330_10037533
1352 Ga0265332_10011292
1353 Ga0307513_10238049
1354 Ga0307513_10314383
1355 Ga0307509_10097844
1356 Ga0307509_10345403
1357 Ga0307509_10523554
1358 Ga0307408_101032590
1359 Ga0307508_10000034
1360 Ga0307508_10210415
1361 Ga0307508_10452355
1362 Ga0265314_10004394
1363 Ga0307516_10012741
1364 Ga0307516_10032981
1365 Ga0307516_10065038
1366 Ga0307516_10252513
1367 Ga0307405_10698883
1368 Ga0307410_10233930
1369 Ga0307406_10101760
1370 Ga0307406_10444783
1371 Ga0307412_10213504
1372 Ga0307409_100054772
1373 Ga0307414_10374532
1374 Ga0307411_10144349
1375 Ga0307415_100150032
1376 Ga0307415_100854509
1377 Ga0307507_10154469
1378 Ga0307510_10003336
1379 Ga0307510_10066449
1380 Ga0307510_10084996
1381 Ga0315911_1000010
1382 Ga0373926_0117731
1383 Ga0373934_0018370
1384 Ga0373934_0023403
1385 Ga0373934_0116398
1386 Ga0373923_0002503
1387 Ga0373936_0005856
1388 Ga0373936_0012112
1389 Ga0373936_0072403
1390 Ga0373936_0097159
1391 Ga0373936_0168920
1392 Ga0373936_0172971
1393 Ga0373945_0162233
1394 Ga0373953_0001969
1395 Ga0373954_0005665
1396 Ga0373954_0084697
1397 Ga0373956_0095529
1398 Ga0373957_0000736
1399 Ga0373943_0003952
1400 Ga0373943_0059547
1401 Ga0373943_0140225
1402 Ga0373946_0028442
1403 Ga0373955_0005145
1404 Ga0373955_0054932
1405 Ga0373955_0122066
1406 Ga0373961_0233487
1407 Ga0373924_0049264
1408 Ga0373924_0095738
1409 Ga0373931_0045962
1410 Ga0373931_0388267
1411 Ga0373935_0000757
1412 Ga0373935_0252555
1413 Ga0373935_1033344
1414 Ga0373927_0001989
1415 Ga0373927_0005694
1416 Ga0373927_0110911
1417 Ga0373927_0366000
1418 Ga0373933_0001305
1419 Ga0373933_0024456
1420 Ga0373933_0069371
1421 Ga0373933_0359702
1422 Ga0373947_0008292
1423 Ga0373947_0010080
1424 Ga0373947_0137760
1425 Ga0373947_0323315
1426 Ga0373937_0036098
1427 Ga0373937_0047886
1428 Ga0373937_0460668
1429 Ga0310109_024739
1430 Ga0373925_0002155
1431 Ga0373925_0112186
1432 Ga0373925_0245252
1433 Ga0395900_0277762
1434 Ga0395905_0417554
1435 Ga0436364_0160837
1436 Ga0395901_0264121
1437 Ga0436365_0207937
1438 Ga0436365_0526074
1439 Ga0436365_0797860
1440 Ga0436365_1353163
1441 Ga0436360_0124501
1442 Ga0436360_0223651
1443 Ga0436360_0668865
1444 Ga0436361_0550718
1445 Ga0436361_0619086
1446 Ga0436361_0737425
1447 Ga0436363_0989765
1448 Ga0436362_0051863
1449 Ga0436362_0128483
1450 Ga0451791_0424928
1451 Ga0451797_1273054
1452 Ga0451802_1317356
1453 Ga0451855_1672864
1454 Ga0466969_0460354
1455 Ga0466966_0326218
1456 Ga0466966_0405775
1457 Ga0466963_0310919
1458 Ga0466963_0632677
1459 Ga0466964_0295022
1460 Ga0466968_0101836
1461 Ga0466970_0188141
1462 Ga0466959_0216038
1463 Ga0466967_0274971
1464 Ga0495617_034968
1465 Ga0495627_098624
1466 Ga0495592_0027847
1467 Ga0495592_0395414
1468 Ga0495592_0464859
1469 Ga0495603_0000064
1470 Ga0495603_0019088
1471 Ga0495603_0033019
1472 Ga0495603_0034710
1473 Ga0495603_0038842
1474 Ga0495629_0004224
1475 Ga0495629_0043875
1476 Ga0495629_0090717
1477 Ga0495629_0245663
1478 Ga0495638_0072979
1479 Ga0495638_0220774
1480 Ga0495641_0020444
1481 Ga0495641_0063503
1482 Ga0495651_0021786
1483 Ga0495651_0109822
1484 Ga0495653_0003792
1485 Ga0495653_0152036
1486 Ga0495650_0146722
1487 Ga0495580_0002461
1488 Ga0495580_0276473
1489 Ga0495582_0000197
1490 Ga0495582_0060111
1491 Ga0495605_0156289
1492 Ga0495605_0203257
1493 Ga0495639_0000218
1494 Ga0495639_0131118
1495 Ga0495639_0435893
1496 Ga0495639_0495160
1497 Ga0495662_0000732
1498 Ga0495662_0122431
1499 Ga0495664_0009846
1500 Ga0495664_0045608
1501 Ga0495664_0209359
1502 Ga0495664_0331204
1503 Ga0495584_0201231
1504 Ga0495584_0220792
1505 Ga0495584_0227339
1506 Ga0495594_0002513
1507 Ga0495594_0051126
1508 Ga0495583_0121704
1509 Ga0495606_0000976
1510 Ga0495606_0103261
1511 Ga0495608_0006251
1512 Ga0495608_0151565
1513 Ga0495610_0106976
1514 Ga0495616_0160909
1515 Ga0495618_0085231
1516 Ga0495620_0183965
1517 Ga0495628_0020250
1518 Ga0495628_0036805
1519 Ga0495628_0086580
1520 Ga0495628_0319043
1521 Ga0495630_0004218
1522 Ga0495630_0139522
1523 Ga0495631_0064932
1524 Ga0495632_0120324
1525 Ga0495632_0147885
1526 Ga0495648_0001038
1527 Ga0495666_0066999
1528 Ga0495666_0267223
1529 Ga0495652_0111215
1530 Ga0495652_0122095
1531 Ga0495652_0129640
1532 Ga0495652_0688806
1533 Ga0495665_0000531
1534 Ga0495665_0125401
1535 Ga0495640_0001572
1536 Ga0495640_0055146
1537 Ga0495640_0059939
1538 Ga0495640_0264149
1539 Ga0495640_0439086
1540 Ga0495586_0341001
1541 Ga0495587_0073220
1542 Ga0495587_0142881
1543 Ga0495587_0357461
1544 Ga0495598_0030150
1545 Ga0495609_0055347
1546 Ga0495645_0066733
1547 Ga0495645_0189922
1548 Ga0495622_0014503
1549 Ga0495622_0067417
1550 Ga0495622_0137244
1551 Ga0495667_0036833
1552 Ga0495667_0037334
1553 Ga0495656_0025190
1554 Ga0495656_0047390
1555 Ga0495656_0141490
1556 Ga0495668_0082544
1557 Ga0495668_0111202
1558 Ga0495668_0216782
1559 Ga0495668_0360483
1560 Ga0495668_0492791
1561 Ga0495634_0032723
1562 Ga0495634_0045928
1563 Ga0495634_0382784
1564 Ga0495611_0163675
1565 Ga0495611_0290356
1566 Ga0495625_0185670
1567 Ga0495625_0214035
1568 Ga0495625_0358749
1569 Ga0495625_0368236
1570 Ga0495635_0000356
1571 Ga0495635_0009382
1572 Ga0495635_0308362
1573 Ga0495635_0522968
1574 Ga0495659_0074733
1575 Ga0495588_0005017
1576 Ga0495588_0129229
1577 Ga0495657_0042456
1578 Ga0495599_0008747
1579 Ga0495599_0142463
1580 Ga0495623_0102188
1581 Ga0495646_0019745
1582 Ga0495647_0038637
1583 Ga0495647_0231668
1584 Ga0495658_0001357
1585 Ga0495658_0171387
1586 Ga0495658_0309361
1587 Ga0495658_0616318
1588 Ga0495669_0141445
1589 Ga0495669_0322155
1590 Ga0495613_0001784
1591 Ga0495613_0027914
1592 Ga0495624_0003608
1593 Ga0495624_0402922
1594 Ga0495670_0238679
1595 Ga0495671_0031809
1596 Ga0495671_0204737
1597 Ga0495589_0093356
1598 Ga0495600_0028015
1599 Ga0495581_0001121
1600 Ga0495604_0024387
1601 Ga0495604_0365405
1602 Ga0495636_0060684
1603 Ga0495636_0394425
1604 Ga0495674_0000910
1605 Ga0495674_0023623
1606 Ga0495674_0312652
1607 Ga0495672_0033942
1608 Ga0495672_0194269
1609 Ga0495680_0054687
1610 Ga0495680_0058904
1611 Ga0495680_0144985
1612 Ga0495675_0009561
1613 Ga0495675_0060330
1614 Ga0495677_0034533
1615 Ga0495677_0080280
1616 Ga0495677_0145479
1617 Ga0495685_059848
1618 Ga0495685_149195
1619 Ga0495673_0038103
1620 Ga0495673_0094597
1621 Ga0495681_0103225
1622 Ga0495684_0001020
1623 Ga0495684_0383689
1624 Ga0495593_0000053
1625 Ga0495593_0007888
1626 Ga0495593_0242344
1627 Ga0495602_0077062
1628 Ga0495614_0180337
1629 Ga0495614_0203854
1630 Ga0496100_0060633
1631 Ga0496100_0148326
1632 Ga0496101_0090913
1633 Ga0496102_0625952
1634 Ga0496102_0626103
1635 Ga0496102_0702912
1636 Ga0496102_0925518
1637 Ga0496102_0940500
1638 Ga0496103_0220729
1639 Ga0496103_0255405
1640 Ga0496103_0306827
1641 Ga0496104_0368281
1642 Ga0496104_0424482
1643 Ga0496104_0677574
1644 Ga0496105_0057058
1645 Ga0496105_0415518
1646 Ga0496105_0495984
1647 Ga0496106_0050763
1648 Ga0496106_0054025
1649 Ga0496106_0280571
1650 Ga0496106_0349821
1651 Ga0496106_0801556
1652 Ga0496107_0108637
1653 Ga0496107_0369921
1654 Ga0496107_0966489
1655 Ga0496108_0043253
1656 Ga0496108_0634035
1657 Ga0496108_0786655
1658 Ga0496109_0052114
1659 Ga0496109_0368697
1660 Ga0496109_1271712
1661 Ga0496110_0425738
1662 Ga0496110_0439236
1663 Ga0496110_0563044
1664 Ga0496111_0254025
1665 Ga0496111_0672150
1666 Ga0496112_0000008
1667 Ga0496112_0017278
1668 Ga0496112_0552225
1669 Ga0496112_0921247
1670 Ga0496113_0108920
1671 Ga0496113_0118535
1672 Ga0496113_0346479
1673 Ga0496114_0036626
1674 Ga0496115_0047118
1675 Ga0496115_0054879
1676 Ga0496117_0025346
1677 Ga0496117_0224367
1678 Ga0496118_0018656
1679 Ga0496118_0137994
1680 Ga0496118_0179292
1681 Ga0496118_0220837
1682 Ga0496118_0383114
1683 Ga0496119_0052904
1684 Ga0496119_0088159
1685 Ga0496120_0163118
1686 Ga0496121_0000178
1687 Ga0496121_0000381
1688 Ga0496121_0001606
1689 Ga0496121_0065155
1690 Ga0496121_0074199
1691 Ga0496121_0094181
1692 Ga0496121_0122575
1693 Ga0496121_0144549
1694 Ga0496121_0251455
1695 Ga0496121_0438888
1696 Ga0496121_0448240
1697 Ga0496121_0455858
1698 Ga0496123_0311933
1699 Ga0496124_0057960
1700 Ga0496124_0227694
1701 Ga0496125_0172081
1702 Ga0496126_0072513
1703 Ga0496126_0135415
1704 Ga0496126_0145644
1705 Ga0496126_0169885
1706 Ga0496126_0180012
1707 Ga0496126_0218646
1708 Ga0496126_0507847
1709 Ga0496126_0512153
1710 Ga0495678_169183
1711 Ga0495682_0207520
1712 Ga0501033_0058655
1713 Ga0501034_0907848
1714 Ga0501036_0658356
1715 Ga0501039_0800798
1716 Ga0501043_0062269
1717 Ga0501046_0116454
1718 Ga0501070_0071621
1719 Ga0501073_0282758
1720 Ga0501075_0940531
1721 Ga0501076_0942825
1722 Ga0501035_0205489
1723 Ga0501044_0056597
1724 Ga0501044_0433402
1725 nmdc:mga03683_190444_c1
1726 nmdc:mga03683_26098_c1
1727 nmdc:mga03n38_77539_c1
1728 nmdc:mga00v17_150838_c1
1729 nmdc:mga00v17_464079_c1
1730 nmdc:mga00v17_651583_c1
1731 nmdc:mga0yw44_28665_c1
1732 nmdc:mga0yw44_95359_c1
1733 nmdc:mga0k408_192270_c1
1734 nmdc:mga0k408_199632_c1
1735 nmdc:mga0k408_302495_c1
1736 nmdc:mga0k408_562543_c1
1737 nmdc:mga06z11_180894_c1
1738 nmdc:mga06z11_26727_c1
1739 nmdc:mga04h51_50942_c1
1740 nmdc:mga07m45_134023_c1
1741 nmdc:mga07m45_40462_c1
1742 nmdc:mga07m45_40483_c1
1743 nmdc:mga07m45_496790_c1
1744 nmdc:mga07m45_536427_c1
1745 nmdc:mga05p37_284592_c1
1746 nmdc:mga09592_1025960_c1
1747 nmdc:mga0qj67_179462_c1
1748 nmdc:mga08y16_82751_c1
1749 nmdc:mga0n895_730985_c1
1750 nmdc:mga0rr50_219099_c1
1751 nmdc:mga0sz30_65860_c1
1752 Ga0495601_0085617
1753 Ga0495601_0231351
1754 Ga0500635_0016572
1755 Ga0500635_0049093
1756 Ga0500635_0268516
1757 Ga0495655_0027175
1758 Ga0495655_0066725
1759 Ga0495655_0116550
1760 Ga0495595_0006351
1761 Ga0495595_0120918
1762 Ga0495619_0004452
1763 Ga0495619_0024318
1764 Ga0500643_079256
1765 Ga0500651_0030081
1766 Ga0500651_0226076
1767 Ga0500651_0424996
1768 Ga0500566_0000008
1769 Ga0500566_0042489
1770 Ga0500566_0151274
1771 Ga0500640_005945
1772 Ga0500641_0017543
1773 Ga0500641_0019512
1774 Ga0500641_0055829
1775 Ga0500650_0363481
1776 Ga0500554_016759
1777 Ga0500556_0035598
1778 Ga0500572_001569
1779 Ga0500572_002289
1780 Ga0500591_110620
1781 Ga0500594_0042046
1782 Ga0500595_001022
1783 Ga0500595_001796
1784 Ga0500595_022869
1785 Ga0500595_129974
1786 Ga0500597_217313
1787 Ga0500608_013208
1788 Ga0500642_0009310
1789 Ga0500655_034038
1790 Ga0500559_0001443
1791 Ga0500559_0002991
1792 Ga0500559_0170543
1793 Ga0500561_0088660
1794 Ga0500577_0045825
1795 Ga0500588_0076954
1796 Ga0500588_0283379
1797 Ga0500589_052332
1798 Ga0500589_136364
1799 Ga0500590_062564
1800 Ga0500603_001477
1801 Ga0500603_001591
1802 Ga0500603_126041
1803 Ga0500616_0227389
1804 Ga0500627_0197623
1805 Ga0500630_032400
1806 Ga0500638_000896
1807 Ga0500638_127630
1808 Ga0500639_000010
1809 Ga0500639_011164
1810 Ga0500639_096015
1811 Ga0500636_0194460
1812 Ga0500636_0328676
1813 Ga0500637_0041226
1814 Ga0500637_0068610
1815 Ga0500637_0306450
1816 Ga0500576_038374
1817 Ga0500596_001566
1818 Ga0500596_001917
1819 Ga0500661_001842
1820 2509147153
1821 2513654945
1822 2513671135
1823 2513697349
1824 2513861259
1825 2513916032
1826 2517894664
1827 2524464004
1828 2524534404
1829 2671119086
1830 2723843155
1831 2728747677
1832 2793071134
1833 2824618957
1834 2824627523
1835 2824638848
1836 2824647650
1837 2824716461
1838 2824726407
1839 2874612513
1840 2885382418
1841 2885389047
1842 2903757852
1843 2903773578
1844 2904697002
1845 2904705697
1846 2906611391
1847 2906641571
1848 2906661275
1849 2908744977
1850 2908762730
1851 2922427977
1852 2935632105
1853 2941508053
1854 2941515442
1855 2941523983
1856 3005477684
1857 8006933534
1858 8006983207
1859 8006989279
1860 8006997756
1861 8019559458
1862 8019569560
1863 8019693989
1864 8056695092

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

23

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.3366 9 173
7dz8-assembly1.cif.gz_L state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii 0.3352 9 144
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.3142 9 173
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.3133 8 174
5wk6-assembly1.cif.gz_A cryo-em structure of p. aeruginosa flagellar filaments g420a 0.2971 11 173
ID Description Score Start End Superfamily
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5213 8 179 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4991 8 179 1.20.1250.20
af_Q9SVE7_354_513_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4086 4 174 1.20.1250.20
af_A0A0R4IF99_149_314_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.3447 34 141 3.30.40.10
af_Q9SVE7_354_513_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3445 4 174 1.20.1250.20
ID Description Score Start End GO Terms
AF-S6GG24-F1-model_v4 Uncharacterized protein 0.666 4 177 GO:0005886
GO:0015171
GO:0033228
AF-A0A3A0EYW3-F1-model_v4 Lysine transporter LysE 0.664 2 180 GO:0005886
GO:0015171
GO:0033228
AF-A0A7Y2NIA6-F1-model_v4 LysE family translocator 0.6576 1 177 GO:0005886
GO:0015171
GO:0033228
AF-A0A3A0EYW3-F1-model_v4 Lysine transporter LysE 0.6568 2 180 GO:0005886
GO:0015171
GO:0033228
AF-A0A258GJJ8-F1-model_v4 Lysine transporter LysE 0.6534 1 178 GO:0005886
GO:0015171
GO:0033228

Map