F486555

General Info

Members Datasets Scaffolds Average Seq Length
950 279 1900 145

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10547816|Ga0207657_105478162
Length 172
Sequence MTSPIRIAVKRLPHGGDLPLPAYATAGAAGMDVVAAESMTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLALKHGVTCLNSPGTIDHDYRGEVKVILANLGSEPFEVRRGERIAQLVPAKVQRAVFRMVEALGETSRGAGGFGARRVAVRLGNRIHPAVDFGKRKTKSFCA

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
164 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
194 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
247 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
248 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
254 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
255 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
256 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
279 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 6.84
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10547816 3300025919 Bacteria 905
2 JGI24740J21852_10017541 3300001979 Bacteria 2557
3 JGI24739J22299_10003057 3300001989 Bacteria 6392
4 JGI24743J22301_10021352 3300001991 Bacteria 1237
5 JGI24735J21928_10105016 3300002067 Bacteria 812
6 JGI24738J21930_10008075 3300002075 Bacteria 2404
7 Ga0065715_10143523 3300005293 Bacteria 1801
8 Ga0065715_10168109 3300005293 Bacteria 1569
9 Ga0065707_10275148 3300005295 Bacteria 1061
10 Ga0070658_10037425 3300005327 Bacteria 3912
11 Ga0070658_10056377 3300005327 Bacteria 3193
12 Ga0070658_10060592 3300005327 Bacteria 3082
13 Ga0070676_10009830 3300005328 Bacteria 5174
14 Ga0070676_10022190 3300005328 Bacteria 3559
15 Ga0070683_100213149 3300005329 Bacteria 1835
16 Ga0070690_100006137 3300005330 Bacteria 6803
17 Ga0070690_100044293 3300005330 Bacteria 2823
18 Ga0070690_100982737 3300005330 Bacteria 664
19 Ga0070670_100000422 3300005331 Bacteria 34896
20 Ga0070670_100010702 3300005331 Bacteria 7838
21 Ga0070670_100150995 3300005331 Bacteria 2010
22 Ga0070670_100233467 3300005331 Bacteria 1601
23 Ga0070670_100311703 3300005331 Bacteria 1377
24 Ga0070670_100923842 3300005331 Bacteria 792
25 Ga0070677_10040988 3300005333 Bacteria 1825
26 Ga0070677_10095244 3300005333 Bacteria 1302
27 Ga0070677_10111083 3300005333 Bacteria 1224
28 Ga0070677_10291910 3300005333 Bacteria 825
29 Ga0068869_100294418 3300005334 Bacteria 1309
30 Ga0070666_10003753 3300005335 Bacteria 9210
31 Ga0070666_10033600 3300005335 Bacteria 3394
32 Ga0070666_10074162 3300005335 Bacteria 2319
33 Ga0070666_10245672 3300005335 Bacteria 1266
34 Ga0070666_10340228 3300005335 Bacteria 1072
35 Ga0070666_10795059 3300005335 Bacteria 696
36 Ga0070680_100007616 3300005336 Bacteria 8259
37 Ga0070680_100011389 3300005336 Bacteria 6878
38 Ga0070680_100070587 3300005336 Bacteria 2869
39 Ga0068868_100005396 3300005338 Bacteria 8983
40 Ga0068868_100010219 3300005338 Bacteria 6785
41 Ga0068868_100012749 3300005338 Bacteria 6148
42 Ga0068868_100124481 3300005338 Bacteria 2105
43 Ga0068868_100790367 3300005338 Bacteria 855
44 Ga0070660_100009796 3300005339 Bacteria 6753
45 Ga0070660_100009867 3300005339 Bacteria 6734
46 Ga0070660_100060630 3300005339 Bacteria 2936
47 Ga0070660_100108474 3300005339 Bacteria 2207
48 Ga0070660_100443960 3300005339 Bacteria 1076
49 Ga0070660_100540030 3300005339 Bacteria 972
50 Ga0070687_100180099 3300005343 Bacteria 1265
51 Ga0070687_100612416 3300005343 Bacteria 750
52 Ga0070661_100020625 3300005344 Bacteria 4701
53 Ga0070661_100033855 3300005344 Bacteria 3703
54 Ga0070661_100053645 3300005344 Bacteria 2951
55 Ga0070661_100104009 3300005344 Bacteria 2115
56 Ga0070661_100105836 3300005344 Bacteria 2097
57 Ga0070661_100219069 3300005344 Bacteria 1459
58 Ga0070661_100337172 3300005344 Bacteria 1180
59 Ga0070661_101083967 3300005344 Bacteria 667
60 Ga0070661_101531436 3300005344 Bacteria 563
61 Ga0070668_100002704 3300005347 Bacteria 13047
62 Ga0070668_100038187 3300005347 Bacteria 3670
63 Ga0070668_100352913 3300005347 Bacteria 1245
64 Ga0070669_100015582 3300005353 Bacteria 5421
65 Ga0070669_100317722 3300005353 Bacteria 1257
66 Ga0070669_100574920 3300005353 Bacteria 942
67 Ga0070669_101095637 3300005353 Bacteria 686
68 Ga0070675_100029170 3300005354 Bacteria 4447
69 Ga0070671_100007797 3300005355 Bacteria 8552
70 Ga0070671_100011351 3300005355 Bacteria 7161
71 Ga0070671_100040246 3300005355 Bacteria 3881
72 Ga0070671_100045261 3300005355 Bacteria 3658
73 Ga0070671_100087300 3300005355 Bacteria 2610
74 Ga0070671_100100459 3300005355 Bacteria 2427
75 Ga0070671_100116211 3300005355 Bacteria 2249
76 Ga0070671_100557512 3300005355 Bacteria 988
77 Ga0070671_100597904 3300005355 Bacteria 953
78 Ga0070671_100768712 3300005355 Bacteria 838
79 Ga0070674_100014017 3300005356 Bacteria 4974
80 Ga0070674_100020505 3300005356 Bacteria 4226
81 Ga0070674_100195151 3300005356 Bacteria 1559
82 Ga0070674_100276558 3300005356 Bacteria 1329
83 Ga0070673_100006202 3300005364 Bacteria 7756
84 Ga0070673_100031587 3300005364 Bacteria 3976
85 Ga0070673_100064254 3300005364 Bacteria 2924
86 Ga0070673_100150484 3300005364 Bacteria 1971
87 Ga0070673_100198678 3300005364 Bacteria 1726
88 Ga0070673_100762361 3300005364 Bacteria 892
89 Ga0070688_100182597 3300005365 Bacteria 1456
90 Ga0070688_101299859 3300005365 Bacteria 587
91 Ga0070659_100002296 3300005366 Bacteria 13620
92 Ga0070659_100003071 3300005366 Bacteria 11854
93 Ga0070659_100006920 3300005366 Bacteria 8212
94 Ga0070659_100023078 3300005366 Bacteria 4756
95 Ga0070659_100032025 3300005366 Bacteria 4076
96 Ga0070659_100085541 3300005366 Bacteria 2522
97 Ga0070659_100114391 3300005366 Bacteria 2180
98 Ga0070659_100115886 3300005366 Bacteria 2166
99 Ga0070659_100542845 3300005366 Bacteria 995
100 Ga0070659_100571895 3300005366 Bacteria 969
101 Ga0070667_100028151 3300005367 Bacteria 4677
102 Ga0070667_100053722 3300005367 Bacteria 3400
103 Ga0070667_100094029 3300005367 Bacteria 2582
104 Ga0070667_100236677 3300005367 Bacteria 1629
105 Ga0070714_100610550 3300005435 Bacteria 1048
106 Ga0070713_100032063 3300005436 Bacteria 4193
107 Ga0070710_10648184 3300005437 Bacteria 740
108 Ga0070701_10703057 3300005438 Bacteria 680
109 Ga0070705_100225896 3300005440 Bacteria 1299
110 Ga0070705_100738182 3300005440 Bacteria 777
111 Ga0070694_100013067 3300005444 Bacteria 5180
112 Ga0070663_100133616 3300005455 Bacteria 1887
113 Ga0070663_100217064 3300005455 Bacteria 1500
114 Ga0070663_100296658 3300005455 Bacteria 1292
115 Ga0070663_100600956 3300005455 Bacteria 925
116 Ga0070663_100670306 3300005455 Bacteria 879
117 Ga0070678_100010627 3300005456 Bacteria 5635
118 Ga0070678_100119256 3300005456 Bacteria 2078
119 Ga0070678_100372241 3300005456 Bacteria 1234
120 Ga0070678_100551888 3300005456 Bacteria 1023
121 Ga0070662_100003862 3300005457 Bacteria 9391
122 Ga0070662_100008396 3300005457 Bacteria 6732
123 Ga0070662_100023620 3300005457 Bacteria 4225
124 Ga0070662_100028000 3300005457 Bacteria 3919
125 Ga0070662_100039765 3300005457 Bacteria 3346
126 Ga0070662_100078125 3300005457 Bacteria 2458
127 Ga0070662_100118623 3300005457 Bacteria 2026
128 Ga0070662_100141998 3300005457 Bacteria 1862
129 Ga0070662_100458428 3300005457 Bacteria 1059
130 Ga0070662_100789606 3300005457 Bacteria 807
131 Ga0070681_10305780 3300005458 Bacteria 1499
132 Ga0070681_10650687 3300005458 Bacteria 969
133 Ga0070681_11247947 3300005458 Bacteria 665
134 Ga0068867_100006878 3300005459 Bacteria 8047
135 Ga0068867_100011417 3300005459 Bacteria 6268
136 Ga0068867_100024318 3300005459 Bacteria 4339
137 Ga0068867_100042370 3300005459 Bacteria 3330
138 Ga0070706_100593957 3300005467 Bacteria 1029
139 Ga0070679_100032585 3300005530 Bacteria 5156
140 Ga0070679_100099721 3300005530 Bacteria 2891
141 Ga0070679_100173561 3300005530 Bacteria 2128
142 Ga0070679_101371381 3300005530 Bacteria 653
143 Ga0070684_100658509 3300005535 Bacteria 975
144 Ga0070684_101208576 3300005535 Bacteria 711
145 Ga0068853_100002073 3300005539 Bacteria 14876
146 Ga0068853_100041674 3300005539 Bacteria 3924
147 Ga0068853_100069252 3300005539 Bacteria 3069
148 Ga0068853_100073897 3300005539 Bacteria 2973
149 Ga0068853_100188864 3300005539 Bacteria 1871
150 Ga0068853_100317755 3300005539 Bacteria 1443
151 Ga0068853_100379270 3300005539 Bacteria 1320
152 Ga0068853_100651007 3300005539 Bacteria 1003
153 Ga0068853_100787482 3300005539 Bacteria 910
154 Ga0068853_101076828 3300005539 Bacteria 775
155 Ga0070672_100001205 3300005543 Bacteria 15828
156 Ga0070672_100003228 3300005543 Bacteria 10553
157 Ga0070672_100026673 3300005543 Bacteria 4303
158 Ga0070672_100080169 3300005543 Bacteria 2615
159 Ga0070672_100400668 3300005543 Bacteria 1176
160 Ga0070672_100418486 3300005543 Bacteria 1151
161 Ga0070672_100490250 3300005543 Bacteria 1062
162 Ga0070686_100131357 3300005544 Bacteria 1732
163 Ga0070695_100076509 3300005545 Bacteria 2204
164 Ga0070696_100008688 3300005546 Bacteria 6797
165 Ga0070696_100063300 3300005546 Bacteria 2591
166 Ga0070696_100374670 3300005546 Bacteria 1108
167 Ga0070693_100201369 3300005547 Bacteria 1293
168 Ga0070693_100418605 3300005547 Bacteria 933
169 Ga0070665_100010036 3300005548 Bacteria 9579
170 Ga0070665_100022327 3300005548 Bacteria 6368
171 Ga0070665_100053158 3300005548 Bacteria 4062
172 Ga0070665_100056010 3300005548 Bacteria 3954
173 Ga0070665_100077800 3300005548 Bacteria 3323
174 Ga0070665_100173993 3300005548 Bacteria 2153
175 Ga0070665_100364337 3300005548 Bacteria 1452
176 Ga0070665_100833972 3300005548 Bacteria 935
177 Ga0070665_101672632 3300005548 Bacteria 644
178 Ga0070665_101692720 3300005548 Bacteria 640
179 Ga0068855_100195366 3300005563 Bacteria 2280
180 Ga0068855_100414026 3300005563 Bacteria 1475
181 Ga0068855_100452920 3300005563 Bacteria 1400
182 Ga0068855_100748951 3300005563 Bacteria 1042
183 Ga0068855_100753911 3300005563 Bacteria 1038
184 Ga0068855_101848394 3300005563 Bacteria 613
185 Ga0070664_100006896 3300005564 Bacteria 9156
186 Ga0070664_100010345 3300005564 Bacteria 7568
187 Ga0070664_100047667 3300005564 Bacteria 3620
188 Ga0070664_100053286 3300005564 Bacteria 3429
189 Ga0070664_100062931 3300005564 Bacteria 3163
190 Ga0070664_100074207 3300005564 Bacteria 2919
191 Ga0070664_100111078 3300005564 Bacteria 2393
192 Ga0068857_100017039 3300005577 Bacteria 6364
193 Ga0068857_100173929 3300005577 Bacteria 1958
194 Ga0068857_100216443 3300005577 Bacteria 1749
195 Ga0068857_100248155 3300005577 Bacteria 1631
196 Ga0068854_100051739 3300005578 Bacteria 2943
197 Ga0068854_100061346 3300005578 Bacteria 2723
198 Ga0068854_100147543 3300005578 Bacteria 1811
199 Ga0068854_100190166 3300005578 Bacteria 1608
200 Ga0068854_100316800 3300005578 Bacteria 1266
201 Ga0068854_101180639 3300005578 Bacteria 685
202 Ga0068856_100054455 3300005614 Bacteria 3945
203 Ga0068856_100134605 3300005614 Bacteria 2477
204 Ga0068856_100177682 3300005614 Bacteria 2141
205 Ga0068856_100252998 3300005614 Bacteria 1777
206 Ga0068856_100620569 3300005614 Bacteria 1102
207 Ga0068852_100000701 3300005616 Bacteria 21899
208 Ga0068852_100108180 3300005616 Bacteria 2523
209 Ga0068852_100147106 3300005616 Bacteria 2187
210 Ga0068852_100253667 3300005616 Bacteria 1686
211 Ga0068852_100335310 3300005616 Bacteria 1473
212 Ga0068852_100474239 3300005616 Bacteria 1242
213 Ga0068852_100504636 3300005616 Bacteria 1205
214 Ga0068852_100886628 3300005616 Bacteria 909
215 Ga0068852_101240763 3300005616 Bacteria 767
216 Ga0068859_100168708 3300005617 Bacteria 2269
217 Ga0068859_100284459 3300005617 Bacteria 1746
218 Ga0068864_100013739 3300005618 Bacteria 6717
219 Ga0068864_100081175 3300005618 Bacteria 2842
220 Ga0068864_100134313 3300005618 Bacteria 2226
221 Ga0068864_100368078 3300005618 Bacteria 1360
222 Ga0068864_100863492 3300005618 Bacteria 892
223 Ga0068864_101915053 3300005618 Bacteria 599
224 Ga0068866_10273664 3300005718 Bacteria 1043
225 Ga0068866_10332834 3300005718 Bacteria 959
226 Ga0068866_10882355 3300005718 Bacteria 628
227 Ga0068861_100050287 3300005719 Bacteria 3160
228 Ga0068851_10001377 3300005834 Bacteria 10618
229 Ga0068851_10115222 3300005834 Bacteria 1439
230 Ga0068851_10228479 3300005834 Bacteria 1048
231 Ga0068863_100001683 3300005841 Bacteria 21885
232 Ga0068863_100010593 3300005841 Bacteria 8950
233 Ga0068863_100017206 3300005841 Bacteria 6933
234 Ga0068863_100179589 3300005841 Bacteria 2032
235 Ga0068863_100198948 3300005841 Bacteria 1927
236 Ga0068858_100018135 3300005842 Bacteria 6594
237 Ga0068858_100078567 3300005842 Bacteria 3066
238 Ga0068858_100081769 3300005842 Bacteria 3002
239 Ga0068860_100033688 3300005843 Bacteria 4914
240 Ga0068860_100051232 3300005843 Bacteria 3928
241 Ga0068860_100080040 3300005843 Bacteria 3107
242 Ga0068862_100168662 3300005844 Bacteria 1958
243 Ga0068862_100861445 3300005844 Bacteria 888
244 Ga0068862_101095530 3300005844 Bacteria 791
245 Ga0081539_10013447 3300005985 Bacteria 6164
246 Ga0070717_10036235 3300006028 Bacteria 4000
247 Ga0070717_10242048 3300006028 Bacteria 1591
248 Ga0097621_100327753 3300006237 Bacteria 1357
249 Ga0068871_100001345 3300006358 Bacteria 16442
250 Ga0068871_100008738 3300006358 Bacteria 7291
251 Ga0068871_100426273 3300006358 Bacteria 1185
252 Ga0068871_100488743 3300006358 Bacteria 1108
253 Ga0075428_101054232 3300006844 Bacteria 860
254 Ga0075434_100962453 3300006871 Bacteria 868
255 Ga0075429_100701117 3300006880 Bacteria 887
256 Ga0068865_100013204 3300006881 Bacteria 5215
257 Ga0068865_100037028 3300006881 Bacteria 3292
258 Ga0068865_100179611 3300006881 Bacteria 1629
259 Ga0068865_101538202 3300006881 Bacteria 597
260 Ga0097620_100168706 3300006931 Bacteria 2269
261 Ga0097620_100284460 3300006931 Bacteria 1746
262 Ga0097620_100838277 3300006931 Bacteria 1006
263 Ga0105251_10094397 3300009011 Bacteria 1372
264 Ga0105240_10010008 3300009093 Bacteria 13357
265 Ga0105240_10402144 3300009093 Bacteria 1542
266 Ga0105240_11227897 3300009093 Bacteria 793
267 Ga0111539_10030770 3300009094 Bacteria 6524
268 Ga0111539_11881274 3300009094 Bacteria 694
269 Ga0105245_10005505 3300009098 Bacteria 11120
270 Ga0105247_10212222 3300009101 Bacteria 1306
271 Ga0105247_11231991 3300009101 Bacteria 597
272 Ga0105241_10174154 3300009174 Bacteria 1779
273 Ga0105241_10387801 3300009174 Bacteria 1222
274 Ga0105241_11262712 3300009174 Bacteria 702
275 Ga0105242_10064883 3300009176 Bacteria 3011
276 Ga0105248_10002618 3300009177 Bacteria 20018
277 Ga0105248_10074018 3300009177 Bacteria 3829
278 Ga0105248_10079494 3300009177 Bacteria 3686
279 Ga0105248_10125694 3300009177 Bacteria 2893
280 Ga0105248_10173656 3300009177 Bacteria 2429
281 Ga0105248_10227329 3300009177 Bacteria 2100
282 Ga0105248_10592550 3300009177 Bacteria 1251
283 Ga0105248_10597343 3300009177 Bacteria 1245
284 Ga0105248_10867468 3300009177 Bacteria 1019
285 Ga0105248_10881424 3300009177 Bacteria 1010
286 Ga0105248_12276750 3300009177 Bacteria 617
287 Ga0105237_10006648 3300009545 Bacteria 12780
288 Ga0105237_10974073 3300009545 Bacteria 855
289 Ga0105237_11984288 3300009545 Bacteria 590
290 Ga0105238_10024869 3300009551 Bacteria 6103
291 Ga0105238_10363771 3300009551 Bacteria 1436
292 Ga0105238_10641939 3300009551 Bacteria 1071
293 Ga0105239_10000060 3300010375 Bacteria 155195
294 Ga0105239_11232564 3300010375 Bacteria 862
295 Ga0105246_10098684 3300011119 Bacteria 2122
296 Ga0105246_11887320 3300011119 Bacteria 573
297 Ga0157373_10067610 3300013100 Bacteria 2527
298 Ga0157373_10168343 3300013100 Bacteria 1542
299 Ga0157373_10193377 3300013100 Bacteria 1434
300 Ga0157373_10236861 3300013100 Bacteria 1290
301 Ga0157373_10291710 3300013100 Bacteria 1157
302 Ga0157371_10002316 3300013102 Bacteria 18311
303 Ga0157371_10046715 3300013102 Bacteria 3079
304 Ga0157371_10110239 3300013102 Bacteria 1954
305 Ga0157371_10167609 3300013102 Bacteria 1569
306 Ga0157370_10007886 3300013104 Bacteria 11542
307 Ga0157370_10056019 3300013104 Bacteria 3753
308 Ga0157369_10116175 3300013105 Bacteria 2841
309 Ga0157369_10158678 3300013105 Bacteria 2388
310 Ga0157369_10167078 3300013105 Bacteria 2320
311 Ga0157369_10390758 3300013105 Bacteria 1443
312 Ga0157369_10420402 3300013105 Bacteria 1386
313 Ga0157369_10463809 3300013105 Bacteria 1311
314 Ga0157369_10476858 3300013105 Bacteria 1291
315 Ga0157369_10716366 3300013105 Bacteria 1030
316 Ga0157369_11408803 3300013105 Bacteria 709
317 Ga0157374_10175209 3300013296 Bacteria 2093
318 Ga0157374_10193435 3300013296 Bacteria 1990
319 Ga0157374_10412235 3300013296 Bacteria 1349
320 Ga0157374_10678337 3300013296 Bacteria 1043
321 Ga0157378_10012389 3300013297 Bacteria 7466
322 Ga0163162_10211509 3300013306 Bacteria 2069
323 Ga0157372_10044111 3300013307 Bacteria 4940
324 Ga0157372_10209468 3300013307 Bacteria 2259
325 Ga0157372_10674106 3300013307 Bacteria 1204
326 Ga0157372_10788225 3300013307 Bacteria 1104
327 Ga0157372_11902756 3300013307 Bacteria 684
328 Ga0157372_12443937 3300013307 Bacteria 600
329 Ga0157375_10035574 3300013308 Bacteria 4755
330 Ga0157375_10235851 3300013308 Bacteria 1988
331 Ga0163163_10156508 3300014325 Bacteria 2323
332 Ga0163163_11313283 3300014325 Bacteria 785
333 Ga0157380_10592611 3300014326 Bacteria 1095
334 Ga0157379_10002119 3300014968 Bacteria 16448
335 Ga0157379_10255877 3300014968 Bacteria 1590
336 Ga0157379_10274607 3300014968 Bacteria 1533
337 Ga0157379_11875106 3300014968 Bacteria 590
338 Ga0157376_10001755 3300014969 Bacteria 14445
339 Ga0157376_11138605 3300014969 Bacteria 807
340 Ga0163161_10000753 3300017792 Bacteria 25411
341 Ga0163161_10331696 3300017792 Bacteria 1205
342 Ga0163161_10757440 3300017792 Bacteria 813
343 Ga0209148_1000074 3300025254 Bacteria 314356
344 Ga0209050_1067444 3300025298 Bacteria 815
345 Ga0207697_10011449 3300025315 Bacteria 3751
346 Ga0207697_10016196 3300025315 Bacteria 3074
347 Ga0207697_10101895 3300025315 Bacteria 1224
348 Ga0207656_10004618 3300025321 Bacteria 4824
349 Ga0207656_10174425 3300025321 Bacteria 1029
350 Ga0207682_10016220 3300025893 Bacteria 2903
351 Ga0207682_10018394 3300025893 Bacteria 2732
352 Ga0207642_10022795 3300025899 Bacteria 2490
353 Ga0207642_10060353 3300025899 Bacteria 1758
354 Ga0207710_10355225 3300025900 Bacteria 747
355 Ga0207688_10002587 3300025901 Bacteria 9785
356 Ga0207688_10071998 3300025901 Bacteria 1963
357 Ga0207688_10157928 3300025901 Bacteria 1343
358 Ga0207688_10183974 3300025901 Unclassified 1247
359 Ga0207680_10035912 3300025903 Bacteria 2850
360 Ga0207680_10039631 3300025903 Bacteria 2735
361 Ga0207680_10223167 3300025903 Bacteria 1293
362 Ga0207680_10555842 3300025903 Bacteria 819
363 Ga0207680_10789255 3300025903 Bacteria 681
364 Ga0207647_10039174 3300025904 Bacteria 2993
365 Ga0207647_10121443 3300025904 Bacteria 1540
366 Ga0207645_10018108 3300025907 Bacteria 4642
367 Ga0207645_10045502 3300025907 Bacteria 2805
368 Ga0207645_10055318 3300025907 Bacteria 2533
369 Ga0207643_10392092 3300025908 Bacteria 877
370 Ga0207705_10018941 3300025909 Bacteria 4922
371 Ga0207705_10019577 3300025909 Bacteria 4838
372 Ga0207705_10052480 3300025909 Bacteria 2935
373 Ga0207705_10057556 3300025909 Bacteria 2804
374 Ga0207705_10077199 3300025909 Bacteria 2423
375 Ga0207705_10081032 3300025909 Bacteria 2365
376 Ga0207705_10193400 3300025909 Bacteria 1539
377 Ga0207705_10204229 3300025909 Bacteria 1497
378 Ga0207684_10172607 3300025910 Bacteria 1864
379 Ga0207707_10070618 3300025912 Bacteria 3043
380 Ga0207707_10173026 3300025912 Bacteria 1887
381 Ga0207707_10555313 3300025912 Bacteria 975
382 Ga0207707_10922198 3300025912 Bacteria 721
383 Ga0207695_10012047 3300025913 Bacteria 10398
384 Ga0207695_10265063 3300025913 Bacteria 1615
385 Ga0207695_10363569 3300025913 Bacteria 1333
386 Ga0207671_10007438 3300025914 Bacteria 9503
387 Ga0207660_10000049 3300025917 Bacteria 59933
388 Ga0207660_10011512 3300025917 Bacteria 5762
389 Ga0207660_10172158 3300025917 Bacteria 1676
390 Ga0207662_10207101 3300025918 Bacteria 1272
391 Ga0207662_10626530 3300025918 Bacteria 750
392 Ga0207657_10002900 3300025919 Bacteria 18411
393 Ga0207657_10016916 3300025919 Bacteria 7017
394 Ga0207657_10022407 3300025919 Bacteria 5911
395 Ga0207657_10026926 3300025919 Bacteria 5273
396 Ga0207657_10031512 3300025919 Bacteria 4802
397 Ga0207657_10031868 3300025919 Bacteria 4768
398 Ga0207657_10197282 3300025919 Bacteria 1621
399 Ga0207657_10251697 3300025919 Bacteria 1408
400 Ga0207657_10479429 3300025919 Bacteria 975
401 Ga0207657_11344084 3300025919 Bacteria 538
402 Ga0207649_10025323 3300025920 Bacteria 3457
403 Ga0207649_10075191 3300025920 Bacteria 2170
404 Ga0207649_10112222 3300025920 Bacteria 1823
405 Ga0207649_10121478 3300025920 Bacteria 1761
406 Ga0207649_10500330 3300025920 Bacteria 924
407 Ga0207649_10614314 3300025920 Bacteria 837
408 Ga0207649_11109748 3300025920 Bacteria 624
409 Ga0207649_11165257 3300025920 Bacteria 609
410 Ga0207652_10067386 3300025921 Bacteria 3104
411 Ga0207652_11216275 3300025921 Bacteria 655
412 Ga0207681_10068303 3300025923 Bacteria 2468
413 Ga0207681_10424796 3300025923 Bacteria 1077
414 Ga0207694_10524221 3300025924 Bacteria 993
415 Ga0207694_10746867 3300025924 Bacteria 826
416 Ga0207694_11192468 3300025924 Bacteria 644
417 Ga0207650_10016967 3300025925 Bacteria 5093
418 Ga0207650_10193740 3300025925 Bacteria 1625
419 Ga0207650_10287625 3300025925 Bacteria 1340
420 Ga0207650_10450126 3300025925 Bacteria 1071
421 Ga0207650_10501538 3300025925 Bacteria 1014
422 Ga0207650_11364314 3300025925 Bacteria 603
423 Ga0207659_10009328 3300025926 Bacteria 6126
424 Ga0207687_10006509 3300025927 Bacteria 7715
425 Ga0207700_10475863 3300025928 Bacteria 1103
426 Ga0207664_10187531 3300025929 Bacteria 1779
427 Ga0207664_10305492 3300025929 Bacteria 1400
428 Ga0207664_10684370 3300025929 Bacteria 922
429 Ga0207644_10000509 3300025931 Bacteria 25068
430 Ga0207644_10000695 3300025931 Bacteria 21288
431 Ga0207644_10041098 3300025931 Bacteria 3269
432 Ga0207644_10096750 3300025931 Bacteria 2210
433 Ga0207644_10102127 3300025931 Bacteria 2156
434 Ga0207644_10119077 3300025931 Bacteria 2007
435 Ga0207644_10163637 3300025931 Bacteria 1731
436 Ga0207644_10190431 3300025931 Bacteria 1612
437 Ga0207644_10229809 3300025931 Bacteria 1473
438 Ga0207644_10470531 3300025931 Bacteria 1034
439 Ga0207644_10577698 3300025931 Bacteria 932
440 Ga0207644_10734795 3300025931 Bacteria 824
441 Ga0207644_10829216 3300025931 Bacteria 774
442 Ga0207690_10010300 3300025932 Bacteria 5550
443 Ga0207690_10023086 3300025932 Bacteria 3879
444 Ga0207690_10029851 3300025932 Bacteria 3471
445 Ga0207690_10060090 3300025932 Bacteria 2577
446 Ga0207690_10096570 3300025932 Bacteria 2101
447 Ga0207690_10131345 3300025932 Bacteria 1833
448 Ga0207690_10158789 3300025932 Bacteria 1683
449 Ga0207690_10161813 3300025932 Bacteria 1669
450 Ga0207690_10201453 3300025932 Bacteria 1512
451 Ga0207690_10409086 3300025932 Bacteria 1083
452 Ga0207690_10510915 3300025932 Bacteria 973
453 Ga0207690_10512112 3300025932 Bacteria 972
454 Ga0207690_10704290 3300025932 Bacteria 830
455 Ga0207706_10001263 3300025933 Bacteria 25500
456 Ga0207706_10005392 3300025933 Bacteria 11921
457 Ga0207706_10006331 3300025933 Bacteria 10995
458 Ga0207706_10014922 3300025933 Bacteria 7036
459 Ga0207706_10016981 3300025933 Bacteria 6567
460 Ga0207706_10039663 3300025933 Bacteria 4175
461 Ga0207706_10075280 3300025933 Bacteria 2968
462 Ga0207706_10080816 3300025933 Bacteria 2857
463 Ga0207706_10095377 3300025933 Bacteria 2617
464 Ga0207706_10112002 3300025933 Bacteria 2401
465 Ga0207706_10262962 3300025933 Bacteria 1506
466 Ga0207706_10445596 3300025933 Bacteria 1120
467 Ga0207686_10053445 3300025934 Bacteria 2525
468 Ga0207670_10951820 3300025936 Bacteria 721
469 Ga0207669_10060965 3300025937 Bacteria 2315
470 Ga0207669_10152113 3300025937 Bacteria 1622
471 Ga0207669_10527392 3300025937 Bacteria 949
472 Ga0207669_10633578 3300025937 Bacteria 872
473 Ga0207669_10784946 3300025937 Bacteria 789
474 Ga0207669_11121484 3300025937 Bacteria 664
475 Ga0207704_10315262 3300025938 Bacteria 1204
476 Ga0207704_10361257 3300025938 Bacteria 1134
477 Ga0207704_10687176 3300025938 Bacteria 846
478 Ga0207691_10003542 3300025940 Bacteria 15186
479 Ga0207691_10004608 3300025940 Bacteria 13350
480 Ga0207691_10133027 3300025940 Bacteria 2196
481 Ga0207691_10150662 3300025940 Bacteria 2045
482 Ga0207691_10186794 3300025940 Bacteria 1809
483 Ga0207691_10411420 3300025940 Bacteria 1153
484 Ga0207711_10002650 3300025941 Bacteria 15817
485 Ga0207711_10008614 3300025941 Bacteria 8527
486 Ga0207711_10052294 3300025941 Bacteria 3500
487 Ga0207711_10077756 3300025941 Bacteria 2893
488 Ga0207711_10148696 3300025941 Bacteria 2112
489 Ga0207711_10163144 3300025941 Bacteria 2018
490 Ga0207711_10889427 3300025941 Bacteria 828
491 Ga0207711_11718663 3300025941 Bacteria 571
492 Ga0207689_10006370 3300025942 Bacteria 10452
493 Ga0207689_10170844 3300025942 Bacteria 1792
494 Ga0207689_11082597 3300025942 Bacteria 676
495 Ga0207661_10330963 3300025944 Bacteria 1371
496 Ga0207661_10788459 3300025944 Bacteria 875
497 Ga0207679_10021325 3300025945 Bacteria 4391
498 Ga0207679_10029582 3300025945 Bacteria 3815
499 Ga0207679_10051617 3300025945 Bacteria 3011
500 Ga0207679_10052376 3300025945 Bacteria 2993
501 Ga0207679_10067784 3300025945 Bacteria 2678
502 Ga0207679_10250066 3300025945 Bacteria 1506
503 Ga0207679_10286606 3300025945 Bacteria 1414
504 Ga0207679_10349895 3300025945 Bacteria 1288
505 Ga0207679_10511093 3300025945 Bacteria 1073
506 Ga0207679_10532028 3300025945 Bacteria 1052
507 Ga0207667_10034109 3300025949 Bacteria 5468
508 Ga0207667_10037751 3300025949 Bacteria 5163
509 Ga0207667_10089819 3300025949 Bacteria 3175
510 Ga0207667_10133559 3300025949 Bacteria 2556
511 Ga0207667_10194288 3300025949 Bacteria 2082
512 Ga0207667_10260465 3300025949 Bacteria 1773
513 Ga0207667_10292857 3300025949 Bacteria 1663
514 Ga0207651_10008656 3300025960 Bacteria 5512
515 Ga0207651_10026727 3300025960 Bacteria 3611
516 Ga0207651_10037646 3300025960 Bacteria 3171
517 Ga0207651_10079061 3300025960 Bacteria 2361
518 Ga0207651_10173360 3300025960 Bacteria 1704
519 Ga0207651_10195391 3300025960 Bacteria 1617
520 Ga0207651_10911708 3300025960 Bacteria 783
521 Ga0207651_11960517 3300025960 Bacteria 526
522 Ga0207668_10000223 3300025972 Bacteria 38523
523 Ga0207668_10009988 3300025972 Bacteria 5713
524 Ga0207668_10027960 3300025972 Bacteria 3681
525 Ga0207640_10031126 3300025981 Bacteria 3294
526 Ga0207640_10038320 3300025981 Bacteria 3024
527 Ga0207640_10055962 3300025981 Bacteria 2587
528 Ga0207640_10088519 3300025981 Bacteria 2138
529 Ga0207640_10457922 3300025981 Bacteria 1053
530 Ga0207640_10645525 3300025981 Bacteria 901
531 Ga0207640_10667451 3300025981 Bacteria 888
532 Ga0207640_11095992 3300025981 Bacteria 704
533 Ga0207640_11216673 3300025981 Bacteria 670
534 Ga0207658_10033187 3300025986 Bacteria 3680
535 Ga0207658_10052808 3300025986 Bacteria 3000
536 Ga0207658_10129902 3300025986 Bacteria 2022
537 Ga0207658_10175029 3300025986 Bacteria 1771
538 Ga0207658_10475277 3300025986 Bacteria 1110
539 Ga0207658_10709255 3300025986 Bacteria 909
540 Ga0207677_10008314 3300026023 Bacteria 5787
541 Ga0207677_10097441 3300026023 Bacteria 2155
542 Ga0207677_10119456 3300026023 Bacteria 1979
543 Ga0207677_10189026 3300026023 Bacteria 1627
544 Ga0207703_10038441 3300026035 Bacteria 3819
545 Ga0207703_10060516 3300026035 Bacteria 3097
546 Ga0207639_10050420 3300026041 Bacteria 3161
547 Ga0207639_10063520 3300026041 Bacteria 2859
548 Ga0207639_10326196 3300026041 Bacteria 1364
549 Ga0207639_10561483 3300026041 Bacteria 1049
550 Ga0207639_10956291 3300026041 Bacteria 802
551 Ga0207639_10976708 3300026041 Bacteria 793
552 Ga0207639_10987537 3300026041 Bacteria 788
553 Ga0207639_11407919 3300026041 Bacteria 654
554 Ga0207678_10004058 3300026067 Bacteria 13173
555 Ga0207678_10049150 3300026067 Bacteria 3644
556 Ga0207678_10157338 3300026067 Bacteria 1940
557 Ga0207678_10453680 3300026067 Bacteria 1115
558 Ga0207678_10791721 3300026067 Bacteria 837
559 Ga0207702_10021421 3300026078 Bacteria 5351
560 Ga0207702_10272032 3300026078 Bacteria 1598
561 Ga0207702_10295189 3300026078 Bacteria 1537
562 Ga0207641_10021253 3300026088 Bacteria 5335
563 Ga0207641_10028343 3300026088 Bacteria 4627
564 Ga0207641_10070223 3300026088 Bacteria 3009
565 Ga0207641_10132931 3300026088 Bacteria 2236
566 Ga0207641_10269465 3300026088 Bacteria 1597
567 Ga0207648_10005333 3300026089 Bacteria 12958
568 Ga0207648_10012960 3300026089 Bacteria 7784
569 Ga0207648_10064774 3300026089 Bacteria 3185
570 Ga0207648_11313701 3300026089 Bacteria 680
571 Ga0207676_10058082 3300026095 Bacteria 3050
572 Ga0207676_10242122 3300026095 Bacteria 1619
573 Ga0207676_10420388 3300026095 Bacteria 1253
574 Ga0207674_10001193 3300026116 Bacteria 33801
575 Ga0207674_10005620 3300026116 Bacteria 14863
576 Ga0207674_10021911 3300026116 Bacteria 6873
577 Ga0207674_10143250 3300026116 Bacteria 2349
578 Ga0207674_10153875 3300026116 Bacteria 2255
579 Ga0207674_11377826 3300026116 Bacteria 675
580 Ga0207675_100076027 3300026118 Bacteria 3144
581 Ga0207675_100279557 3300026118 Bacteria 1622
582 Ga0207683_10003015 3300026121 Bacteria 14710
583 Ga0207683_10154102 3300026121 Bacteria 2075
584 Ga0207683_10200732 3300026121 Bacteria 1813
585 Ga0207683_10983566 3300026121 Bacteria 783
586 Ga0207698_10001855 3300026142 Bacteria 12342
587 Ga0207698_10005772 3300026142 Bacteria 7680
588 Ga0207698_10112168 3300026142 Bacteria 2288
589 Ga0207698_10115473 3300026142 Bacteria 2260
590 Ga0207698_10181557 3300026142 Bacteria 1865
591 Ga0207698_10235678 3300026142 Bacteria 1664
592 Ga0207698_10284926 3300026142 Bacteria 1530
593 Ga0207698_10346066 3300026142 Bacteria 1402
594 Ga0207698_10461524 3300026142 Bacteria 1228
595 Ga0207698_11632022 3300026142 Bacteria 660
596 Ga0207428_10176698 3300027907 Bacteria 1614
597 Ga0268266_10006287 3300028379 Bacteria 10893
598 Ga0268266_10012139 3300028379 Bacteria 7456
599 Ga0268266_10018445 3300028379 Bacteria 5946
600 Ga0268266_10058512 3300028379 Bacteria 3318
601 Ga0268266_10134510 3300028379 Bacteria 2213
602 Ga0268266_10204234 3300028379 Bacteria 1809
603 Ga0268266_10465213 3300028379 Bacteria 1204
604 Ga0268266_10707481 3300028379 Bacteria 971
605 Ga0268265_10005469 3300028380 Bacteria 8678
606 Ga0268265_10008030 3300028380 Bacteria 7125
607 Ga0268265_10215513 3300028380 Bacteria 1676
608 Ga0268265_11064960 3300028380 Bacteria 801
609 Ga0268264_10036404 3300028381 Bacteria 4055
610 Ga0268264_10049982 3300028381 Bacteria 3480
611 Ga0268264_10500006 3300028381 Bacteria 1186
612 Ga0268264_11088030 3300028381 Bacteria 808
613 Ga0316177_1210950 3300030731 Bacteria 2310
614 Ga0316180_1062979 3300030736 Bacteria 1729
615 Ga0316182_1140734 3300030745 Bacteria 1298
616 Ga0316182_1144134 3300030745 Bacteria 2323
617 Ga0307408_100163768 3300031548 Bacteria 1769
618 Ga0307408_100398622 3300031548 Bacteria 1181
619 Ga0307405_10164728 3300031731 Bacteria 1574
620 Ga0307405_10321010 3300031731 Bacteria 1183
621 Ga0307405_10539670 3300031731 Bacteria 942
622 Ga0307413_10187428 3300031824 Bacteria 1482
623 Ga0307413_10326273 3300031824 Bacteria 1175
624 Ga0307410_10002928 3300031852 Bacteria 8415
625 Ga0307410_10044413 3300031852 Bacteria 2952
626 Ga0307410_10288988 3300031852 Bacteria 1290
627 Ga0307410_10403244 3300031852 Bacteria 1105
628 Ga0307410_10873499 3300031852 Bacteria 769
629 Ga0307410_10981666 3300031852 Bacteria 727
630 Ga0307406_10013951 3300031901 Bacteria 4612
631 Ga0307406_10267675 3300031901 Bacteria 1296
632 Ga0307406_10827585 3300031901 Bacteria 783
633 Ga0307407_10036218 3300031903 Bacteria 2718
634 Ga0307412_10568728 3300031911 Bacteria 955
635 Ga0307412_10759681 3300031911 Bacteria 838
636 Ga0307412_10779618 3300031911 Bacteria 828
637 Ga0307409_100046154 3300031995 Bacteria 3296
638 Ga0307409_100262459 3300031995 Bacteria 1586
639 Ga0307409_100373285 3300031995 Bacteria 1353
640 Ga0307409_101199443 3300031995 Bacteria 782
641 Ga0307416_100006418 3300032002 Bacteria 7362
642 Ga0307416_100191991 3300032002 Bacteria 1927
643 Ga0307414_10029899 3300032004 Bacteria 3552
644 Ga0307414_10039519 3300032004 Bacteria 3178
645 Ga0307414_10304499 3300032004 Bacteria 1350
646 Ga0307411_10025437 3300032005 Bacteria 3547
647 Ga0307411_10035258 3300032005 Bacteria 3122
648 Ga0307411_10372435 3300032005 Bacteria 1172
649 Ga0307411_10513836 3300032005 Unclassified 1015
650 Ga0307411_10626724 3300032005 Bacteria 928
651 Ga0307415_100002963 3300032126 Bacteria 8531
652 Ga0307415_100021255 3300032126 Bacteria 3984
653 Ga0307415_100069374 3300032126 Bacteria 2472
654 Ga0373943_0051315 3300035170 Bacteria 2030
655 Ga0373946_0212326 3300035171 Bacteria 931
656 Ga0373935_0079963 3300035692 Bacteria 2123
657 Ga0373927_0082841 3300035695 Bacteria 2080
658 Ga0373927_0183411 3300035695 Bacteria 1373
659 Ga0373947_0082771 3300035725 Bacteria 1989
660 Ga0373925_0092034 3300037068 Bacteria 2319
661 Ga0395899_0008297 3300037312 Bacteria 7999
662 Ga0395899_0009091 3300037312 Bacteria 7633
663 Ga0395899_0060438 3300037312 Bacteria 2792
664 Ga0395899_0072004 3300037312 Bacteria 2529
665 Ga0395899_0105033 3300037312 Bacteria 2035
666 Ga0395899_0106949 3300037312 Bacteria 2014
667 Ga0395899_0112093 3300037312 Bacteria 1960
668 Ga0395899_0114908 3300037312 Bacteria 1932
669 Ga0395899_0123329 3300037312 Bacteria 1854
670 Ga0395899_0130707 3300037312 Bacteria 1793
671 Ga0395899_0137676 3300037312 Bacteria 1739
672 Ga0395899_0312074 3300037312 Bacteria 1062
673 Ga0395899_0556918 3300037312 Bacteria 736
674 Ga0395899_0592063 3300037312 Bacteria 707
675 Ga0395900_0030787 3300037418 Bacteria 5510
676 Ga0395900_0031221 3300037418 Bacteria 5472
677 Ga0395900_0050281 3300037418 Bacteria 4294
678 Ga0395900_0058460 3300037418 Bacteria 3969
679 Ga0395900_0066682 3300037418 Bacteria 3698
680 Ga0395900_0162196 3300037418 Bacteria 2279
681 Ga0395900_0167190 3300037418 Bacteria 2241
682 Ga0395900_0180084 3300037418 Bacteria 2148
683 Ga0395900_0314059 3300037418 Bacteria 1549
684 Ga0395900_0354776 3300037418 Bacteria 1439
685 Ga0395900_0466009 3300037418 Bacteria 1217
686 Ga0395900_0486048 3300037418 Bacteria 1186
687 Ga0395900_0497078 3300037418 Bacteria 1170
688 Ga0395900_0619142 3300037418 Bacteria 1021
689 Ga0395900_0627687 3300037418 Bacteria 1013
690 Ga0395900_0770248 3300037418 Bacteria 892
691 Ga0395900_0923665 3300037418 Bacteria 795
692 Ga0395898_0042401 3300037466 Bacteria 4489
693 Ga0395898_0079695 3300037466 Bacteria 3159
694 Ga0395898_0082482 3300037466 Bacteria 3099
695 Ga0395898_0131366 3300037466 Bacteria 2398
696 Ga0395898_0160891 3300037466 Bacteria 2147
697 Ga0395898_0349405 3300037466 Bacteria 1410
698 Ga0395898_0406802 3300037466 Bacteria 1297
699 Ga0395898_0474411 3300037466 Bacteria 1190
700 Ga0395898_1383332 3300037466 Bacteria 632
701 Ga0395905_0001174 3300037471 Bacteria 32682
702 Ga0395905_0001175 3300037471 Bacteria 32680
703 Ga0395905_0001635 3300037471 Bacteria 26576
704 Ga0395905_0007031 3300037471 Bacteria 11245
705 Ga0395905_0010072 3300037471 Bacteria 9214
706 Ga0395905_0012852 3300037471 Bacteria 8049
707 Ga0395905_0013915 3300037471 Bacteria 7695
708 Ga0395905_0031979 3300037471 Bacteria 4950
709 Ga0395905_0032488 3300037471 Bacteria 4908
710 Ga0395905_0034337 3300037471 Bacteria 4763
711 Ga0395905_0036663 3300037471 Bacteria 4606
712 Ga0395905_0037397 3300037471 Bacteria 4557
713 Ga0395905_0053488 3300037471 Bacteria 3779
714 Ga0395905_0073212 3300037471 Bacteria 3211
715 Ga0395905_0104678 3300037471 Bacteria 2656
716 Ga0395905_0177163 3300037471 Bacteria 2001
717 Ga0395905_0225210 3300037471 Bacteria 1754
718 Ga0395905_0227235 3300037471 Bacteria 1745
719 Ga0395905_0245596 3300037471 Bacteria 1672
720 Ga0395905_0248181 3300037471 Bacteria 1663
721 Ga0395905_0285808 3300037471 Bacteria 1536
722 Ga0395905_0289513 3300037471 Bacteria 1525
723 Ga0395905_0324181 3300037471 Bacteria 1430
724 Ga0395905_0457085 3300037471 Bacteria 1175
725 Ga0395905_0537633 3300037471 Bacteria 1069
726 Ga0395905_0750005 3300037471 Bacteria 878
727 Ga0395905_0991077 3300037471 Bacteria 743
728 Ga0395905_1054831 3300037471 Bacteria 716
729 Ga0395905_1067643 3300037471 Bacteria 711
730 Ga0436364_0873098 3300037853 Bacteria 1089
731 Ga0395901_0006288 3300038443 Bacteria 12031
732 Ga0395901_0009338 3300038443 Bacteria 9944
733 Ga0395901_0012424 3300038443 Bacteria 8639
734 Ga0395901_0017002 3300038443 Bacteria 7412
735 Ga0395901_0027440 3300038443 Bacteria 5850
736 Ga0395901_0039648 3300038443 Bacteria 4875
737 Ga0395901_0042407 3300038443 Bacteria 4717
738 Ga0395901_0057895 3300038443 Bacteria 4031
739 Ga0395901_0077643 3300038443 Bacteria 3466
740 Ga0395901_0101584 3300038443 Bacteria 3017
741 Ga0395901_0138970 3300038443 Bacteria 2553
742 Ga0395901_0159693 3300038443 Bacteria 2367
743 Ga0395901_0241240 3300038443 Bacteria 1885
744 Ga0395901_0267183 3300038443 Bacteria 1780
745 Ga0395901_0718150 3300038443 Bacteria 995
746 Ga0395901_0792188 3300038443 Bacteria 937
747 Ga0395901_1239840 3300038443 Bacteria 710
748 Ga0395901_1368199 3300038443 Bacteria 667
749 Ga0395901_1542207 3300038443 Bacteria 619
750 Ga0436365_1532646 3300039437 Bacteria 978
751 Ga0451789_0771960 3300041443 Bacteria 595
752 Ga0439455_0111941 3300042012 Bacteria 760
753 Ga0450914_006994 3300042118 Bacteria 1006
754 Ga0450917_001974 3300042120 Bacteria 1465
755 Ga0450889_000017 3300042144 Bacteria 14742
756 Ga0466972_0086759 3300044658 Bacteria 1487
757 Ga0466972_0322875 3300044658 Bacteria 721
758 Ga0466966_0093805 3300044684 Bacteria 1861
759 Ga0466966_0097655 3300044684 Bacteria 1819
760 Ga0466961_0006839 3300044693 Bacteria 7256
761 Ga0466961_0224815 3300044693 Bacteria 1156
762 Ga0466961_0247065 3300044693 Bacteria 1096
763 Ga0466961_0803561 3300044693 Bacteria 561
764 Ga0466963_0004653 3300044694 Bacteria 8005
765 Ga0466963_0007062 3300044694 Bacteria 6686
766 Ga0466963_0017889 3300044694 Bacteria 4423
767 Ga0466963_0047585 3300044694 Bacteria 2831
768 Ga0466963_0069664 3300044694 Bacteria 2364
769 Ga0466963_0114071 3300044694 Bacteria 1856
770 Ga0466963_0217569 3300044694 Bacteria 1337
771 Ga0466963_0231301 3300044694 Bacteria 1295
772 Ga0466963_0338636 3300044694 Bacteria 1059
773 Ga0466964_0036872 3300044706 Bacteria 1962
774 Ga0466964_0108279 3300044706 Bacteria 1236
775 Ga0466964_0870768 3300044706 Bacteria 513
776 Ga0466971_0002967 3300044719 Bacteria 7203
777 Ga0466971_0190980 3300044719 Bacteria 965
778 Ga0466971_0225616 3300044719 Bacteria 889
779 Ga0466971_0286780 3300044719 Bacteria 789
780 Ga0466971_0326584 3300044719 Bacteria 740
781 Ga0466968_0010984 3300044735 Bacteria 3520
782 Ga0466968_0028865 3300044735 Bacteria 2290
783 Ga0466970_0120906 3300044765 Bacteria 1434
784 Ga0466957_0032622 3300044842 Bacteria 3119
785 Ga0466957_0033593 3300044842 Bacteria 3078
786 Ga0466957_0069784 3300044842 Bacteria 2171
787 Ga0466957_0073894 3300044842 Bacteria 2114
788 Ga0466957_0117395 3300044842 Bacteria 1694
789 Ga0466957_0272872 3300044842 Bacteria 1130
790 Ga0466957_0477177 3300044842 Bacteria 862
791 Ga0466957_0953016 3300044842 Bacteria 615
792 Ga0466959_0106462 3300045049 Bacteria 2005
793 Ga0466959_0845949 3300045049 Bacteria 611
794 Ga0466958_0039442 3300045836 Bacteria 2838
795 Ga0466958_0138975 3300045836 Bacteria 1529
796 Ga0466958_0189969 3300045836 Bacteria 1305
797 Ga0466958_0253039 3300045836 Bacteria 1127
798 Ga0466958_0302518 3300045836 Bacteria 1027
799 Ga0466967_0032422 3300045976 Bacteria 4411
800 Ga0466967_0037046 3300045976 Bacteria 4170
801 Ga0466967_0103832 3300045976 Bacteria 2601
802 Ga0466967_0158966 3300045976 Bacteria 2119
803 Ga0466967_0180079 3300045976 Bacteria 1993
804 Ga0466967_0215083 3300045976 Bacteria 1824
805 Ga0466967_0333811 3300045976 Bacteria 1464
806 Ga0466967_0334961 3300045976 Bacteria 1462
807 Ga0466967_0415143 3300045976 Bacteria 1311
808 Ga0466967_0470126 3300045976 Bacteria 1231
809 Ga0466967_0630520 3300045976 Bacteria 1059
810 Ga0466967_0842109 3300045976 Bacteria 911
811 Ga0466967_0893432 3300045976 Bacteria 883
812 Ga0495603_0640943 3300046455 Bacteria 608
813 Ga0495582_0163979 3300046473 Bacteria 1265
814 Ga0495583_0255369 3300046506 Bacteria 702
815 Ga0495610_0319515 3300046512 Bacteria 593
816 Ga0495631_0232478 3300046518 Bacteria 786
817 Ga0495637_0040347 3300046520 Bacteria 2010
818 Ga0495643_0035548 3300046522 Bacteria 2743
819 Ga0495609_0070881 3300046538 Bacteria 1532
820 Ga0495621_0066778 3300046539 Bacteria 1316
821 Ga0495597_0019400 3300046542 Bacteria 3182
822 Ga0495668_0012074 3300046616 Bacteria 5139
823 Ga0495668_0024021 3300046616 Bacteria 3469
824 Ga0495668_0085651 3300046616 Bacteria 1728
825 Ga0495625_0050498 3300046660 Bacteria 2985
826 Ga0495625_0113653 3300046660 Bacteria 1849
827 Ga0495625_0709670 3300046660 Bacteria 593
828 Ga0495669_0000184 3300046684 Bacteria 38767
829 Ga0495669_0001430 3300046684 Bacteria 9839
830 Ga0495669_0009152 3300046684 Bacteria 4172
831 Ga0495669_0014479 3300046684 Bacteria 3370
832 Ga0495669_0022601 3300046684 Bacteria 2732
833 Ga0495669_0053100 3300046684 Bacteria 1822
834 Ga0495669_0165675 3300046684 Bacteria 1050
835 Ga0495676_0256109 3300047321 Bacteria 1192
836 Ga0495677_0288568 3300047445 Bacteria 644
837 Ga0496100_0040385 3300048903 Bacteria 2968
838 Ga0496100_0099724 3300048903 Bacteria 1999
839 Ga0496101_0001040 3300048904 Bacteria 16385
840 Ga0496101_0320053 3300048904 Bacteria 1217
841 Ga0496101_0651642 3300048904 Bacteria 832
842 Ga0496102_0062289 3300048905 Bacteria 3416
843 Ga0496102_0245689 3300048905 Bacteria 1687
844 Ga0496102_0267790 3300048905 Bacteria 1611
845 Ga0496102_0990250 3300048905 Bacteria 761
846 Ga0496102_1052246 3300048905 Bacteria 734
847 Ga0496103_0005416 3300048906 Bacteria 7641
848 Ga0496103_0063781 3300048906 Bacteria 2295
849 Ga0496103_0147779 3300048906 Bacteria 1505
850 Ga0496104_0111507 3300048907 Bacteria 2623
851 Ga0496104_0218286 3300048907 Bacteria 1819
852 Ga0496104_0270944 3300048907 Bacteria 1610
853 Ga0496105_0006326 3300048908 Bacteria 9098
854 Ga0496105_0163923 3300048908 Bacteria 1824
855 Ga0496105_0491717 3300048908 Bacteria 964
856 Ga0496106_0019842 3300048909 Bacteria 4984
857 Ga0496106_0050227 3300048909 Bacteria 3143
858 Ga0496107_0031060 3300048910 Bacteria 3809
859 Ga0496107_0052671 3300048910 Bacteria 2935
860 Ga0496107_0079150 3300048910 Bacteria 2396
861 Ga0496107_0080554 3300048910 Bacteria 2374
862 Ga0496108_0003932 3300048911 Bacteria 11932
863 Ga0496108_0004045 3300048911 Bacteria 11769
864 Ga0496108_0026421 3300048911 Bacteria 4787
865 Ga0496108_0038822 3300048911 Bacteria 3967
866 Ga0496108_0090472 3300048911 Bacteria 2601
867 Ga0496108_0307071 3300048911 Bacteria 1382
868 Ga0496109_0004440 3300048912 Bacteria 11716
869 Ga0496109_0012998 3300048912 Bacteria 7198
870 Ga0496109_0082466 3300048912 Bacteria 2963
871 Ga0496109_0089020 3300048912 Bacteria 2853
872 Ga0496109_0163708 3300048912 Bacteria 2084
873 Ga0496109_0363486 3300048912 Bacteria 1367
874 Ga0496110_0006143 3300048913 Bacteria 9470
875 Ga0496110_0010886 3300048913 Bacteria 7415
876 Ga0496110_0032975 3300048913 Bacteria 4478
877 Ga0496110_0086647 3300048913 Bacteria 2796
878 Ga0496110_0127387 3300048913 Bacteria 2297
879 Ga0496110_0212476 3300048913 Bacteria 1759
880 Ga0496111_0002690 3300048914 Bacteria 10795
881 Ga0496111_0012440 3300048914 Bacteria 5762
882 Ga0496111_0044211 3300048914 Bacteria 3201
883 Ga0496111_0099788 3300048914 Bacteria 2132
884 Ga0496111_0126818 3300048914 Bacteria 1887
885 Ga0496111_0207711 3300048914 Bacteria 1455
886 Ga0496111_0604712 3300048914 Bacteria 802
887 Ga0496112_0012868 3300048915 Bacteria 7702
888 Ga0496112_0055495 3300048915 Bacteria 3895
889 Ga0496112_0072117 3300048915 Bacteria 3413
890 Ga0496112_0092636 3300048915 Bacteria 2991
891 Ga0496112_0725279 3300048915 Bacteria 921
892 Ga0496112_0860695 3300048915 Bacteria 829
893 Ga0496112_1292029 3300048915 Bacteria 645
894 Ga0496113_0021034 3300048916 Bacteria 4597
895 Ga0496113_0031422 3300048916 Bacteria 3854
896 Ga0496113_0128887 3300048916 Bacteria 1983
897 Ga0496114_0070577 3300048917 Bacteria 2935
898 Ga0496114_0193825 3300048917 Bacteria 1778
899 Ga0496114_0552366 3300048917 Bacteria 1017
900 Ga0496115_0001276 3300048918 Bacteria 18017
901 Ga0496117_0035202 3300048920 Bacteria 3761
902 Ga0496117_0145341 3300048920 Bacteria 1413
903 Ga0496118_0081349 3300048921 Bacteria 2275
904 Ga0496118_0166729 3300048921 Bacteria 1352
905 Ga0496121_0010061 3300048924 Bacteria 10734
906 Ga0496121_0091548 3300048924 Bacteria 2374
907 Ga0496121_0119633 3300048924 Bacteria 1991
908 Ga0496121_0383918 3300048924 Bacteria 925
909 Ga0501047_0761326 3300049581 Bacteria 784
910 Ga0501067_0251704 3300049583 Bacteria 983
911 Ga0501069_0404565 3300049585 Bacteria 808
912 Ga0501070_0150955 3300049586 Bacteria 1917
913 Ga0501207_015384 3300049654 Bacteria 1177
914 Ga0501209_165255 3300049656 Bacteria 671
915 Ga0501230_023114 3300049667 Bacteria 1104
916 Ga0501235_061843 3300049669 Bacteria 877
917 Ga0501242_010235 3300049674 Bacteria 1118
918 Ga0501225_0180526 3300049705 Bacteria 659
919 Ga0501080_0166950 3300049742 Bacteria 2031
920 Ga0501080_0301101 3300049742 Bacteria 1454
921 Ga0501262_012451 3300049759 Bacteria 1088
922 Ga0501263_013000 3300049760 Bacteria 1050
923 Ga0501266_011216 3300049763 Bacteria 1147
924 Ga0501273_019093 3300049770 Bacteria 917
925 Ga0501044_0477174 3300049823 Bacteria 1151
926 Ga0501204_020545 3300049850 Bacteria 859
927 nmdc:mga05p37_484214_c1 3300050507 Bacteria 1424
928 nmdc:mga08y16_59077_c1 3300050511 Bacteria 4006
929 Ga0500644_0106169 3300053088 Bacteria 1075
930 Ga0500583_0137819 3300053092 Bacteria 1212
931 Ga0500651_0001347 3300053093 Bacteria 12292
932 Ga0500566_0340979 3300053094 Bacteria 690
933 Ga0500650_0454644 3300053098 Bacteria 549
934 Ga0500614_004605 3300053123 Bacteria 2907
935 Ga0500618_009124 3300053125 Bacteria 2725
936 Ga0500642_0011742 3300053130 Bacteria 3147
937 Ga0500652_055112 3300053131 Bacteria 1629
938 Ga0500655_000024 3300053133 Bacteria 43300
939 Ga0500655_028765 3300053133 Bacteria 1064
940 Ga0500559_0020678 3300053136 Bacteria 2784
941 Ga0500577_0085080 3300053142 Bacteria 1268
942 Ga0500622_0027441 3300053156 Bacteria 3002
943 Ga0500636_0476673 3300053177 Bacteria 557
944 Ga0500637_0471416 3300053178 Bacteria 631
945 Ga0500570_021758 3300053724 Bacteria 3567
946 Ga0466962_0006118 3300061719 Bacteria 5786
947 Ga0466962_0060993 3300061719 Bacteria 1800
948 Ga0466962_0296822 3300061719 Bacteria 799
949 2585260482 2582581305 Bacteria 4895574
950 2885430428 2885429604 Bacteria 3642894
951 Ga0207657_10547816
952 JGI24740J21852_10017541
953 JGI24739J22299_10003057
954 JGI24743J22301_10021352
955 JGI24735J21928_10105016
956 JGI24738J21930_10008075
957 Ga0065715_10143523
958 Ga0065715_10168109
959 Ga0065707_10275148
960 Ga0070658_10037425
961 Ga0070658_10056377
962 Ga0070658_10060592
963 Ga0070676_10009830
964 Ga0070676_10022190
965 Ga0070683_100213149
966 Ga0070690_100006137
967 Ga0070690_100044293
968 Ga0070690_100982737
969 Ga0070670_100000422
970 Ga0070670_100010702
971 Ga0070670_100150995
972 Ga0070670_100233467
973 Ga0070670_100311703
974 Ga0070670_100923842
975 Ga0070677_10040988
976 Ga0070677_10095244
977 Ga0070677_10111083
978 Ga0070677_10291910
979 Ga0068869_100294418
980 Ga0070666_10003753
981 Ga0070666_10033600
982 Ga0070666_10074162
983 Ga0070666_10245672
984 Ga0070666_10340228
985 Ga0070666_10795059
986 Ga0070680_100007616
987 Ga0070680_100011389
988 Ga0070680_100070587
989 Ga0068868_100005396
990 Ga0068868_100010219
991 Ga0068868_100012749
992 Ga0068868_100124481
993 Ga0068868_100790367
994 Ga0070660_100009796
995 Ga0070660_100009867
996 Ga0070660_100060630
997 Ga0070660_100108474
998 Ga0070660_100443960
999 Ga0070660_100540030
1000 Ga0070687_100180099
1001 Ga0070687_100612416
1002 Ga0070661_100020625
1003 Ga0070661_100033855
1004 Ga0070661_100053645
1005 Ga0070661_100104009
1006 Ga0070661_100105836
1007 Ga0070661_100219069
1008 Ga0070661_100337172
1009 Ga0070661_101083967
1010 Ga0070661_101531436
1011 Ga0070668_100002704
1012 Ga0070668_100038187
1013 Ga0070668_100352913
1014 Ga0070669_100015582
1015 Ga0070669_100317722
1016 Ga0070669_100574920
1017 Ga0070669_101095637
1018 Ga0070675_100029170
1019 Ga0070671_100007797
1020 Ga0070671_100011351
1021 Ga0070671_100040246
1022 Ga0070671_100045261
1023 Ga0070671_100087300
1024 Ga0070671_100100459
1025 Ga0070671_100116211
1026 Ga0070671_100557512
1027 Ga0070671_100597904
1028 Ga0070671_100768712
1029 Ga0070674_100014017
1030 Ga0070674_100020505
1031 Ga0070674_100195151
1032 Ga0070674_100276558
1033 Ga0070673_100006202
1034 Ga0070673_100031587
1035 Ga0070673_100064254
1036 Ga0070673_100150484
1037 Ga0070673_100198678
1038 Ga0070673_100762361
1039 Ga0070688_100182597
1040 Ga0070688_101299859
1041 Ga0070659_100002296
1042 Ga0070659_100003071
1043 Ga0070659_100006920
1044 Ga0070659_100023078
1045 Ga0070659_100032025
1046 Ga0070659_100085541
1047 Ga0070659_100114391
1048 Ga0070659_100115886
1049 Ga0070659_100542845
1050 Ga0070659_100571895
1051 Ga0070667_100028151
1052 Ga0070667_100053722
1053 Ga0070667_100094029
1054 Ga0070667_100236677
1055 Ga0070714_100610550
1056 Ga0070713_100032063
1057 Ga0070710_10648184
1058 Ga0070701_10703057
1059 Ga0070705_100225896
1060 Ga0070705_100738182
1061 Ga0070694_100013067
1062 Ga0070663_100133616
1063 Ga0070663_100217064
1064 Ga0070663_100296658
1065 Ga0070663_100600956
1066 Ga0070663_100670306
1067 Ga0070678_100010627
1068 Ga0070678_100119256
1069 Ga0070678_100372241
1070 Ga0070678_100551888
1071 Ga0070662_100003862
1072 Ga0070662_100008396
1073 Ga0070662_100023620
1074 Ga0070662_100028000
1075 Ga0070662_100039765
1076 Ga0070662_100078125
1077 Ga0070662_100118623
1078 Ga0070662_100141998
1079 Ga0070662_100458428
1080 Ga0070662_100789606
1081 Ga0070681_10305780
1082 Ga0070681_10650687
1083 Ga0070681_11247947
1084 Ga0068867_100006878
1085 Ga0068867_100011417
1086 Ga0068867_100024318
1087 Ga0068867_100042370
1088 Ga0070706_100593957
1089 Ga0070679_100032585
1090 Ga0070679_100099721
1091 Ga0070679_100173561
1092 Ga0070679_101371381
1093 Ga0070684_100658509
1094 Ga0070684_101208576
1095 Ga0068853_100002073
1096 Ga0068853_100041674
1097 Ga0068853_100069252
1098 Ga0068853_100073897
1099 Ga0068853_100188864
1100 Ga0068853_100317755
1101 Ga0068853_100379270
1102 Ga0068853_100651007
1103 Ga0068853_100787482
1104 Ga0068853_101076828
1105 Ga0070672_100001205
1106 Ga0070672_100003228
1107 Ga0070672_100026673
1108 Ga0070672_100080169
1109 Ga0070672_100400668
1110 Ga0070672_100418486
1111 Ga0070672_100490250
1112 Ga0070686_100131357
1113 Ga0070695_100076509
1114 Ga0070696_100008688
1115 Ga0070696_100063300
1116 Ga0070696_100374670
1117 Ga0070693_100201369
1118 Ga0070693_100418605
1119 Ga0070665_100010036
1120 Ga0070665_100022327
1121 Ga0070665_100053158
1122 Ga0070665_100056010
1123 Ga0070665_100077800
1124 Ga0070665_100173993
1125 Ga0070665_100364337
1126 Ga0070665_100833972
1127 Ga0070665_101672632
1128 Ga0070665_101692720
1129 Ga0068855_100195366
1130 Ga0068855_100414026
1131 Ga0068855_100452920
1132 Ga0068855_100748951
1133 Ga0068855_100753911
1134 Ga0068855_101848394
1135 Ga0070664_100006896
1136 Ga0070664_100010345
1137 Ga0070664_100047667
1138 Ga0070664_100053286
1139 Ga0070664_100062931
1140 Ga0070664_100074207
1141 Ga0070664_100111078
1142 Ga0068857_100017039
1143 Ga0068857_100173929
1144 Ga0068857_100216443
1145 Ga0068857_100248155
1146 Ga0068854_100051739
1147 Ga0068854_100061346
1148 Ga0068854_100147543
1149 Ga0068854_100190166
1150 Ga0068854_100316800
1151 Ga0068854_101180639
1152 Ga0068856_100054455
1153 Ga0068856_100134605
1154 Ga0068856_100177682
1155 Ga0068856_100252998
1156 Ga0068856_100620569
1157 Ga0068852_100000701
1158 Ga0068852_100108180
1159 Ga0068852_100147106
1160 Ga0068852_100253667
1161 Ga0068852_100335310
1162 Ga0068852_100474239
1163 Ga0068852_100504636
1164 Ga0068852_100886628
1165 Ga0068852_101240763
1166 Ga0068859_100168708
1167 Ga0068859_100284459
1168 Ga0068864_100013739
1169 Ga0068864_100081175
1170 Ga0068864_100134313
1171 Ga0068864_100368078
1172 Ga0068864_100863492
1173 Ga0068864_101915053
1174 Ga0068866_10273664
1175 Ga0068866_10332834
1176 Ga0068866_10882355
1177 Ga0068861_100050287
1178 Ga0068851_10001377
1179 Ga0068851_10115222
1180 Ga0068851_10228479
1181 Ga0068863_100001683
1182 Ga0068863_100010593
1183 Ga0068863_100017206
1184 Ga0068863_100179589
1185 Ga0068863_100198948
1186 Ga0068858_100018135
1187 Ga0068858_100078567
1188 Ga0068858_100081769
1189 Ga0068860_100033688
1190 Ga0068860_100051232
1191 Ga0068860_100080040
1192 Ga0068862_100168662
1193 Ga0068862_100861445
1194 Ga0068862_101095530
1195 Ga0081539_10013447
1196 Ga0070717_10036235
1197 Ga0070717_10242048
1198 Ga0097621_100327753
1199 Ga0068871_100001345
1200 Ga0068871_100008738
1201 Ga0068871_100426273
1202 Ga0068871_100488743
1203 Ga0075428_101054232
1204 Ga0075434_100962453
1205 Ga0075429_100701117
1206 Ga0068865_100013204
1207 Ga0068865_100037028
1208 Ga0068865_100179611
1209 Ga0068865_101538202
1210 Ga0097620_100168706
1211 Ga0097620_100284460
1212 Ga0097620_100838277
1213 Ga0105251_10094397
1214 Ga0105240_10010008
1215 Ga0105240_10402144
1216 Ga0105240_11227897
1217 Ga0111539_10030770
1218 Ga0111539_11881274
1219 Ga0105245_10005505
1220 Ga0105247_10212222
1221 Ga0105247_11231991
1222 Ga0105241_10174154
1223 Ga0105241_10387801
1224 Ga0105241_11262712
1225 Ga0105242_10064883
1226 Ga0105248_10002618
1227 Ga0105248_10074018
1228 Ga0105248_10079494
1229 Ga0105248_10125694
1230 Ga0105248_10173656
1231 Ga0105248_10227329
1232 Ga0105248_10592550
1233 Ga0105248_10597343
1234 Ga0105248_10867468
1235 Ga0105248_10881424
1236 Ga0105248_12276750
1237 Ga0105237_10006648
1238 Ga0105237_10974073
1239 Ga0105237_11984288
1240 Ga0105238_10024869
1241 Ga0105238_10363771
1242 Ga0105238_10641939
1243 Ga0105239_10000060
1244 Ga0105239_11232564
1245 Ga0105246_10098684
1246 Ga0105246_11887320
1247 Ga0157373_10067610
1248 Ga0157373_10168343
1249 Ga0157373_10193377
1250 Ga0157373_10236861
1251 Ga0157373_10291710
1252 Ga0157371_10002316
1253 Ga0157371_10046715
1254 Ga0157371_10110239
1255 Ga0157371_10167609
1256 Ga0157370_10007886
1257 Ga0157370_10056019
1258 Ga0157369_10116175
1259 Ga0157369_10158678
1260 Ga0157369_10167078
1261 Ga0157369_10390758
1262 Ga0157369_10420402
1263 Ga0157369_10463809
1264 Ga0157369_10476858
1265 Ga0157369_10716366
1266 Ga0157369_11408803
1267 Ga0157374_10175209
1268 Ga0157374_10193435
1269 Ga0157374_10412235
1270 Ga0157374_10678337
1271 Ga0157378_10012389
1272 Ga0163162_10211509
1273 Ga0157372_10044111
1274 Ga0157372_10209468
1275 Ga0157372_10674106
1276 Ga0157372_10788225
1277 Ga0157372_11902756
1278 Ga0157372_12443937
1279 Ga0157375_10035574
1280 Ga0157375_10235851
1281 Ga0163163_10156508
1282 Ga0163163_11313283
1283 Ga0157380_10592611
1284 Ga0157379_10002119
1285 Ga0157379_10255877
1286 Ga0157379_10274607
1287 Ga0157379_11875106
1288 Ga0157376_10001755
1289 Ga0157376_11138605
1290 Ga0163161_10000753
1291 Ga0163161_10331696
1292 Ga0163161_10757440
1293 Ga0209148_1000074
1294 Ga0209050_1067444
1295 Ga0207697_10011449
1296 Ga0207697_10016196
1297 Ga0207697_10101895
1298 Ga0207656_10004618
1299 Ga0207656_10174425
1300 Ga0207682_10016220
1301 Ga0207682_10018394
1302 Ga0207642_10022795
1303 Ga0207642_10060353
1304 Ga0207710_10355225
1305 Ga0207688_10002587
1306 Ga0207688_10071998
1307 Ga0207688_10157928
1308 Ga0207688_10183974
1309 Ga0207680_10035912
1310 Ga0207680_10039631
1311 Ga0207680_10223167
1312 Ga0207680_10555842
1313 Ga0207680_10789255
1314 Ga0207647_10039174
1315 Ga0207647_10121443
1316 Ga0207645_10018108
1317 Ga0207645_10045502
1318 Ga0207645_10055318
1319 Ga0207643_10392092
1320 Ga0207705_10018941
1321 Ga0207705_10019577
1322 Ga0207705_10052480
1323 Ga0207705_10057556
1324 Ga0207705_10077199
1325 Ga0207705_10081032
1326 Ga0207705_10193400
1327 Ga0207705_10204229
1328 Ga0207684_10172607
1329 Ga0207707_10070618
1330 Ga0207707_10173026
1331 Ga0207707_10555313
1332 Ga0207707_10922198
1333 Ga0207695_10012047
1334 Ga0207695_10265063
1335 Ga0207695_10363569
1336 Ga0207671_10007438
1337 Ga0207660_10000049
1338 Ga0207660_10011512
1339 Ga0207660_10172158
1340 Ga0207662_10207101
1341 Ga0207662_10626530
1342 Ga0207657_10002900
1343 Ga0207657_10016916
1344 Ga0207657_10022407
1345 Ga0207657_10026926
1346 Ga0207657_10031512
1347 Ga0207657_10031868
1348 Ga0207657_10197282
1349 Ga0207657_10251697
1350 Ga0207657_10479429
1351 Ga0207657_11344084
1352 Ga0207649_10025323
1353 Ga0207649_10075191
1354 Ga0207649_10112222
1355 Ga0207649_10121478
1356 Ga0207649_10500330
1357 Ga0207649_10614314
1358 Ga0207649_11109748
1359 Ga0207649_11165257
1360 Ga0207652_10067386
1361 Ga0207652_11216275
1362 Ga0207681_10068303
1363 Ga0207681_10424796
1364 Ga0207694_10524221
1365 Ga0207694_10746867
1366 Ga0207694_11192468
1367 Ga0207650_10016967
1368 Ga0207650_10193740
1369 Ga0207650_10287625
1370 Ga0207650_10450126
1371 Ga0207650_10501538
1372 Ga0207650_11364314
1373 Ga0207659_10009328
1374 Ga0207687_10006509
1375 Ga0207700_10475863
1376 Ga0207664_10187531
1377 Ga0207664_10305492
1378 Ga0207664_10684370
1379 Ga0207644_10000509
1380 Ga0207644_10000695
1381 Ga0207644_10041098
1382 Ga0207644_10096750
1383 Ga0207644_10102127
1384 Ga0207644_10119077
1385 Ga0207644_10163637
1386 Ga0207644_10190431
1387 Ga0207644_10229809
1388 Ga0207644_10470531
1389 Ga0207644_10577698
1390 Ga0207644_10734795
1391 Ga0207644_10829216
1392 Ga0207690_10010300
1393 Ga0207690_10023086
1394 Ga0207690_10029851
1395 Ga0207690_10060090
1396 Ga0207690_10096570
1397 Ga0207690_10131345
1398 Ga0207690_10158789
1399 Ga0207690_10161813
1400 Ga0207690_10201453
1401 Ga0207690_10409086
1402 Ga0207690_10510915
1403 Ga0207690_10512112
1404 Ga0207690_10704290
1405 Ga0207706_10001263
1406 Ga0207706_10005392
1407 Ga0207706_10006331
1408 Ga0207706_10014922
1409 Ga0207706_10016981
1410 Ga0207706_10039663
1411 Ga0207706_10075280
1412 Ga0207706_10080816
1413 Ga0207706_10095377
1414 Ga0207706_10112002
1415 Ga0207706_10262962
1416 Ga0207706_10445596
1417 Ga0207686_10053445
1418 Ga0207670_10951820
1419 Ga0207669_10060965
1420 Ga0207669_10152113
1421 Ga0207669_10527392
1422 Ga0207669_10633578
1423 Ga0207669_10784946
1424 Ga0207669_11121484
1425 Ga0207704_10315262
1426 Ga0207704_10361257
1427 Ga0207704_10687176
1428 Ga0207691_10003542
1429 Ga0207691_10004608
1430 Ga0207691_10133027
1431 Ga0207691_10150662
1432 Ga0207691_10186794
1433 Ga0207691_10411420
1434 Ga0207711_10002650
1435 Ga0207711_10008614
1436 Ga0207711_10052294
1437 Ga0207711_10077756
1438 Ga0207711_10148696
1439 Ga0207711_10163144
1440 Ga0207711_10889427
1441 Ga0207711_11718663
1442 Ga0207689_10006370
1443 Ga0207689_10170844
1444 Ga0207689_11082597
1445 Ga0207661_10330963
1446 Ga0207661_10788459
1447 Ga0207679_10021325
1448 Ga0207679_10029582
1449 Ga0207679_10051617
1450 Ga0207679_10052376
1451 Ga0207679_10067784
1452 Ga0207679_10250066
1453 Ga0207679_10286606
1454 Ga0207679_10349895
1455 Ga0207679_10511093
1456 Ga0207679_10532028
1457 Ga0207667_10034109
1458 Ga0207667_10037751
1459 Ga0207667_10089819
1460 Ga0207667_10133559
1461 Ga0207667_10194288
1462 Ga0207667_10260465
1463 Ga0207667_10292857
1464 Ga0207651_10008656
1465 Ga0207651_10026727
1466 Ga0207651_10037646
1467 Ga0207651_10079061
1468 Ga0207651_10173360
1469 Ga0207651_10195391
1470 Ga0207651_10911708
1471 Ga0207651_11960517
1472 Ga0207668_10000223
1473 Ga0207668_10009988
1474 Ga0207668_10027960
1475 Ga0207640_10031126
1476 Ga0207640_10038320
1477 Ga0207640_10055962
1478 Ga0207640_10088519
1479 Ga0207640_10457922
1480 Ga0207640_10645525
1481 Ga0207640_10667451
1482 Ga0207640_11095992
1483 Ga0207640_11216673
1484 Ga0207658_10033187
1485 Ga0207658_10052808
1486 Ga0207658_10129902
1487 Ga0207658_10175029
1488 Ga0207658_10475277
1489 Ga0207658_10709255
1490 Ga0207677_10008314
1491 Ga0207677_10097441
1492 Ga0207677_10119456
1493 Ga0207677_10189026
1494 Ga0207703_10038441
1495 Ga0207703_10060516
1496 Ga0207639_10050420
1497 Ga0207639_10063520
1498 Ga0207639_10326196
1499 Ga0207639_10561483
1500 Ga0207639_10956291
1501 Ga0207639_10976708
1502 Ga0207639_10987537
1503 Ga0207639_11407919
1504 Ga0207678_10004058
1505 Ga0207678_10049150
1506 Ga0207678_10157338
1507 Ga0207678_10453680
1508 Ga0207678_10791721
1509 Ga0207702_10021421
1510 Ga0207702_10272032
1511 Ga0207702_10295189
1512 Ga0207641_10021253
1513 Ga0207641_10028343
1514 Ga0207641_10070223
1515 Ga0207641_10132931
1516 Ga0207641_10269465
1517 Ga0207648_10005333
1518 Ga0207648_10012960
1519 Ga0207648_10064774
1520 Ga0207648_11313701
1521 Ga0207676_10058082
1522 Ga0207676_10242122
1523 Ga0207676_10420388
1524 Ga0207674_10001193
1525 Ga0207674_10005620
1526 Ga0207674_10021911
1527 Ga0207674_10143250
1528 Ga0207674_10153875
1529 Ga0207674_11377826
1530 Ga0207675_100076027
1531 Ga0207675_100279557
1532 Ga0207683_10003015
1533 Ga0207683_10154102
1534 Ga0207683_10200732
1535 Ga0207683_10983566
1536 Ga0207698_10001855
1537 Ga0207698_10005772
1538 Ga0207698_10112168
1539 Ga0207698_10115473
1540 Ga0207698_10181557
1541 Ga0207698_10235678
1542 Ga0207698_10284926
1543 Ga0207698_10346066
1544 Ga0207698_10461524
1545 Ga0207698_11632022
1546 Ga0207428_10176698
1547 Ga0268266_10006287
1548 Ga0268266_10012139
1549 Ga0268266_10018445
1550 Ga0268266_10058512
1551 Ga0268266_10134510
1552 Ga0268266_10204234
1553 Ga0268266_10465213
1554 Ga0268266_10707481
1555 Ga0268265_10005469
1556 Ga0268265_10008030
1557 Ga0268265_10215513
1558 Ga0268265_11064960
1559 Ga0268264_10036404
1560 Ga0268264_10049982
1561 Ga0268264_10500006
1562 Ga0268264_11088030
1563 Ga0316177_1210950
1564 Ga0316180_1062979
1565 Ga0316182_1140734
1566 Ga0316182_1144134
1567 Ga0307408_100163768
1568 Ga0307408_100398622
1569 Ga0307405_10164728
1570 Ga0307405_10321010
1571 Ga0307405_10539670
1572 Ga0307413_10187428
1573 Ga0307413_10326273
1574 Ga0307410_10002928
1575 Ga0307410_10044413
1576 Ga0307410_10288988
1577 Ga0307410_10403244
1578 Ga0307410_10873499
1579 Ga0307410_10981666
1580 Ga0307406_10013951
1581 Ga0307406_10267675
1582 Ga0307406_10827585
1583 Ga0307407_10036218
1584 Ga0307412_10568728
1585 Ga0307412_10759681
1586 Ga0307412_10779618
1587 Ga0307409_100046154
1588 Ga0307409_100262459
1589 Ga0307409_100373285
1590 Ga0307409_101199443
1591 Ga0307416_100006418
1592 Ga0307416_100191991
1593 Ga0307414_10029899
1594 Ga0307414_10039519
1595 Ga0307414_10304499
1596 Ga0307411_10025437
1597 Ga0307411_10035258
1598 Ga0307411_10372435
1599 Ga0307411_10513836
1600 Ga0307411_10626724
1601 Ga0307415_100002963
1602 Ga0307415_100021255
1603 Ga0307415_100069374
1604 Ga0373943_0051315
1605 Ga0373946_0212326
1606 Ga0373935_0079963
1607 Ga0373927_0082841
1608 Ga0373927_0183411
1609 Ga0373947_0082771
1610 Ga0373925_0092034
1611 Ga0395899_0008297
1612 Ga0395899_0009091
1613 Ga0395899_0060438
1614 Ga0395899_0072004
1615 Ga0395899_0105033
1616 Ga0395899_0106949
1617 Ga0395899_0112093
1618 Ga0395899_0114908
1619 Ga0395899_0123329
1620 Ga0395899_0130707
1621 Ga0395899_0137676
1622 Ga0395899_0312074
1623 Ga0395899_0556918
1624 Ga0395899_0592063
1625 Ga0395900_0030787
1626 Ga0395900_0031221
1627 Ga0395900_0050281
1628 Ga0395900_0058460
1629 Ga0395900_0066682
1630 Ga0395900_0162196
1631 Ga0395900_0167190
1632 Ga0395900_0180084
1633 Ga0395900_0314059
1634 Ga0395900_0354776
1635 Ga0395900_0466009
1636 Ga0395900_0486048
1637 Ga0395900_0497078
1638 Ga0395900_0619142
1639 Ga0395900_0627687
1640 Ga0395900_0770248
1641 Ga0395900_0923665
1642 Ga0395898_0042401
1643 Ga0395898_0079695
1644 Ga0395898_0082482
1645 Ga0395898_0131366
1646 Ga0395898_0160891
1647 Ga0395898_0349405
1648 Ga0395898_0406802
1649 Ga0395898_0474411
1650 Ga0395898_1383332
1651 Ga0395905_0001174
1652 Ga0395905_0001175
1653 Ga0395905_0001635
1654 Ga0395905_0007031
1655 Ga0395905_0010072
1656 Ga0395905_0012852
1657 Ga0395905_0013915
1658 Ga0395905_0031979
1659 Ga0395905_0032488
1660 Ga0395905_0034337
1661 Ga0395905_0036663
1662 Ga0395905_0037397
1663 Ga0395905_0053488
1664 Ga0395905_0073212
1665 Ga0395905_0104678
1666 Ga0395905_0177163
1667 Ga0395905_0225210
1668 Ga0395905_0227235
1669 Ga0395905_0245596
1670 Ga0395905_0248181
1671 Ga0395905_0285808
1672 Ga0395905_0289513
1673 Ga0395905_0324181
1674 Ga0395905_0457085
1675 Ga0395905_0537633
1676 Ga0395905_0750005
1677 Ga0395905_0991077
1678 Ga0395905_1054831
1679 Ga0395905_1067643
1680 Ga0436364_0873098
1681 Ga0395901_0006288
1682 Ga0395901_0009338
1683 Ga0395901_0012424
1684 Ga0395901_0017002
1685 Ga0395901_0027440
1686 Ga0395901_0039648
1687 Ga0395901_0042407
1688 Ga0395901_0057895
1689 Ga0395901_0077643
1690 Ga0395901_0101584
1691 Ga0395901_0138970
1692 Ga0395901_0159693
1693 Ga0395901_0241240
1694 Ga0395901_0267183
1695 Ga0395901_0718150
1696 Ga0395901_0792188
1697 Ga0395901_1239840
1698 Ga0395901_1368199
1699 Ga0395901_1542207
1700 Ga0436365_1532646
1701 Ga0451789_0771960
1702 Ga0439455_0111941
1703 Ga0450914_006994
1704 Ga0450917_001974
1705 Ga0450889_000017
1706 Ga0466972_0086759
1707 Ga0466972_0322875
1708 Ga0466966_0093805
1709 Ga0466966_0097655
1710 Ga0466961_0006839
1711 Ga0466961_0224815
1712 Ga0466961_0247065
1713 Ga0466961_0803561
1714 Ga0466963_0004653
1715 Ga0466963_0007062
1716 Ga0466963_0017889
1717 Ga0466963_0047585
1718 Ga0466963_0069664
1719 Ga0466963_0114071
1720 Ga0466963_0217569
1721 Ga0466963_0231301
1722 Ga0466963_0338636
1723 Ga0466964_0036872
1724 Ga0466964_0108279
1725 Ga0466964_0870768
1726 Ga0466971_0002967
1727 Ga0466971_0190980
1728 Ga0466971_0225616
1729 Ga0466971_0286780
1730 Ga0466971_0326584
1731 Ga0466968_0010984
1732 Ga0466968_0028865
1733 Ga0466970_0120906
1734 Ga0466957_0032622
1735 Ga0466957_0033593
1736 Ga0466957_0069784
1737 Ga0466957_0073894
1738 Ga0466957_0117395
1739 Ga0466957_0272872
1740 Ga0466957_0477177
1741 Ga0466957_0953016
1742 Ga0466959_0106462
1743 Ga0466959_0845949
1744 Ga0466958_0039442
1745 Ga0466958_0138975
1746 Ga0466958_0189969
1747 Ga0466958_0253039
1748 Ga0466958_0302518
1749 Ga0466967_0032422
1750 Ga0466967_0037046
1751 Ga0466967_0103832
1752 Ga0466967_0158966
1753 Ga0466967_0180079
1754 Ga0466967_0215083
1755 Ga0466967_0333811
1756 Ga0466967_0334961
1757 Ga0466967_0415143
1758 Ga0466967_0470126
1759 Ga0466967_0630520
1760 Ga0466967_0842109
1761 Ga0466967_0893432
1762 Ga0495603_0640943
1763 Ga0495582_0163979
1764 Ga0495583_0255369
1765 Ga0495610_0319515
1766 Ga0495631_0232478
1767 Ga0495637_0040347
1768 Ga0495643_0035548
1769 Ga0495609_0070881
1770 Ga0495621_0066778
1771 Ga0495597_0019400
1772 Ga0495668_0012074
1773 Ga0495668_0024021
1774 Ga0495668_0085651
1775 Ga0495625_0050498
1776 Ga0495625_0113653
1777 Ga0495625_0709670
1778 Ga0495669_0000184
1779 Ga0495669_0001430
1780 Ga0495669_0009152
1781 Ga0495669_0014479
1782 Ga0495669_0022601
1783 Ga0495669_0053100
1784 Ga0495669_0165675
1785 Ga0495676_0256109
1786 Ga0495677_0288568
1787 Ga0496100_0040385
1788 Ga0496100_0099724
1789 Ga0496101_0001040
1790 Ga0496101_0320053
1791 Ga0496101_0651642
1792 Ga0496102_0062289
1793 Ga0496102_0245689
1794 Ga0496102_0267790
1795 Ga0496102_0990250
1796 Ga0496102_1052246
1797 Ga0496103_0005416
1798 Ga0496103_0063781
1799 Ga0496103_0147779
1800 Ga0496104_0111507
1801 Ga0496104_0218286
1802 Ga0496104_0270944
1803 Ga0496105_0006326
1804 Ga0496105_0163923
1805 Ga0496105_0491717
1806 Ga0496106_0019842
1807 Ga0496106_0050227
1808 Ga0496107_0031060
1809 Ga0496107_0052671
1810 Ga0496107_0079150
1811 Ga0496107_0080554
1812 Ga0496108_0003932
1813 Ga0496108_0004045
1814 Ga0496108_0026421
1815 Ga0496108_0038822
1816 Ga0496108_0090472
1817 Ga0496108_0307071
1818 Ga0496109_0004440
1819 Ga0496109_0012998
1820 Ga0496109_0082466
1821 Ga0496109_0089020
1822 Ga0496109_0163708
1823 Ga0496109_0363486
1824 Ga0496110_0006143
1825 Ga0496110_0010886
1826 Ga0496110_0032975
1827 Ga0496110_0086647
1828 Ga0496110_0127387
1829 Ga0496110_0212476
1830 Ga0496111_0002690
1831 Ga0496111_0012440
1832 Ga0496111_0044211
1833 Ga0496111_0099788
1834 Ga0496111_0126818
1835 Ga0496111_0207711
1836 Ga0496111_0604712
1837 Ga0496112_0012868
1838 Ga0496112_0055495
1839 Ga0496112_0072117
1840 Ga0496112_0092636
1841 Ga0496112_0725279
1842 Ga0496112_0860695
1843 Ga0496112_1292029
1844 Ga0496113_0021034
1845 Ga0496113_0031422
1846 Ga0496113_0128887
1847 Ga0496114_0070577
1848 Ga0496114_0193825
1849 Ga0496114_0552366
1850 Ga0496115_0001276
1851 Ga0496117_0035202
1852 Ga0496117_0145341
1853 Ga0496118_0081349
1854 Ga0496118_0166729
1855 Ga0496121_0010061
1856 Ga0496121_0091548
1857 Ga0496121_0119633
1858 Ga0496121_0383918
1859 Ga0501047_0761326
1860 Ga0501067_0251704
1861 Ga0501069_0404565
1862 Ga0501070_0150955
1863 Ga0501207_015384
1864 Ga0501209_165255
1865 Ga0501230_023114
1866 Ga0501235_061843
1867 Ga0501242_010235
1868 Ga0501225_0180526
1869 Ga0501080_0166950
1870 Ga0501080_0301101
1871 Ga0501262_012451
1872 Ga0501263_013000
1873 Ga0501266_011216
1874 Ga0501273_019093
1875 Ga0501044_0477174
1876 Ga0501204_020545
1877 nmdc:mga05p37_484214_c1
1878 nmdc:mga08y16_59077_c1
1879 Ga0500644_0106169
1880 Ga0500583_0137819
1881 Ga0500651_0001347
1882 Ga0500566_0340979
1883 Ga0500650_0454644
1884 Ga0500614_004605
1885 Ga0500618_009124
1886 Ga0500642_0011742
1887 Ga0500652_055112
1888 Ga0500655_000024
1889 Ga0500655_028765
1890 Ga0500559_0020678
1891 Ga0500577_0085080
1892 Ga0500622_0027441
1893 Ga0500636_0476673
1894 Ga0500637_0471416
1895 Ga0500570_021758
1896 Ga0466962_0006118
1897 Ga0466962_0060993
1898 Ga0466962_0296822
1899 2585260482
1900 2885430428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

17

146

0.96

PF22769

DCD

dCTP deaminase-like

28

122

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.9292 5 122
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.9214 5 122
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.8971 1 128
3tp1-assembly1.cif.gz_A crystal structure of the precatalytic m-pmv dutpase - substrate (dupnpp) complex 0.8863 17 125
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.8854 3 129
ID Description Score Start End Superfamily
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9148 17 119 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8875 1 131 2.70.40.10
5y5qC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8828 3 122 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8726 3 130 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8641 1 131 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9552 1 122
AF-A0A2E9CZE5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9452 2 117 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X1TBK2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9412 1 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X1TBK2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9264 1 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9257 1 122

Map