F486557

General Info

Members Datasets Scaffolds Average Seq Length
950 607 1900 256

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10214309|Ga0307411_102143092
Length 298
Sequence MIIVILFEHVPPRNIPLGLPLTSRRNVLGSGGNRPDQVTENNMEMLNPHCGIDRDGRGVVRLSICNAGSLNILSSAVTDGVREGFEKLASDKTIRAVILAGQSEKSMIGGADIKEMAKLDQKSAEAFITRLRDLCEAVRRFPAPVIARLPGWCLGGGLEVAAACDFRIAAHDAKFGMPEVRVGIPSVIHAALLPRLIGWGRARWLVMTAENIDAPTAHTWGLVDVVAEEGGLDAAVEHTVKALLECGPEALRAQKALMRQWEELPLTESVNLSIEVFGKSFLTGEPQRLMQGFLERKK

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
66 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
92 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
93 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
94 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
357 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
368 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
369 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
380 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
384 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
385 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
386 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
387 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
388 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
389 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
390 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
391 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
392 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
393 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
394 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
395 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
396 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
397 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
398 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
399 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
400 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
401 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
402 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
403 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
404 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
405 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
406 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
407 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
408 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
409 2643221621 Achromobacter sp. Root83 Isolate Unclassified
410 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
411 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
412 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
413 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
414 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
415 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
416 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
417 2791355199
418 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
419 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
420 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
421 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
422 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
423 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
424 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
425 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
426 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
427 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
428 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
429 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
430 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
431 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
432 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
433 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
434 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
435 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
436 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
437 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
438 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
439 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
440 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
441 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
442 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
443 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
444 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
445 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
446 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
447 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
448 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
449 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
450 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
451 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
452 2855730933 Achromobacter sp. HZ28 Isolate Nodule
453 2855767633 Achromobacter sp. HZ34 Isolate Nodule
454 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
455 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
456 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
457 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
458 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
459 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
460 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
461 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
462 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
463 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
464 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
465 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
466 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
467 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
468 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
469 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
470 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
471 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
472 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
473 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
474 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
475 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
476 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
477 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
478 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
479 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
480 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
481 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
482 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
483 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
484 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
485 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
486 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
487 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
488 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
489 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
490 2904699407
491 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
492 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
493 2906610324
494 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
495 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
496 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
497 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
498 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
499 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
500 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
501 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
502 2922368715
503 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
504 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
505 2922425934
506 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
507 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
508 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
509 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
510 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
511 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
512 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
513 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
514 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
515 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
516 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
517 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
518 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
519 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
520 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
521 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
522 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
523 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
524 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
525 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
526 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
527 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
528 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
529 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
530 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
531 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
532 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
533 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
534 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
535 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
536 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
537 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
538 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
539 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
540 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
541 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
542 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
543 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
544 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
545 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
546 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
547 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
548 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
549 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
550 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
551 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
552 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
553 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
554 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
555 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
556 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
557 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
558 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
559 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
560 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
561 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
562 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
563 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
564 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
565 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
566 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
567 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
568 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
569 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
570 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
571 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
572 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
573 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
574 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
575 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
576 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
577 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
578 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
579 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
580 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
581 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
582 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
583 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
584 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
585 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
586 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
587 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
588 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
589 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
590 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
591 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
592 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
593 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
594 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
595 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
596 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
597 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
598 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
599 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
600 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
601 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
602 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
603 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
604 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
605 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
606 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
607 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.72
Metatranscriptomes 0
Isolates 23.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 17.79
Rhizoplane 5.37
Rhizosphere 50.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10214309 3300032005 Bacteria 1489
2 JGI25151J46595_10000771 3300003187 Bacteria 25948
3 JGI25406J46586_10010965 3300003203 Bacteria 3989
4 JGI25153J46596_10001356 3300003215 Bacteria 14648
5 JGI25153J46596_10003157 3300003215 Bacteria 9295
6 JGI25153J46596_10006306 3300003215 Bacteria 6038
7 JGI25160J50197_1001301 3300003354 Bacteria 12602
8 JGI25160J50197_1018309 3300003354 Bacteria 2188
9 JGI25404J52841_10007507 3300003659 Bacteria 2307
10 JGI25404J52841_10026821 3300003659 Bacteria 1239
11 Ga0055531_10001373 3300003794 Bacteria 18075
12 Ga0055543_1005177 3300004625 Bacteria 3379
13 Ga0065165_1000231 3300005262 Bacteria 97237
14 Ga0065165_1001615 3300005262 Bacteria 22970
15 Ga0065165_1012190 3300005262 Bacteria 3519
16 Ga0065165_1030497 3300005262 Bacteria 1714
17 Ga0070683_100073945 3300005329 Bacteria 3182
18 Ga0070683_100129317 3300005329 Bacteria 2389
19 Ga0070690_100268989 3300005330 Bacteria 1212
20 Ga0068868_100006460 3300005338 Bacteria 8297
21 Ga0070660_100078143 3300005339 Bacteria 2594
22 Ga0070669_100082491 3300005353 Bacteria 2397
23 Ga0070675_100121948 3300005354 Bacteria 2215
24 Ga0070671_100207479 3300005355 Bacteria 1662
25 Ga0070671_100326443 3300005355 Bacteria 1308
26 Ga0070671_100435493 3300005355 Bacteria 1124
27 Ga0070674_100042283 3300005356 Bacteria 3094
28 Ga0070674_100068497 3300005356 Bacteria 2500
29 Ga0070673_100470675 3300005364 Bacteria 1133
30 Ga0070659_100033068 3300005366 Bacteria 4015
31 Ga0070659_100135974 3300005366 Bacteria 1999
32 Ga0070659_100259853 3300005366 Bacteria 1441
33 Ga0070667_100207919 3300005367 Bacteria 1739
34 Ga0070667_100418830 3300005367 Bacteria 1221
35 Ga0070709_10000351 3300005434 Bacteria 28490
36 Ga0070709_10059167 3300005434 Bacteria 2432
37 Ga0070709_10097368 3300005434 Bacteria 1953
38 Ga0070709_10181078 3300005434 Bacteria 1480
39 Ga0070709_10281330 3300005434 Bacteria 1209
40 Ga0070714_100028697 3300005435 Bacteria 4620
41 Ga0070714_100060765 3300005435 Bacteria 3244
42 Ga0070714_100114084 3300005435 Bacteria 2397
43 Ga0070714_100191918 3300005435 Bacteria 1864
44 Ga0070714_100419947 3300005435 Bacteria 1267
45 Ga0070713_100010740 3300005436 Bacteria 6632
46 Ga0070713_100045355 3300005436 Bacteria 3602
47 Ga0070713_100134091 3300005436 Bacteria 2187
48 Ga0070713_100169677 3300005436 Bacteria 1954
49 Ga0070710_10000790 3300005437 Bacteria 15175
50 Ga0070710_10006588 3300005437 Bacteria 5584
51 Ga0070710_10021776 3300005437 Bacteria 3346
52 Ga0070710_10023705 3300005437 Bacteria 3229
53 Ga0070711_100003109 3300005439 Bacteria 9606
54 Ga0070711_100005522 3300005439 Bacteria 7570
55 Ga0070663_100030695 3300005455 Bacteria 3686
56 Ga0070663_100060153 3300005455 Bacteria 2731
57 Ga0070663_100118917 3300005455 Bacteria 1994
58 Ga0070663_100141497 3300005455 Bacteria 1837
59 Ga0070678_100158271 3300005456 Bacteria 1832
60 Ga0070678_100347736 3300005456 Bacteria 1274
61 Ga0070706_100556312 3300005467 Bacteria 1067
62 Ga0070679_100055233 3300005530 Bacteria 3955
63 Ga0070679_100166882 3300005530 Bacteria 2175
64 Ga0070679_100186312 3300005530 Bacteria 2046
65 Ga0070684_100023204 3300005535 Bacteria 5185
66 Ga0070684_100645903 3300005535 Bacteria 985
67 Ga0068853_100474643 3300005539 Bacteria 1179
68 Ga0068853_100560449 3300005539 Bacteria 1083
69 Ga0070672_100397050 3300005543 Bacteria 1181
70 Ga0070665_100025947 3300005548 Bacteria 5901
71 Ga0070665_100036979 3300005548 Bacteria 4910
72 Ga0070665_100060854 3300005548 Bacteria 3785
73 Ga0070665_100151628 3300005548 Bacteria 2321
74 Ga0070665_100200021 3300005548 Bacteria 1999
75 Ga0070665_100203493 3300005548 Bacteria 1980
76 Ga0070665_100208313 3300005548 Bacteria 1956
77 Ga0070665_100871143 3300005548 Bacteria 913
78 Ga0068855_100102451 3300005563 Bacteria 3295
79 Ga0068855_100315982 3300005563 Bacteria 1727
80 Ga0068857_100083327 3300005577 Bacteria 2856
81 Ga0068854_100012639 3300005578 Bacteria 5533
82 Ga0068854_100280741 3300005578 Bacteria 1341
83 Ga0068854_100321672 3300005578 Bacteria 1257
84 Ga0068856_100000020 3300005614 Bacteria 146775
85 Ga0068856_100004981 3300005614 Bacteria 13148
86 Ga0068856_100592409 3300005614 Bacteria 1130
87 Ga0070702_100082602 3300005615 Bacteria 1928
88 Ga0068852_100025025 3300005616 Bacteria 4832
89 Ga0068866_10055899 3300005718 Bacteria 2029
90 Ga0068861_100037780 3300005719 Bacteria 3590
91 Ga0068861_100059734 3300005719 Bacteria 2920
92 Ga0068851_10192907 3300005834 Bacteria 1133
93 Ga0068858_100177740 3300005842 Bacteria 2009
94 Ga0068860_100181433 3300005843 Bacteria 2034
95 Ga0068860_100701869 3300005843 Bacteria 1021
96 Ga0068862_100053644 3300005844 Bacteria 3451
97 Ga0068862_100092250 3300005844 Bacteria 2640
98 Ga0068862_100185838 3300005844 Bacteria 1867
99 Ga0081455_10002087 3300005937 Bacteria 23835
100 Ga0081455_10178435 3300005937 Bacteria 1611
101 Ga0081540_1000544 3300005983 Bacteria 36521
102 Ga0081540_1002537 3300005983 Bacteria 14812
103 Ga0081540_1007763 3300005983 Bacteria 7594
104 Ga0081540_1014601 3300005983 Bacteria 5021
105 Ga0081540_1018042 3300005983 Bacteria 4344
106 Ga0081540_1019612 3300005983 Bacteria 4101
107 Ga0081540_1052409 3300005983 Bacteria 2009
108 Ga0081540_1080110 3300005983 Bacteria 1474
109 Ga0081539_10001065 3300005985 Bacteria 50187
110 Ga0081539_10025008 3300005985 Bacteria 3858
111 Ga0070717_10033314 3300006028 Bacteria 4156
112 Ga0070717_10035208 3300006028 Bacteria 4051
113 Ga0070717_10196040 3300006028 Bacteria 1767
114 Ga0075365_10015033 3300006038 Bacteria 4671
115 Ga0075365_10016997 3300006038 Bacteria 4442
116 Ga0075365_10027865 3300006038 Bacteria 3598
117 Ga0075365_10080641 3300006038 Bacteria 2203
118 Ga0075365_10081177 3300006038 Bacteria 2197
119 Ga0075368_10005507 3300006042 Bacteria 4359
120 Ga0075368_10012445 3300006042 Bacteria 3110
121 Ga0075368_10069060 3300006042 Bacteria 1425
122 Ga0075363_100003747 3300006048 Bacteria 6543
123 Ga0075363_100042738 3300006048 Bacteria 2395
124 Ga0075363_100094667 3300006048 Bacteria 1647
125 Ga0075364_10021240 3300006051 Bacteria 4090
126 Ga0070715_10047457 3300006163 Bacteria 1830
127 Ga0070716_100001893 3300006173 Bacteria 9489
128 Ga0070716_100002939 3300006173 Bacteria 7944
129 Ga0070716_100032549 3300006173 Bacteria 2845
130 Ga0070712_100014227 3300006175 Bacteria 5106
131 Ga0070712_100034601 3300006175 Bacteria 3425
132 Ga0070712_100055261 3300006175 Bacteria 2780
133 Ga0070712_100131428 3300006175 Bacteria 1898
134 Ga0070712_100207338 3300006175 Bacteria 1544
135 Ga0075362_10010396 3300006177 Bacteria 3632
136 Ga0075367_10029633 3300006178 Bacteria 3132
137 Ga0075367_10088416 3300006178 Bacteria 1883
138 Ga0075367_10139696 3300006178 Bacteria 1500
139 Ga0075367_10286152 3300006178 Bacteria 1037
140 Ga0075369_10024341 3300006186 Bacteria 2508
141 Ga0075369_10063006 3300006186 Bacteria 1621
142 Ga0075366_10235662 3300006195 Bacteria 1115
143 Ga0097621_100044709 3300006237 Bacteria 3574
144 Ga0075370_10041783 3300006353 Bacteria 2589
145 Ga0075370_10050053 3300006353 Bacteria 2369
146 Ga0075370_10086243 3300006353 Bacteria 1808
147 Ga0075428_100020304 3300006844 Bacteria 7357
148 Ga0075428_100393436 3300006844 Bacteria 1485
149 Ga0075434_100113707 3300006871 Bacteria 2719
150 Ga0099825_1027806 3300006941 Bacteria 2834
151 Ga0099824_1013697 3300006942 Bacteria 8328
152 Ga0075435_100061221 3300007076 Bacteria 3053
153 Ga0099795_10155305 3300007788 Bacteria 940
154 Ga0105240_10016003 3300009093 Bacteria 10167
155 Ga0105240_10594063 3300009093 Bacteria 1220
156 Ga0105240_10954614 3300009093 Bacteria 919
157 Ga0105245_10388955 3300009098 Bacteria 1391
158 Ga0114129_10202039 3300009147 Bacteria 2691
159 Ga0105241_10078470 3300009174 Bacteria 2580
160 Ga0105241_10213832 3300009174 Bacteria 1617
161 Ga0105242_10487436 3300009176 Bacteria 1170
162 Ga0105242_10869106 3300009176 Bacteria 899
163 Ga0105248_10116638 3300009177 Bacteria 3011
164 Ga0105248_10548232 3300009177 Bacteria 1304
165 Ga0105237_10008180 3300009545 Bacteria 11362
166 Ga0105237_10044534 3300009545 Bacteria 4469
167 Ga0105237_10108781 3300009545 Bacteria 2763
168 Ga0105238_10086581 3300009551 Bacteria 3120
169 Ga0105238_10379099 3300009551 Bacteria 1406
170 Ga0105239_10063987 3300010375 Bacteria 4038
171 Ga0105239_10114262 3300010375 Bacteria 2995
172 Ga0105239_10121462 3300010375 Bacteria 2901
173 Ga0105239_10600764 3300010375 Bacteria 1255
174 Ga0105239_10746272 3300010375 Bacteria 1120
175 Ga0105246_10551445 3300011119 Bacteria 988
176 Ga0157371_10299676 3300013102 Bacteria 1164
177 Ga0157370_10175441 3300013104 Bacteria 1992
178 Ga0157369_10017045 3300013105 Bacteria 8162
179 Ga0157369_10100743 3300013105 Bacteria 3079
180 Ga0157378_10005570 3300013297 Bacteria 11023
181 Ga0157378_10208892 3300013297 Bacteria 1850
182 Ga0163162_10036732 3300013306 Bacteria 4885
183 Ga0157372_10167784 3300013307 Bacteria 2539
184 Ga0157375_10512727 3300013308 Bacteria 1363
185 Ga0163163_10020685 3300014325 Bacteria 6202
186 Ga0157380_10162545 3300014326 Bacteria 1942
187 Ga0182008_10125385 3300014497 Bacteria 1278
188 Ga0157379_10312350 3300014968 Bacteria 1434
189 Ga0157376_10032597 3300014969 Bacteria 4185
190 Ga0214544_1000002 3300021320 Bacteria 753857
191 Ga0214542_1000001 3300021321 Bacteria 1018696
192 Ga0214545_1000001 3300021324 Bacteria 1092817
193 Ga0214543_1000001 3300021327 Bacteria 776921
194 Ga0213872_10138378 3300021361 Bacteria 1070
195 Ga0213874_10024195 3300021377 Bacteria 1701
196 Ga0213871_10003516 3300021441 Bacteria 3031
197 Ga0209677_100483 3300025253 Bacteria 22633
198 Ga0209677_104067 3300025253 Bacteria 4396
199 Ga0209148_1005631 3300025254 Bacteria 2840
200 Ga0209233_1001668 3300025261 Bacteria 8646
201 Ga0209233_1006103 3300025261 Bacteria 3920
202 Ga0209233_1008167 3300025261 Bacteria 3259
203 Ga0209455_1001684 3300025272 Bacteria 9471
204 Ga0209025_1000018 3300025294 Bacteria 686898
205 Ga0209564_1021385 3300025295 Bacteria 2329
206 Ga0209564_1040789 3300025295 Bacteria 1255
207 Ga0209758_1000140 3300025297 Bacteria 174267
208 Ga0209758_1000321 3300025297 Bacteria 92591
209 Ga0209758_1001331 3300025297 Bacteria 29931
210 Ga0209758_1003646 3300025297 Bacteria 13738
211 Ga0209758_1006172 3300025297 Bacteria 8773
212 Ga0209758_1007980 3300025297 Bacteria 7009
213 Ga0209758_1012881 3300025297 Bacteria 4627
214 Ga0209758_1016109 3300025297 Bacteria 3816
215 Ga0209758_1037807 3300025297 Bacteria 1860
216 Ga0209758_1050985 3300025297 Bacteria 1445
217 Ga0209256_1004950 3300025299 Bacteria 7983
218 Ga0207426_1000278 3300025302 Bacteria 105775
219 Ga0207426_1000434 3300025302 Bacteria 68127
220 Ga0207426_1007488 3300025302 Bacteria 4565
221 Ga0207426_1023439 3300025302 Bacteria 2106
222 Ga0209257_1000522 3300025304 Bacteria 66723
223 Ga0209257_1013223 3300025304 Bacteria 3703
224 Ga0207697_10047475 3300025315 Bacteria 1770
225 Ga0207692_10005939 3300025898 Bacteria 4927
226 Ga0207692_10015770 3300025898 Bacteria 3332
227 Ga0207692_10030387 3300025898 Bacteria 2576
228 Ga0207642_10078545 3300025899 Bacteria 1595
229 Ga0207680_10033125 3300025903 Bacteria 2944
230 Ga0207647_10010455 3300025904 Bacteria 6556
231 Ga0207699_10000274 3300025906 Bacteria 28351
232 Ga0207699_10010208 3300025906 Bacteria 4703
233 Ga0207699_10061107 3300025906 Bacteria 2266
234 Ga0207699_10182488 3300025906 Bacteria 1412
235 Ga0207643_10212224 3300025908 Bacteria 1182
236 Ga0207705_10225416 3300025909 Bacteria 1424
237 Ga0207707_10180129 3300025912 Bacteria 1845
238 Ga0207707_10196337 3300025912 Bacteria 1760
239 Ga0207695_10000008 3300025913 Bacteria 1058268
240 Ga0207671_10005303 3300025914 Bacteria 11944
241 Ga0207671_10035244 3300025914 Bacteria 3715
242 Ga0207671_10153871 3300025914 Bacteria 1778
243 Ga0207671_10419527 3300025914 Bacteria 1065
244 Ga0207693_10008368 3300025915 Bacteria 8464
245 Ga0207693_10023655 3300025915 Bacteria 4875
246 Ga0207693_10070166 3300025915 Bacteria 2742
247 Ga0207663_10000084 3300025916 Bacteria 44454
248 Ga0207663_10007427 3300025916 Bacteria 5682
249 Ga0207663_10030428 3300025916 Bacteria 3185
250 Ga0207660_10037461 3300025917 Bacteria 3379
251 Ga0207657_10412032 3300025919 Bacteria 1062
252 Ga0207649_10113680 3300025920 Bacteria 1813
253 Ga0207652_10066947 3300025921 Bacteria 3114
254 Ga0207681_10068461 3300025923 Bacteria 2466
255 Ga0207694_10070674 3300025924 Bacteria 2727
256 Ga0207659_10208204 3300025926 Bacteria 1566
257 Ga0207687_10341400 3300025927 Bacteria 1218
258 Ga0207700_10073423 3300025928 Bacteria 2641
259 Ga0207700_10086545 3300025928 Bacteria 2463
260 Ga0207700_10134927 3300025928 Bacteria 2020
261 Ga0207700_10143541 3300025928 Bacteria 1965
262 Ga0207700_10445875 3300025928 Bacteria 1140
263 Ga0207664_10002496 3300025929 Bacteria 12180
264 Ga0207664_10085336 3300025929 Bacteria 2576
265 Ga0207664_10102554 3300025929 Bacteria 2366
266 Ga0207664_10486355 3300025929 Bacteria 1104
267 Ga0207644_10189752 3300025931 Bacteria 1615
268 Ga0207644_10193326 3300025931 Bacteria 1601
269 Ga0207644_10395333 3300025931 Bacteria 1129
270 Ga0207644_10451598 3300025931 Bacteria 1056
271 Ga0207690_10179677 3300025932 Bacteria 1592
272 Ga0207706_10050730 3300025933 Bacteria 3666
273 Ga0207706_10070340 3300025933 Bacteria 3078
274 Ga0207686_10203494 3300025934 Bacteria 1419
275 Ga0207669_10174680 3300025937 Bacteria 1533
276 Ga0207665_10002807 3300025939 Bacteria 11674
277 Ga0207665_10032925 3300025939 Bacteria 3433
278 Ga0207665_10206823 3300025939 Bacteria 1432
279 Ga0207665_10261301 3300025939 Bacteria 1283
280 Ga0207665_10306626 3300025939 Bacteria 1188
281 Ga0207691_10076528 3300025940 Bacteria 3015
282 Ga0207711_10090544 3300025941 Bacteria 2689
283 Ga0207711_10532513 3300025941 Bacteria 1096
284 Ga0207661_10008546 3300025944 Bacteria 7318
285 Ga0207661_10114804 3300025944 Bacteria 2284
286 Ga0207679_10138591 3300025945 Bacteria 1963
287 Ga0207667_10785701 3300025949 Bacteria 950
288 Ga0207651_10041786 3300025960 Bacteria 3046
289 Ga0207651_10245886 3300025960 Bacteria 1461
290 Ga0207712_10172803 3300025961 Bacteria 1691
291 Ga0207668_10040632 3300025972 Bacteria 3139
292 Ga0207668_10074342 3300025972 Bacteria 2439
293 Ga0207640_10004002 3300025981 Bacteria 7962
294 Ga0207658_10209925 3300025986 Bacteria 1631
295 Ga0207677_10046223 3300026023 Bacteria 2913
296 Ga0207639_10492668 3300026041 Bacteria 1118
297 Ga0207678_10006143 3300026067 Bacteria 10683
298 Ga0207678_10016812 3300026067 Bacteria 6425
299 Ga0207678_10093268 3300026067 Bacteria 2573
300 Ga0207678_10123907 3300026067 Bacteria 2206
301 Ga0207678_10189170 3300026067 Bacteria 1759
302 Ga0207678_10345845 3300026067 Bacteria 1282
303 Ga0207678_10456843 3300026067 Bacteria 1111
304 Ga0207708_10019823 3300026075 Bacteria 5071
305 Ga0207708_10121088 3300026075 Bacteria 2039
306 Ga0207708_10138261 3300026075 Bacteria 1909
307 Ga0207702_10000748 3300026078 Bacteria 34672
308 Ga0207702_10091695 3300026078 Bacteria 2661
309 Ga0207702_10143059 3300026078 Bacteria 2167
310 Ga0207702_10497402 3300026078 Bacteria 1188
311 Ga0207641_10137968 3300026088 Bacteria 2197
312 Ga0207641_10355050 3300026088 Bacteria 1398
313 Ga0207675_100046463 3300026118 Bacteria 4056
314 Ga0207683_10029535 3300026121 Bacteria 4747
315 Ga0207683_10349609 3300026121 Bacteria 1357
316 Ga0207698_10051841 3300026142 Bacteria 3139
317 Ga0207698_10060464 3300026142 Bacteria 2947
318 Ga0207698_10428359 3300026142 Bacteria 1271
319 Ga0209389_1000040 3300027296 Bacteria 124256
320 Ga0209389_1000123 3300027296 Bacteria 70041
321 Ga0209589_1000036 3300027357 Bacteria 131278
322 Ga0209489_100006 3300027361 Bacteria 475698
323 Ga0209489_111146 3300027361 Bacteria 9434
324 Ga0209700_100005 3300027363 Bacteria 573969
325 Ga0209813_10039185 3300027866 Bacteria 1435
326 Ga0207428_10383415 3300027907 Bacteria 1031
327 Ga0268266_10002598 3300028379 Bacteria 19129
328 Ga0268266_10027621 3300028379 Bacteria 4824
329 Ga0268266_10152487 3300028379 Bacteria 2084
330 Ga0268266_10229557 3300028379 Bacteria 1709
331 Ga0268266_10300258 3300028379 Bacteria 1498
332 Ga0268266_10307747 3300028379 Bacteria 1480
333 Ga0268266_10463615 3300028379 Bacteria 1206
334 Ga0268266_10774991 3300028379 Bacteria 926
335 Ga0268265_10062055 3300028380 Bacteria 2870
336 Ga0268265_10225589 3300028380 Bacteria 1643
337 Ga0268265_10620121 3300028380 Bacteria 1036
338 Ga0268264_10071176 3300028381 Bacteria 2946
339 Ga0268264_10452889 3300028381 Bacteria 1244
340 Ga0265337_1030922 3300028556 Bacteria 1591
341 Ga0265319_1001625 3300028563 Bacteria 13112
342 Ga0265334_10011646 3300028573 Bacteria 3698
343 Ga0265323_10000194 3300028653 Bacteria 36720
344 Ga0265336_10000244 3300028666 Bacteria 38493
345 Ga0307517_10000249 3300028786 Bacteria 91911
346 Ga0307515_10075370 3300028794 Bacteria 4495
347 Ga0265338_10000665 3300028800 Bacteria 59449
348 Ga0265324_10013895 3300029957 Bacteria 2989
349 Ga0265330_10007755 3300031235 Bacteria 5211
350 Ga0265330_10077068 3300031235 Bacteria 1439
351 Ga0265325_10028947 3300031241 Bacteria 2981
352 Ga0265340_10013213 3300031247 Bacteria 4345
353 Ga0265339_10149755 3300031249 Bacteria 1181
354 Ga0265316_10133331 3300031344 Bacteria 1870
355 Ga0307513_10064593 3300031456 Bacteria 3856
356 Ga0265313_10077547 3300031595 Bacteria 1517
357 Ga0265314_10006694 3300031711 Bacteria 10125
358 Ga0265342_10074982 3300031712 Bacteria 1964
359 Ga0307516_10066838 3300031730 Bacteria 3466
360 Ga0307516_10252820 3300031730 Bacteria 1456
361 Ga0307413_10546295 3300031824 Bacteria 939
362 Ga0307406_10190542 3300031901 Bacteria 1501
363 Ga0307409_100505020 3300031995 Bacteria 1178
364 Ga0307414_10268514 3300032004 Bacteria 1427
365 Ga0307510_10003728 3300033180 Bacteria 17805
366 Ga0307510_10229219 3300033180 Bacteria 1361
367 Ga0315911_1000006 3300033442 Bacteria 414563
368 Ga0373959_0043778 3300034820 Bacteria 948
369 Ga0373928_0022976 3300035084 Bacteria 1326
370 Ga0373934_0017731 3300035086 Bacteria 2720
371 Ga0373944_0096679 3300035089 Bacteria 993
372 Ga0373923_0007119 3300035111 Bacteria 3916
373 Ga0373936_0072373 3300035113 Bacteria 1423
374 Ga0373953_0000370 3300035117 Bacteria 12142
375 Ga0373953_0085020 3300035117 Bacteria 1319
376 Ga0373954_0000900 3300035118 Bacteria 11573
377 Ga0373956_0001015 3300035119 Bacteria 11589
378 Ga0373943_0039037 3300035170 Bacteria 2285
379 Ga0373955_0000271 3300035172 Bacteria 21553
380 Ga0373955_0022527 3300035172 Bacteria 3196
381 Ga0373955_0065761 3300035172 Bacteria 2014
382 Ga0373931_0001699 3300035691 Bacteria 9542
383 Ga0373935_0192187 3300035692 Bacteria 1407
384 Ga0373927_0006090 3300035695 Bacteria 8260
385 Ga0373927_0056397 3300035695 Bacteria 2540
386 Ga0373927_0194411 3300035695 Bacteria 1331
387 Ga0373933_0002469 3300035724 Bacteria 10403
388 Ga0373947_0081262 3300035725 Bacteria 2006
389 Ga0373937_0027502 3300036401 Bacteria 5143
390 Ga0373937_0078045 3300036401 Bacteria 3060
391 Ga0373925_0044168 3300037068 Bacteria 3309
392 Ga0373925_0243554 3300037068 Bacteria 1441
393 Ga0395899_0129770 3300037312 Bacteria 1800
394 Ga0395900_0007773 3300037418 Bacteria 11059
395 Ga0395900_0435461 3300037418 Bacteria 1270
396 Ga0395898_0018745 3300037466 Bacteria 7052
397 Ga0395898_0068852 3300037466 Bacteria 3425
398 Ga0395905_0030242 3300037471 Bacteria 5105
399 Ga0395905_0127471 3300037471 Bacteria 2393
400 Ga0395905_0198186 3300037471 Bacteria 1883
401 Ga0436364_0042848 3300037853 Bacteria 4706
402 Ga0436364_0901257 3300037853 Bacteria 1598
403 Ga0436365_0907811 3300039437 Bacteria 1142
404 Ga0436365_1082335 3300039437 Bacteria 1433
405 Ga0436365_1668816 3300039437 Bacteria 1738
406 Ga0436360_0888541 3300039438 Bacteria 6397
407 Ga0436361_0873079 3300039447 Bacteria 3237
408 Ga0436361_1057161 3300039447 Bacteria 1694
409 Ga0436363_1613029 3300039450 Bacteria 5674
410 Ga0451807_0494685 3300041486 Bacteria 1645
411 Ga0451855_1184848 3300041511 Bacteria 858
412 Ga0439455_0046295 3300042012 Bacteria 1127
413 Ga0439459_0012683 3300042438 Bacteria 1505
414 Ga0466969_0027564 3300044656 Bacteria 2909
415 Ga0466969_0042371 3300044656 Bacteria 2273
416 Ga0466972_0000160 3300044658 Bacteria 54154
417 Ga0466972_0006766 3300044658 Bacteria 5754
418 Ga0453683_0097213 3300044673 Bacteria 1848
419 Ga0466965_0024363 3300044683 Bacteria 2927
420 Ga0466966_0001852 3300044684 Bacteria 13714
421 Ga0466966_0162157 3300044684 Bacteria 1361
422 Ga0466961_0002102 3300044693 Bacteria 12393
423 Ga0466971_0193891 3300044719 Bacteria 958
424 Ga0466968_0014536 3300044735 Bacteria 3111
425 Ga0466970_0138645 3300044765 Bacteria 1339
426 Ga0466960_0005483 3300044901 Bacteria 5030
427 Ga0466960_0040682 3300044901 Bacteria 2199
428 Ga0466959_0001487 3300045049 Bacteria 14377
429 Ga0466959_0141407 3300045049 Bacteria 1700
430 Ga0466959_0178953 3300045049 Bacteria 1484
431 Ga0466958_0109103 3300045836 Bacteria 1727
432 Ga0466967_0031696 3300045976 Bacteria 4454
433 Ga0466967_0148652 3300045976 Bacteria 2187
434 Ga0466967_0374035 3300045976 Bacteria 1382
435 Ga0466967_1062510 3300045976 Bacteria 806
436 Ga0495603_0012659 3300046455 Bacteria 5102
437 Ga0495603_0017993 3300046455 Bacteria 4276
438 Ga0495603_0036946 3300046455 Bacteria 2931
439 Ga0495603_0047425 3300046455 Bacteria 2558
440 Ga0495603_0113339 3300046455 Bacteria 1581
441 Ga0495629_0007149 3300046459 Bacteria 8224
442 Ga0495638_0098461 3300046460 Bacteria 1752
443 Ga0495641_0031962 3300046461 Bacteria 2510
444 Ga0495651_0018066 3300046462 Bacteria 5459
445 Ga0495651_0076075 3300046462 Bacteria 2543
446 Ga0495651_0092723 3300046462 Bacteria 2262
447 Ga0495651_0233734 3300046462 Bacteria 1264
448 Ga0495651_0317328 3300046462 Bacteria 1040
449 Ga0495653_0052078 3300046463 Bacteria 3139
450 Ga0495650_0010928 3300046471 Bacteria 5023
451 Ga0495582_0148657 3300046473 Bacteria 1330
452 Ga0495605_0063307 3300046474 Bacteria 1765
453 Ga0495639_0021278 3300046475 Bacteria 2838
454 Ga0495639_0023073 3300046475 Bacteria 2733
455 Ga0495662_0121429 3300046476 Bacteria 1283
456 Ga0495664_0058033 3300046477 Bacteria 2302
457 Ga0495664_0121029 3300046477 Bacteria 1583
458 Ga0495664_0134109 3300046477 Bacteria 1500
459 Ga0495584_0068792 3300046491 Bacteria 1779
460 Ga0495585_0027274 3300046492 Bacteria 3259
461 Ga0495594_0037759 3300046499 Bacteria 2636
462 Ga0495594_0055424 3300046499 Bacteria 2186
463 Ga0495583_0067541 3300046506 Bacteria 1579
464 Ga0495606_0016917 3300046507 Bacteria 5536
465 Ga0495608_0082775 3300046511 Bacteria 2084
466 Ga0495608_0147796 3300046511 Bacteria 1498
467 Ga0495608_0149512 3300046511 Bacteria 1489
468 Ga0495616_0075041 3300046513 Bacteria 1628
469 Ga0495618_0033328 3300046514 Bacteria 3229
470 Ga0495620_0103082 3300046515 Bacteria 1136
471 Ga0495628_0048889 3300046516 Bacteria 3350
472 Ga0495628_0109630 3300046516 Bacteria 2124
473 Ga0495628_0339394 3300046516 Bacteria 1106
474 Ga0495643_0021848 3300046522 Bacteria 3662
475 Ga0495652_0027032 3300046529 Bacteria 5060
476 Ga0495640_0045531 3300046533 Bacteria 3044
477 Ga0495640_0119038 3300046533 Bacteria 1718
478 Ga0495640_0266793 3300046533 Bacteria 1068
479 Ga0495587_0001231 3300046536 Bacteria 16965
480 Ga0495587_0018937 3300046536 Bacteria 4266
481 Ga0495609_0020238 3300046538 Bacteria 3075
482 Ga0495609_0121263 3300046538 Bacteria 1124
483 Ga0495645_0004742 3300046543 Bacteria 9292
484 Ga0495645_0255925 3300046543 Bacteria 1161
485 Ga0495622_0080786 3300046557 Bacteria 1496
486 Ga0495667_0024251 3300046559 Bacteria 4085
487 Ga0495667_0035177 3300046559 Bacteria 3348
488 Ga0495656_0008574 3300046615 Bacteria 3653
489 Ga0495656_0188916 3300046615 Bacteria 1016
490 Ga0495656_0194068 3300046615 Bacteria 1004
491 Ga0495668_0020807 3300046616 Bacteria 3768
492 Ga0495668_0046110 3300046616 Bacteria 2422
493 Ga0495634_0027297 3300046642 Bacteria 3973
494 Ga0495611_0129235 3300046648 Bacteria 1179
495 Ga0495625_0056679 3300046660 Bacteria 2788
496 Ga0495625_0133265 3300046660 Bacteria 1682
497 Ga0495625_0271875 3300046660 Bacteria 1093
498 Ga0495625_0290659 3300046660 Bacteria 1049
499 Ga0495635_0013502 3300046663 Bacteria 5715
500 Ga0495659_0071812 3300046664 Bacteria 1298
501 Ga0495659_0099621 3300046664 Bacteria 1124
502 Ga0495661_0132880 3300046665 Bacteria 1362
503 Ga0495588_0020300 3300046674 Bacteria 3263
504 Ga0495588_0266010 3300046674 Bacteria 903
505 Ga0495657_0003048 3300046675 Bacteria 13866
506 Ga0495657_0022491 3300046675 Bacteria 4515
507 Ga0495657_0027210 3300046675 Bacteria 4038
508 Ga0495657_0131361 3300046675 Bacteria 1568
509 Ga0495599_0012174 3300046678 Bacteria 5297
510 Ga0495623_0010720 3300046679 Bacteria 5936
511 Ga0495646_0122816 3300046680 Bacteria 1468
512 Ga0495647_0010644 3300046681 Bacteria 3135
513 Ga0495658_0083701 3300046683 Bacteria 1877
514 Ga0495669_0021361 3300046684 Bacteria 2808
515 Ga0495669_0098415 3300046684 Bacteria 1357
516 Ga0495613_0029694 3300046689 Bacteria 4064
517 Ga0495613_0305038 3300046689 Bacteria 1101
518 Ga0495624_0106680 3300046690 Bacteria 1723
519 Ga0495624_0152891 3300046690 Bacteria 1411
520 Ga0495624_0299992 3300046690 Bacteria 969
521 Ga0495624_0314970 3300046690 Bacteria 943
522 Ga0495670_0130922 3300046691 Bacteria 1307
523 Ga0495600_0009290 3300046809 Bacteria 6069
524 Ga0495600_0055481 3300046809 Bacteria 2587
525 Ga0495600_0155673 3300046809 Bacteria 1478
526 Ga0495581_0127221 3300047315 Bacteria 1484
527 Ga0495581_0175523 3300047315 Bacteria 1253
528 Ga0495581_0239057 3300047315 Bacteria 1062
529 Ga0495581_0325939 3300047315 Bacteria 897
530 Ga0495604_0004143 3300047317 Bacteria 11513
531 Ga0495604_0024939 3300047317 Bacteria 4768
532 Ga0495604_0043000 3300047317 Bacteria 3538
533 Ga0495636_0120296 3300047318 Bacteria 1161
534 Ga0495674_0021971 3300047319 Bacteria 5890
535 Ga0495674_0057891 3300047319 Bacteria 3390
536 Ga0495672_0012877 3300047320 Bacteria 5802
537 Ga0495672_0030772 3300047320 Bacteria 3359
538 Ga0495676_0060616 3300047321 Bacteria 2964
539 Ga0495680_0002256 3300047322 Bacteria 19869
540 Ga0495680_0017868 3300047322 Bacteria 6036
541 Ga0495680_0204221 3300047322 Bacteria 1416
542 Ga0495687_013063 3300047443 Bacteria 4351
543 Ga0495675_0025039 3300047444 Bacteria 3805
544 Ga0495675_0044584 3300047444 Bacteria 2825
545 Ga0495677_0015810 3300047445 Bacteria 2740
546 Ga0495673_0107710 3300047469 Bacteria 1118
547 Ga0495684_0009505 3300047471 Bacteria 7502
548 Ga0495684_0049434 3300047471 Bacteria 3213
549 Ga0495684_0243879 3300047471 Bacteria 1309
550 Ga0495593_0048051 3300047673 Bacteria 2268
551 Ga0495602_0031896 3300048088 Bacteria 4972
552 Ga0495602_0188536 3300048088 Bacteria 1583
553 Ga0496100_0029235 3300048903 Bacteria 3407
554 Ga0496100_0338701 3300048903 Bacteria 1134
555 Ga0496101_0004401 3300048904 Bacteria 8854
556 Ga0496101_0033676 3300048904 Bacteria 3615
557 Ga0496101_0297703 3300048904 Bacteria 1263
558 Ga0496102_0062019 3300048905 Bacteria 3423
559 Ga0496102_0089687 3300048905 Bacteria 2844
560 Ga0496102_0133305 3300048905 Bacteria 2327
561 Ga0496102_0299376 3300048905 Bacteria 1516
562 Ga0496103_0034728 3300048906 Bacteria 3085
563 Ga0496103_0036941 3300048906 Bacteria 2992
564 Ga0496103_0280444 3300048906 Bacteria 1072
565 Ga0496104_0009984 3300048907 Bacteria 8477
566 Ga0496104_0506525 3300048907 Bacteria 1118
567 Ga0496105_0316590 3300048908 Bacteria 1251
568 Ga0496106_0007812 3300048909 Bacteria 7913
569 Ga0496106_0011928 3300048909 Bacteria 6417
570 Ga0496107_0007527 3300048910 Bacteria 7514
571 Ga0496107_0080548 3300048910 Bacteria 2374
572 Ga0496107_0085467 3300048910 Bacteria 2302
573 Ga0496108_0343029 3300048911 Bacteria 1303
574 Ga0496109_0401259 3300048912 Bacteria 1295
575 Ga0496109_0406335 3300048912 Bacteria 1286
576 Ga0496109_0410105 3300048912 Bacteria 1280
577 Ga0496109_0517685 3300048912 Bacteria 1126
578 Ga0496109_0681525 3300048912 Bacteria 965
579 Ga0496110_0036901 3300048913 Bacteria 4246
580 Ga0496110_0215759 3300048913 Bacteria 1745
581 Ga0496110_0376839 3300048913 Bacteria 1293
582 Ga0496110_0541674 3300048913 Bacteria 1058
583 Ga0496111_0021489 3300048914 Bacteria 4508
584 Ga0496111_0055700 3300048914 Bacteria 2860
585 Ga0496111_0200666 3300048914 Bacteria 1483
586 Ga0496112_0000004 3300048915 Bacteria 553294
587 Ga0496112_0013523 3300048915 Bacteria 7539
588 Ga0496112_0024619 3300048915 Bacteria 5768
589 Ga0496112_0347293 3300048915 Bacteria 1426
590 Ga0496113_0304497 3300048916 Bacteria 1276
591 Ga0496113_0363930 3300048916 Bacteria 1160
592 Ga0496114_0035406 3300048917 Bacteria 4122
593 Ga0496114_0061257 3300048917 Bacteria 3147
594 Ga0496114_0113306 3300048917 Bacteria 2325
595 Ga0496114_0120338 3300048917 Bacteria 2257
596 Ga0496114_0666713 3300048917 Bacteria 914
597 Ga0496115_0002608 3300048918 Bacteria 12941
598 Ga0496115_0039675 3300048918 Bacteria 3741
599 Ga0496115_0074334 3300048918 Bacteria 2759
600 Ga0496115_0160075 3300048918 Bacteria 1860
601 Ga0496115_0178656 3300048918 Bacteria 1755
602 Ga0496116_0026275 3300048919 Bacteria 4262
603 Ga0496117_0052595 3300048920 Bacteria 2868
604 Ga0496117_0108130 3300048920 Bacteria 1740
605 Ga0496117_0156145 3300048920 Bacteria 1343
606 Ga0496118_0013128 3300048921 Bacteria 7865
607 Ga0496118_0026494 3300048921 Bacteria 4936
608 Ga0496118_0051192 3300048921 Bacteria 3161
609 Ga0496118_0054716 3300048921 Bacteria 3020
610 Ga0496119_0011739 3300048922 Bacteria 7206
611 Ga0496119_0070726 3300048922 Bacteria 2045
612 Ga0496119_0173169 3300048922 Bacteria 1138
613 Ga0496119_0174488 3300048922 Bacteria 1132
614 Ga0496121_0000458 3300048924 Bacteria 80207
615 Ga0496121_0002768 3300048924 Bacteria 26008
616 Ga0496121_0013901 3300048924 Bacteria 8605
617 Ga0496121_0021415 3300048924 Bacteria 6331
618 Ga0496121_0033694 3300048924 Bacteria 4629
619 Ga0496121_0080309 3300048924 Bacteria 2586
620 Ga0496121_0134036 3300048924 Bacteria 1848
621 Ga0496122_0027043 3300048925 Bacteria 4920
622 Ga0496122_0119786 3300048925 Bacteria 1701
623 Ga0496123_0010439 3300048926 Bacteria 8208
624 Ga0496124_0031915 3300048927 Bacteria 4658
625 Ga0496124_0253444 3300048927 Bacteria 1300
626 Ga0496125_0002258 3300048928 Bacteria 25570
627 Ga0496125_0070716 3300048928 Bacteria 2730
628 Ga0496125_0108087 3300048928 Bacteria 2024
629 Ga0496126_0010740 3300048929 Bacteria 9562
630 Ga0496126_0021457 3300048929 Bacteria 6306
631 Ga0496126_0036391 3300048929 Bacteria 4603
632 Ga0496126_0068282 3300048929 Bacteria 3174
633 Ga0496126_0071842 3300048929 Bacteria 3079
634 Ga0496126_0107962 3300048929 Bacteria 2427
635 Ga0496126_0114780 3300048929 Bacteria 2343
636 Ga0496126_0218460 3300048929 Bacteria 1602
637 Ga0496126_0354169 3300048929 Bacteria 1200
638 Ga0496126_0426407 3300048929 Bacteria 1071
639 Ga0495682_0101098 3300049460 Bacteria 1034
640 Ga0495682_0110560 3300049460 Bacteria 985
641 Ga0501036_0244136 3300049572 Bacteria 1506
642 Ga0501047_0356052 3300049581 Bacteria 1300
643 Ga0501069_0236557 3300049585 Bacteria 1064
644 nmdc:mga03683_5086_c1 3300050489 Bacteria 4414
645 nmdc:mga03n38_41670_c1 3300050490 Bacteria 2003
646 nmdc:mga03n38_48697_c1 3300050490 Bacteria 1881
647 nmdc:mga00v17_77626_c1 3300050491 Bacteria 2068
648 nmdc:mga0yw44_102069_c1 3300050492 Bacteria 1828
649 nmdc:mga0yw44_194563_c1 3300050492 Bacteria 1338
650 nmdc:mga0yw44_21547_c1 3300050492 Bacteria 3597
651 nmdc:mga0yw44_86663_c1 3300050492 Bacteria 1973
652 nmdc:mga0k408_215347_c1 3300050493 Bacteria 1147
653 nmdc:mga0k408_31972_c1 3300050493 Bacteria 3007
654 nmdc:mga06z11_1189_c1 3300050494 Bacteria 9578
655 nmdc:mga06z11_119062_c1 3300050494 Bacteria 1471
656 nmdc:mga06z11_203008_c1 3300050494 Bacteria 1152
657 nmdc:mga06z11_22297_c1 3300050494 Bacteria 2956
658 nmdc:mga04h51_52287_c1 3300050495 Bacteria 1375
659 nmdc:mga04h51_96242_c1 3300050495 Bacteria 1073
660 nmdc:mga07m45_41293_c1 3300050496 Bacteria 2583
661 nmdc:mga07m45_49982_c1 3300050496 Bacteria 2355
662 nmdc:mga05p37_302933_c1 3300050507 Bacteria 1898
663 nmdc:mga06r32_561520_c1 3300050510 Bacteria 1114
664 nmdc:mga0n895_113919_c1 3300050512 Bacteria 2722
665 nmdc:mga0rr50_65295_c1 3300050513 Bacteria 2756
666 nmdc:mga08x19_81102_c1 3300050514 Bacteria 2130
667 nmdc:mga0sz30_150449_c1 3300050516 Bacteria 1030
668 nmdc:mga0sz30_5200_c1 3300050516 Bacteria 4763
669 nmdc:mga0sz30_69284_c1 3300050516 Bacteria 1517
670 nmdc:mga0sz30_8049_c1 3300050516 Bacteria 3971
671 Ga0495601_0009741 3300053077 Bacteria 5682
672 Ga0495595_0042824 3300053084 Bacteria 2075
673 Ga0495619_0001765 3300053085 Bacteria 14387
674 Ga0495619_0005620 3300053085 Bacteria 7956
675 Ga0500578_0066616 3300053086 Bacteria 2296
676 Ga0500578_0140988 3300053086 Bacteria 1507
677 Ga0500643_000035 3300053087 Bacteria 184794
678 Ga0500583_0144102 3300053092 Bacteria 1184
679 Ga0500651_0008223 3300053093 Bacteria 6125
680 Ga0500651_0035620 3300053093 Bacteria 3136
681 Ga0500566_0000995 3300053094 Bacteria 16308
682 Ga0500566_0036349 3300053094 Bacteria 2858
683 Ga0500641_0009486 3300053096 Bacteria 3502
684 Ga0500554_020508 3300053102 Bacteria 1818
685 Ga0500555_002156 3300053103 Bacteria 5765
686 Ga0500556_0003621 3300053104 Bacteria 4497
687 Ga0500557_000004 3300053105 Bacteria 202318
688 Ga0500562_015689 3300053108 Bacteria 1944
689 Ga0500562_062370 3300053108 Bacteria 1002
690 Ga0500569_001889 3300053109 Bacteria 4041
691 Ga0500572_006675 3300053111 Bacteria 2649
692 Ga0500595_006151 3300053119 Bacteria 5137
693 Ga0500595_008294 3300053119 Bacteria 4250
694 Ga0500595_016372 3300053119 Bacteria 2762
695 Ga0500595_033412 3300053119 Bacteria 1707
696 Ga0500597_136812 3300053120 Bacteria 1057
697 Ga0500608_158108 3300053122 Bacteria 985
698 Ga0500642_0000124 3300053130 Bacteria 35205
699 Ga0500642_0074298 3300053130 Bacteria 1551
700 Ga0500652_039046 3300053131 Bacteria 1902
701 Ga0500658_0045287 3300053134 Bacteria 1778
702 Ga0500559_0001481 3300053136 Bacteria 13253
703 Ga0500564_192471 3300053138 Bacteria 843
704 Ga0500568_0018807 3300053139 Bacteria 3013
705 Ga0500568_0068786 3300053139 Bacteria 1359
706 Ga0500603_001693 3300053150 Bacteria 4973
707 Ga0500603_011120 3300053150 Bacteria 2041
708 Ga0500604_0122798 3300053151 Bacteria 869
709 Ga0500620_002492 3300053155 Bacteria 3725
710 Ga0500622_0088644 3300053156 Bacteria 1538
711 Ga0500624_015529 3300053157 Bacteria 1166
712 Ga0500627_0012584 3300053158 Bacteria 3177
713 Ga0500633_0100433 3300053160 Bacteria 1065
714 Ga0500638_144188 3300053162 Bacteria 1066
715 Ga0500636_0001590 3300053177 Bacteria 12361
716 Ga0500636_0041180 3300053177 Bacteria 2732
717 Ga0500637_0000377 3300053178 Bacteria 16875
718 Ga0500637_0000979 3300053178 Bacteria 11648
719 Ga0500625_002428 3300053729 Bacteria 6985
720 Ga0500645_007384 3300053730 Bacteria 3836
721 Ga0500609_006065 3300053731 Bacteria 1647
722 Ga0500601_000602 3300053737 Bacteria 5122
723 Ga0501084_0602073 3300054114 Bacteria 929
724 Ga0500661_000291 3300055283 Bacteria 9158
725 Ga0500661_003528 3300055283 Bacteria 2935
726 2507508332 2507262055 Bacteria 8048963
727 2508542407 2508501009 Bacteria 7784016
728 2508691842 2508501042 Bacteria 8719808
729 2509150457 2508501128 Bacteria 8613869
730 2511397623 2511231028 Bacteria 8046582
731 2513629140 2513237092 Bacteria 8341956
732 2513640643 2513237094 Bacteria 8789602
733 2513645576 2513237095 Bacteria 8976980
734 2513657884 2513237096 Bacteria 8722461
735 2513674429 2513237098 Bacteria 9902361
736 2513692840 2513237101 Bacteria 7952346
737 2513701578 2513237102 Bacteria 7703324
738 2513718495 2513237104 Bacteria 10034502
739 2513855583 2513237137 Bacteria 9558895
740 2513873011 2513237139 Bacteria 8737671
741 2513890221 2513237141 Bacteria 8496279
742 2513920023 2513237145 Bacteria 8979722
743 2514015695 2513237161 Bacteria 8871253
744 2515627165 2515154112 Bacteria 8294334
745 2517102798 2517093001 Bacteria 9002274
746 2517892128 2517572143 Bacteria 9484767
747 2524437596 2524023205 Bacteria 8918781
748 2524465765 2524023210 Bacteria 9029266
749 2524534224 2524023228 Bacteria 10118060
750 2617347128 2617270735 Bacteria 9163226
751 2617375504 2617270741 Bacteria 8201522
752 2644124193 2643221621 Bacteria 6212786
753 2671120617 2667528175 Bacteria 7532676
754 2723844795 2721755755 Bacteria 8322773
755 2728753514 2728368998 Bacteria 8720350
756 2739613562 2739367655 Bacteria 4051151
757 2745079530 2744054633 Bacteria 8678936
758 2793062726 2791355196 Bacteria 7323613
759 2793068789 2791355197 Bacteria 8420563
760 2793082426
761 2805915089 2802429603 Bacteria 8777136
762 2818238622 2816332527 Bacteria 8933356
763 2824604137 2824600985 Bacteria 8488197
764 2824610406 2824609381 Bacteria 8672835
765 2824617980 2824617872 Bacteria 8814715
766 2824626648 2824626560 Bacteria 8813858
767 2824642954 2824635225 Bacteria 8785348
768 2824647932 2824644064 Bacteria 8743947
769 2824659399 2824653114 Bacteria 8493680
770 2824668852 2824661429 Bacteria 9877870
771 2824682619 2824679649 Bacteria 8248951
772 2824688919 2824687955 Bacteria 8360029
773 2824702655 2824696289 Bacteria 8335049
774 2824712542 2824704595 Bacteria 9667483
775 2824720869 2824714736 Bacteria 8717648
776 2824731096 2824723954 Bacteria 8758240
777 2824733330 2824732956 Bacteria 7810675
778 2824746543 2824746037 Bacteria 7911610
779 2824754222 2824753945 Bacteria 9787441
780 2824768959 2824763712 Bacteria 9792355
781 2824775388 2824773399 Bacteria 8360218
782 2838123487 2838122688 Bacteria 8803140
783 2841947740 2841941048 Bacteria 8688029
784 2841949589 2841949485 Bacteria 8680857
785 2841964170 2841957949 Bacteria 8652217
786 2841971906 2841966195 Bacteria 8673214
787 2841974751 2841974524 Bacteria 8931498
788 2841983689 2841983080 Bacteria 8395090
789 2842040055 2842038055 Bacteria 8002051
790 2842047000 2842045827 Bacteria 8006841
791 2844319303 2844315083 Bacteria 8138177
792 2847936468 2847930680 Bacteria 9342022
793 2847946813 2847939898 Bacteria 8606328
794 2849079074 2849076700 Bacteria 7039503
795 2855731634 2855730933 Bacteria 7047938
796 2855768340 2855767633 Bacteria 7049357
797 2857516677 2857509624 Bacteria 7472071
798 2857540331 2857537821 Bacteria 5248181
799 2874598301 2874590934 Bacteria 8299676
800 2874605486 2874604998 Bacteria 7834745
801 2874619497 2874612657 Bacteria 8252029
802 2874627552 2874620515 Bacteria 8290088
803 2874632126 2874628541 Bacteria 8630250
804 2874652643 2874645413 Bacteria 8214782
805 2876764788 2876761206 Bacteria 10111113
806 2876778221 2876771140 Bacteria 8287509
807 2876814351 2876808645 Bacteria 8824342
808 2876825910 2876818435 Bacteria 8274608
809 2879082015 2879074833 Bacteria 8279565
810 2879089496 2879083081 Bacteria 8587928
811 2879104858 2879099564 Bacteria 10442239
812 2879115803 2879110137 Bacteria 8907982
813 2879135137 2879127579 Bacteria 8294491
814 2879149822 2879142872 Bacteria 8267021
815 2881368596 2881364244 Bacteria 7710352
816 2881413482 2881412998 Bacteria 6492157
817 2881672642 2881665667 Bacteria 8175609
818 2885369146 2885366525 Bacteria 8326213
819 2885381683 2885374607 Bacteria 8927485
820 2885390542 2885383462 Bacteria 9473874
821 2885417217 2885409591 Bacteria 9235467
822 2887380650 2887375801 Bacteria 5334027
823 2888384345 2888378607 Bacteria 9652610
824 2888393566 2888388044 Bacteria 7304136
825 2888424781 2888419890 Bacteria 7857137
826 2889039501 2889033259 Bacteria 9099371
827 2893068585 2893066018 Bacteria 6158120
828 2903731143 2903727486 Bacteria 8281579
829 2903753370 2903748898 Bacteria 9972761
830 2903774444 2903768456 Bacteria 9749579
831 2904673128 2904666416 Bacteria 8226587
832 2904694792 2904690495 Bacteria 9412302
833 2904702266
834 2904714945 2904711408 Bacteria 9771557
835 2906607348 2906602504 Bacteria 8295279
836 2906617254
837 2906633586 2906626472 Bacteria 8826946
838 2906643353 2906635258 Bacteria 8601019
839 2906650822 2906643746 Bacteria 8722424
840 2906662517 2906660503 Bacteria 8595048
841 2908742408 2908739725 Bacteria 8628932
842 2908761205 2908756301 Bacteria 8864324
843 2908780432 2908775508 Bacteria 8092255
844 2922365620 2922361189 Bacteria 7436256
845 2922374697
846 2922391236 2922386360 Bacteria 7017218
847 2922400542 2922393267 Bacteria 8285685
848 2922430573
849 2929621784 2929615660 Bacteria 9193770
850 2929629909 2929624759 Bacteria 9339455
851 2932788638 2932784394 Bacteria 9704911
852 2932798104 2932794094 Bacteria 7915132
853 2932807040 2932801729 Bacteria 7987968
854 2932817221 2932809354 Bacteria 9135765
855 2932825171 2932818245 Bacteria 9955613
856 2932830286 2932828146 Bacteria 9745859
857 2933583940 2933577622 Bacteria 9116884
858 2935609178 2935608549 Bacteria 8203142
859 2935622487 2935616580 Bacteria 9032984
860 2935631265 2935630451 Bacteria 8169952
861 2935642093 2935638405 Bacteria 10015038
862 2935651019 2935648319 Bacteria 8801166
863 2935659200 2935656913 Bacteria 8965014
864 2935672523 2935665750 Bacteria 9571747
865 2935676012 2935675223 Bacteria 9928132
866 2935686004 2935684952 Bacteria 9590419
867 2935697752 2935694250 Bacteria 9291695
868 2935705844 2935703347 Bacteria 10242284
869 2935714556 2935713505 Bacteria 9608509
870 2935725175 2935722832 Bacteria 9608746
871 2935732465 2935732158 Bacteria 9706831
872 2935741844 2935741537 Bacteria 9707219
873 2935751969 2935750917 Bacteria 9590372
874 2935765226 2935760218 Bacteria 9817913
875 2935778756 2935777560 Bacteria 8077691
876 2935788855 2935785616 Bacteria 7962367
877 2935795345 2935793552 Bacteria 8012592
878 2935802841 2935801545 Bacteria 9301974
879 2935813327 2935810662 Bacteria 9401221
880 2935822338 2935819856 Bacteria 8261050
881 2935830260 2935827899 Bacteria 10038562
882 2935838157 2935837841 Bacteria 9454360
883 2935847920 2935847175 Bacteria 8228321
884 2935860736 2935855204 Bacteria 9035059
885 2935872291 2935864058 Bacteria 9784707
886 2935878654 2935873716 Bacteria 9632195
887 2935886833 2935883170 Bacteria 7964738
888 2935908861 2935908558 Bacteria 8568796
889 2935919580 2935916978 Bacteria 9113783
890 2935926565 2935926038 Bacteria 8601059
891 2935935015 2935934488 Bacteria 8602579
892 2935943465 2935942939 Bacteria 8599779
893 2935951903 2935951376 Bacteria 8602333
894 2935960662 2935959822 Bacteria 7869783
895 2935968028 2935967501 Bacteria 8603075
896 2935978659 2935975950 Bacteria 8347125
897 2935987474 2935984226 Bacteria 8302647
898 2935996309 2935992306 Bacteria 9802711
899 2936003592 2936002035 Bacteria 9362176
900 2936013615 2936011229 Bacteria 8801034
901 2936022258 2936019824 Bacteria 8804134
902 2936030704 2936028420 Bacteria 8965941
903 2936042276 2936037263 Bacteria 9446081
904 2936048517 2936046547 Bacteria 8903709
905 2936058731 2936055302 Bacteria 8785755
906 2940557228 2940556831 Bacteria 9590747
907 2941510006 2941507105 Bacteria 8166816
908 2941518907 2941515067 Bacteria 8166720
909 2941525405 2941523033 Bacteria 8169134
910 2941539176 2941538514 Bacteria 9402094
911 3005480484 3005474847 Bacteria 9259049
912 3005484571 3005483717 Bacteria 7877331
913 3005510568 3005506211 Bacteria 6943378
914 3005587786 3005587118 Bacteria 7794411
915 3005715151 3005710791 Bacteria 7622528
916 3005722547 3005718088 Bacteria 8283608
917 8006931990 8006926726 Bacteria 6749210
918 8006940309 8006933436 Bacteria 10410654
919 8006967047 8006964411 Bacteria 8966052
920 8006980087 8006973647 Bacteria 10679141
921 8006988001 8006984368 Bacteria 9651211
922 8016522021 8016511872 Bacteria 9921665
923 8016529367 8016522445 Bacteria 8156687
924 8016534578 8016530956 Bacteria 8155261
925 8016547798 8016539877 Bacteria 8155419
926 8016554338 8016548790 Bacteria 8155074
927 8016572922 8016566248 Bacteria 8158151
928 8016577078 8016575299 Bacteria 8154085
929 8016593138 8016583857 Bacteria 10421953
930 8016600490 8016595262 Bacteria 8149947
931 8016610257 8016603502 Bacteria 8731218
932 8016640057 8016630954 Bacteria 9217207
933 8017063647 8017057580 Bacteria 10023680
934 8019534343 8019530166 Bacteria 8155624
935 8019545114 8019538911 Bacteria 7872763
936 8019556278 8019555841 Bacteria 9642137
937 8019569035 8019565922 Bacteria 9639779
938 8019628461 8019619141 Bacteria 9218857
939 8019634179 8019629233 Bacteria 8687553
940 8019645554 8019638758 Bacteria 9062356
941 8019658797 8019648815 Bacteria 10014479
942 8019662054 8019659431 Bacteria 8577854
943 8019671578 8019668869 Bacteria 8791617
944 8019690329 8019687851 Bacteria 8712826
945 8055226775 8055225921 Bacteria 3341787
946 8055746050 8055742211 Bacteria 9226248
947 8056677637 8056673599 Bacteria 7871253
948 8056687353 8056681323 Bacteria 8472857
949 8056694188 8056689827 Bacteria 6712655
950 8056968278 8056967851 Bacteria 9038162
951 Ga0307411_10214309
952 JGI25151J46595_10000771
953 JGI25406J46586_10010965
954 JGI25153J46596_10001356
955 JGI25153J46596_10003157
956 JGI25153J46596_10006306
957 JGI25160J50197_1001301
958 JGI25160J50197_1018309
959 JGI25404J52841_10007507
960 JGI25404J52841_10026821
961 Ga0055531_10001373
962 Ga0055543_1005177
963 Ga0065165_1000231
964 Ga0065165_1001615
965 Ga0065165_1012190
966 Ga0065165_1030497
967 Ga0070683_100073945
968 Ga0070683_100129317
969 Ga0070690_100268989
970 Ga0068868_100006460
971 Ga0070660_100078143
972 Ga0070669_100082491
973 Ga0070675_100121948
974 Ga0070671_100207479
975 Ga0070671_100326443
976 Ga0070671_100435493
977 Ga0070674_100042283
978 Ga0070674_100068497
979 Ga0070673_100470675
980 Ga0070659_100033068
981 Ga0070659_100135974
982 Ga0070659_100259853
983 Ga0070667_100207919
984 Ga0070667_100418830
985 Ga0070709_10000351
986 Ga0070709_10059167
987 Ga0070709_10097368
988 Ga0070709_10181078
989 Ga0070709_10281330
990 Ga0070714_100028697
991 Ga0070714_100060765
992 Ga0070714_100114084
993 Ga0070714_100191918
994 Ga0070714_100419947
995 Ga0070713_100010740
996 Ga0070713_100045355
997 Ga0070713_100134091
998 Ga0070713_100169677
999 Ga0070710_10000790
1000 Ga0070710_10006588
1001 Ga0070710_10021776
1002 Ga0070710_10023705
1003 Ga0070711_100003109
1004 Ga0070711_100005522
1005 Ga0070663_100030695
1006 Ga0070663_100060153
1007 Ga0070663_100118917
1008 Ga0070663_100141497
1009 Ga0070678_100158271
1010 Ga0070678_100347736
1011 Ga0070706_100556312
1012 Ga0070679_100055233
1013 Ga0070679_100166882
1014 Ga0070679_100186312
1015 Ga0070684_100023204
1016 Ga0070684_100645903
1017 Ga0068853_100474643
1018 Ga0068853_100560449
1019 Ga0070672_100397050
1020 Ga0070665_100025947
1021 Ga0070665_100036979
1022 Ga0070665_100060854
1023 Ga0070665_100151628
1024 Ga0070665_100200021
1025 Ga0070665_100203493
1026 Ga0070665_100208313
1027 Ga0070665_100871143
1028 Ga0068855_100102451
1029 Ga0068855_100315982
1030 Ga0068857_100083327
1031 Ga0068854_100012639
1032 Ga0068854_100280741
1033 Ga0068854_100321672
1034 Ga0068856_100000020
1035 Ga0068856_100004981
1036 Ga0068856_100592409
1037 Ga0070702_100082602
1038 Ga0068852_100025025
1039 Ga0068866_10055899
1040 Ga0068861_100037780
1041 Ga0068861_100059734
1042 Ga0068851_10192907
1043 Ga0068858_100177740
1044 Ga0068860_100181433
1045 Ga0068860_100701869
1046 Ga0068862_100053644
1047 Ga0068862_100092250
1048 Ga0068862_100185838
1049 Ga0081455_10002087
1050 Ga0081455_10178435
1051 Ga0081540_1000544
1052 Ga0081540_1002537
1053 Ga0081540_1007763
1054 Ga0081540_1014601
1055 Ga0081540_1018042
1056 Ga0081540_1019612
1057 Ga0081540_1052409
1058 Ga0081540_1080110
1059 Ga0081539_10001065
1060 Ga0081539_10025008
1061 Ga0070717_10033314
1062 Ga0070717_10035208
1063 Ga0070717_10196040
1064 Ga0075365_10015033
1065 Ga0075365_10016997
1066 Ga0075365_10027865
1067 Ga0075365_10080641
1068 Ga0075365_10081177
1069 Ga0075368_10005507
1070 Ga0075368_10012445
1071 Ga0075368_10069060
1072 Ga0075363_100003747
1073 Ga0075363_100042738
1074 Ga0075363_100094667
1075 Ga0075364_10021240
1076 Ga0070715_10047457
1077 Ga0070716_100001893
1078 Ga0070716_100002939
1079 Ga0070716_100032549
1080 Ga0070712_100014227
1081 Ga0070712_100034601
1082 Ga0070712_100055261
1083 Ga0070712_100131428
1084 Ga0070712_100207338
1085 Ga0075362_10010396
1086 Ga0075367_10029633
1087 Ga0075367_10088416
1088 Ga0075367_10139696
1089 Ga0075367_10286152
1090 Ga0075369_10024341
1091 Ga0075369_10063006
1092 Ga0075366_10235662
1093 Ga0097621_100044709
1094 Ga0075370_10041783
1095 Ga0075370_10050053
1096 Ga0075370_10086243
1097 Ga0075428_100020304
1098 Ga0075428_100393436
1099 Ga0075434_100113707
1100 Ga0099825_1027806
1101 Ga0099824_1013697
1102 Ga0075435_100061221
1103 Ga0099795_10155305
1104 Ga0105240_10016003
1105 Ga0105240_10594063
1106 Ga0105240_10954614
1107 Ga0105245_10388955
1108 Ga0114129_10202039
1109 Ga0105241_10078470
1110 Ga0105241_10213832
1111 Ga0105242_10487436
1112 Ga0105242_10869106
1113 Ga0105248_10116638
1114 Ga0105248_10548232
1115 Ga0105237_10008180
1116 Ga0105237_10044534
1117 Ga0105237_10108781
1118 Ga0105238_10086581
1119 Ga0105238_10379099
1120 Ga0105239_10063987
1121 Ga0105239_10114262
1122 Ga0105239_10121462
1123 Ga0105239_10600764
1124 Ga0105239_10746272
1125 Ga0105246_10551445
1126 Ga0157371_10299676
1127 Ga0157370_10175441
1128 Ga0157369_10017045
1129 Ga0157369_10100743
1130 Ga0157378_10005570
1131 Ga0157378_10208892
1132 Ga0163162_10036732
1133 Ga0157372_10167784
1134 Ga0157375_10512727
1135 Ga0163163_10020685
1136 Ga0157380_10162545
1137 Ga0182008_10125385
1138 Ga0157379_10312350
1139 Ga0157376_10032597
1140 Ga0214544_1000002
1141 Ga0214542_1000001
1142 Ga0214545_1000001
1143 Ga0214543_1000001
1144 Ga0213872_10138378
1145 Ga0213874_10024195
1146 Ga0213871_10003516
1147 Ga0209677_100483
1148 Ga0209677_104067
1149 Ga0209148_1005631
1150 Ga0209233_1001668
1151 Ga0209233_1006103
1152 Ga0209233_1008167
1153 Ga0209455_1001684
1154 Ga0209025_1000018
1155 Ga0209564_1021385
1156 Ga0209564_1040789
1157 Ga0209758_1000140
1158 Ga0209758_1000321
1159 Ga0209758_1001331
1160 Ga0209758_1003646
1161 Ga0209758_1006172
1162 Ga0209758_1007980
1163 Ga0209758_1012881
1164 Ga0209758_1016109
1165 Ga0209758_1037807
1166 Ga0209758_1050985
1167 Ga0209256_1004950
1168 Ga0207426_1000278
1169 Ga0207426_1000434
1170 Ga0207426_1007488
1171 Ga0207426_1023439
1172 Ga0209257_1000522
1173 Ga0209257_1013223
1174 Ga0207697_10047475
1175 Ga0207692_10005939
1176 Ga0207692_10015770
1177 Ga0207692_10030387
1178 Ga0207642_10078545
1179 Ga0207680_10033125
1180 Ga0207647_10010455
1181 Ga0207699_10000274
1182 Ga0207699_10010208
1183 Ga0207699_10061107
1184 Ga0207699_10182488
1185 Ga0207643_10212224
1186 Ga0207705_10225416
1187 Ga0207707_10180129
1188 Ga0207707_10196337
1189 Ga0207695_10000008
1190 Ga0207671_10005303
1191 Ga0207671_10035244
1192 Ga0207671_10153871
1193 Ga0207671_10419527
1194 Ga0207693_10008368
1195 Ga0207693_10023655
1196 Ga0207693_10070166
1197 Ga0207663_10000084
1198 Ga0207663_10007427
1199 Ga0207663_10030428
1200 Ga0207660_10037461
1201 Ga0207657_10412032
1202 Ga0207649_10113680
1203 Ga0207652_10066947
1204 Ga0207681_10068461
1205 Ga0207694_10070674
1206 Ga0207659_10208204
1207 Ga0207687_10341400
1208 Ga0207700_10073423
1209 Ga0207700_10086545
1210 Ga0207700_10134927
1211 Ga0207700_10143541
1212 Ga0207700_10445875
1213 Ga0207664_10002496
1214 Ga0207664_10085336
1215 Ga0207664_10102554
1216 Ga0207664_10486355
1217 Ga0207644_10189752
1218 Ga0207644_10193326
1219 Ga0207644_10395333
1220 Ga0207644_10451598
1221 Ga0207690_10179677
1222 Ga0207706_10050730
1223 Ga0207706_10070340
1224 Ga0207686_10203494
1225 Ga0207669_10174680
1226 Ga0207665_10002807
1227 Ga0207665_10032925
1228 Ga0207665_10206823
1229 Ga0207665_10261301
1230 Ga0207665_10306626
1231 Ga0207691_10076528
1232 Ga0207711_10090544
1233 Ga0207711_10532513
1234 Ga0207661_10008546
1235 Ga0207661_10114804
1236 Ga0207679_10138591
1237 Ga0207667_10785701
1238 Ga0207651_10041786
1239 Ga0207651_10245886
1240 Ga0207712_10172803
1241 Ga0207668_10040632
1242 Ga0207668_10074342
1243 Ga0207640_10004002
1244 Ga0207658_10209925
1245 Ga0207677_10046223
1246 Ga0207639_10492668
1247 Ga0207678_10006143
1248 Ga0207678_10016812
1249 Ga0207678_10093268
1250 Ga0207678_10123907
1251 Ga0207678_10189170
1252 Ga0207678_10345845
1253 Ga0207678_10456843
1254 Ga0207708_10019823
1255 Ga0207708_10121088
1256 Ga0207708_10138261
1257 Ga0207702_10000748
1258 Ga0207702_10091695
1259 Ga0207702_10143059
1260 Ga0207702_10497402
1261 Ga0207641_10137968
1262 Ga0207641_10355050
1263 Ga0207675_100046463
1264 Ga0207683_10029535
1265 Ga0207683_10349609
1266 Ga0207698_10051841
1267 Ga0207698_10060464
1268 Ga0207698_10428359
1269 Ga0209389_1000040
1270 Ga0209389_1000123
1271 Ga0209589_1000036
1272 Ga0209489_100006
1273 Ga0209489_111146
1274 Ga0209700_100005
1275 Ga0209813_10039185
1276 Ga0207428_10383415
1277 Ga0268266_10002598
1278 Ga0268266_10027621
1279 Ga0268266_10152487
1280 Ga0268266_10229557
1281 Ga0268266_10300258
1282 Ga0268266_10307747
1283 Ga0268266_10463615
1284 Ga0268266_10774991
1285 Ga0268265_10062055
1286 Ga0268265_10225589
1287 Ga0268265_10620121
1288 Ga0268264_10071176
1289 Ga0268264_10452889
1290 Ga0265337_1030922
1291 Ga0265319_1001625
1292 Ga0265334_10011646
1293 Ga0265323_10000194
1294 Ga0265336_10000244
1295 Ga0307517_10000249
1296 Ga0307515_10075370
1297 Ga0265338_10000665
1298 Ga0265324_10013895
1299 Ga0265330_10007755
1300 Ga0265330_10077068
1301 Ga0265325_10028947
1302 Ga0265340_10013213
1303 Ga0265339_10149755
1304 Ga0265316_10133331
1305 Ga0307513_10064593
1306 Ga0265313_10077547
1307 Ga0265314_10006694
1308 Ga0265342_10074982
1309 Ga0307516_10066838
1310 Ga0307516_10252820
1311 Ga0307413_10546295
1312 Ga0307406_10190542
1313 Ga0307409_100505020
1314 Ga0307414_10268514
1315 Ga0307510_10003728
1316 Ga0307510_10229219
1317 Ga0315911_1000006
1318 Ga0373959_0043778
1319 Ga0373928_0022976
1320 Ga0373934_0017731
1321 Ga0373944_0096679
1322 Ga0373923_0007119
1323 Ga0373936_0072373
1324 Ga0373953_0000370
1325 Ga0373953_0085020
1326 Ga0373954_0000900
1327 Ga0373956_0001015
1328 Ga0373943_0039037
1329 Ga0373955_0000271
1330 Ga0373955_0022527
1331 Ga0373955_0065761
1332 Ga0373931_0001699
1333 Ga0373935_0192187
1334 Ga0373927_0006090
1335 Ga0373927_0056397
1336 Ga0373927_0194411
1337 Ga0373933_0002469
1338 Ga0373947_0081262
1339 Ga0373937_0027502
1340 Ga0373937_0078045
1341 Ga0373925_0044168
1342 Ga0373925_0243554
1343 Ga0395899_0129770
1344 Ga0395900_0007773
1345 Ga0395900_0435461
1346 Ga0395898_0018745
1347 Ga0395898_0068852
1348 Ga0395905_0030242
1349 Ga0395905_0127471
1350 Ga0395905_0198186
1351 Ga0436364_0042848
1352 Ga0436364_0901257
1353 Ga0436365_0907811
1354 Ga0436365_1082335
1355 Ga0436365_1668816
1356 Ga0436360_0888541
1357 Ga0436361_0873079
1358 Ga0436361_1057161
1359 Ga0436363_1613029
1360 Ga0451807_0494685
1361 Ga0451855_1184848
1362 Ga0439455_0046295
1363 Ga0439459_0012683
1364 Ga0466969_0027564
1365 Ga0466969_0042371
1366 Ga0466972_0000160
1367 Ga0466972_0006766
1368 Ga0453683_0097213
1369 Ga0466965_0024363
1370 Ga0466966_0001852
1371 Ga0466966_0162157
1372 Ga0466961_0002102
1373 Ga0466971_0193891
1374 Ga0466968_0014536
1375 Ga0466970_0138645
1376 Ga0466960_0005483
1377 Ga0466960_0040682
1378 Ga0466959_0001487
1379 Ga0466959_0141407
1380 Ga0466959_0178953
1381 Ga0466958_0109103
1382 Ga0466967_0031696
1383 Ga0466967_0148652
1384 Ga0466967_0374035
1385 Ga0466967_1062510
1386 Ga0495603_0012659
1387 Ga0495603_0017993
1388 Ga0495603_0036946
1389 Ga0495603_0047425
1390 Ga0495603_0113339
1391 Ga0495629_0007149
1392 Ga0495638_0098461
1393 Ga0495641_0031962
1394 Ga0495651_0018066
1395 Ga0495651_0076075
1396 Ga0495651_0092723
1397 Ga0495651_0233734
1398 Ga0495651_0317328
1399 Ga0495653_0052078
1400 Ga0495650_0010928
1401 Ga0495582_0148657
1402 Ga0495605_0063307
1403 Ga0495639_0021278
1404 Ga0495639_0023073
1405 Ga0495662_0121429
1406 Ga0495664_0058033
1407 Ga0495664_0121029
1408 Ga0495664_0134109
1409 Ga0495584_0068792
1410 Ga0495585_0027274
1411 Ga0495594_0037759
1412 Ga0495594_0055424
1413 Ga0495583_0067541
1414 Ga0495606_0016917
1415 Ga0495608_0082775
1416 Ga0495608_0147796
1417 Ga0495608_0149512
1418 Ga0495616_0075041
1419 Ga0495618_0033328
1420 Ga0495620_0103082
1421 Ga0495628_0048889
1422 Ga0495628_0109630
1423 Ga0495628_0339394
1424 Ga0495643_0021848
1425 Ga0495652_0027032
1426 Ga0495640_0045531
1427 Ga0495640_0119038
1428 Ga0495640_0266793
1429 Ga0495587_0001231
1430 Ga0495587_0018937
1431 Ga0495609_0020238
1432 Ga0495609_0121263
1433 Ga0495645_0004742
1434 Ga0495645_0255925
1435 Ga0495622_0080786
1436 Ga0495667_0024251
1437 Ga0495667_0035177
1438 Ga0495656_0008574
1439 Ga0495656_0188916
1440 Ga0495656_0194068
1441 Ga0495668_0020807
1442 Ga0495668_0046110
1443 Ga0495634_0027297
1444 Ga0495611_0129235
1445 Ga0495625_0056679
1446 Ga0495625_0133265
1447 Ga0495625_0271875
1448 Ga0495625_0290659
1449 Ga0495635_0013502
1450 Ga0495659_0071812
1451 Ga0495659_0099621
1452 Ga0495661_0132880
1453 Ga0495588_0020300
1454 Ga0495588_0266010
1455 Ga0495657_0003048
1456 Ga0495657_0022491
1457 Ga0495657_0027210
1458 Ga0495657_0131361
1459 Ga0495599_0012174
1460 Ga0495623_0010720
1461 Ga0495646_0122816
1462 Ga0495647_0010644
1463 Ga0495658_0083701
1464 Ga0495669_0021361
1465 Ga0495669_0098415
1466 Ga0495613_0029694
1467 Ga0495613_0305038
1468 Ga0495624_0106680
1469 Ga0495624_0152891
1470 Ga0495624_0299992
1471 Ga0495624_0314970
1472 Ga0495670_0130922
1473 Ga0495600_0009290
1474 Ga0495600_0055481
1475 Ga0495600_0155673
1476 Ga0495581_0127221
1477 Ga0495581_0175523
1478 Ga0495581_0239057
1479 Ga0495581_0325939
1480 Ga0495604_0004143
1481 Ga0495604_0024939
1482 Ga0495604_0043000
1483 Ga0495636_0120296
1484 Ga0495674_0021971
1485 Ga0495674_0057891
1486 Ga0495672_0012877
1487 Ga0495672_0030772
1488 Ga0495676_0060616
1489 Ga0495680_0002256
1490 Ga0495680_0017868
1491 Ga0495680_0204221
1492 Ga0495687_013063
1493 Ga0495675_0025039
1494 Ga0495675_0044584
1495 Ga0495677_0015810
1496 Ga0495673_0107710
1497 Ga0495684_0009505
1498 Ga0495684_0049434
1499 Ga0495684_0243879
1500 Ga0495593_0048051
1501 Ga0495602_0031896
1502 Ga0495602_0188536
1503 Ga0496100_0029235
1504 Ga0496100_0338701
1505 Ga0496101_0004401
1506 Ga0496101_0033676
1507 Ga0496101_0297703
1508 Ga0496102_0062019
1509 Ga0496102_0089687
1510 Ga0496102_0133305
1511 Ga0496102_0299376
1512 Ga0496103_0034728
1513 Ga0496103_0036941
1514 Ga0496103_0280444
1515 Ga0496104_0009984
1516 Ga0496104_0506525
1517 Ga0496105_0316590
1518 Ga0496106_0007812
1519 Ga0496106_0011928
1520 Ga0496107_0007527
1521 Ga0496107_0080548
1522 Ga0496107_0085467
1523 Ga0496108_0343029
1524 Ga0496109_0401259
1525 Ga0496109_0406335
1526 Ga0496109_0410105
1527 Ga0496109_0517685
1528 Ga0496109_0681525
1529 Ga0496110_0036901
1530 Ga0496110_0215759
1531 Ga0496110_0376839
1532 Ga0496110_0541674
1533 Ga0496111_0021489
1534 Ga0496111_0055700
1535 Ga0496111_0200666
1536 Ga0496112_0000004
1537 Ga0496112_0013523
1538 Ga0496112_0024619
1539 Ga0496112_0347293
1540 Ga0496113_0304497
1541 Ga0496113_0363930
1542 Ga0496114_0035406
1543 Ga0496114_0061257
1544 Ga0496114_0113306
1545 Ga0496114_0120338
1546 Ga0496114_0666713
1547 Ga0496115_0002608
1548 Ga0496115_0039675
1549 Ga0496115_0074334
1550 Ga0496115_0160075
1551 Ga0496115_0178656
1552 Ga0496116_0026275
1553 Ga0496117_0052595
1554 Ga0496117_0108130
1555 Ga0496117_0156145
1556 Ga0496118_0013128
1557 Ga0496118_0026494
1558 Ga0496118_0051192
1559 Ga0496118_0054716
1560 Ga0496119_0011739
1561 Ga0496119_0070726
1562 Ga0496119_0173169
1563 Ga0496119_0174488
1564 Ga0496121_0000458
1565 Ga0496121_0002768
1566 Ga0496121_0013901
1567 Ga0496121_0021415
1568 Ga0496121_0033694
1569 Ga0496121_0080309
1570 Ga0496121_0134036
1571 Ga0496122_0027043
1572 Ga0496122_0119786
1573 Ga0496123_0010439
1574 Ga0496124_0031915
1575 Ga0496124_0253444
1576 Ga0496125_0002258
1577 Ga0496125_0070716
1578 Ga0496125_0108087
1579 Ga0496126_0010740
1580 Ga0496126_0021457
1581 Ga0496126_0036391
1582 Ga0496126_0068282
1583 Ga0496126_0071842
1584 Ga0496126_0107962
1585 Ga0496126_0114780
1586 Ga0496126_0218460
1587 Ga0496126_0354169
1588 Ga0496126_0426407
1589 Ga0495682_0101098
1590 Ga0495682_0110560
1591 Ga0501036_0244136
1592 Ga0501047_0356052
1593 Ga0501069_0236557
1594 nmdc:mga03683_5086_c1
1595 nmdc:mga03n38_41670_c1
1596 nmdc:mga03n38_48697_c1
1597 nmdc:mga00v17_77626_c1
1598 nmdc:mga0yw44_102069_c1
1599 nmdc:mga0yw44_194563_c1
1600 nmdc:mga0yw44_21547_c1
1601 nmdc:mga0yw44_86663_c1
1602 nmdc:mga0k408_215347_c1
1603 nmdc:mga0k408_31972_c1
1604 nmdc:mga06z11_1189_c1
1605 nmdc:mga06z11_119062_c1
1606 nmdc:mga06z11_203008_c1
1607 nmdc:mga06z11_22297_c1
1608 nmdc:mga04h51_52287_c1
1609 nmdc:mga04h51_96242_c1
1610 nmdc:mga07m45_41293_c1
1611 nmdc:mga07m45_49982_c1
1612 nmdc:mga05p37_302933_c1
1613 nmdc:mga06r32_561520_c1
1614 nmdc:mga0n895_113919_c1
1615 nmdc:mga0rr50_65295_c1
1616 nmdc:mga08x19_81102_c1
1617 nmdc:mga0sz30_150449_c1
1618 nmdc:mga0sz30_5200_c1
1619 nmdc:mga0sz30_69284_c1
1620 nmdc:mga0sz30_8049_c1
1621 Ga0495601_0009741
1622 Ga0495595_0042824
1623 Ga0495619_0001765
1624 Ga0495619_0005620
1625 Ga0500578_0066616
1626 Ga0500578_0140988
1627 Ga0500643_000035
1628 Ga0500583_0144102
1629 Ga0500651_0008223
1630 Ga0500651_0035620
1631 Ga0500566_0000995
1632 Ga0500566_0036349
1633 Ga0500641_0009486
1634 Ga0500554_020508
1635 Ga0500555_002156
1636 Ga0500556_0003621
1637 Ga0500557_000004
1638 Ga0500562_015689
1639 Ga0500562_062370
1640 Ga0500569_001889
1641 Ga0500572_006675
1642 Ga0500595_006151
1643 Ga0500595_008294
1644 Ga0500595_016372
1645 Ga0500595_033412
1646 Ga0500597_136812
1647 Ga0500608_158108
1648 Ga0500642_0000124
1649 Ga0500642_0074298
1650 Ga0500652_039046
1651 Ga0500658_0045287
1652 Ga0500559_0001481
1653 Ga0500564_192471
1654 Ga0500568_0018807
1655 Ga0500568_0068786
1656 Ga0500603_001693
1657 Ga0500603_011120
1658 Ga0500604_0122798
1659 Ga0500620_002492
1660 Ga0500622_0088644
1661 Ga0500624_015529
1662 Ga0500627_0012584
1663 Ga0500633_0100433
1664 Ga0500638_144188
1665 Ga0500636_0001590
1666 Ga0500636_0041180
1667 Ga0500637_0000377
1668 Ga0500637_0000979
1669 Ga0500625_002428
1670 Ga0500645_007384
1671 Ga0500609_006065
1672 Ga0500601_000602
1673 Ga0501084_0602073
1674 Ga0500661_000291
1675 Ga0500661_003528
1676 2507508332
1677 2508542407
1678 2508691842
1679 2509150457
1680 2511397623
1681 2513629140
1682 2513640643
1683 2513645576
1684 2513657884
1685 2513674429
1686 2513692840
1687 2513701578
1688 2513718495
1689 2513855583
1690 2513873011
1691 2513890221
1692 2513920023
1693 2514015695
1694 2515627165
1695 2517102798
1696 2517892128
1697 2524437596
1698 2524465765
1699 2524534224
1700 2617347128
1701 2617375504
1702 2644124193
1703 2671120617
1704 2723844795
1705 2728753514
1706 2739613562
1707 2745079530
1708 2793062726
1709 2793068789
1710 2793082426
1711 2805915089
1712 2818238622
1713 2824604137
1714 2824610406
1715 2824617980
1716 2824626648
1717 2824642954
1718 2824647932
1719 2824659399
1720 2824668852
1721 2824682619
1722 2824688919
1723 2824702655
1724 2824712542
1725 2824720869
1726 2824731096
1727 2824733330
1728 2824746543
1729 2824754222
1730 2824768959
1731 2824775388
1732 2838123487
1733 2841947740
1734 2841949589
1735 2841964170
1736 2841971906
1737 2841974751
1738 2841983689
1739 2842040055
1740 2842047000
1741 2844319303
1742 2847936468
1743 2847946813
1744 2849079074
1745 2855731634
1746 2855768340
1747 2857516677
1748 2857540331
1749 2874598301
1750 2874605486
1751 2874619497
1752 2874627552
1753 2874632126
1754 2874652643
1755 2876764788
1756 2876778221
1757 2876814351
1758 2876825910
1759 2879082015
1760 2879089496
1761 2879104858
1762 2879115803
1763 2879135137
1764 2879149822
1765 2881368596
1766 2881413482
1767 2881672642
1768 2885369146
1769 2885381683
1770 2885390542
1771 2885417217
1772 2887380650
1773 2888384345
1774 2888393566
1775 2888424781
1776 2889039501
1777 2893068585
1778 2903731143
1779 2903753370
1780 2903774444
1781 2904673128
1782 2904694792
1783 2904702266
1784 2904714945
1785 2906607348
1786 2906617254
1787 2906633586
1788 2906643353
1789 2906650822
1790 2906662517
1791 2908742408
1792 2908761205
1793 2908780432
1794 2922365620
1795 2922374697
1796 2922391236
1797 2922400542
1798 2922430573
1799 2929621784
1800 2929629909
1801 2932788638
1802 2932798104
1803 2932807040
1804 2932817221
1805 2932825171
1806 2932830286
1807 2933583940
1808 2935609178
1809 2935622487
1810 2935631265
1811 2935642093
1812 2935651019
1813 2935659200
1814 2935672523
1815 2935676012
1816 2935686004
1817 2935697752
1818 2935705844
1819 2935714556
1820 2935725175
1821 2935732465
1822 2935741844
1823 2935751969
1824 2935765226
1825 2935778756
1826 2935788855
1827 2935795345
1828 2935802841
1829 2935813327
1830 2935822338
1831 2935830260
1832 2935838157
1833 2935847920
1834 2935860736
1835 2935872291
1836 2935878654
1837 2935886833
1838 2935908861
1839 2935919580
1840 2935926565
1841 2935935015
1842 2935943465
1843 2935951903
1844 2935960662
1845 2935968028
1846 2935978659
1847 2935987474
1848 2935996309
1849 2936003592
1850 2936013615
1851 2936022258
1852 2936030704
1853 2936042276
1854 2936048517
1855 2936058731
1856 2940557228
1857 2941510006
1858 2941518907
1859 2941525405
1860 2941539176
1861 3005480484
1862 3005484571
1863 3005510568
1864 3005587786
1865 3005715151
1866 3005722547
1867 8006931990
1868 8006940309
1869 8006967047
1870 8006980087
1871 8006988001
1872 8016522021
1873 8016529367
1874 8016534578
1875 8016547798
1876 8016554338
1877 8016572922
1878 8016577078
1879 8016593138
1880 8016600490
1881 8016610257
1882 8016640057
1883 8017063647
1884 8019534343
1885 8019545114
1886 8019556278
1887 8019569035
1888 8019628461
1889 8019634179
1890 8019645554
1891 8019658797
1892 8019662054
1893 8019671578
1894 8019690329
1895 8055226775
1896 8055746050
1897 8056677637
1898 8056687353
1899 8056694188
1900 8056968278

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

54

298

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

59

281

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9364 10 257
7eum-assembly1.cif.gz_C crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9352 10 243
7eum-assembly1.cif.gz_D crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9309 10 243
7eum-assembly1.cif.gz_A crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9302 10 243
7eum-assembly1.cif.gz_E crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9281 10 243
ID Description Score Start End Superfamily
af_Q54HG7_37_243_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9325 10 204 3.90.226.10
af_Q4DIE0_13_217_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9281 6 205 3.90.226.10
af_Q9JLZ3_43_254_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.927 10 201 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9235 15 205 3.90.226.10
2a7kB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9185 11 206 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2N4UE97-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9618 5 260 GO:0004300
GO:0006635
AF-A0A363REB8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9616 3 254 GO:0004300
GO:0006635
AF-A0A261U359-F1-model_v4 Enoyl-CoA hydratase 0.9607 7 260
AF-A0A261SIX8-F1-model_v4 Enoyl-CoA hydratase 0.9602 6 258 GO:0006635
AF-A0A356HTY6-F1-model_v4 deleted 0.9576 49 255

Map