F486563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 950 | 402 | 1900 | 380 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0014701|Ga0495643_0014701_3068_4216 |
| Length | 354 |
| Sequence | MKITKLTLYRVPPRWMFLKVETDEGITGWGEPVIEGRARTVEAAVKELAHDLIGQDPMRINDLWQLMYRGAFYRGGPILMSAIAGVDQALWDIKGKALGVPVYQLLGGLVRDRMKMYSWVGGDRPAEVVAGIHTLRAIGIDTFKLNGTEELAMLDFHGRVAAPMAKVLLRELEPYRPLFIEEPVLAEQAEYYPRLAEATSIPLAAGERMYSRFDFKRVFRDGGIAIVQPDVSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSHNAVLQEQSMGIHYNKGAELLDYVVNTEDFVIKEGYFAPLTKPGLGVIVNEERVIAASQGAPDWRNPVWRHPDGSVAEW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 54 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 78 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 79 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 80 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 145 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 146 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 148 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 149 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 150 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 151 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 152 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 171 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 172 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 173 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 174 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 175 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 176 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 177 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 178 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 185 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 257 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 261 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 267 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 276 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 277 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 278 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 279 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 280 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 281 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 282 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 283 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 284 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 285 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 286 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 287 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 288 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 289 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 290 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 291 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 292 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 293 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 294 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 295 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 296 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 297 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 298 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 299 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 300 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 301 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 302 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 303 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 304 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 305 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 306 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 307 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 308 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 309 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 310 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 311 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 312 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 313 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 314 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 315 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 316 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 317 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 318 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 319 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 320 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 321 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 322 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 323 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 324 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 325 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 326 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 327 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 328 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 329 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 330 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 331 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 332 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 333 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 334 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 335 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 336 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 337 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 338 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 339 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 340 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 341 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 342 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 343 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 344 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 345 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 346 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 347 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 348 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 349 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 350 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 351 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 352 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 353 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 354 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 355 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 356 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 357 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 358 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 359 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 360 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 361 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 362 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 363 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 364 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 365 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 366 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 367 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 368 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 369 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 370 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 371 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 372 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 373 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 374 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 375 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 376 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 377 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 378 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 379 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 380 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 381 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 382 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 383 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 384 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 385 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 386 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 387 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 388 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 389 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 390 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 391 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 392 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 393 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 394 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 395 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 396 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 397 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 398 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 399 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 400 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 401 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 402 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.21 |
| Metatranscriptomes | 0.32 |
| Isolates | 13.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 18.21 |
| Nodule | 2.21 |
| Rhizoplane | 5.47 |
| Rhizosphere | 55.79 |
| Stem | 0 |
| Stem Tuber | 0.53 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495643_0014701 | 3300046522 | Bacteria | 4650 |
| 2 | JGI24741J21665_1000408 | 3300001915 | Bacteria | 12965 |
| 3 | JGI24740J21852_10001196 | 3300001979 | Bacteria | 11704 |
| 4 | JGI24740J21852_10002395 | 3300001979 | Bacteria | 8530 |
| 5 | JGI24740J21852_10003713 | 3300001979 | Bacteria | 6645 |
| 6 | JGI25158J39367_1000429 | 3300002739 | Bacteria | 8710 |
| 7 | JGI25158J39367_1000753 | 3300002739 | Bacteria | 6214 |
| 8 | JGI25163J39215_1000118 | 3300002771 | Bacteria | 33381 |
| 9 | JGI25164J39214_1000302 | 3300002772 | Bacteria | 33358 |
| 10 | JGI25152J39213_1000026 | 3300002773 | Bacteria | 101759 |
| 11 | JGI25152J39213_1000153 | 3300002773 | Bacteria | 47218 |
| 12 | JGI25150J39212_1000117 | 3300002774 | Bacteria | 45175 |
| 13 | JGI25150J39212_1000280 | 3300002774 | Bacteria | 26822 |
| 14 | JGI25150J39212_1013003 | 3300002774 | Bacteria | 1455 |
| 15 | JGI25159J45721_1004491 | 3300002987 | Bacteria | 4620 |
| 16 | JGI25159J45721_1005331 | 3300002987 | Bacteria | 4055 |
| 17 | JGI25151J46595_10000148 | 3300003187 | Bacteria | 92040 |
| 18 | JGI25151J46595_10000207 | 3300003187 | Bacteria | 71940 |
| 19 | JGI25153J46596_10000146 | 3300003215 | Bacteria | 71940 |
| 20 | JGI25153J46596_10004004 | 3300003215 | Bacteria | 8046 |
| 21 | JGI25153J46596_10007834 | 3300003215 | Bacteria | 5187 |
| 22 | rootH1_10018743 | 3300003316 | Bacteria | 12934 |
| 23 | rootL2_10012396 | 3300003322 | Bacteria | 18736 |
| 24 | JGI25161J50226_1000266 | 3300003374 | Bacteria | 30738 |
| 25 | Ga0055538_1000217 | 3300003751 | Bacteria | 33362 |
| 26 | Ga0055538_1002216 | 3300003751 | Bacteria | 3003 |
| 27 | Ga0055538_1002256 | 3300003751 | Bacteria | 2951 |
| 28 | Ga0055539_1000259 | 3300003752 | Bacteria | 33362 |
| 29 | Ga0055539_1000443 | 3300003752 | Bacteria | 14387 |
| 30 | Ga0055533_1000250 | 3300003756 | Bacteria | 33362 |
| 31 | Ga0055533_1001778 | 3300003756 | Bacteria | 5458 |
| 32 | Ga0055533_1003737 | 3300003756 | Bacteria | 2954 |
| 33 | Ga0055532_1000008 | 3300003758 | Bacteria | 404753 |
| 34 | Ga0055525_1000347 | 3300003759 | Bacteria | 33362 |
| 35 | Ga0055525_1000500 | 3300003759 | Bacteria | 19694 |
| 36 | Ga0055527_1002530 | 3300003760 | Bacteria | 3043 |
| 37 | Ga0055535_1000006 | 3300003761 | Bacteria | 404753 |
| 38 | Ga0055529_1000025 | 3300003763 | Bacteria | 304757 |
| 39 | Ga0055526_1000020 | 3300003771 | Bacteria | 188230 |
| 40 | Ga0055526_1000031 | 3300003771 | Bacteria | 143136 |
| 41 | Ga0055526_1000487 | 3300003771 | Bacteria | 31529 |
| 42 | Ga0055526_1000911 | 3300003771 | Bacteria | 21980 |
| 43 | Ga0055537_1000035 | 3300003773 | Bacteria | 96274 |
| 44 | Ga0055537_1010321 | 3300003773 | Bacteria | 1978 |
| 45 | Ga0055537_1012918 | 3300003773 | Bacteria | 1600 |
| 46 | Ga0055524_1000129 | 3300003775 | Bacteria | 88836 |
| 47 | Ga0055524_1000322 | 3300003775 | Bacteria | 45133 |
| 48 | Ga0055524_1000727 | 3300003775 | Bacteria | 22596 |
| 49 | Ga0055524_1001062 | 3300003775 | Bacteria | 16934 |
| 50 | Ga0055524_1001522 | 3300003775 | Bacteria | 13122 |
| 51 | Ga0055524_1010727 | 3300003775 | Bacteria | 3628 |
| 52 | Ga0055534_1000325 | 3300003784 | Bacteria | 31562 |
| 53 | Ga0055534_1005326 | 3300003784 | Bacteria | 3470 |
| 54 | Ga0055534_1011124 | 3300003784 | Bacteria | 1845 |
| 55 | Ga0055528_1000058 | 3300003790 | Bacteria | 88086 |
| 56 | Ga0055530_10000037 | 3300003791 | Bacteria | 116741 |
| 57 | Ga0055530_10000499 | 3300003791 | Bacteria | 34011 |
| 58 | Ga0055530_10007754 | 3300003791 | Bacteria | 4450 |
| 59 | Ga0055530_10009349 | 3300003791 | Bacteria | 3780 |
| 60 | Ga0055531_10002721 | 3300003794 | Bacteria | 11636 |
| 61 | Ga0055541_1003489 | 3300003841 | Bacteria | 2954 |
| 62 | Ga0058692_1000122 | 3300003856 | Bacteria | 50557 |
| 63 | Ga0058692_1000871 | 3300003856 | Bacteria | 11880 |
| 64 | Ga0058692_1001369 | 3300003856 | Bacteria | 9036 |
| 65 | Ga0055543_1000339 | 3300004625 | Bacteria | 31976 |
| 66 | Ga0055543_1005717 | 3300004625 | Bacteria | 3129 |
| 67 | Ga0065165_1000224 | 3300005262 | Bacteria | 99359 |
| 68 | Ga0065165_1001110 | 3300005262 | Bacteria | 31976 |
| 69 | Ga0065704_10000581 | 3300005289 | Bacteria | 28087 |
| 70 | Ga0065704_10002543 | 3300005289 | Bacteria | 5889 |
| 71 | Ga0065704_10002719 | 3300005289 | Bacteria | 4795 |
| 72 | Ga0065704_10003295 | 3300005289 | Bacteria | 5918 |
| 73 | Ga0065704_10003831 | 3300005289 | Bacteria | 13528 |
| 74 | Ga0070666_10082178 | 3300005335 | Bacteria | 2203 |
| 75 | Ga0070661_100000417 | 3300005344 | Bacteria | 32723 |
| 76 | Ga0070661_100104382 | 3300005344 | Bacteria | 2111 |
| 77 | Ga0070667_100001671 | 3300005367 | Bacteria | 19832 |
| 78 | Ga0070678_100103219 | 3300005456 | Bacteria | 2215 |
| 79 | Ga0070662_100015699 | 3300005457 | Bacteria | 5078 |
| 80 | Ga0070681_10143255 | 3300005458 | Bacteria | 2319 |
| 81 | Ga0070685_10000588 | 3300005466 | Bacteria | 20219 |
| 82 | Ga0070679_100003714 | 3300005530 | Bacteria | 13995 |
| 83 | Ga0068853_100070789 | 3300005539 | Bacteria | 3036 |
| 84 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 85 | Ga0070665_100000160 | 3300005548 | Bacteria | 122425 |
| 86 | Ga0070665_100016979 | 3300005548 | Bacteria | 7297 |
| 87 | Ga0070665_100174268 | 3300005548 | Bacteria | 2152 |
| 88 | Ga0070664_100000001 | 3300005564 | Bacteria | 551832 |
| 89 | Ga0068857_100000013 | 3300005577 | Bacteria | 105599 |
| 90 | Ga0068857_100017469 | 3300005577 | Bacteria | 6287 |
| 91 | Ga0068857_100043166 | 3300005577 | Bacteria | 4000 |
| 92 | Ga0068854_100000060 | 3300005578 | Bacteria | 80591 |
| 93 | Ga0068854_100007812 | 3300005578 | Bacteria | 6843 |
| 94 | Ga0068856_100002389 | 3300005614 | Bacteria | 19317 |
| 95 | Ga0068856_100133320 | 3300005614 | Bacteria | 2489 |
| 96 | Ga0068858_100000741 | 3300005842 | Bacteria | 34187 |
| 97 | Ga0068860_100023779 | 3300005843 | Bacteria | 5923 |
| 98 | Ga0075364_10000771 | 3300006051 | Bacteria | 16831 |
| 99 | Ga0075364_10004224 | 3300006051 | Bacteria | 8248 |
| 100 | Ga0075364_10011667 | 3300006051 | Bacteria | 5344 |
| 101 | Ga0075364_10080678 | 3300006051 | Bacteria | 2151 |
| 102 | Ga0075364_10153041 | 3300006051 | Bacteria | 1555 |
| 103 | Ga0075366_10000439 | 3300006195 | Bacteria | 19409 |
| 104 | Ga0079104_1000036 | 3300006946 | Bacteria | 194741 |
| 105 | Ga0079104_1000122 | 3300006946 | Bacteria | 111219 |
| 106 | Ga0079104_1000203 | 3300006946 | Bacteria | 83190 |
| 107 | Ga0079104_1000437 | 3300006946 | Bacteria | 47476 |
| 108 | Ga0079104_1001827 | 3300006946 | Bacteria | 13090 |
| 109 | Ga0079104_1002423 | 3300006946 | Bacteria | 10072 |
| 110 | Ga0079104_1002630 | 3300006946 | Bacteria | 9381 |
| 111 | Ga0079104_1005598 | 3300006946 | Bacteria | 4976 |
| 112 | Ga0079104_1011891 | 3300006946 | Bacteria | 2768 |
| 113 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 114 | Ga0105251_10000277 | 3300009011 | Bacteria | 51445 |
| 115 | Ga0105251_10001409 | 3300009011 | Bacteria | 20711 |
| 116 | Ga0105251_10003581 | 3300009011 | Bacteria | 11191 |
| 117 | Ga0105251_10004348 | 3300009011 | Bacteria | 9691 |
| 118 | Ga0105251_10039575 | 3300009011 | Bacteria | 2302 |
| 119 | Ga0105244_10001959 | 3300009036 | Bacteria | 15960 |
| 120 | Ga0105244_10002307 | 3300009036 | Bacteria | 14498 |
| 121 | Ga0105244_10002367 | 3300009036 | Bacteria | 14314 |
| 122 | Ga0105244_10003041 | 3300009036 | Bacteria | 12310 |
| 123 | Ga0105244_10010955 | 3300009036 | Bacteria | 5468 |
| 124 | Ga0105250_10000855 | 3300009092 | Bacteria | 17996 |
| 125 | Ga0105250_10003442 | 3300009092 | Bacteria | 7498 |
| 126 | Ga0105250_10023228 | 3300009092 | Bacteria | 2499 |
| 127 | Ga0105240_10007862 | 3300009093 | Bacteria | 15388 |
| 128 | Ga0105240_10007892 | 3300009093 | Bacteria | 15350 |
| 129 | Ga0105240_10022027 | 3300009093 | Bacteria | 8461 |
| 130 | Ga0105240_10044181 | 3300009093 | Bacteria | 5665 |
| 131 | Ga0105240_10074091 | 3300009093 | Bacteria | 4203 |
| 132 | Ga0105240_10094914 | 3300009093 | Bacteria | 3637 |
| 133 | Ga0105240_10246122 | 3300009093 | Bacteria | 2070 |
| 134 | Ga0105243_10000259 | 3300009148 | Bacteria | 60174 |
| 135 | Ga0105237_10000774 | 3300009545 | Bacteria | 43726 |
| 136 | Ga0105238_10004980 | 3300009551 | Bacteria | 13136 |
| 137 | Ga0105249_10003765 | 3300009553 | Bacteria | 13088 |
| 138 | Ga0099796_10055307 | 3300010159 | Bacteria | 1390 |
| 139 | Ga0105239_10000480 | 3300010375 | Bacteria | 58268 |
| 140 | Ga0105239_10000644 | 3300010375 | Bacteria | 49525 |
| 141 | Ga0105246_10035707 | 3300011119 | Bacteria | 3324 |
| 142 | Ga0105246_10076771 | 3300011119 | Bacteria | 2368 |
| 143 | Ga0157373_10000646 | 3300013100 | Bacteria | 27422 |
| 144 | Ga0157373_10002943 | 3300013100 | Bacteria | 12904 |
| 145 | Ga0157373_10033962 | 3300013100 | Bacteria | 3665 |
| 146 | Ga0157373_10051163 | 3300013100 | Bacteria | 2942 |
| 147 | Ga0157373_10223152 | 3300013100 | Bacteria | 1330 |
| 148 | Ga0157371_10000404 | 3300013102 | Bacteria | 54021 |
| 149 | Ga0157371_10001363 | 3300013102 | Bacteria | 25629 |
| 150 | Ga0157371_10005803 | 3300013102 | Bacteria | 10332 |
| 151 | Ga0157371_10016673 | 3300013102 | Bacteria | 5475 |
| 152 | Ga0157371_10029511 | 3300013102 | Bacteria | 3964 |
| 153 | Ga0157371_10091166 | 3300013102 | Bacteria | 2159 |
| 154 | Ga0157370_10006219 | 3300013104 | Bacteria | 13227 |
| 155 | Ga0157370_10007229 | 3300013104 | Bacteria | 12116 |
| 156 | Ga0157370_10183156 | 3300013104 | Bacteria | 1946 |
| 157 | Ga0157369_10004570 | 3300013105 | Bacteria | 16272 |
| 158 | Ga0157369_10005312 | 3300013105 | Bacteria | 15012 |
| 159 | Ga0157369_10239450 | 3300013105 | Bacteria | 1895 |
| 160 | Ga0163162_10034844 | 3300013306 | Bacteria | 5011 |
| 161 | Ga0157372_10000062 | 3300013307 | Bacteria | 119721 |
| 162 | Ga0157372_10006644 | 3300013307 | Bacteria | 12308 |
| 163 | Ga0157372_10023640 | 3300013307 | Bacteria | 6666 |
| 164 | Ga0157372_10030390 | 3300013307 | Bacteria | 5911 |
| 165 | Ga0157372_10039194 | 3300013307 | Bacteria | 5230 |
| 166 | Ga0157372_10040945 | 3300013307 | Bacteria | 5120 |
| 167 | Ga0157372_10105763 | 3300013307 | Bacteria | 3219 |
| 168 | Ga0163163_10110438 | 3300014325 | Bacteria | 2778 |
| 169 | Ga0182008_10000147 | 3300014497 | Bacteria | 54639 |
| 170 | Ga0182006_1000212 | 3300015261 | Bacteria | 57379 |
| 171 | Ga0182006_1006900 | 3300015261 | Bacteria | 5234 |
| 172 | Ga0182006_1010041 | 3300015261 | Bacteria | 4222 |
| 173 | Ga0182007_10027739 | 3300015262 | Bacteria | 1950 |
| 174 | Ga0182005_1000018 | 3300015265 | Bacteria | 324307 |
| 175 | Ga0183366_1004 | 3300015679 | Bacteria | 252597 |
| 176 | Ga0183370_1004 | 3300015680 | Bacteria | 252597 |
| 177 | Ga0183369_1010 | 3300015685 | Bacteria | 252581 |
| 178 | Ga0183368_1008 | 3300015687 | Bacteria | 252581 |
| 179 | Ga0163161_10169939 | 3300017792 | Bacteria | 1666 |
| 180 | Ga0163161_10222672 | 3300017792 | Bacteria | 1461 |
| 181 | Ga0197907_10544216 | 3300020069 | Bacteria | 3436 |
| 182 | Ga0206351_10076999 | 3300020077 | Bacteria | 4244 |
| 183 | Ga0154015_1694190 | 3300020610 | Bacteria | 4267 |
| 184 | Ga0213872_10000654 | 3300021361 | Bacteria | 26277 |
| 185 | Ga0213872_10001316 | 3300021361 | Bacteria | 16470 |
| 186 | Ga0213872_10001452 | 3300021361 | Bacteria | 15431 |
| 187 | Ga0213872_10004382 | 3300021361 | Bacteria | 7515 |
| 188 | Ga0213872_10009443 | 3300021361 | Bacteria | 4677 |
| 189 | Ga0213876_10000049 | 3300021384 | Bacteria | 145629 |
| 190 | Ga0209760_100179 | 3300025207 | Bacteria | 33431 |
| 191 | Ga0209436_100178 | 3300025208 | Bacteria | 30007 |
| 192 | Ga0209436_100211 | 3300025208 | Bacteria | 26922 |
| 193 | Ga0209436_100684 | 3300025208 | Bacteria | 14390 |
| 194 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 195 | Ga0209784_100063 | 3300025224 | Bacteria | 159576 |
| 196 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 197 | Ga0209566_100048 | 3300025225 | Bacteria | 241570 |
| 198 | Ga0209566_102596 | 3300025225 | Bacteria | 3221 |
| 199 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 200 | Ga0209674_100071 | 3300025226 | Bacteria | 241568 |
| 201 | Ga0209674_103236 | 3300025226 | Bacteria | 3069 |
| 202 | Ga0209672_100199 | 3300025228 | Bacteria | 47771 |
| 203 | Ga0209672_100339 | 3300025228 | Bacteria | 30154 |
| 204 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 205 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 206 | Ga0209563_100085 | 3300025230 | Bacteria | 186579 |
| 207 | Ga0207427_100032 | 3300025231 | Bacteria | 349939 |
| 208 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 209 | Ga0209437_100092 | 3300025233 | Bacteria | 240044 |
| 210 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 211 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 212 | Ga0207425_1000011 | 3300025245 | Bacteria | 550735 |
| 213 | Ga0207425_1000017 | 3300025245 | Bacteria | 423851 |
| 214 | Ga0207425_1000067 | 3300025245 | Bacteria | 124459 |
| 215 | Ga0207425_1000085 | 3300025245 | Bacteria | 95577 |
| 216 | Ga0207425_1001571 | 3300025245 | Bacteria | 9266 |
| 217 | Ga0207425_1005801 | 3300025245 | Bacteria | 3470 |
| 218 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 219 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 220 | Ga0209677_100040 | 3300025253 | Bacteria | 241568 |
| 221 | Ga0209759_1002426 | 3300025256 | Bacteria | 8172 |
| 222 | Ga0209759_1009418 | 3300025256 | Bacteria | 2954 |
| 223 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 224 | Ga0209129_1000021 | 3300025258 | Bacteria | 445018 |
| 225 | Ga0209129_1000162 | 3300025258 | Bacteria | 101248 |
| 226 | Ga0209129_1000273 | 3300025258 | Bacteria | 50169 |
| 227 | Ga0209129_1002118 | 3300025258 | Bacteria | 10097 |
| 228 | Ga0209129_1005230 | 3300025258 | Bacteria | 4696 |
| 229 | Ga0209129_1013492 | 3300025258 | Bacteria | 1797 |
| 230 | Ga0209233_1001209 | 3300025261 | Bacteria | 10412 |
| 231 | Ga0209233_1001959 | 3300025261 | Bacteria | 7829 |
| 232 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 233 | Ga0209565_1000452 | 3300025263 | Bacteria | 31667 |
| 234 | Ga0209565_1000613 | 3300025263 | Bacteria | 23636 |
| 235 | Ga0209565_1000665 | 3300025263 | Bacteria | 21915 |
| 236 | Ga0209565_1001924 | 3300025263 | Bacteria | 8204 |
| 237 | Ga0209565_1002725 | 3300025263 | Bacteria | 6139 |
| 238 | Ga0209565_1003902 | 3300025263 | Bacteria | 4683 |
| 239 | Ga0209565_1004983 | 3300025263 | Bacteria | 3935 |
| 240 | Ga0209565_1005250 | 3300025263 | Bacteria | 3796 |
| 241 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 242 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 243 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 244 | Ga0209673_1007399 | 3300025273 | Bacteria | 5071 |
| 245 | Ga0209673_1015512 | 3300025273 | Bacteria | 2890 |
| 246 | Ga0209130_1000044 | 3300025284 | Bacteria | 241110 |
| 247 | Ga0209130_1000059 | 3300025284 | Bacteria | 204772 |
| 248 | Ga0209130_1000733 | 3300025284 | Bacteria | 29001 |
| 249 | Ga0209130_1000968 | 3300025284 | Bacteria | 22635 |
| 250 | Ga0209130_1003333 | 3300025284 | Bacteria | 6918 |
| 251 | Ga0209130_1005009 | 3300025284 | Bacteria | 4773 |
| 252 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 253 | Ga0209675_1000394 | 3300025291 | Bacteria | 36250 |
| 254 | Ga0209675_1001363 | 3300025291 | Bacteria | 14327 |
| 255 | Ga0209675_1001613 | 3300025291 | Bacteria | 12716 |
| 256 | Ga0209675_1007023 | 3300025291 | Bacteria | 4395 |
| 257 | Ga0209676_1006547 | 3300025292 | Bacteria | 5721 |
| 258 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 259 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 260 | Ga0209025_1007861 | 3300025294 | Bacteria | 7823 |
| 261 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 262 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 263 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 264 | Ga0209564_1000142 | 3300025295 | Bacteria | 178742 |
| 265 | Ga0209564_1005605 | 3300025295 | Bacteria | 7071 |
| 266 | Ga0209564_1007137 | 3300025295 | Bacteria | 5832 |
| 267 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 268 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 269 | Ga0209758_1000250 | 3300025297 | Bacteria | 109992 |
| 270 | Ga0209758_1000583 | 3300025297 | Bacteria | 56955 |
| 271 | Ga0209758_1007146 | 3300025297 | Bacteria | 7707 |
| 272 | Ga0209050_1000058 | 3300025298 | Bacteria | 325558 |
| 273 | Ga0209050_1000612 | 3300025298 | Bacteria | 56207 |
| 274 | Ga0209050_1000654 | 3300025298 | Bacteria | 53586 |
| 275 | Ga0209050_1001112 | 3300025298 | Bacteria | 32536 |
| 276 | Ga0209050_1001305 | 3300025298 | Bacteria | 28023 |
| 277 | Ga0209050_1001484 | 3300025298 | Bacteria | 24939 |
| 278 | Ga0209050_1010656 | 3300025298 | Bacteria | 4492 |
| 279 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 280 | Ga0209256_1000184 | 3300025299 | Bacteria | 121336 |
| 281 | Ga0209256_1000201 | 3300025299 | Bacteria | 112637 |
| 282 | Ga0209256_1000285 | 3300025299 | Bacteria | 88890 |
| 283 | Ga0209256_1000503 | 3300025299 | Bacteria | 57448 |
| 284 | Ga0209256_1000875 | 3300025299 | Bacteria | 37255 |
| 285 | Ga0209256_1002929 | 3300025299 | Bacteria | 12821 |
| 286 | Ga0207426_1002835 | 3300025302 | Bacteria | 10323 |
| 287 | Ga0207426_1005567 | 3300025302 | Bacteria | 5714 |
| 288 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 289 | Ga0209257_1000123 | 3300025304 | Bacteria | 219092 |
| 290 | Ga0209257_1002302 | 3300025304 | Bacteria | 19351 |
| 291 | Ga0209257_1004098 | 3300025304 | Bacteria | 11660 |
| 292 | Ga0207696_1000202 | 3300025711 | Bacteria | 91342 |
| 293 | Ga0207696_1000949 | 3300025711 | Bacteria | 17703 |
| 294 | Ga0207696_1002169 | 3300025711 | Bacteria | 9843 |
| 295 | Ga0207696_1007432 | 3300025711 | Bacteria | 4291 |
| 296 | Ga0207655_1000067 | 3300025728 | Bacteria | 245484 |
| 297 | Ga0207655_1000111 | 3300025728 | Bacteria | 170772 |
| 298 | Ga0207655_1000122 | 3300025728 | Bacteria | 154848 |
| 299 | Ga0207655_1000218 | 3300025728 | Bacteria | 98543 |
| 300 | Ga0207655_1001050 | 3300025728 | Bacteria | 27637 |
| 301 | Ga0207655_1002313 | 3300025728 | Bacteria | 15653 |
| 302 | Ga0207655_1004581 | 3300025728 | Bacteria | 9736 |
| 303 | Ga0207655_1005717 | 3300025728 | Bacteria | 8399 |
| 304 | Ga0207655_1029638 | 3300025728 | Bacteria | 2558 |
| 305 | Ga0207713_1000184 | 3300025735 | Bacteria | 88768 |
| 306 | Ga0207713_1000636 | 3300025735 | Bacteria | 34132 |
| 307 | Ga0207713_1000748 | 3300025735 | Bacteria | 30270 |
| 308 | Ga0207713_1002034 | 3300025735 | Bacteria | 15140 |
| 309 | Ga0207713_1002094 | 3300025735 | Bacteria | 14894 |
| 310 | Ga0207713_1004241 | 3300025735 | Bacteria | 9366 |
| 311 | Ga0207647_10000024 | 3300025904 | Bacteria | 115153 |
| 312 | Ga0207695_10000200 | 3300025913 | Bacteria | 165896 |
| 313 | Ga0207695_10001553 | 3300025913 | Bacteria | 37757 |
| 314 | Ga0207695_10002561 | 3300025913 | Bacteria | 26716 |
| 315 | Ga0207695_10029467 | 3300025913 | Bacteria | 6063 |
| 316 | Ga0207695_10077056 | 3300025913 | Bacteria | 3388 |
| 317 | Ga0207671_10021575 | 3300025914 | Bacteria | 4883 |
| 318 | Ga0207671_10270261 | 3300025914 | Bacteria | 1339 |
| 319 | Ga0207649_10000390 | 3300025920 | Bacteria | 32941 |
| 320 | Ga0207652_10083219 | 3300025921 | Bacteria | 2802 |
| 321 | Ga0207694_10011349 | 3300025924 | Bacteria | 6725 |
| 322 | Ga0207644_10250209 | 3300025931 | Bacteria | 1414 |
| 323 | Ga0207706_10001182 | 3300025933 | Bacteria | 26340 |
| 324 | Ga0207709_10000289 | 3300025935 | Bacteria | 57229 |
| 325 | Ga0207679_10000003 | 3300025945 | Bacteria | 597553 |
| 326 | Ga0207712_10000244 | 3300025961 | Bacteria | 53354 |
| 327 | Ga0207712_10000608 | 3300025961 | Bacteria | 28444 |
| 328 | Ga0207640_10000071 | 3300025981 | Bacteria | 80591 |
| 329 | Ga0207677_10137142 | 3300026023 | Bacteria | 1867 |
| 330 | Ga0207703_10000573 | 3300026035 | Bacteria | 37600 |
| 331 | Ga0207639_10013416 | 3300026041 | Bacteria | 5736 |
| 332 | Ga0207639_10030426 | 3300026041 | Bacteria | 3959 |
| 333 | Ga0207678_10000175 | 3300026067 | Bacteria | 54512 |
| 334 | Ga0207678_10028388 | 3300026067 | Bacteria | 4885 |
| 335 | Ga0207702_10000110 | 3300026078 | Bacteria | 95353 |
| 336 | Ga0207674_10000071 | 3300026116 | Bacteria | 105678 |
| 337 | Ga0207674_10011098 | 3300026116 | Bacteria | 10131 |
| 338 | Ga0207674_10079114 | 3300026116 | Bacteria | 3292 |
| 339 | Ga0207683_10144062 | 3300026121 | Bacteria | 2148 |
| 340 | Ga0209281_1000031 | 3300027111 | Bacteria | 422772 |
| 341 | Ga0209281_1000080 | 3300027111 | Bacteria | 261394 |
| 342 | Ga0209281_1000086 | 3300027111 | Bacteria | 250986 |
| 343 | Ga0209281_1000117 | 3300027111 | Bacteria | 209272 |
| 344 | Ga0209281_1000206 | 3300027111 | Bacteria | 133510 |
| 345 | Ga0209281_1000261 | 3300027111 | Bacteria | 101694 |
| 346 | Ga0209281_1000338 | 3300027111 | Bacteria | 79936 |
| 347 | Ga0209281_1001242 | 3300027111 | Bacteria | 16718 |
| 348 | Ga0209281_1002414 | 3300027111 | Bacteria | 7565 |
| 349 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 350 | Ga0209371_1000029 | 3300027312 | Bacteria | 424797 |
| 351 | Ga0209371_1000042 | 3300027312 | Bacteria | 333147 |
| 352 | Ga0209371_1000133 | 3300027312 | Bacteria | 122145 |
| 353 | Ga0209371_1000257 | 3300027312 | Bacteria | 64352 |
| 354 | Ga0209371_1001693 | 3300027312 | Bacteria | 13989 |
| 355 | Ga0209371_1002593 | 3300027312 | Bacteria | 9935 |
| 356 | Ga0209371_1003013 | 3300027312 | Bacteria | 8707 |
| 357 | Ga0209371_1011434 | 3300027312 | Bacteria | 2636 |
| 358 | Ga0209371_1017609 | 3300027312 | Bacteria | 1845 |
| 359 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 360 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 361 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 362 | Ga0268266_10000129 | 3300028379 | Bacteria | 148215 |
| 363 | Ga0268266_10052560 | 3300028379 | Bacteria | 3499 |
| 364 | Ga0268264_10035567 | 3300028381 | Bacteria | 4100 |
| 365 | Ga0307517_10006778 | 3300028786 | Bacteria | 16859 |
| 366 | Ga0307517_10105419 | 3300028786 | Bacteria | 2188 |
| 367 | Ga0307515_10000652 | 3300028794 | Bacteria | 80185 |
| 368 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 369 | Ga0268256_1000032 | 3300030500 | Bacteria | 424603 |
| 370 | Ga0268256_1000042 | 3300030500 | Bacteria | 333815 |
| 371 | Ga0268256_1000262 | 3300030500 | Bacteria | 55825 |
| 372 | Ga0268256_1001353 | 3300030500 | Bacteria | 14953 |
| 373 | Ga0268256_1001716 | 3300030500 | Bacteria | 12466 |
| 374 | Ga0268256_1001932 | 3300030500 | Bacteria | 11354 |
| 375 | Ga0268256_1004434 | 3300030500 | Bacteria | 5821 |
| 376 | Ga0268256_1008802 | 3300030500 | Bacteria | 3426 |
| 377 | Ga0268256_1009719 | 3300030500 | Bacteria | 3162 |
| 378 | Ga0268256_1015762 | 3300030500 | Bacteria | 2192 |
| 379 | Ga0268256_1016889 | 3300030500 | Bacteria | 2074 |
| 380 | Ga0307511_10000875 | 3300030521 | Bacteria | 32041 |
| 381 | Ga0307511_10004090 | 3300030521 | Bacteria | 14908 |
| 382 | Ga0307512_10051335 | 3300030522 | Bacteria | 3301 |
| 383 | Ga0316180_1052418 | 3300030736 | Bacteria | 2915 |
| 384 | Ga0316182_1325361 | 3300030745 | Bacteria | 1568 |
| 385 | Ga0307513_10206262 | 3300031456 | Bacteria | 1801 |
| 386 | Ga0307513_10323942 | 3300031456 | Bacteria | 1298 |
| 387 | Ga0307509_10002463 | 3300031507 | Bacteria | 29929 |
| 388 | Ga0307509_10009159 | 3300031507 | Bacteria | 12441 |
| 389 | Ga0307408_100000016 | 3300031548 | Bacteria | 356896 |
| 390 | Ga0307408_100000082 | 3300031548 | Bacteria | 106847 |
| 391 | Ga0307408_100000194 | 3300031548 | Bacteria | 65753 |
| 392 | Ga0307408_100001091 | 3300031548 | Bacteria | 20747 |
| 393 | Ga0307408_100004846 | 3300031548 | Bacteria | 9063 |
| 394 | Ga0307508_10131442 | 3300031616 | Bacteria | 2106 |
| 395 | Ga0307514_10002227 | 3300031649 | Bacteria | 20686 |
| 396 | Ga0307514_10077067 | 3300031649 | Bacteria | 2481 |
| 397 | Ga0265314_10009564 | 3300031711 | Bacteria | 8168 |
| 398 | Ga0307516_10000348 | 3300031730 | Bacteria | 60054 |
| 399 | Ga0307416_100000733 | 3300032002 | Bacteria | 17094 |
| 400 | Ga0307510_10003186 | 3300033180 | Bacteria | 19042 |
| 401 | Ga0307510_10015746 | 3300033180 | Bacteria | 8942 |
| 402 | Ga0373939_0000113 | 3300035114 | Bacteria | 24383 |
| 403 | Ga0373960_0000857 | 3300035121 | Bacteria | 6436 |
| 404 | Ga0373931_0002626 | 3300035691 | Bacteria | 7997 |
| 405 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 406 | Ga0395900_0051003 | 3300037418 | Bacteria | 4262 |
| 407 | Ga0395905_0010150 | 3300037471 | Bacteria | 9177 |
| 408 | Ga0395905_0013852 | 3300037471 | Bacteria | 7714 |
| 409 | Ga0395901_0056740 | 3300038443 | Bacteria | 4074 |
| 410 | Ga0237819_00016 | 3300038705 | Bacteria | 57788 |
| 411 | Ga0436365_0245969 | 3300039437 | Bacteria | 378821 |
| 412 | Ga0436361_0080811 | 3300039447 | Bacteria | 13019 |
| 413 | Ga0436361_0810533 | 3300039447 | Bacteria | 9812 |
| 414 | Ga0436361_0821396 | 3300039447 | Bacteria | 16496 |
| 415 | Ga0439438_001391 | 3300041405 | Bacteria | 10661 |
| 416 | Ga0439447_002006 | 3300041407 | Bacteria | 7480 |
| 417 | Ga0451798_0664110 | 3300041458 | Bacteria | 1498 |
| 418 | Ga0439452_000012 | 3300042010 | Bacteria | 412478 |
| 419 | Ga0439452_000076 | 3300042010 | Bacteria | 87445 |
| 420 | Ga0439452_000494 | 3300042010 | Bacteria | 21620 |
| 421 | Ga0450900_003287 | 3300042136 | Bacteria | 1787 |
| 422 | Ga0439464_0015981 | 3300042439 | Bacteria | 2028 |
| 423 | Ga0450918_000309 | 3300042531 | Bacteria | 10941 |
| 424 | Ga0466972_0000331 | 3300044658 | Bacteria | 26574 |
| 425 | Ga0466981_0000020 | 3300044669 | Bacteria | 87281 |
| 426 | Ga0466965_0024779 | 3300044683 | Bacteria | 2903 |
| 427 | Ga0466965_0072550 | 3300044683 | Bacteria | 1732 |
| 428 | Ga0466966_0014028 | 3300044684 | Bacteria | 5304 |
| 429 | Ga0466961_0004626 | 3300044693 | Bacteria | 8635 |
| 430 | Ga0466968_0007269 | 3300044735 | Bacteria | 4208 |
| 431 | Ga0466968_0017600 | 3300044735 | Bacteria | 2859 |
| 432 | Ga0466957_0042727 | 3300044842 | Bacteria | 2743 |
| 433 | Ga0466960_0048075 | 3300044901 | Bacteria | 2049 |
| 434 | Ga0466960_0169611 | 3300044901 | Bacteria | 1177 |
| 435 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 436 | Ga0495617_000460 | 3300046452 | Bacteria | 21930 |
| 437 | Ga0495617_000570 | 3300046452 | Bacteria | 18943 |
| 438 | Ga0495617_000947 | 3300046452 | Bacteria | 13464 |
| 439 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 440 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 441 | Ga0495591_000095 | 3300046458 | Bacteria | 100685 |
| 442 | Ga0495591_000126 | 3300046458 | Bacteria | 83383 |
| 443 | Ga0495591_001567 | 3300046458 | Bacteria | 13925 |
| 444 | Ga0495638_0000366 | 3300046460 | Bacteria | 55970 |
| 445 | Ga0495638_0002123 | 3300046460 | Bacteria | 16699 |
| 446 | Ga0495638_0002285 | 3300046460 | Bacteria | 15813 |
| 447 | Ga0495638_0074618 | 3300046460 | Bacteria | 2068 |
| 448 | Ga0495638_0083629 | 3300046460 | Bacteria | 1933 |
| 449 | Ga0495653_0000037 | 3300046463 | Bacteria | 120575 |
| 450 | Ga0495653_0197745 | 3300046463 | Bacteria | 1367 |
| 451 | Ga0495650_0000094 | 3300046471 | Bacteria | 219056 |
| 452 | Ga0495650_0000126 | 3300046471 | Bacteria | 178143 |
| 453 | Ga0495650_0000169 | 3300046471 | Bacteria | 145238 |
| 454 | Ga0495650_0000177 | 3300046471 | Bacteria | 139376 |
| 455 | Ga0495650_0000256 | 3300046471 | Bacteria | 103125 |
| 456 | Ga0495650_0000421 | 3300046471 | Bacteria | 69019 |
| 457 | Ga0495650_0003963 | 3300046471 | Bacteria | 10407 |
| 458 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 459 | Ga0495605_0000239 | 3300046474 | Bacteria | 65496 |
| 460 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 461 | Ga0495584_0000144 | 3300046491 | Bacteria | 49665 |
| 462 | Ga0495584_0001913 | 3300046491 | Bacteria | 11987 |
| 463 | Ga0495584_0065214 | 3300046491 | Bacteria | 1831 |
| 464 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 465 | Ga0495585_0000026 | 3300046492 | Bacteria | 148243 |
| 466 | Ga0495585_0000922 | 3300046492 | Bacteria | 24890 |
| 467 | Ga0495585_0000984 | 3300046492 | Bacteria | 23867 |
| 468 | Ga0495585_0001182 | 3300046492 | Bacteria | 21187 |
| 469 | Ga0495585_0007599 | 3300046492 | Bacteria | 6621 |
| 470 | Ga0495585_0007857 | 3300046492 | Bacteria | 6489 |
| 471 | Ga0495585_0050822 | 3300046492 | Bacteria | 2298 |
| 472 | Ga0495585_0070416 | 3300046492 | Bacteria | 1908 |
| 473 | Ga0495585_0189029 | 3300046492 | Bacteria | 1054 |
| 474 | Ga0495594_0021495 | 3300046499 | Bacteria | 3443 |
| 475 | Ga0495596_0000149 | 3300046500 | Bacteria | 48579 |
| 476 | Ga0495596_0003827 | 3300046500 | Bacteria | 7488 |
| 477 | Ga0495596_0004037 | 3300046500 | Bacteria | 7228 |
| 478 | Ga0495596_0009020 | 3300046500 | Bacteria | 4409 |
| 479 | Ga0495607_0000423 | 3300046501 | Bacteria | 43024 |
| 480 | Ga0495607_0002599 | 3300046501 | Bacteria | 14519 |
| 481 | Ga0495607_0002760 | 3300046501 | Bacteria | 14001 |
| 482 | Ga0495607_0005270 | 3300046501 | Bacteria | 9303 |
| 483 | Ga0495607_0006087 | 3300046501 | Bacteria | 8532 |
| 484 | Ga0495607_0009553 | 3300046501 | Bacteria | 6554 |
| 485 | Ga0495607_0078202 | 3300046501 | Bacteria | 1825 |
| 486 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 487 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 488 | Ga0495583_0000021 | 3300046506 | Bacteria | 287046 |
| 489 | Ga0495583_0000431 | 3300046506 | Bacteria | 63149 |
| 490 | Ga0495583_0000508 | 3300046506 | Bacteria | 55961 |
| 491 | Ga0495583_0020905 | 3300046506 | Bacteria | 3376 |
| 492 | Ga0495583_0029448 | 3300046506 | Bacteria | 2686 |
| 493 | Ga0495583_0045912 | 3300046506 | Bacteria | 2017 |
| 494 | Ga0495606_0000024 | 3300046507 | Bacteria | 262080 |
| 495 | Ga0495606_0000069 | 3300046507 | Bacteria | 179158 |
| 496 | Ga0495606_0000268 | 3300046507 | Bacteria | 91857 |
| 497 | Ga0495606_0002135 | 3300046507 | Bacteria | 23874 |
| 498 | Ga0495606_0003645 | 3300046507 | Bacteria | 16154 |
| 499 | Ga0495606_0004126 | 3300046507 | Bacteria | 14749 |
| 500 | Ga0495606_0009070 | 3300046507 | Bacteria | 8481 |
| 501 | Ga0495606_0012997 | 3300046507 | Bacteria | 6621 |
| 502 | Ga0495606_0032074 | 3300046507 | Bacteria | 3644 |
| 503 | Ga0495606_0072980 | 3300046507 | Bacteria | 2154 |
| 504 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 505 | Ga0495610_0000688 | 3300046512 | Bacteria | 32625 |
| 506 | Ga0495610_0001096 | 3300046512 | Bacteria | 24679 |
| 507 | Ga0495610_0001354 | 3300046512 | Bacteria | 21747 |
| 508 | Ga0495610_0083542 | 3300046512 | Bacteria | 1461 |
| 509 | Ga0495616_0000616 | 3300046513 | Bacteria | 26772 |
| 510 | Ga0495616_0002987 | 3300046513 | Bacteria | 10986 |
| 511 | Ga0495616_0005767 | 3300046513 | Bacteria | 7571 |
| 512 | Ga0495616_0006740 | 3300046513 | Bacteria | 6924 |
| 513 | Ga0495616_0009497 | 3300046513 | Bacteria | 5682 |
| 514 | Ga0495616_0028253 | 3300046513 | Bacteria | 2970 |
| 515 | Ga0495616_0030102 | 3300046513 | Bacteria | 2856 |
| 516 | Ga0495620_0001761 | 3300046515 | Bacteria | 12736 |
| 517 | Ga0495620_0011071 | 3300046515 | Bacteria | 4723 |
| 518 | Ga0495631_0003073 | 3300046518 | Bacteria | 9212 |
| 519 | Ga0495631_0009757 | 3300046518 | Bacteria | 4781 |
| 520 | Ga0495631_0011449 | 3300046518 | Bacteria | 4362 |
| 521 | Ga0495631_0098547 | 3300046518 | Bacteria | 1258 |
| 522 | Ga0495632_0001138 | 3300046519 | Bacteria | 22748 |
| 523 | Ga0495632_0024916 | 3300046519 | Bacteria | 3171 |
| 524 | Ga0495637_0001417 | 3300046520 | Bacteria | 14138 |
| 525 | Ga0495637_0020431 | 3300046520 | Bacteria | 3047 |
| 526 | Ga0495643_0000182 | 3300046522 | Bacteria | 100196 |
| 527 | Ga0495643_0000383 | 3300046522 | Bacteria | 58554 |
| 528 | Ga0495643_0000425 | 3300046522 | Bacteria | 54854 |
| 529 | Ga0495643_0000695 | 3300046522 | Bacteria | 38698 |
| 530 | Ga0495643_0040750 | 3300046522 | Bacteria | 2535 |
| 531 | Ga0495644_0000347 | 3300046523 | Bacteria | 21047 |
| 532 | Ga0495644_0003130 | 3300046523 | Bacteria | 6544 |
| 533 | Ga0495644_0003727 | 3300046523 | Bacteria | 5998 |
| 534 | Ga0495644_0006940 | 3300046523 | Bacteria | 4384 |
| 535 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 536 | Ga0495648_0000045 | 3300046524 | Bacteria | 172587 |
| 537 | Ga0495648_0001995 | 3300046524 | Bacteria | 19327 |
| 538 | Ga0495648_0002014 | 3300046524 | Bacteria | 19253 |
| 539 | Ga0495648_0003262 | 3300046524 | Bacteria | 14373 |
| 540 | Ga0495648_0009843 | 3300046524 | Bacteria | 7346 |
| 541 | Ga0495648_0013578 | 3300046524 | Bacteria | 6009 |
| 542 | Ga0495648_0066573 | 3300046524 | Bacteria | 2112 |
| 543 | Ga0495648_0081834 | 3300046524 | Bacteria | 1835 |
| 544 | Ga0495663_0002406 | 3300046525 | Bacteria | 5626 |
| 545 | Ga0495663_0006313 | 3300046525 | Bacteria | 3275 |
| 546 | Ga0495663_0026773 | 3300046525 | Bacteria | 1689 |
| 547 | Ga0495666_0018861 | 3300046526 | Bacteria | 3427 |
| 548 | Ga0495642_0003014 | 3300046528 | Bacteria | 6710 |
| 549 | Ga0495642_0003809 | 3300046528 | Bacteria | 5910 |
| 550 | Ga0495642_0007287 | 3300046528 | Bacteria | 4246 |
| 551 | Ga0495642_0015571 | 3300046528 | Bacteria | 2958 |
| 552 | Ga0495642_0020660 | 3300046528 | Bacteria | 2588 |
| 553 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 554 | Ga0495654_0000072 | 3300046530 | Bacteria | 115797 |
| 555 | Ga0495654_0000133 | 3300046530 | Bacteria | 78489 |
| 556 | Ga0495654_0000208 | 3300046530 | Bacteria | 55576 |
| 557 | Ga0495654_0002518 | 3300046530 | Bacteria | 11773 |
| 558 | Ga0495654_0003249 | 3300046530 | Bacteria | 10030 |
| 559 | Ga0495654_0007878 | 3300046530 | Bacteria | 5924 |
| 560 | Ga0495665_0006893 | 3300046531 | Bacteria | 6132 |
| 561 | Ga0495586_0046147 | 3300046535 | Bacteria | 2349 |
| 562 | Ga0495587_0015764 | 3300046536 | Bacteria | 4712 |
| 563 | Ga0495609_0000771 | 3300046538 | Bacteria | 24022 |
| 564 | Ga0495609_0001220 | 3300046538 | Bacteria | 17715 |
| 565 | Ga0495609_0001731 | 3300046538 | Bacteria | 14095 |
| 566 | Ga0495609_0002003 | 3300046538 | Bacteria | 12875 |
| 567 | Ga0495609_0009992 | 3300046538 | Bacteria | 4570 |
| 568 | Ga0495609_0020942 | 3300046538 | Bacteria | 3017 |
| 569 | Ga0495609_0022955 | 3300046538 | Bacteria | 2872 |
| 570 | Ga0495597_0000434 | 3300046542 | Bacteria | 35709 |
| 571 | Ga0495597_0001158 | 3300046542 | Bacteria | 19843 |
| 572 | Ga0495597_0002890 | 3300046542 | Bacteria | 10472 |
| 573 | Ga0495597_0003565 | 3300046542 | Bacteria | 8981 |
| 574 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 575 | Ga0495622_0000489 | 3300046557 | Bacteria | 24974 |
| 576 | Ga0495622_0006038 | 3300046557 | Bacteria | 5628 |
| 577 | Ga0495633_0000356 | 3300046558 | Bacteria | 49639 |
| 578 | Ga0495633_0000522 | 3300046558 | Bacteria | 38445 |
| 579 | Ga0495633_0004410 | 3300046558 | Bacteria | 8960 |
| 580 | Ga0495633_0010220 | 3300046558 | Bacteria | 5135 |
| 581 | Ga0495633_0013669 | 3300046558 | Bacteria | 4269 |
| 582 | Ga0495633_0014930 | 3300046558 | Bacteria | 4038 |
| 583 | Ga0495633_0039794 | 3300046558 | Bacteria | 2242 |
| 584 | Ga0495633_0100007 | 3300046558 | Bacteria | 1346 |
| 585 | Ga0495656_0003608 | 3300046615 | Bacteria | 5243 |
| 586 | Ga0495656_0055091 | 3300046615 | Bacteria | 1713 |
| 587 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 588 | Ga0495668_0000307 | 3300046616 | Bacteria | 67683 |
| 589 | Ga0495668_0000764 | 3300046616 | Bacteria | 37666 |
| 590 | Ga0495668_0001108 | 3300046616 | Bacteria | 27819 |
| 591 | Ga0495668_0001920 | 3300046616 | Bacteria | 18482 |
| 592 | Ga0495668_0040672 | 3300046616 | Bacteria | 2592 |
| 593 | Ga0495611_0009567 | 3300046648 | Bacteria | 4094 |
| 594 | Ga0495611_0014075 | 3300046648 | Bacteria | 3412 |
| 595 | Ga0495611_0018688 | 3300046648 | Bacteria | 2974 |
| 596 | Ga0495611_0041778 | 3300046648 | Bacteria | 2045 |
| 597 | Ga0495625_0001394 | 3300046660 | Bacteria | 29641 |
| 598 | Ga0495625_0001654 | 3300046660 | Bacteria | 26125 |
| 599 | Ga0495625_0001834 | 3300046660 | Bacteria | 24309 |
| 600 | Ga0495625_0013019 | 3300046660 | Bacteria | 6708 |
| 601 | Ga0495625_0016949 | 3300046660 | Bacteria | 5716 |
| 602 | Ga0495625_0125329 | 3300046660 | Bacteria | 1744 |
| 603 | Ga0495625_0158286 | 3300046660 | Bacteria | 1519 |
| 604 | Ga0495659_0000091 | 3300046664 | Bacteria | 39620 |
| 605 | Ga0495659_0000414 | 3300046664 | Bacteria | 16287 |
| 606 | Ga0495659_0003001 | 3300046664 | Bacteria | 5412 |
| 607 | Ga0495659_0017389 | 3300046664 | Bacteria | 2382 |
| 608 | Ga0495661_0000130 | 3300046665 | Bacteria | 91302 |
| 609 | Ga0495661_0000296 | 3300046665 | Bacteria | 56421 |
| 610 | Ga0495661_0008417 | 3300046665 | Bacteria | 7133 |
| 611 | Ga0495661_0015865 | 3300046665 | Bacteria | 5014 |
| 612 | Ga0495661_0036020 | 3300046665 | Bacteria | 3102 |
| 613 | Ga0495661_0074485 | 3300046665 | Bacteria | 1975 |
| 614 | Ga0495661_0080739 | 3300046665 | Bacteria | 1876 |
| 615 | Ga0495661_0117611 | 3300046665 | Bacteria | 1472 |
| 616 | Ga0495588_0000083 | 3300046674 | Bacteria | 197018 |
| 617 | Ga0495669_0005645 | 3300046684 | Bacteria | 5222 |
| 618 | Ga0495670_0000812 | 3300046691 | Bacteria | 15051 |
| 619 | Ga0495670_0006970 | 3300046691 | Bacteria | 5568 |
| 620 | Ga0495670_0014039 | 3300046691 | Bacteria | 3940 |
| 621 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 622 | Ga0495671_0000246 | 3300046692 | Bacteria | 46812 |
| 623 | Ga0495671_0037425 | 3300046692 | Bacteria | 2454 |
| 624 | Ga0495671_0097571 | 3300046692 | Bacteria | 1437 |
| 625 | Ga0495649_0000053 | 3300046694 | Bacteria | 107885 |
| 626 | Ga0495649_0004130 | 3300046694 | Bacteria | 9537 |
| 627 | Ga0495649_0008166 | 3300046694 | Bacteria | 6312 |
| 628 | Ga0495649_0023194 | 3300046694 | Bacteria | 3467 |
| 629 | Ga0495649_0034037 | 3300046694 | Bacteria | 2804 |
| 630 | Ga0495649_0061273 | 3300046694 | Bacteria | 2023 |
| 631 | Ga0495589_0000022 | 3300046794 | Bacteria | 196021 |
| 632 | Ga0495589_0000076 | 3300046794 | Bacteria | 91288 |
| 633 | Ga0495589_0038137 | 3300046794 | Bacteria | 2406 |
| 634 | Ga0495589_0086496 | 3300046794 | Bacteria | 1522 |
| 635 | Ga0495660_0000028 | 3300046810 | Bacteria | 244534 |
| 636 | Ga0495660_0000044 | 3300046810 | Bacteria | 150926 |
| 637 | Ga0495660_0000051 | 3300046810 | Bacteria | 138590 |
| 638 | Ga0495660_0000914 | 3300046810 | Bacteria | 21739 |
| 639 | Ga0495660_0002115 | 3300046810 | Bacteria | 12854 |
| 640 | Ga0495660_0005694 | 3300046810 | Bacteria | 7444 |
| 641 | Ga0495660_0006366 | 3300046810 | Bacteria | 6991 |
| 642 | Ga0495660_0018634 | 3300046810 | Bacteria | 3990 |
| 643 | Ga0495660_0021987 | 3300046810 | Bacteria | 3646 |
| 644 | Ga0495660_0055889 | 3300046810 | Bacteria | 2135 |
| 645 | Ga0495581_0020359 | 3300047315 | Bacteria | 3850 |
| 646 | Ga0495604_0028592 | 3300047317 | Bacteria | 4435 |
| 647 | Ga0495636_0000101 | 3300047318 | Bacteria | 36405 |
| 648 | Ga0495636_0000430 | 3300047318 | Bacteria | 15568 |
| 649 | Ga0495636_0002862 | 3300047318 | Bacteria | 6662 |
| 650 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 651 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 652 | Ga0495672_0000039 | 3300047320 | Bacteria | 272506 |
| 653 | Ga0495672_0000154 | 3300047320 | Bacteria | 100095 |
| 654 | Ga0495672_0001702 | 3300047320 | Bacteria | 21328 |
| 655 | Ga0495672_0034255 | 3300047320 | Bacteria | 3139 |
| 656 | Ga0495676_0036890 | 3300047321 | Bacteria | 4076 |
| 657 | Ga0495683_0000009 | 3300047323 | Bacteria | 241385 |
| 658 | Ga0495683_0001547 | 3300047323 | Bacteria | 14899 |
| 659 | Ga0495683_0006154 | 3300047323 | Bacteria | 6579 |
| 660 | Ga0495683_0006907 | 3300047323 | Bacteria | 6169 |
| 661 | Ga0495683_0013607 | 3300047323 | Bacteria | 4252 |
| 662 | Ga0495683_0030559 | 3300047323 | Bacteria | 2748 |
| 663 | Ga0495687_000099 | 3300047443 | Bacteria | 132139 |
| 664 | Ga0495687_000245 | 3300047443 | Bacteria | 73990 |
| 665 | Ga0495687_001356 | 3300047443 | Bacteria | 22728 |
| 666 | Ga0495687_001959 | 3300047443 | Bacteria | 17586 |
| 667 | Ga0495687_035568 | 3300047443 | Bacteria | 2238 |
| 668 | Ga0495675_0064341 | 3300047444 | Bacteria | 2320 |
| 669 | Ga0495677_0000319 | 3300047445 | Bacteria | 20801 |
| 670 | Ga0495677_0002770 | 3300047445 | Bacteria | 6835 |
| 671 | Ga0495677_0006013 | 3300047445 | Bacteria | 4589 |
| 672 | Ga0495677_0017575 | 3300047445 | Bacteria | 2592 |
| 673 | Ga0495677_0021168 | 3300047445 | Bacteria | 2357 |
| 674 | Ga0495679_000016 | 3300047446 | Bacteria | 282024 |
| 675 | Ga0495679_005316 | 3300047446 | Bacteria | 5728 |
| 676 | Ga0495685_000045 | 3300047447 | Bacteria | 50520 |
| 677 | Ga0495685_003874 | 3300047447 | Bacteria | 4800 |
| 678 | Ga0495685_006938 | 3300047447 | Bacteria | 3725 |
| 679 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 680 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 681 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 682 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 683 | Ga0495673_0000137 | 3300047469 | Bacteria | 134484 |
| 684 | Ga0495681_0003829 | 3300047470 | Bacteria | 10409 |
| 685 | Ga0495681_0004629 | 3300047470 | Bacteria | 9332 |
| 686 | Ga0495681_0014546 | 3300047470 | Bacteria | 4502 |
| 687 | Ga0495681_0076979 | 3300047470 | Bacteria | 1498 |
| 688 | Ga0495686_0032960 | 3300047472 | Bacteria | 3348 |
| 689 | Ga0495686_0034396 | 3300047472 | Bacteria | 3264 |
| 690 | Ga0495626_0000014 | 3300048091 | Bacteria | 246660 |
| 691 | Ga0495626_0000021 | 3300048091 | Bacteria | 217213 |
| 692 | Ga0495626_0002580 | 3300048091 | Bacteria | 12392 |
| 693 | Ga0495626_0004663 | 3300048091 | Bacteria | 8320 |
| 694 | Ga0495626_0007450 | 3300048091 | Bacteria | 6091 |
| 695 | Ga0495626_0027947 | 3300048091 | Bacteria | 2738 |
| 696 | Ga0495626_0030215 | 3300048091 | Bacteria | 2614 |
| 697 | Ga0496101_0000063 | 3300048904 | Bacteria | 125670 |
| 698 | Ga0496102_0001073 | 3300048905 | Bacteria | 25277 |
| 699 | Ga0496103_0020776 | 3300048906 | Bacteria | 3947 |
| 700 | Ga0496105_0079474 | 3300048908 | Bacteria | 2708 |
| 701 | Ga0496107_0038364 | 3300048910 | Bacteria | 3437 |
| 702 | Ga0496114_0004140 | 3300048917 | Bacteria | 11220 |
| 703 | Ga0496116_0000147 | 3300048919 | Bacteria | 142463 |
| 704 | Ga0496116_0001013 | 3300048919 | Bacteria | 34257 |
| 705 | Ga0496116_0001377 | 3300048919 | Bacteria | 27467 |
| 706 | Ga0496116_0019647 | 3300048919 | Bacteria | 5164 |
| 707 | Ga0496116_0020112 | 3300048919 | Bacteria | 5081 |
| 708 | Ga0496116_0032380 | 3300048919 | Bacteria | 3726 |
| 709 | Ga0496116_0036256 | 3300048919 | Bacteria | 3453 |
| 710 | Ga0496116_0078490 | 3300048919 | Bacteria | 2058 |
| 711 | Ga0496117_0000306 | 3300048920 | Bacteria | 85642 |
| 712 | Ga0496117_0002498 | 3300048920 | Bacteria | 23080 |
| 713 | Ga0496117_0009407 | 3300048920 | Bacteria | 9095 |
| 714 | Ga0496117_0009676 | 3300048920 | Bacteria | 8918 |
| 715 | Ga0496117_0015996 | 3300048920 | Bacteria | 6355 |
| 716 | Ga0496117_0017021 | 3300048920 | Bacteria | 6088 |
| 717 | Ga0496117_0035095 | 3300048920 | Bacteria | 3769 |
| 718 | Ga0496117_0039174 | 3300048920 | Bacteria | 3501 |
| 719 | Ga0496117_0043737 | 3300048920 | Bacteria | 3252 |
| 720 | Ga0496118_0000384 | 3300048921 | Bacteria | 74482 |
| 721 | Ga0496118_0001557 | 3300048921 | Bacteria | 34088 |
| 722 | Ga0496118_0012632 | 3300048921 | Bacteria | 8081 |
| 723 | Ga0496118_0017872 | 3300048921 | Bacteria | 6433 |
| 724 | Ga0496118_0037006 | 3300048921 | Bacteria | 3935 |
| 725 | Ga0496118_0051567 | 3300048921 | Bacteria | 3146 |
| 726 | Ga0496119_0000105 | 3300048922 | Bacteria | 119993 |
| 727 | Ga0496119_0000606 | 3300048922 | Bacteria | 48440 |
| 728 | Ga0496119_0000748 | 3300048922 | Bacteria | 43680 |
| 729 | Ga0496119_0000942 | 3300048922 | Bacteria | 37503 |
| 730 | Ga0496119_0003515 | 3300048922 | Bacteria | 16199 |
| 731 | Ga0496119_0003913 | 3300048922 | Bacteria | 15134 |
| 732 | Ga0496119_0006590 | 3300048922 | Bacteria | 10697 |
| 733 | Ga0496119_0013225 | 3300048922 | Bacteria | 6597 |
| 734 | Ga0496119_0014214 | 3300048922 | Bacteria | 6253 |
| 735 | Ga0496119_0016199 | 3300048922 | Bacteria | 5693 |
| 736 | Ga0496119_0017141 | 3300048922 | Bacteria | 5469 |
| 737 | Ga0496119_0048063 | 3300048922 | Bacteria | 2649 |
| 738 | Ga0496119_0076576 | 3300048922 | Bacteria | 1940 |
| 739 | Ga0496120_0000013 | 3300048923 | Bacteria | 331109 |
| 740 | Ga0496120_0000016 | 3300048923 | Bacteria | 307608 |
| 741 | Ga0496120_0000217 | 3300048923 | Bacteria | 99402 |
| 742 | Ga0496120_0000308 | 3300048923 | Bacteria | 81512 |
| 743 | Ga0496120_0001434 | 3300048923 | Bacteria | 28732 |
| 744 | Ga0496120_0002024 | 3300048923 | Bacteria | 22036 |
| 745 | Ga0496120_0003312 | 3300048923 | Bacteria | 14796 |
| 746 | Ga0496120_0014157 | 3300048923 | Bacteria | 5324 |
| 747 | Ga0496120_0017818 | 3300048923 | Bacteria | 4590 |
| 748 | Ga0496120_0036893 | 3300048923 | Bacteria | 2904 |
| 749 | Ga0496120_0044801 | 3300048923 | Bacteria | 2568 |
| 750 | Ga0496121_0000531 | 3300048924 | Bacteria | 72444 |
| 751 | Ga0496121_0002595 | 3300048924 | Bacteria | 27283 |
| 752 | Ga0496121_0008153 | 3300048924 | Bacteria | 12443 |
| 753 | Ga0496121_0013651 | 3300048924 | Bacteria | 8708 |
| 754 | Ga0496121_0024031 | 3300048924 | Bacteria | 5841 |
| 755 | Ga0496121_0027721 | 3300048924 | Bacteria | 5294 |
| 756 | Ga0496121_0046770 | 3300048924 | Bacteria | 3699 |
| 757 | Ga0496121_0116053 | 3300048924 | Bacteria | 2031 |
| 758 | Ga0496122_0000104 | 3300048925 | Bacteria | 195617 |
| 759 | Ga0496122_0000441 | 3300048925 | Bacteria | 87041 |
| 760 | Ga0496122_0001479 | 3300048925 | Bacteria | 37819 |
| 761 | Ga0496122_0001663 | 3300048925 | Bacteria | 34489 |
| 762 | Ga0496122_0008000 | 3300048925 | Bacteria | 11552 |
| 763 | Ga0496122_0016924 | 3300048925 | Bacteria | 6851 |
| 764 | Ga0496122_0018321 | 3300048925 | Bacteria | 6479 |
| 765 | Ga0496122_0044424 | 3300048925 | Bacteria | 3467 |
| 766 | Ga0496122_0049718 | 3300048925 | Bacteria | 3206 |
| 767 | Ga0496122_0051031 | 3300048925 | Bacteria | 3148 |
| 768 | Ga0496122_0078593 | 3300048925 | Bacteria | 2310 |
| 769 | Ga0496123_0000060 | 3300048926 | Bacteria | 224015 |
| 770 | Ga0496123_0000342 | 3300048926 | Bacteria | 87798 |
| 771 | Ga0496123_0001369 | 3300048926 | Bacteria | 34241 |
| 772 | Ga0496123_0001529 | 3300048926 | Bacteria | 31947 |
| 773 | Ga0496123_0009004 | 3300048926 | Bacteria | 9056 |
| 774 | Ga0496123_0009956 | 3300048926 | Bacteria | 8476 |
| 775 | Ga0496123_0010076 | 3300048926 | Bacteria | 8409 |
| 776 | Ga0496123_0014537 | 3300048926 | Bacteria | 6517 |
| 777 | Ga0496123_0017255 | 3300048926 | Bacteria | 5819 |
| 778 | Ga0496123_0023406 | 3300048926 | Bacteria | 4728 |
| 779 | Ga0496124_0000092 | 3300048927 | Bacteria | 189213 |
| 780 | Ga0496124_0000578 | 3300048927 | Bacteria | 61876 |
| 781 | Ga0496124_0005071 | 3300048927 | Bacteria | 15020 |
| 782 | Ga0496124_0007962 | 3300048927 | Bacteria | 11153 |
| 783 | Ga0496124_0115640 | 3300048927 | Bacteria | 2152 |
| 784 | Ga0496124_0175138 | 3300048927 | Bacteria | 1656 |
| 785 | Ga0496125_0000103 | 3300048928 | Bacteria | 201675 |
| 786 | Ga0496125_0004496 | 3300048928 | Bacteria | 16046 |
| 787 | Ga0496125_0012969 | 3300048928 | Bacteria | 8228 |
| 788 | Ga0496125_0015333 | 3300048928 | Bacteria | 7418 |
| 789 | Ga0496125_0160247 | 3300048928 | Bacteria | 1529 |
| 790 | Ga0496126_0000595 | 3300048929 | Bacteria | 68485 |
| 791 | Ga0496126_0001015 | 3300048929 | Bacteria | 47751 |
| 792 | Ga0496126_0001327 | 3300048929 | Bacteria | 39329 |
| 793 | Ga0496126_0002274 | 3300048929 | Bacteria | 26481 |
| 794 | Ga0496126_0004373 | 3300048929 | Bacteria | 16940 |
| 795 | Ga0496126_0020389 | 3300048929 | Bacteria | 6501 |
| 796 | Ga0496126_0025845 | 3300048929 | Bacteria | 5641 |
| 797 | Ga0496126_0025931 | 3300048929 | Bacteria | 5628 |
| 798 | Ga0496126_0107569 | 3300048929 | Bacteria | 2432 |
| 799 | Ga0496126_0151035 | 3300048929 | Bacteria | 1991 |
| 800 | Ga0496126_0270736 | 3300048929 | Bacteria | 1409 |
| 801 | Ga0495678_000042 | 3300049459 | Bacteria | 174125 |
| 802 | Ga0495678_000851 | 3300049459 | Bacteria | 27256 |
| 803 | Ga0495678_004796 | 3300049459 | Bacteria | 7695 |
| 804 | Ga0495678_008053 | 3300049459 | Bacteria | 5374 |
| 805 | Ga0495678_023944 | 3300049459 | Bacteria | 2644 |
| 806 | Ga0495682_0000005 | 3300049460 | Bacteria | 360387 |
| 807 | Ga0495682_0005672 | 3300049460 | Bacteria | 5157 |
| 808 | Ga0495682_0008727 | 3300049460 | Bacteria | 3988 |
| 809 | Ga0501230_002225 | 3300049667 | Bacteria | 2450 |
| 810 | Ga0501249_014021 | 3300049679 | Bacteria | 1706 |
| 811 | Ga0501269_000091 | 3300049766 | Bacteria | 28366 |
| 812 | Ga0501279_000517 | 3300049775 | Bacteria | 5073 |
| 813 | Ga0501279_004804 | 3300049775 | Bacteria | 1775 |
| 814 | nmdc:mga03n38_42233_c1 | 3300050490 | Bacteria | 1992 |
| 815 | nmdc:mga00v17_2595_c1 | 3300050491 | Bacteria | 7591 |
| 816 | nmdc:mga0k408_95_c1 | 3300050493 | Bacteria | 37179 |
| 817 | Ga0500608_006237 | 3300053122 | Bacteria | 4836 |
| 818 | Ga0500618_000008 | 3300053125 | Bacteria | 214678 |
| 819 | Ga0500618_000172 | 3300053125 | Bacteria | 53899 |
| 820 | Ga0500618_017365 | 3300053125 | Bacteria | 1791 |
| 821 | Ga0500621_000012 | 3300053126 | Bacteria | 138999 |
| 822 | Ga0500634_0000047 | 3300053161 | Bacteria | 55541 |
| 823 | 2508849961 | 2508501071 | Bacteria | 5454741 |
| 824 | 2511380186 | 2511231025 | Bacteria | 5324661 |
| 825 | 2511437547 | 2511231035 | Bacteria | 5341610 |
| 826 | 2538428623 | 2537561728 | Bacteria | 5149301 |
| 827 | 2555262312 | 2554235234 | Bacteria | 5762085 |
| 828 | 2597031810 | 2596583598 | Bacteria | 5251611 |
| 829 | 2599413300 | 2599185169 | Bacteria | 5441380 |
| 830 | 2599446508 | 2599185178 | Bacteria | 5365746 |
| 831 | 2601525954 | 2600255254 | Bacteria | 5281859 |
| 832 | 2601531029 | 2600255255 | Bacteria | 5282785 |
| 833 | 2601617846 | 2600255280 | Bacteria | 5292309 |
| 834 | 2601622880 | 2600255281 | Bacteria | 5288753 |
| 835 | 2601646374 | 2600255287 | Bacteria | 5210468 |
| 836 | 2601651264 | 2600255288 | Bacteria | 5282738 |
| 837 | 2601656220 | 2600255289 | Bacteria | 5281907 |
| 838 | 2601661243 | 2600255290 | Bacteria | 5282218 |
| 839 | 2601666356 | 2600255291 | Bacteria | 5217298 |
| 840 | 2601699331 | 2600255298 | Bacteria | 5215185 |
| 841 | 2601704226 | 2600255299 | Bacteria | 5218662 |
| 842 | 2601709068 | 2600255300 | Bacteria | 5287774 |
| 843 | 2601714117 | 2600255301 | Bacteria | 5280532 |
| 844 | 2601719151 | 2600255302 | Bacteria | 5288235 |
| 845 | 2601724161 | 2600255303 | Bacteria | 5219315 |
| 846 | 2601729073 | 2600255304 | Bacteria | 5283973 |
| 847 | 2601734115 | 2600255305 | Bacteria | 5282329 |
| 848 | 2601739101 | 2600255306 | Bacteria | 5281613 |
| 849 | 2601743872 | 2600255307 | Bacteria | 5439064 |
| 850 | 2601754715 | 2600255309 | Bacteria | 5431045 |
| 851 | 2602021886 | 2600255392 | Bacteria | 5437392 |
| 852 | 2603659109 | 2602042052 | Bacteria | 5215873 |
| 853 | 2603663984 | 2602042053 | Bacteria | 5214361 |
| 854 | 2603701633 | 2602042066 | Bacteria | 4423871 |
| 855 | 2603836443 | 2602042103 | Bacteria | 5284714 |
| 856 | 2603841523 | 2602042104 | Bacteria | 5281639 |
| 857 | 2603846594 | 2602042105 | Bacteria | 5282303 |
| 858 | 2603851666 | 2602042106 | Bacteria | 5282744 |
| 859 | 2603864588 | 2602042109 | Bacteria | 5152801 |
| 860 | 2603874334 | 2602042110 | Bacteria | 5283285 |
| 861 | 2603874629 | 2602042111 | Bacteria | 5212080 |
| 862 | 2606051513 | 2603880178 | Bacteria | 5283018 |
| 863 | 2606068431 | 2603880184 | Bacteria | 5217896 |
| 864 | 2606149198 | 2603880202 | Bacteria | 5284684 |
| 865 | 2606174330 | 2603880211 | Bacteria | 5284226 |
| 866 | 2608671479 | 2608642108 | Bacteria | 4104624 |
| 867 | 2609910887 | 2609459761 | Bacteria | 5513740 |
| 868 | 2637224607 | 2636415599 | Bacteria | 5718434 |
| 869 | 2643789494 | 2643221554 | Bacteria | 6603920 |
| 870 | 2643791530 | 2643221554 | Bacteria | 6603920 |
| 871 | 2643976653 | 2643221593 | Bacteria | 6296053 |
| 872 | 2644211382 | 2643221638 | Bacteria | 6579467 |
| 873 | 2644216048 | 2643221638 | Bacteria | 6579467 |
| 874 | 2644246410 | 2643221644 | Bacteria | 6865017 |
| 875 | 2644255149 | 2643221645 | Bacteria | 7207331 |
| 876 | 2644359067 | 2643221664 | Bacteria | 7272945 |
| 877 | 2671104805 | 2667528172 | Bacteria | 5170840 |
| 878 | 2671585146 | 2671180115 | Bacteria | 5353919 |
| 879 | 2676410095 | 2675903046 | Bacteria | 5451247 |
| 880 | 2681995014 | 2681812866 | Bacteria | 4552357 |
| 881 | 2682009518 | 2681812869 | Bacteria | 5014465 |
| 882 | 2712471758 | 2711768156 | Bacteria | 4471618 |
| 883 | 2738738509 | 2738541280 | Bacteria | 6630198 |
| 884 | 2738825210 | 2738541297 | Bacteria | 6549566 |
| 885 | 2738842689 | 2738541300 | Bacteria | 6675882 |
| 886 | 2739149007 | 2738541357 | Bacteria | 6549408 |
| 887 | 2739190926 | 2738543003 | Bacteria | 6549560 |
| 888 | 2739251856 | 2738543013 | Bacteria | 5618633 |
| 889 | 2739273437 | 2738543018 | Bacteria | 6718814 |
| 890 | 2739317403 | 2738543026 | Bacteria | 6549408 |
| 891 | 2739335644 | 2738543029 | Bacteria | 6549249 |
| 892 | 2739342481 | 2738543030 | Bacteria | 6719714 |
| 893 | 2748015585 | 2747842501 | Bacteria | 5293829 |
| 894 | 2753853910 | 2751185917 | Bacteria | 4551186 |
| 895 | 2765586807 | 2765235842 | Bacteria | 4799256 |
| 896 | 2777022987 | 2775507074 | Bacteria | 5532402 |
| 897 | 2821133803 | 2821131069 | Bacteria | 6108407 |
| 898 | 2823377995 | 2823373977 | Bacteria | 4779415 |
| 899 | 2842716737 | 2842711865 | Bacteria | 7155354 |
| 900 | 2842759315 | 2842757796 | Bacteria | 3981385 |
| 901 | 2844425500 | 2844425489 | Bacteria | 4854065 |
| 902 | 2854603226 | 2854601825 | Bacteria | 4797592 |
| 903 | 2855195653 | 2855195626 | Bacteria | 4927512 |
| 904 | 2857553913 | 2857553236 | Bacteria | 6166726 |
| 905 | 2857560295 | 2857558681 | Bacteria | 6617694 |
| 906 | 2857565595 | 2857564685 | Bacteria | 6290584 |
| 907 | 2858470438 | 2858466076 | Bacteria | 4722413 |
| 908 | 2871274747 | 2871272651 | Bacteria | 5042015 |
| 909 | 2871283410 | 2871282230 | Bacteria | 4917173 |
| 910 | 2876603563 | 2876601092 | Bacteria | 5114497 |
| 911 | 2885270317 | 2885266251 | Bacteria | 4796748 |
| 912 | 2888375734 | 2888373701 | Bacteria | 5098052 |
| 913 | 2894417640 | 2894414249 | Bacteria | 4405451 |
| 914 | 2895499116 | 2895498888 | Bacteria | 5283788 |
| 915 | 2895512137 | 2895511927 | Bacteria | 6802080 |
| 916 | 2895522146 | 2895522137 | Bacteria | 3284416 |
| 917 | 2895527408 | 2895525241 | Bacteria | 3388457 |
| 918 | 2900580959 | 2900577576 | Bacteria | 5438534 |
| 919 | 2904453302 | 2904449895 | Bacteria | 6927402 |
| 920 | 2904479132 | 2904474040 | Bacteria | 5504324 |
| 921 | 2904514460 | 2904513164 | Bacteria | 5476410 |
| 922 | 2919113565 | 2919108558 | Bacteria | 5897419 |
| 923 | 2919155436 | 2919150387 | Bacteria | 5500879 |
| 924 | 2919480528 | 2919476304 | Bacteria | 5888696 |
| 925 | 2923637307 | 2923634449 | Bacteria | 4753480 |
| 926 | 2927148850 | 2927143783 | Bacteria | 5504251 |
| 927 | 2927836261 | 2927833300 | Bacteria | 4923934 |
| 928 | 2928061571 | 2928058823 | Bacteria | 5520022 |
| 929 | 2935628695 | 2935625433 | Bacteria | 5042964 |
| 930 | 2939571913 | 2939568625 | Bacteria | 4542555 |
| 931 | 2939606482 | 2939602548 | Bacteria | 4950493 |
| 932 | 2939621000 | 2939617950 | Bacteria | 4820956 |
| 933 | 2939646230 | 2939642701 | Bacteria | 4475280 |
| 934 | 2945875255 | 2945874760 | Bacteria | 5527237 |
| 935 | 2969081650 | 2969079654 | Bacteria | 5439582 |
| 936 | 2971820978 | 2971820967 | Bacteria | 5823634 |
| 937 | 2974314323 | 2974310843 | Bacteria | 4947816 |
| 938 | 2974436189 | 2974435778 | Bacteria | 4876478 |
| 939 | 2984564064 | 2984559226 | Bacteria | 5683096 |
| 940 | 2984596798 | 2984595703 | Bacteria | 5682994 |
| 941 | 640935529 | 640753048 | Bacteria | 5495657 |
| 942 | 8016737907 | 8016733728 | Bacteria | 5274317 |
| 943 | 8018225586 | 8018221730 | Bacteria | 4616064 |
| 944 | 8018406388 | 8018405270 | Bacteria | 4978981 |
| 945 | 8019503732 | 8019499862 | Bacteria | 5169538 |
| 946 | 8019507043 | 8019504834 | Bacteria | 4819156 |
| 947 | 8054845111 | 8054844752 | Bacteria | 4450330 |
| 948 | 8054852549 | 8054849141 | Bacteria | 5232694 |
| 949 | 8055093439 | 8055092621 | Bacteria | 4873875 |
| 950 | 8055693950 | 8055693939 | Bacteria | 4772047 |
| 951 | Ga0495643_0014701 | |||
| 952 | JGI24741J21665_1000408 | |||
| 953 | JGI24740J21852_10001196 | |||
| 954 | JGI24740J21852_10002395 | |||
| 955 | JGI24740J21852_10003713 | |||
| 956 | JGI25158J39367_1000429 | |||
| 957 | JGI25158J39367_1000753 | |||
| 958 | JGI25163J39215_1000118 | |||
| 959 | JGI25164J39214_1000302 | |||
| 960 | JGI25152J39213_1000026 | |||
| 961 | JGI25152J39213_1000153 | |||
| 962 | JGI25150J39212_1000117 | |||
| 963 | JGI25150J39212_1000280 | |||
| 964 | JGI25150J39212_1013003 | |||
| 965 | JGI25159J45721_1004491 | |||
| 966 | JGI25159J45721_1005331 | |||
| 967 | JGI25151J46595_10000148 | |||
| 968 | JGI25151J46595_10000207 | |||
| 969 | JGI25153J46596_10000146 | |||
| 970 | JGI25153J46596_10004004 | |||
| 971 | JGI25153J46596_10007834 | |||
| 972 | rootH1_10018743 | |||
| 973 | rootL2_10012396 | |||
| 974 | JGI25161J50226_1000266 | |||
| 975 | Ga0055538_1000217 | |||
| 976 | Ga0055538_1002216 | |||
| 977 | Ga0055538_1002256 | |||
| 978 | Ga0055539_1000259 | |||
| 979 | Ga0055539_1000443 | |||
| 980 | Ga0055533_1000250 | |||
| 981 | Ga0055533_1001778 | |||
| 982 | Ga0055533_1003737 | |||
| 983 | Ga0055532_1000008 | |||
| 984 | Ga0055525_1000347 | |||
| 985 | Ga0055525_1000500 | |||
| 986 | Ga0055527_1002530 | |||
| 987 | Ga0055535_1000006 | |||
| 988 | Ga0055529_1000025 | |||
| 989 | Ga0055526_1000020 | |||
| 990 | Ga0055526_1000031 | |||
| 991 | Ga0055526_1000487 | |||
| 992 | Ga0055526_1000911 | |||
| 993 | Ga0055537_1000035 | |||
| 994 | Ga0055537_1010321 | |||
| 995 | Ga0055537_1012918 | |||
| 996 | Ga0055524_1000129 | |||
| 997 | Ga0055524_1000322 | |||
| 998 | Ga0055524_1000727 | |||
| 999 | Ga0055524_1001062 | |||
| 1000 | Ga0055524_1001522 | |||
| 1001 | Ga0055524_1010727 | |||
| 1002 | Ga0055534_1000325 | |||
| 1003 | Ga0055534_1005326 | |||
| 1004 | Ga0055534_1011124 | |||
| 1005 | Ga0055528_1000058 | |||
| 1006 | Ga0055530_10000037 | |||
| 1007 | Ga0055530_10000499 | |||
| 1008 | Ga0055530_10007754 | |||
| 1009 | Ga0055530_10009349 | |||
| 1010 | Ga0055531_10002721 | |||
| 1011 | Ga0055541_1003489 | |||
| 1012 | Ga0058692_1000122 | |||
| 1013 | Ga0058692_1000871 | |||
| 1014 | Ga0058692_1001369 | |||
| 1015 | Ga0055543_1000339 | |||
| 1016 | Ga0055543_1005717 | |||
| 1017 | Ga0065165_1000224 | |||
| 1018 | Ga0065165_1001110 | |||
| 1019 | Ga0065704_10000581 | |||
| 1020 | Ga0065704_10002543 | |||
| 1021 | Ga0065704_10002719 | |||
| 1022 | Ga0065704_10003295 | |||
| 1023 | Ga0065704_10003831 | |||
| 1024 | Ga0070666_10082178 | |||
| 1025 | Ga0070661_100000417 | |||
| 1026 | Ga0070661_100104382 | |||
| 1027 | Ga0070667_100001671 | |||
| 1028 | Ga0070678_100103219 | |||
| 1029 | Ga0070662_100015699 | |||
| 1030 | Ga0070681_10143255 | |||
| 1031 | Ga0070685_10000588 | |||
| 1032 | Ga0070679_100003714 | |||
| 1033 | Ga0068853_100070789 | |||
| 1034 | Ga0070665_100000057 | |||
| 1035 | Ga0070665_100000160 | |||
| 1036 | Ga0070665_100016979 | |||
| 1037 | Ga0070665_100174268 | |||
| 1038 | Ga0070664_100000001 | |||
| 1039 | Ga0068857_100000013 | |||
| 1040 | Ga0068857_100017469 | |||
| 1041 | Ga0068857_100043166 | |||
| 1042 | Ga0068854_100000060 | |||
| 1043 | Ga0068854_100007812 | |||
| 1044 | Ga0068856_100002389 | |||
| 1045 | Ga0068856_100133320 | |||
| 1046 | Ga0068858_100000741 | |||
| 1047 | Ga0068860_100023779 | |||
| 1048 | Ga0075364_10000771 | |||
| 1049 | Ga0075364_10004224 | |||
| 1050 | Ga0075364_10011667 | |||
| 1051 | Ga0075364_10080678 | |||
| 1052 | Ga0075364_10153041 | |||
| 1053 | Ga0075366_10000439 | |||
| 1054 | Ga0079104_1000036 | |||
| 1055 | Ga0079104_1000122 | |||
| 1056 | Ga0079104_1000203 | |||
| 1057 | Ga0079104_1000437 | |||
| 1058 | Ga0079104_1001827 | |||
| 1059 | Ga0079104_1002423 | |||
| 1060 | Ga0079104_1002630 | |||
| 1061 | Ga0079104_1005598 | |||
| 1062 | Ga0079104_1011891 | |||
| 1063 | Ga0099826_10000001 | |||
| 1064 | Ga0105251_10000277 | |||
| 1065 | Ga0105251_10001409 | |||
| 1066 | Ga0105251_10003581 | |||
| 1067 | Ga0105251_10004348 | |||
| 1068 | Ga0105251_10039575 | |||
| 1069 | Ga0105244_10001959 | |||
| 1070 | Ga0105244_10002307 | |||
| 1071 | Ga0105244_10002367 | |||
| 1072 | Ga0105244_10003041 | |||
| 1073 | Ga0105244_10010955 | |||
| 1074 | Ga0105250_10000855 | |||
| 1075 | Ga0105250_10003442 | |||
| 1076 | Ga0105250_10023228 | |||
| 1077 | Ga0105240_10007862 | |||
| 1078 | Ga0105240_10007892 | |||
| 1079 | Ga0105240_10022027 | |||
| 1080 | Ga0105240_10044181 | |||
| 1081 | Ga0105240_10074091 | |||
| 1082 | Ga0105240_10094914 | |||
| 1083 | Ga0105240_10246122 | |||
| 1084 | Ga0105243_10000259 | |||
| 1085 | Ga0105237_10000774 | |||
| 1086 | Ga0105238_10004980 | |||
| 1087 | Ga0105249_10003765 | |||
| 1088 | Ga0099796_10055307 | |||
| 1089 | Ga0105239_10000480 | |||
| 1090 | Ga0105239_10000644 | |||
| 1091 | Ga0105246_10035707 | |||
| 1092 | Ga0105246_10076771 | |||
| 1093 | Ga0157373_10000646 | |||
| 1094 | Ga0157373_10002943 | |||
| 1095 | Ga0157373_10033962 | |||
| 1096 | Ga0157373_10051163 | |||
| 1097 | Ga0157373_10223152 | |||
| 1098 | Ga0157371_10000404 | |||
| 1099 | Ga0157371_10001363 | |||
| 1100 | Ga0157371_10005803 | |||
| 1101 | Ga0157371_10016673 | |||
| 1102 | Ga0157371_10029511 | |||
| 1103 | Ga0157371_10091166 | |||
| 1104 | Ga0157370_10006219 | |||
| 1105 | Ga0157370_10007229 | |||
| 1106 | Ga0157370_10183156 | |||
| 1107 | Ga0157369_10004570 | |||
| 1108 | Ga0157369_10005312 | |||
| 1109 | Ga0157369_10239450 | |||
| 1110 | Ga0163162_10034844 | |||
| 1111 | Ga0157372_10000062 | |||
| 1112 | Ga0157372_10006644 | |||
| 1113 | Ga0157372_10023640 | |||
| 1114 | Ga0157372_10030390 | |||
| 1115 | Ga0157372_10039194 | |||
| 1116 | Ga0157372_10040945 | |||
| 1117 | Ga0157372_10105763 | |||
| 1118 | Ga0163163_10110438 | |||
| 1119 | Ga0182008_10000147 | |||
| 1120 | Ga0182006_1000212 | |||
| 1121 | Ga0182006_1006900 | |||
| 1122 | Ga0182006_1010041 | |||
| 1123 | Ga0182007_10027739 | |||
| 1124 | Ga0182005_1000018 | |||
| 1125 | Ga0183366_1004 | |||
| 1126 | Ga0183370_1004 | |||
| 1127 | Ga0183369_1010 | |||
| 1128 | Ga0183368_1008 | |||
| 1129 | Ga0163161_10169939 | |||
| 1130 | Ga0163161_10222672 | |||
| 1131 | Ga0197907_10544216 | |||
| 1132 | Ga0206351_10076999 | |||
| 1133 | Ga0154015_1694190 | |||
| 1134 | Ga0213872_10000654 | |||
| 1135 | Ga0213872_10001316 | |||
| 1136 | Ga0213872_10001452 | |||
| 1137 | Ga0213872_10004382 | |||
| 1138 | Ga0213872_10009443 | |||
| 1139 | Ga0213876_10000049 | |||
| 1140 | Ga0209760_100179 | |||
| 1141 | Ga0209436_100178 | |||
| 1142 | Ga0209436_100211 | |||
| 1143 | Ga0209436_100684 | |||
| 1144 | Ga0209784_100001 | |||
| 1145 | Ga0209784_100063 | |||
| 1146 | Ga0209566_100001 | |||
| 1147 | Ga0209566_100048 | |||
| 1148 | Ga0209566_102596 | |||
| 1149 | Ga0209674_100002 | |||
| 1150 | Ga0209674_100071 | |||
| 1151 | Ga0209674_103236 | |||
| 1152 | Ga0209672_100199 | |||
| 1153 | Ga0209672_100339 | |||
| 1154 | Ga0209147_100002 | |||
| 1155 | Ga0209563_100002 | |||
| 1156 | Ga0209563_100085 | |||
| 1157 | Ga0207427_100032 | |||
| 1158 | Ga0209437_100001 | |||
| 1159 | Ga0209437_100092 | |||
| 1160 | Ga0209258_100002 | |||
| 1161 | Ga0207425_1000001 | |||
| 1162 | Ga0207425_1000011 | |||
| 1163 | Ga0207425_1000017 | |||
| 1164 | Ga0207425_1000067 | |||
| 1165 | Ga0207425_1000085 | |||
| 1166 | Ga0207425_1001571 | |||
| 1167 | Ga0207425_1005801 | |||
| 1168 | Ga0209646_1000028 | |||
| 1169 | Ga0209677_100002 | |||
| 1170 | Ga0209677_100040 | |||
| 1171 | Ga0209759_1002426 | |||
| 1172 | Ga0209759_1009418 | |||
| 1173 | Ga0209129_1000003 | |||
| 1174 | Ga0209129_1000021 | |||
| 1175 | Ga0209129_1000162 | |||
| 1176 | Ga0209129_1000273 | |||
| 1177 | Ga0209129_1002118 | |||
| 1178 | Ga0209129_1005230 | |||
| 1179 | Ga0209129_1013492 | |||
| 1180 | Ga0209233_1001209 | |||
| 1181 | Ga0209233_1001959 | |||
| 1182 | Ga0209565_1000009 | |||
| 1183 | Ga0209565_1000452 | |||
| 1184 | Ga0209565_1000613 | |||
| 1185 | Ga0209565_1000665 | |||
| 1186 | Ga0209565_1001924 | |||
| 1187 | Ga0209565_1002725 | |||
| 1188 | Ga0209565_1003902 | |||
| 1189 | Ga0209565_1004983 | |||
| 1190 | Ga0209565_1005250 | |||
| 1191 | Ga0209455_1000009 | |||
| 1192 | Ga0209455_1000049 | |||
| 1193 | Ga0209673_1000036 | |||
| 1194 | Ga0209673_1007399 | |||
| 1195 | Ga0209673_1015512 | |||
| 1196 | Ga0209130_1000044 | |||
| 1197 | Ga0209130_1000059 | |||
| 1198 | Ga0209130_1000733 | |||
| 1199 | Ga0209130_1000968 | |||
| 1200 | Ga0209130_1003333 | |||
| 1201 | Ga0209130_1005009 | |||
| 1202 | Ga0209675_1000013 | |||
| 1203 | Ga0209675_1000394 | |||
| 1204 | Ga0209675_1001363 | |||
| 1205 | Ga0209675_1001613 | |||
| 1206 | Ga0209675_1007023 | |||
| 1207 | Ga0209676_1006547 | |||
| 1208 | Ga0209025_1000005 | |||
| 1209 | Ga0209025_1000054 | |||
| 1210 | Ga0209025_1007861 | |||
| 1211 | Ga0209564_1000006 | |||
| 1212 | Ga0209564_1000038 | |||
| 1213 | Ga0209564_1000122 | |||
| 1214 | Ga0209564_1000142 | |||
| 1215 | Ga0209564_1005605 | |||
| 1216 | Ga0209564_1007137 | |||
| 1217 | Ga0209758_1000020 | |||
| 1218 | Ga0209758_1000062 | |||
| 1219 | Ga0209758_1000250 | |||
| 1220 | Ga0209758_1000583 | |||
| 1221 | Ga0209758_1007146 | |||
| 1222 | Ga0209050_1000058 | |||
| 1223 | Ga0209050_1000612 | |||
| 1224 | Ga0209050_1000654 | |||
| 1225 | Ga0209050_1001112 | |||
| 1226 | Ga0209050_1001305 | |||
| 1227 | Ga0209050_1001484 | |||
| 1228 | Ga0209050_1010656 | |||
| 1229 | Ga0209256_1000106 | |||
| 1230 | Ga0209256_1000184 | |||
| 1231 | Ga0209256_1000201 | |||
| 1232 | Ga0209256_1000285 | |||
| 1233 | Ga0209256_1000503 | |||
| 1234 | Ga0209256_1000875 | |||
| 1235 | Ga0209256_1002929 | |||
| 1236 | Ga0207426_1002835 | |||
| 1237 | Ga0207426_1005567 | |||
| 1238 | Ga0209257_1000003 | |||
| 1239 | Ga0209257_1000123 | |||
| 1240 | Ga0209257_1002302 | |||
| 1241 | Ga0209257_1004098 | |||
| 1242 | Ga0207696_1000202 | |||
| 1243 | Ga0207696_1000949 | |||
| 1244 | Ga0207696_1002169 | |||
| 1245 | Ga0207696_1007432 | |||
| 1246 | Ga0207655_1000067 | |||
| 1247 | Ga0207655_1000111 | |||
| 1248 | Ga0207655_1000122 | |||
| 1249 | Ga0207655_1000218 | |||
| 1250 | Ga0207655_1001050 | |||
| 1251 | Ga0207655_1002313 | |||
| 1252 | Ga0207655_1004581 | |||
| 1253 | Ga0207655_1005717 | |||
| 1254 | Ga0207655_1029638 | |||
| 1255 | Ga0207713_1000184 | |||
| 1256 | Ga0207713_1000636 | |||
| 1257 | Ga0207713_1000748 | |||
| 1258 | Ga0207713_1002034 | |||
| 1259 | Ga0207713_1002094 | |||
| 1260 | Ga0207713_1004241 | |||
| 1261 | Ga0207647_10000024 | |||
| 1262 | Ga0207695_10000200 | |||
| 1263 | Ga0207695_10001553 | |||
| 1264 | Ga0207695_10002561 | |||
| 1265 | Ga0207695_10029467 | |||
| 1266 | Ga0207695_10077056 | |||
| 1267 | Ga0207671_10021575 | |||
| 1268 | Ga0207671_10270261 | |||
| 1269 | Ga0207649_10000390 | |||
| 1270 | Ga0207652_10083219 | |||
| 1271 | Ga0207694_10011349 | |||
| 1272 | Ga0207644_10250209 | |||
| 1273 | Ga0207706_10001182 | |||
| 1274 | Ga0207709_10000289 | |||
| 1275 | Ga0207679_10000003 | |||
| 1276 | Ga0207712_10000244 | |||
| 1277 | Ga0207712_10000608 | |||
| 1278 | Ga0207640_10000071 | |||
| 1279 | Ga0207677_10137142 | |||
| 1280 | Ga0207703_10000573 | |||
| 1281 | Ga0207639_10013416 | |||
| 1282 | Ga0207639_10030426 | |||
| 1283 | Ga0207678_10000175 | |||
| 1284 | Ga0207678_10028388 | |||
| 1285 | Ga0207702_10000110 | |||
| 1286 | Ga0207674_10000071 | |||
| 1287 | Ga0207674_10011098 | |||
| 1288 | Ga0207674_10079114 | |||
| 1289 | Ga0207683_10144062 | |||
| 1290 | Ga0209281_1000031 | |||
| 1291 | Ga0209281_1000080 | |||
| 1292 | Ga0209281_1000086 | |||
| 1293 | Ga0209281_1000117 | |||
| 1294 | Ga0209281_1000206 | |||
| 1295 | Ga0209281_1000261 | |||
| 1296 | Ga0209281_1000338 | |||
| 1297 | Ga0209281_1001242 | |||
| 1298 | Ga0209281_1002414 | |||
| 1299 | Ga0209371_1000005 | |||
| 1300 | Ga0209371_1000029 | |||
| 1301 | Ga0209371_1000042 | |||
| 1302 | Ga0209371_1000133 | |||
| 1303 | Ga0209371_1000257 | |||
| 1304 | Ga0209371_1001693 | |||
| 1305 | Ga0209371_1002593 | |||
| 1306 | Ga0209371_1003013 | |||
| 1307 | Ga0209371_1011434 | |||
| 1308 | Ga0209371_1017609 | |||
| 1309 | Ga0209282_1000001 | |||
| 1310 | Ga0268266_10000001 | |||
| 1311 | Ga0268266_10000008 | |||
| 1312 | Ga0268266_10000129 | |||
| 1313 | Ga0268266_10052560 | |||
| 1314 | Ga0268264_10035567 | |||
| 1315 | Ga0307517_10006778 | |||
| 1316 | Ga0307517_10105419 | |||
| 1317 | Ga0307515_10000652 | |||
| 1318 | Ga0268256_1000006 | |||
| 1319 | Ga0268256_1000032 | |||
| 1320 | Ga0268256_1000042 | |||
| 1321 | Ga0268256_1000262 | |||
| 1322 | Ga0268256_1001353 | |||
| 1323 | Ga0268256_1001716 | |||
| 1324 | Ga0268256_1001932 | |||
| 1325 | Ga0268256_1004434 | |||
| 1326 | Ga0268256_1008802 | |||
| 1327 | Ga0268256_1009719 | |||
| 1328 | Ga0268256_1015762 | |||
| 1329 | Ga0268256_1016889 | |||
| 1330 | Ga0307511_10000875 | |||
| 1331 | Ga0307511_10004090 | |||
| 1332 | Ga0307512_10051335 | |||
| 1333 | Ga0316180_1052418 | |||
| 1334 | Ga0316182_1325361 | |||
| 1335 | Ga0307513_10206262 | |||
| 1336 | Ga0307513_10323942 | |||
| 1337 | Ga0307509_10002463 | |||
| 1338 | Ga0307509_10009159 | |||
| 1339 | Ga0307408_100000016 | |||
| 1340 | Ga0307408_100000082 | |||
| 1341 | Ga0307408_100000194 | |||
| 1342 | Ga0307408_100001091 | |||
| 1343 | Ga0307408_100004846 | |||
| 1344 | Ga0307508_10131442 | |||
| 1345 | Ga0307514_10002227 | |||
| 1346 | Ga0307514_10077067 | |||
| 1347 | Ga0265314_10009564 | |||
| 1348 | Ga0307516_10000348 | |||
| 1349 | Ga0307416_100000733 | |||
| 1350 | Ga0307510_10003186 | |||
| 1351 | Ga0307510_10015746 | |||
| 1352 | Ga0373939_0000113 | |||
| 1353 | Ga0373960_0000857 | |||
| 1354 | Ga0373931_0002626 | |||
| 1355 | Ga0395899_0000012 | |||
| 1356 | Ga0395900_0051003 | |||
| 1357 | Ga0395905_0010150 | |||
| 1358 | Ga0395905_0013852 | |||
| 1359 | Ga0395901_0056740 | |||
| 1360 | Ga0237819_00016 | |||
| 1361 | Ga0436365_0245969 | |||
| 1362 | Ga0436361_0080811 | |||
| 1363 | Ga0436361_0810533 | |||
| 1364 | Ga0436361_0821396 | |||
| 1365 | Ga0439438_001391 | |||
| 1366 | Ga0439447_002006 | |||
| 1367 | Ga0451798_0664110 | |||
| 1368 | Ga0439452_000012 | |||
| 1369 | Ga0439452_000076 | |||
| 1370 | Ga0439452_000494 | |||
| 1371 | Ga0450900_003287 | |||
| 1372 | Ga0439464_0015981 | |||
| 1373 | Ga0450918_000309 | |||
| 1374 | Ga0466972_0000331 | |||
| 1375 | Ga0466981_0000020 | |||
| 1376 | Ga0466965_0024779 | |||
| 1377 | Ga0466965_0072550 | |||
| 1378 | Ga0466966_0014028 | |||
| 1379 | Ga0466961_0004626 | |||
| 1380 | Ga0466968_0007269 | |||
| 1381 | Ga0466968_0017600 | |||
| 1382 | Ga0466957_0042727 | |||
| 1383 | Ga0466960_0048075 | |||
| 1384 | Ga0466960_0169611 | |||
| 1385 | Ga0495617_000007 | |||
| 1386 | Ga0495617_000460 | |||
| 1387 | Ga0495617_000570 | |||
| 1388 | Ga0495617_000947 | |||
| 1389 | Ga0495627_000006 | |||
| 1390 | Ga0495590_0000004 | |||
| 1391 | Ga0495591_000095 | |||
| 1392 | Ga0495591_000126 | |||
| 1393 | Ga0495591_001567 | |||
| 1394 | Ga0495638_0000366 | |||
| 1395 | Ga0495638_0002123 | |||
| 1396 | Ga0495638_0002285 | |||
| 1397 | Ga0495638_0074618 | |||
| 1398 | Ga0495638_0083629 | |||
| 1399 | Ga0495653_0000037 | |||
| 1400 | Ga0495653_0197745 | |||
| 1401 | Ga0495650_0000094 | |||
| 1402 | Ga0495650_0000126 | |||
| 1403 | Ga0495650_0000169 | |||
| 1404 | Ga0495650_0000177 | |||
| 1405 | Ga0495650_0000256 | |||
| 1406 | Ga0495650_0000421 | |||
| 1407 | Ga0495650_0003963 | |||
| 1408 | Ga0495605_0000003 | |||
| 1409 | Ga0495605_0000239 | |||
| 1410 | Ga0495584_0000001 | |||
| 1411 | Ga0495584_0000144 | |||
| 1412 | Ga0495584_0001913 | |||
| 1413 | Ga0495584_0065214 | |||
| 1414 | Ga0495585_0000002 | |||
| 1415 | Ga0495585_0000026 | |||
| 1416 | Ga0495585_0000922 | |||
| 1417 | Ga0495585_0000984 | |||
| 1418 | Ga0495585_0001182 | |||
| 1419 | Ga0495585_0007599 | |||
| 1420 | Ga0495585_0007857 | |||
| 1421 | Ga0495585_0050822 | |||
| 1422 | Ga0495585_0070416 | |||
| 1423 | Ga0495585_0189029 | |||
| 1424 | Ga0495594_0021495 | |||
| 1425 | Ga0495596_0000149 | |||
| 1426 | Ga0495596_0003827 | |||
| 1427 | Ga0495596_0004037 | |||
| 1428 | Ga0495596_0009020 | |||
| 1429 | Ga0495607_0000423 | |||
| 1430 | Ga0495607_0002599 | |||
| 1431 | Ga0495607_0002760 | |||
| 1432 | Ga0495607_0005270 | |||
| 1433 | Ga0495607_0006087 | |||
| 1434 | Ga0495607_0009553 | |||
| 1435 | Ga0495607_0078202 | |||
| 1436 | Ga0495583_0000008 | |||
| 1437 | Ga0495583_0000009 | |||
| 1438 | Ga0495583_0000021 | |||
| 1439 | Ga0495583_0000431 | |||
| 1440 | Ga0495583_0000508 | |||
| 1441 | Ga0495583_0020905 | |||
| 1442 | Ga0495583_0029448 | |||
| 1443 | Ga0495583_0045912 | |||
| 1444 | Ga0495606_0000024 | |||
| 1445 | Ga0495606_0000069 | |||
| 1446 | Ga0495606_0000268 | |||
| 1447 | Ga0495606_0002135 | |||
| 1448 | Ga0495606_0003645 | |||
| 1449 | Ga0495606_0004126 | |||
| 1450 | Ga0495606_0009070 | |||
| 1451 | Ga0495606_0012997 | |||
| 1452 | Ga0495606_0032074 | |||
| 1453 | Ga0495606_0072980 | |||
| 1454 | Ga0495610_0000004 | |||
| 1455 | Ga0495610_0000688 | |||
| 1456 | Ga0495610_0001096 | |||
| 1457 | Ga0495610_0001354 | |||
| 1458 | Ga0495610_0083542 | |||
| 1459 | Ga0495616_0000616 | |||
| 1460 | Ga0495616_0002987 | |||
| 1461 | Ga0495616_0005767 | |||
| 1462 | Ga0495616_0006740 | |||
| 1463 | Ga0495616_0009497 | |||
| 1464 | Ga0495616_0028253 | |||
| 1465 | Ga0495616_0030102 | |||
| 1466 | Ga0495620_0001761 | |||
| 1467 | Ga0495620_0011071 | |||
| 1468 | Ga0495631_0003073 | |||
| 1469 | Ga0495631_0009757 | |||
| 1470 | Ga0495631_0011449 | |||
| 1471 | Ga0495631_0098547 | |||
| 1472 | Ga0495632_0001138 | |||
| 1473 | Ga0495632_0024916 | |||
| 1474 | Ga0495637_0001417 | |||
| 1475 | Ga0495637_0020431 | |||
| 1476 | Ga0495643_0000182 | |||
| 1477 | Ga0495643_0000383 | |||
| 1478 | Ga0495643_0000425 | |||
| 1479 | Ga0495643_0000695 | |||
| 1480 | Ga0495643_0040750 | |||
| 1481 | Ga0495644_0000347 | |||
| 1482 | Ga0495644_0003130 | |||
| 1483 | Ga0495644_0003727 | |||
| 1484 | Ga0495644_0006940 | |||
| 1485 | Ga0495648_0000012 | |||
| 1486 | Ga0495648_0000045 | |||
| 1487 | Ga0495648_0001995 | |||
| 1488 | Ga0495648_0002014 | |||
| 1489 | Ga0495648_0003262 | |||
| 1490 | Ga0495648_0009843 | |||
| 1491 | Ga0495648_0013578 | |||
| 1492 | Ga0495648_0066573 | |||
| 1493 | Ga0495648_0081834 | |||
| 1494 | Ga0495663_0002406 | |||
| 1495 | Ga0495663_0006313 | |||
| 1496 | Ga0495663_0026773 | |||
| 1497 | Ga0495666_0018861 | |||
| 1498 | Ga0495642_0003014 | |||
| 1499 | Ga0495642_0003809 | |||
| 1500 | Ga0495642_0007287 | |||
| 1501 | Ga0495642_0015571 | |||
| 1502 | Ga0495642_0020660 | |||
| 1503 | Ga0495654_0000004 | |||
| 1504 | Ga0495654_0000072 | |||
| 1505 | Ga0495654_0000133 | |||
| 1506 | Ga0495654_0000208 | |||
| 1507 | Ga0495654_0002518 | |||
| 1508 | Ga0495654_0003249 | |||
| 1509 | Ga0495654_0007878 | |||
| 1510 | Ga0495665_0006893 | |||
| 1511 | Ga0495586_0046147 | |||
| 1512 | Ga0495587_0015764 | |||
| 1513 | Ga0495609_0000771 | |||
| 1514 | Ga0495609_0001220 | |||
| 1515 | Ga0495609_0001731 | |||
| 1516 | Ga0495609_0002003 | |||
| 1517 | Ga0495609_0009992 | |||
| 1518 | Ga0495609_0020942 | |||
| 1519 | Ga0495609_0022955 | |||
| 1520 | Ga0495597_0000434 | |||
| 1521 | Ga0495597_0001158 | |||
| 1522 | Ga0495597_0002890 | |||
| 1523 | Ga0495597_0003565 | |||
| 1524 | Ga0495622_0000003 | |||
| 1525 | Ga0495622_0000489 | |||
| 1526 | Ga0495622_0006038 | |||
| 1527 | Ga0495633_0000356 | |||
| 1528 | Ga0495633_0000522 | |||
| 1529 | Ga0495633_0004410 | |||
| 1530 | Ga0495633_0010220 | |||
| 1531 | Ga0495633_0013669 | |||
| 1532 | Ga0495633_0014930 | |||
| 1533 | Ga0495633_0039794 | |||
| 1534 | Ga0495633_0100007 | |||
| 1535 | Ga0495656_0003608 | |||
| 1536 | Ga0495656_0055091 | |||
| 1537 | Ga0495668_0000025 | |||
| 1538 | Ga0495668_0000307 | |||
| 1539 | Ga0495668_0000764 | |||
| 1540 | Ga0495668_0001108 | |||
| 1541 | Ga0495668_0001920 | |||
| 1542 | Ga0495668_0040672 | |||
| 1543 | Ga0495611_0009567 | |||
| 1544 | Ga0495611_0014075 | |||
| 1545 | Ga0495611_0018688 | |||
| 1546 | Ga0495611_0041778 | |||
| 1547 | Ga0495625_0001394 | |||
| 1548 | Ga0495625_0001654 | |||
| 1549 | Ga0495625_0001834 | |||
| 1550 | Ga0495625_0013019 | |||
| 1551 | Ga0495625_0016949 | |||
| 1552 | Ga0495625_0125329 | |||
| 1553 | Ga0495625_0158286 | |||
| 1554 | Ga0495659_0000091 | |||
| 1555 | Ga0495659_0000414 | |||
| 1556 | Ga0495659_0003001 | |||
| 1557 | Ga0495659_0017389 | |||
| 1558 | Ga0495661_0000130 | |||
| 1559 | Ga0495661_0000296 | |||
| 1560 | Ga0495661_0008417 | |||
| 1561 | Ga0495661_0015865 | |||
| 1562 | Ga0495661_0036020 | |||
| 1563 | Ga0495661_0074485 | |||
| 1564 | Ga0495661_0080739 | |||
| 1565 | Ga0495661_0117611 | |||
| 1566 | Ga0495588_0000083 | |||
| 1567 | Ga0495669_0005645 | |||
| 1568 | Ga0495670_0000812 | |||
| 1569 | Ga0495670_0006970 | |||
| 1570 | Ga0495670_0014039 | |||
| 1571 | Ga0495671_0000001 | |||
| 1572 | Ga0495671_0000246 | |||
| 1573 | Ga0495671_0037425 | |||
| 1574 | Ga0495671_0097571 | |||
| 1575 | Ga0495649_0000053 | |||
| 1576 | Ga0495649_0004130 | |||
| 1577 | Ga0495649_0008166 | |||
| 1578 | Ga0495649_0023194 | |||
| 1579 | Ga0495649_0034037 | |||
| 1580 | Ga0495649_0061273 | |||
| 1581 | Ga0495589_0000022 | |||
| 1582 | Ga0495589_0000076 | |||
| 1583 | Ga0495589_0038137 | |||
| 1584 | Ga0495589_0086496 | |||
| 1585 | Ga0495660_0000028 | |||
| 1586 | Ga0495660_0000044 | |||
| 1587 | Ga0495660_0000051 | |||
| 1588 | Ga0495660_0000914 | |||
| 1589 | Ga0495660_0002115 | |||
| 1590 | Ga0495660_0005694 | |||
| 1591 | Ga0495660_0006366 | |||
| 1592 | Ga0495660_0018634 | |||
| 1593 | Ga0495660_0021987 | |||
| 1594 | Ga0495660_0055889 | |||
| 1595 | Ga0495581_0020359 | |||
| 1596 | Ga0495604_0028592 | |||
| 1597 | Ga0495636_0000101 | |||
| 1598 | Ga0495636_0000430 | |||
| 1599 | Ga0495636_0002862 | |||
| 1600 | Ga0495672_0000011 | |||
| 1601 | Ga0495672_0000026 | |||
| 1602 | Ga0495672_0000039 | |||
| 1603 | Ga0495672_0000154 | |||
| 1604 | Ga0495672_0001702 | |||
| 1605 | Ga0495672_0034255 | |||
| 1606 | Ga0495676_0036890 | |||
| 1607 | Ga0495683_0000009 | |||
| 1608 | Ga0495683_0001547 | |||
| 1609 | Ga0495683_0006154 | |||
| 1610 | Ga0495683_0006907 | |||
| 1611 | Ga0495683_0013607 | |||
| 1612 | Ga0495683_0030559 | |||
| 1613 | Ga0495687_000099 | |||
| 1614 | Ga0495687_000245 | |||
| 1615 | Ga0495687_001356 | |||
| 1616 | Ga0495687_001959 | |||
| 1617 | Ga0495687_035568 | |||
| 1618 | Ga0495675_0064341 | |||
| 1619 | Ga0495677_0000319 | |||
| 1620 | Ga0495677_0002770 | |||
| 1621 | Ga0495677_0006013 | |||
| 1622 | Ga0495677_0017575 | |||
| 1623 | Ga0495677_0021168 | |||
| 1624 | Ga0495679_000016 | |||
| 1625 | Ga0495679_005316 | |||
| 1626 | Ga0495685_000045 | |||
| 1627 | Ga0495685_003874 | |||
| 1628 | Ga0495685_006938 | |||
| 1629 | Ga0495673_0000006 | |||
| 1630 | Ga0495673_0000014 | |||
| 1631 | Ga0495673_0000017 | |||
| 1632 | Ga0495673_0000020 | |||
| 1633 | Ga0495673_0000137 | |||
| 1634 | Ga0495681_0003829 | |||
| 1635 | Ga0495681_0004629 | |||
| 1636 | Ga0495681_0014546 | |||
| 1637 | Ga0495681_0076979 | |||
| 1638 | Ga0495686_0032960 | |||
| 1639 | Ga0495686_0034396 | |||
| 1640 | Ga0495626_0000014 | |||
| 1641 | Ga0495626_0000021 | |||
| 1642 | Ga0495626_0002580 | |||
| 1643 | Ga0495626_0004663 | |||
| 1644 | Ga0495626_0007450 | |||
| 1645 | Ga0495626_0027947 | |||
| 1646 | Ga0495626_0030215 | |||
| 1647 | Ga0496101_0000063 | |||
| 1648 | Ga0496102_0001073 | |||
| 1649 | Ga0496103_0020776 | |||
| 1650 | Ga0496105_0079474 | |||
| 1651 | Ga0496107_0038364 | |||
| 1652 | Ga0496114_0004140 | |||
| 1653 | Ga0496116_0000147 | |||
| 1654 | Ga0496116_0001013 | |||
| 1655 | Ga0496116_0001377 | |||
| 1656 | Ga0496116_0019647 | |||
| 1657 | Ga0496116_0020112 | |||
| 1658 | Ga0496116_0032380 | |||
| 1659 | Ga0496116_0036256 | |||
| 1660 | Ga0496116_0078490 | |||
| 1661 | Ga0496117_0000306 | |||
| 1662 | Ga0496117_0002498 | |||
| 1663 | Ga0496117_0009407 | |||
| 1664 | Ga0496117_0009676 | |||
| 1665 | Ga0496117_0015996 | |||
| 1666 | Ga0496117_0017021 | |||
| 1667 | Ga0496117_0035095 | |||
| 1668 | Ga0496117_0039174 | |||
| 1669 | Ga0496117_0043737 | |||
| 1670 | Ga0496118_0000384 | |||
| 1671 | Ga0496118_0001557 | |||
| 1672 | Ga0496118_0012632 | |||
| 1673 | Ga0496118_0017872 | |||
| 1674 | Ga0496118_0037006 | |||
| 1675 | Ga0496118_0051567 | |||
| 1676 | Ga0496119_0000105 | |||
| 1677 | Ga0496119_0000606 | |||
| 1678 | Ga0496119_0000748 | |||
| 1679 | Ga0496119_0000942 | |||
| 1680 | Ga0496119_0003515 | |||
| 1681 | Ga0496119_0003913 | |||
| 1682 | Ga0496119_0006590 | |||
| 1683 | Ga0496119_0013225 | |||
| 1684 | Ga0496119_0014214 | |||
| 1685 | Ga0496119_0016199 | |||
| 1686 | Ga0496119_0017141 | |||
| 1687 | Ga0496119_0048063 | |||
| 1688 | Ga0496119_0076576 | |||
| 1689 | Ga0496120_0000013 | |||
| 1690 | Ga0496120_0000016 | |||
| 1691 | Ga0496120_0000217 | |||
| 1692 | Ga0496120_0000308 | |||
| 1693 | Ga0496120_0001434 | |||
| 1694 | Ga0496120_0002024 | |||
| 1695 | Ga0496120_0003312 | |||
| 1696 | Ga0496120_0014157 | |||
| 1697 | Ga0496120_0017818 | |||
| 1698 | Ga0496120_0036893 | |||
| 1699 | Ga0496120_0044801 | |||
| 1700 | Ga0496121_0000531 | |||
| 1701 | Ga0496121_0002595 | |||
| 1702 | Ga0496121_0008153 | |||
| 1703 | Ga0496121_0013651 | |||
| 1704 | Ga0496121_0024031 | |||
| 1705 | Ga0496121_0027721 | |||
| 1706 | Ga0496121_0046770 | |||
| 1707 | Ga0496121_0116053 | |||
| 1708 | Ga0496122_0000104 | |||
| 1709 | Ga0496122_0000441 | |||
| 1710 | Ga0496122_0001479 | |||
| 1711 | Ga0496122_0001663 | |||
| 1712 | Ga0496122_0008000 | |||
| 1713 | Ga0496122_0016924 | |||
| 1714 | Ga0496122_0018321 | |||
| 1715 | Ga0496122_0044424 | |||
| 1716 | Ga0496122_0049718 | |||
| 1717 | Ga0496122_0051031 | |||
| 1718 | Ga0496122_0078593 | |||
| 1719 | Ga0496123_0000060 | |||
| 1720 | Ga0496123_0000342 | |||
| 1721 | Ga0496123_0001369 | |||
| 1722 | Ga0496123_0001529 | |||
| 1723 | Ga0496123_0009004 | |||
| 1724 | Ga0496123_0009956 | |||
| 1725 | Ga0496123_0010076 | |||
| 1726 | Ga0496123_0014537 | |||
| 1727 | Ga0496123_0017255 | |||
| 1728 | Ga0496123_0023406 | |||
| 1729 | Ga0496124_0000092 | |||
| 1730 | Ga0496124_0000578 | |||
| 1731 | Ga0496124_0005071 | |||
| 1732 | Ga0496124_0007962 | |||
| 1733 | Ga0496124_0115640 | |||
| 1734 | Ga0496124_0175138 | |||
| 1735 | Ga0496125_0000103 | |||
| 1736 | Ga0496125_0004496 | |||
| 1737 | Ga0496125_0012969 | |||
| 1738 | Ga0496125_0015333 | |||
| 1739 | Ga0496125_0160247 | |||
| 1740 | Ga0496126_0000595 | |||
| 1741 | Ga0496126_0001015 | |||
| 1742 | Ga0496126_0001327 | |||
| 1743 | Ga0496126_0002274 | |||
| 1744 | Ga0496126_0004373 | |||
| 1745 | Ga0496126_0020389 | |||
| 1746 | Ga0496126_0025845 | |||
| 1747 | Ga0496126_0025931 | |||
| 1748 | Ga0496126_0107569 | |||
| 1749 | Ga0496126_0151035 | |||
| 1750 | Ga0496126_0270736 | |||
| 1751 | Ga0495678_000042 | |||
| 1752 | Ga0495678_000851 | |||
| 1753 | Ga0495678_004796 | |||
| 1754 | Ga0495678_008053 | |||
| 1755 | Ga0495678_023944 | |||
| 1756 | Ga0495682_0000005 | |||
| 1757 | Ga0495682_0005672 | |||
| 1758 | Ga0495682_0008727 | |||
| 1759 | Ga0501230_002225 | |||
| 1760 | Ga0501249_014021 | |||
| 1761 | Ga0501269_000091 | |||
| 1762 | Ga0501279_000517 | |||
| 1763 | Ga0501279_004804 | |||
| 1764 | nmdc:mga03n38_42233_c1 | |||
| 1765 | nmdc:mga00v17_2595_c1 | |||
| 1766 | nmdc:mga0k408_95_c1 | |||
| 1767 | Ga0500608_006237 | |||
| 1768 | Ga0500618_000008 | |||
| 1769 | Ga0500618_000172 | |||
| 1770 | Ga0500618_017365 | |||
| 1771 | Ga0500621_000012 | |||
| 1772 | Ga0500634_0000047 | |||
| 1773 | 2508849961 | |||
| 1774 | 2511380186 | |||
| 1775 | 2511437547 | |||
| 1776 | 2538428623 | |||
| 1777 | 2555262312 | |||
| 1778 | 2597031810 | |||
| 1779 | 2599413300 | |||
| 1780 | 2599446508 | |||
| 1781 | 2601525954 | |||
| 1782 | 2601531029 | |||
| 1783 | 2601617846 | |||
| 1784 | 2601622880 | |||
| 1785 | 2601646374 | |||
| 1786 | 2601651264 | |||
| 1787 | 2601656220 | |||
| 1788 | 2601661243 | |||
| 1789 | 2601666356 | |||
| 1790 | 2601699331 | |||
| 1791 | 2601704226 | |||
| 1792 | 2601709068 | |||
| 1793 | 2601714117 | |||
| 1794 | 2601719151 | |||
| 1795 | 2601724161 | |||
| 1796 | 2601729073 | |||
| 1797 | 2601734115 | |||
| 1798 | 2601739101 | |||
| 1799 | 2601743872 | |||
| 1800 | 2601754715 | |||
| 1801 | 2602021886 | |||
| 1802 | 2603659109 | |||
| 1803 | 2603663984 | |||
| 1804 | 2603701633 | |||
| 1805 | 2603836443 | |||
| 1806 | 2603841523 | |||
| 1807 | 2603846594 | |||
| 1808 | 2603851666 | |||
| 1809 | 2603864588 | |||
| 1810 | 2603874334 | |||
| 1811 | 2603874629 | |||
| 1812 | 2606051513 | |||
| 1813 | 2606068431 | |||
| 1814 | 2606149198 | |||
| 1815 | 2606174330 | |||
| 1816 | 2608671479 | |||
| 1817 | 2609910887 | |||
| 1818 | 2637224607 | |||
| 1819 | 2643789494 | |||
| 1820 | 2643791530 | |||
| 1821 | 2643976653 | |||
| 1822 | 2644211382 | |||
| 1823 | 2644216048 | |||
| 1824 | 2644246410 | |||
| 1825 | 2644255149 | |||
| 1826 | 2644359067 | |||
| 1827 | 2671104805 | |||
| 1828 | 2671585146 | |||
| 1829 | 2676410095 | |||
| 1830 | 2681995014 | |||
| 1831 | 2682009518 | |||
| 1832 | 2712471758 | |||
| 1833 | 2738738509 | |||
| 1834 | 2738825210 | |||
| 1835 | 2738842689 | |||
| 1836 | 2739149007 | |||
| 1837 | 2739190926 | |||
| 1838 | 2739251856 | |||
| 1839 | 2739273437 | |||
| 1840 | 2739317403 | |||
| 1841 | 2739335644 | |||
| 1842 | 2739342481 | |||
| 1843 | 2748015585 | |||
| 1844 | 2753853910 | |||
| 1845 | 2765586807 | |||
| 1846 | 2777022987 | |||
| 1847 | 2821133803 | |||
| 1848 | 2823377995 | |||
| 1849 | 2842716737 | |||
| 1850 | 2842759315 | |||
| 1851 | 2844425500 | |||
| 1852 | 2854603226 | |||
| 1853 | 2855195653 | |||
| 1854 | 2857553913 | |||
| 1855 | 2857560295 | |||
| 1856 | 2857565595 | |||
| 1857 | 2858470438 | |||
| 1858 | 2871274747 | |||
| 1859 | 2871283410 | |||
| 1860 | 2876603563 | |||
| 1861 | 2885270317 | |||
| 1862 | 2888375734 | |||
| 1863 | 2894417640 | |||
| 1864 | 2895499116 | |||
| 1865 | 2895512137 | |||
| 1866 | 2895522146 | |||
| 1867 | 2895527408 | |||
| 1868 | 2900580959 | |||
| 1869 | 2904453302 | |||
| 1870 | 2904479132 | |||
| 1871 | 2904514460 | |||
| 1872 | 2919113565 | |||
| 1873 | 2919155436 | |||
| 1874 | 2919480528 | |||
| 1875 | 2923637307 | |||
| 1876 | 2927148850 | |||
| 1877 | 2927836261 | |||
| 1878 | 2928061571 | |||
| 1879 | 2935628695 | |||
| 1880 | 2939571913 | |||
| 1881 | 2939606482 | |||
| 1882 | 2939621000 | |||
| 1883 | 2939646230 | |||
| 1884 | 2945875255 | |||
| 1885 | 2969081650 | |||
| 1886 | 2971820978 | |||
| 1887 | 2974314323 | |||
| 1888 | 2974436189 | |||
| 1889 | 2984564064 | |||
| 1890 | 2984596798 | |||
| 1891 | 640935529 | |||
| 1892 | 8016737907 | |||
| 1893 | 8018225586 | |||
| 1894 | 8018406388 | |||
| 1895 | 8019503732 | |||
| 1896 | 8019507043 | |||
| 1897 | 8054845111 | |||
| 1898 | 8054852549 | |||
| 1899 | 8055093439 | |||
| 1900 | 8055693950 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rr1-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j | 0.9335 | 2 | 382 |
| 3rr1-assembly1.cif.gz_B | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j | 0.9326 | 2 | 382 |
| 3rra-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound | 0.9311 | 1 | 382 |
| 3rra-assembly1.cif.gz_B | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound | 0.9306 | 2 | 382 |
| 3rr1-assembly1.cif.gz_A | crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j | 0.9238 | 2 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6BF17_1_106_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9644 | 1 | 105 | 3.30.390.10 |
| 4jn8A01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.951 | 1 | 98 | 3.30.390.10 |
| af_Q6BF17_1_106_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9467 | 1 | 105 | 3.30.390.10 |
| 4ggbA01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9313 | 1 | 99 | 3.30.390.10 |
| 3s47B01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9223 | 2 | 98 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A378B4F3-F1-model_v4 | Galactonate dehydratase (EC 4.2.1.6) | 0.9609 | 1 | 241 |
GO:0008869
GO:0009063 |
| AF-S6V6Z6-F1-model_v4 | Galactonate dehydratase | 0.9527 | 1 | 211 |
GO:0009063
GO:0016829 |
| AF-A0A378B4F3-F1-model_v4 | Galactonate dehydratase (EC 4.2.1.6) | 0.9494 | 1 | 241 |
GO:0008869
GO:0009063 |
| AF-S6V6Z6-F1-model_v4 | Galactonate dehydratase | 0.9484 | 1 | 211 |
GO:0009063
GO:0016829 |
| AF-A0A0A2W2Y1-F1-model_v4 | D-galactonate dehydratase | 0.9382 | 2 | 382 |
GO:0003677
GO:0003700 GO:0008671 GO:0008869 GO:0009063 GO:0034194 |