F486563

General Info

Members Datasets Scaffolds Average Seq Length
950 402 1900 380

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0014701|Ga0495643_0014701_3068_4216
Length 354
Sequence MKITKLTLYRVPPRWMFLKVETDEGITGWGEPVIEGRARTVEAAVKELAHDLIGQDPMRINDLWQLMYRGAFYRGGPILMSAIAGVDQALWDIKGKALGVPVYQLLGGLVRDRMKMYSWVGGDRPAEVVAGIHTLRAIGIDTFKLNGTEELAMLDFHGRVAAPMAKVLLRELEPYRPLFIEEPVLAEQAEYYPRLAEATSIPLAAGERMYSRFDFKRVFRDGGIAIVQPDVSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSHNAVLQEQSMGIHYNKGAELLDYVVNTEDFVIKEGYFAPLTKPGLGVIVNEERVIAASQGAPDWRNPVWRHPDGSVAEW

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
78 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
79 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
80 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
171 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
267 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
268 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
276 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
277 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
278 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
279 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
280 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
281 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
282 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
283 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
284 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
285 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
286 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
287 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
288 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
289 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
290 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
291 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
292 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
293 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
294 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
295 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
296 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
297 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
298 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
299 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
300 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
301 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
302 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
303 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
304 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
305 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
306 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
307 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
308 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
309 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
310 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
311 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
312 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
313 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
314 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
315 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
316 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
317 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
318 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
319 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
320 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
321 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
322 2636415599 Klebsiella variicola DX120E Isolate Unclassified
323 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
324 2643221593 Lysobacter sp. Root690 Isolate Unclassified
325 2643221638 Duganella sp. Root336D2 Isolate Unclassified
326 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
327 2643221645 Massilia sp. Root351 Isolate Unclassified
328 2643221664 Massilia sp. Root418 Isolate Unclassified
329 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
330 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
331 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
332 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
333 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
334 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
335 2738541280 Massilia sp. GV090 Isolate Unclassified
336 2738541297 Duganella sp. GV083 Isolate Unclassified
337 2738541300 Massilia sp. GV016 Isolate Unclassified
338 2738541357 Duganella sp. GV053 Isolate Unclassified
339 2738543003 Duganella sp. GV066 Isolate Unclassified
340 2738543013 Variovorax sp. BT01 Isolate Unclassified
341 2738543018 Massilia sp. GV045 Isolate Unclassified
342 2738543026 Duganella sp. GV089 Isolate Unclassified
343 2738543029 Duganella sp. GV039 Isolate Unclassified
344 2738543030 Massilia sp. GV097 Isolate Unclassified
345 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
346 2751185917 Enterobacter sp. HK169 Isolate Unclassified
347 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
348 2775507074 Klebsiella sp. D5A Isolate Unclassified
349 2821131069 Duganella sp. 1224 Isolate Unclassified
350 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
351 2842711865 Duganella sp. R-73148 Isolate Unclassified
352 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
353 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
354 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
355 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
356 2857553236 Duganella sp. R-74557 Isolate Unclassified
357 2857558681 Duganella sp. R-74565 Isolate Unclassified
358 2857564685 Duganella sp. R-74599 Isolate Unclassified
359 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
360 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
361 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
362 2876601092 Pantoea endophytica 596 Isolate Unclassified
363 2885266251 Ralstonia sp. SET104 Isolate Nodule
364 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
365 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
366 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
367 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
368 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
369 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
370 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
371 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
372 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
373 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
374 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
375 2919150387 Rahnella aceris 1817 Isolate Unclassified
376 2919476304 Duganella sp. 3397 Isolate Unclassified
377 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
378 2927143783 Rahnella sp. 2050 Isolate Unclassified
379 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
380 2928058823 Ralstonia sp. 1138 Isolate Unclassified
381 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
382 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
383 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
384 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
385 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
386 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
387 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
388 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
389 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
390 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
391 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
392 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
393 640753048 Serratia proteamaculans 568 Isolate Endosphere
394 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
395 8018221730 Enterobacter sp. CM29 Isolate Unclassified
396 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
397 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
398 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
399 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
400 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
401 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
402 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.21
Metatranscriptomes 0.32
Isolates 13.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 18.21
Nodule 2.21
Rhizoplane 5.47
Rhizosphere 55.79
Stem 0
Stem Tuber 0.53
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0014701 3300046522 Bacteria 4650
2 JGI24741J21665_1000408 3300001915 Bacteria 12965
3 JGI24740J21852_10001196 3300001979 Bacteria 11704
4 JGI24740J21852_10002395 3300001979 Bacteria 8530
5 JGI24740J21852_10003713 3300001979 Bacteria 6645
6 JGI25158J39367_1000429 3300002739 Bacteria 8710
7 JGI25158J39367_1000753 3300002739 Bacteria 6214
8 JGI25163J39215_1000118 3300002771 Bacteria 33381
9 JGI25164J39214_1000302 3300002772 Bacteria 33358
10 JGI25152J39213_1000026 3300002773 Bacteria 101759
11 JGI25152J39213_1000153 3300002773 Bacteria 47218
12 JGI25150J39212_1000117 3300002774 Bacteria 45175
13 JGI25150J39212_1000280 3300002774 Bacteria 26822
14 JGI25150J39212_1013003 3300002774 Bacteria 1455
15 JGI25159J45721_1004491 3300002987 Bacteria 4620
16 JGI25159J45721_1005331 3300002987 Bacteria 4055
17 JGI25151J46595_10000148 3300003187 Bacteria 92040
18 JGI25151J46595_10000207 3300003187 Bacteria 71940
19 JGI25153J46596_10000146 3300003215 Bacteria 71940
20 JGI25153J46596_10004004 3300003215 Bacteria 8046
21 JGI25153J46596_10007834 3300003215 Bacteria 5187
22 rootH1_10018743 3300003316 Bacteria 12934
23 rootL2_10012396 3300003322 Bacteria 18736
24 JGI25161J50226_1000266 3300003374 Bacteria 30738
25 Ga0055538_1000217 3300003751 Bacteria 33362
26 Ga0055538_1002216 3300003751 Bacteria 3003
27 Ga0055538_1002256 3300003751 Bacteria 2951
28 Ga0055539_1000259 3300003752 Bacteria 33362
29 Ga0055539_1000443 3300003752 Bacteria 14387
30 Ga0055533_1000250 3300003756 Bacteria 33362
31 Ga0055533_1001778 3300003756 Bacteria 5458
32 Ga0055533_1003737 3300003756 Bacteria 2954
33 Ga0055532_1000008 3300003758 Bacteria 404753
34 Ga0055525_1000347 3300003759 Bacteria 33362
35 Ga0055525_1000500 3300003759 Bacteria 19694
36 Ga0055527_1002530 3300003760 Bacteria 3043
37 Ga0055535_1000006 3300003761 Bacteria 404753
38 Ga0055529_1000025 3300003763 Bacteria 304757
39 Ga0055526_1000020 3300003771 Bacteria 188230
40 Ga0055526_1000031 3300003771 Bacteria 143136
41 Ga0055526_1000487 3300003771 Bacteria 31529
42 Ga0055526_1000911 3300003771 Bacteria 21980
43 Ga0055537_1000035 3300003773 Bacteria 96274
44 Ga0055537_1010321 3300003773 Bacteria 1978
45 Ga0055537_1012918 3300003773 Bacteria 1600
46 Ga0055524_1000129 3300003775 Bacteria 88836
47 Ga0055524_1000322 3300003775 Bacteria 45133
48 Ga0055524_1000727 3300003775 Bacteria 22596
49 Ga0055524_1001062 3300003775 Bacteria 16934
50 Ga0055524_1001522 3300003775 Bacteria 13122
51 Ga0055524_1010727 3300003775 Bacteria 3628
52 Ga0055534_1000325 3300003784 Bacteria 31562
53 Ga0055534_1005326 3300003784 Bacteria 3470
54 Ga0055534_1011124 3300003784 Bacteria 1845
55 Ga0055528_1000058 3300003790 Bacteria 88086
56 Ga0055530_10000037 3300003791 Bacteria 116741
57 Ga0055530_10000499 3300003791 Bacteria 34011
58 Ga0055530_10007754 3300003791 Bacteria 4450
59 Ga0055530_10009349 3300003791 Bacteria 3780
60 Ga0055531_10002721 3300003794 Bacteria 11636
61 Ga0055541_1003489 3300003841 Bacteria 2954
62 Ga0058692_1000122 3300003856 Bacteria 50557
63 Ga0058692_1000871 3300003856 Bacteria 11880
64 Ga0058692_1001369 3300003856 Bacteria 9036
65 Ga0055543_1000339 3300004625 Bacteria 31976
66 Ga0055543_1005717 3300004625 Bacteria 3129
67 Ga0065165_1000224 3300005262 Bacteria 99359
68 Ga0065165_1001110 3300005262 Bacteria 31976
69 Ga0065704_10000581 3300005289 Bacteria 28087
70 Ga0065704_10002543 3300005289 Bacteria 5889
71 Ga0065704_10002719 3300005289 Bacteria 4795
72 Ga0065704_10003295 3300005289 Bacteria 5918
73 Ga0065704_10003831 3300005289 Bacteria 13528
74 Ga0070666_10082178 3300005335 Bacteria 2203
75 Ga0070661_100000417 3300005344 Bacteria 32723
76 Ga0070661_100104382 3300005344 Bacteria 2111
77 Ga0070667_100001671 3300005367 Bacteria 19832
78 Ga0070678_100103219 3300005456 Bacteria 2215
79 Ga0070662_100015699 3300005457 Bacteria 5078
80 Ga0070681_10143255 3300005458 Bacteria 2319
81 Ga0070685_10000588 3300005466 Bacteria 20219
82 Ga0070679_100003714 3300005530 Bacteria 13995
83 Ga0068853_100070789 3300005539 Bacteria 3036
84 Ga0070665_100000057 3300005548 Bacteria 237271
85 Ga0070665_100000160 3300005548 Bacteria 122425
86 Ga0070665_100016979 3300005548 Bacteria 7297
87 Ga0070665_100174268 3300005548 Bacteria 2152
88 Ga0070664_100000001 3300005564 Bacteria 551832
89 Ga0068857_100000013 3300005577 Bacteria 105599
90 Ga0068857_100017469 3300005577 Bacteria 6287
91 Ga0068857_100043166 3300005577 Bacteria 4000
92 Ga0068854_100000060 3300005578 Bacteria 80591
93 Ga0068854_100007812 3300005578 Bacteria 6843
94 Ga0068856_100002389 3300005614 Bacteria 19317
95 Ga0068856_100133320 3300005614 Bacteria 2489
96 Ga0068858_100000741 3300005842 Bacteria 34187
97 Ga0068860_100023779 3300005843 Bacteria 5923
98 Ga0075364_10000771 3300006051 Bacteria 16831
99 Ga0075364_10004224 3300006051 Bacteria 8248
100 Ga0075364_10011667 3300006051 Bacteria 5344
101 Ga0075364_10080678 3300006051 Bacteria 2151
102 Ga0075364_10153041 3300006051 Bacteria 1555
103 Ga0075366_10000439 3300006195 Bacteria 19409
104 Ga0079104_1000036 3300006946 Bacteria 194741
105 Ga0079104_1000122 3300006946 Bacteria 111219
106 Ga0079104_1000203 3300006946 Bacteria 83190
107 Ga0079104_1000437 3300006946 Bacteria 47476
108 Ga0079104_1001827 3300006946 Bacteria 13090
109 Ga0079104_1002423 3300006946 Bacteria 10072
110 Ga0079104_1002630 3300006946 Bacteria 9381
111 Ga0079104_1005598 3300006946 Bacteria 4976
112 Ga0079104_1011891 3300006946 Bacteria 2768
113 Ga0099826_10000001 3300006948 Bacteria 1155201
114 Ga0105251_10000277 3300009011 Bacteria 51445
115 Ga0105251_10001409 3300009011 Bacteria 20711
116 Ga0105251_10003581 3300009011 Bacteria 11191
117 Ga0105251_10004348 3300009011 Bacteria 9691
118 Ga0105251_10039575 3300009011 Bacteria 2302
119 Ga0105244_10001959 3300009036 Bacteria 15960
120 Ga0105244_10002307 3300009036 Bacteria 14498
121 Ga0105244_10002367 3300009036 Bacteria 14314
122 Ga0105244_10003041 3300009036 Bacteria 12310
123 Ga0105244_10010955 3300009036 Bacteria 5468
124 Ga0105250_10000855 3300009092 Bacteria 17996
125 Ga0105250_10003442 3300009092 Bacteria 7498
126 Ga0105250_10023228 3300009092 Bacteria 2499
127 Ga0105240_10007862 3300009093 Bacteria 15388
128 Ga0105240_10007892 3300009093 Bacteria 15350
129 Ga0105240_10022027 3300009093 Bacteria 8461
130 Ga0105240_10044181 3300009093 Bacteria 5665
131 Ga0105240_10074091 3300009093 Bacteria 4203
132 Ga0105240_10094914 3300009093 Bacteria 3637
133 Ga0105240_10246122 3300009093 Bacteria 2070
134 Ga0105243_10000259 3300009148 Bacteria 60174
135 Ga0105237_10000774 3300009545 Bacteria 43726
136 Ga0105238_10004980 3300009551 Bacteria 13136
137 Ga0105249_10003765 3300009553 Bacteria 13088
138 Ga0099796_10055307 3300010159 Bacteria 1390
139 Ga0105239_10000480 3300010375 Bacteria 58268
140 Ga0105239_10000644 3300010375 Bacteria 49525
141 Ga0105246_10035707 3300011119 Bacteria 3324
142 Ga0105246_10076771 3300011119 Bacteria 2368
143 Ga0157373_10000646 3300013100 Bacteria 27422
144 Ga0157373_10002943 3300013100 Bacteria 12904
145 Ga0157373_10033962 3300013100 Bacteria 3665
146 Ga0157373_10051163 3300013100 Bacteria 2942
147 Ga0157373_10223152 3300013100 Bacteria 1330
148 Ga0157371_10000404 3300013102 Bacteria 54021
149 Ga0157371_10001363 3300013102 Bacteria 25629
150 Ga0157371_10005803 3300013102 Bacteria 10332
151 Ga0157371_10016673 3300013102 Bacteria 5475
152 Ga0157371_10029511 3300013102 Bacteria 3964
153 Ga0157371_10091166 3300013102 Bacteria 2159
154 Ga0157370_10006219 3300013104 Bacteria 13227
155 Ga0157370_10007229 3300013104 Bacteria 12116
156 Ga0157370_10183156 3300013104 Bacteria 1946
157 Ga0157369_10004570 3300013105 Bacteria 16272
158 Ga0157369_10005312 3300013105 Bacteria 15012
159 Ga0157369_10239450 3300013105 Bacteria 1895
160 Ga0163162_10034844 3300013306 Bacteria 5011
161 Ga0157372_10000062 3300013307 Bacteria 119721
162 Ga0157372_10006644 3300013307 Bacteria 12308
163 Ga0157372_10023640 3300013307 Bacteria 6666
164 Ga0157372_10030390 3300013307 Bacteria 5911
165 Ga0157372_10039194 3300013307 Bacteria 5230
166 Ga0157372_10040945 3300013307 Bacteria 5120
167 Ga0157372_10105763 3300013307 Bacteria 3219
168 Ga0163163_10110438 3300014325 Bacteria 2778
169 Ga0182008_10000147 3300014497 Bacteria 54639
170 Ga0182006_1000212 3300015261 Bacteria 57379
171 Ga0182006_1006900 3300015261 Bacteria 5234
172 Ga0182006_1010041 3300015261 Bacteria 4222
173 Ga0182007_10027739 3300015262 Bacteria 1950
174 Ga0182005_1000018 3300015265 Bacteria 324307
175 Ga0183366_1004 3300015679 Bacteria 252597
176 Ga0183370_1004 3300015680 Bacteria 252597
177 Ga0183369_1010 3300015685 Bacteria 252581
178 Ga0183368_1008 3300015687 Bacteria 252581
179 Ga0163161_10169939 3300017792 Bacteria 1666
180 Ga0163161_10222672 3300017792 Bacteria 1461
181 Ga0197907_10544216 3300020069 Bacteria 3436
182 Ga0206351_10076999 3300020077 Bacteria 4244
183 Ga0154015_1694190 3300020610 Bacteria 4267
184 Ga0213872_10000654 3300021361 Bacteria 26277
185 Ga0213872_10001316 3300021361 Bacteria 16470
186 Ga0213872_10001452 3300021361 Bacteria 15431
187 Ga0213872_10004382 3300021361 Bacteria 7515
188 Ga0213872_10009443 3300021361 Bacteria 4677
189 Ga0213876_10000049 3300021384 Bacteria 145629
190 Ga0209760_100179 3300025207 Bacteria 33431
191 Ga0209436_100178 3300025208 Bacteria 30007
192 Ga0209436_100211 3300025208 Bacteria 26922
193 Ga0209436_100684 3300025208 Bacteria 14390
194 Ga0209784_100001 3300025224 Bacteria 3600592
195 Ga0209784_100063 3300025224 Bacteria 159576
196 Ga0209566_100001 3300025225 Bacteria 3600765
197 Ga0209566_100048 3300025225 Bacteria 241570
198 Ga0209566_102596 3300025225 Bacteria 3221
199 Ga0209674_100002 3300025226 Bacteria 3600592
200 Ga0209674_100071 3300025226 Bacteria 241568
201 Ga0209674_103236 3300025226 Bacteria 3069
202 Ga0209672_100199 3300025228 Bacteria 47771
203 Ga0209672_100339 3300025228 Bacteria 30154
204 Ga0209147_100002 3300025229 Bacteria 2158988
205 Ga0209563_100002 3300025230 Bacteria 2045675
206 Ga0209563_100085 3300025230 Bacteria 186579
207 Ga0207427_100032 3300025231 Bacteria 349939
208 Ga0209437_100001 3300025233 Bacteria 2045675
209 Ga0209437_100092 3300025233 Bacteria 240044
210 Ga0209258_100002 3300025242 Bacteria 2158988
211 Ga0207425_1000001 3300025245 Bacteria 2525432
212 Ga0207425_1000011 3300025245 Bacteria 550735
213 Ga0207425_1000017 3300025245 Bacteria 423851
214 Ga0207425_1000067 3300025245 Bacteria 124459
215 Ga0207425_1000085 3300025245 Bacteria 95577
216 Ga0207425_1001571 3300025245 Bacteria 9266
217 Ga0207425_1005801 3300025245 Bacteria 3470
218 Ga0209646_1000028 3300025246 Bacteria 387986
219 Ga0209677_100002 3300025253 Bacteria 2045675
220 Ga0209677_100040 3300025253 Bacteria 241568
221 Ga0209759_1002426 3300025256 Bacteria 8172
222 Ga0209759_1009418 3300025256 Bacteria 2954
223 Ga0209129_1000003 3300025258 Bacteria 903689
224 Ga0209129_1000021 3300025258 Bacteria 445018
225 Ga0209129_1000162 3300025258 Bacteria 101248
226 Ga0209129_1000273 3300025258 Bacteria 50169
227 Ga0209129_1002118 3300025258 Bacteria 10097
228 Ga0209129_1005230 3300025258 Bacteria 4696
229 Ga0209129_1013492 3300025258 Bacteria 1797
230 Ga0209233_1001209 3300025261 Bacteria 10412
231 Ga0209233_1001959 3300025261 Bacteria 7829
232 Ga0209565_1000009 3300025263 Bacteria 751701
233 Ga0209565_1000452 3300025263 Bacteria 31667
234 Ga0209565_1000613 3300025263 Bacteria 23636
235 Ga0209565_1000665 3300025263 Bacteria 21915
236 Ga0209565_1001924 3300025263 Bacteria 8204
237 Ga0209565_1002725 3300025263 Bacteria 6139
238 Ga0209565_1003902 3300025263 Bacteria 4683
239 Ga0209565_1004983 3300025263 Bacteria 3935
240 Ga0209565_1005250 3300025263 Bacteria 3796
241 Ga0209455_1000009 3300025272 Bacteria 1042273
242 Ga0209455_1000049 3300025272 Bacteria 374414
243 Ga0209673_1000036 3300025273 Bacteria 323162
244 Ga0209673_1007399 3300025273 Bacteria 5071
245 Ga0209673_1015512 3300025273 Bacteria 2890
246 Ga0209130_1000044 3300025284 Bacteria 241110
247 Ga0209130_1000059 3300025284 Bacteria 204772
248 Ga0209130_1000733 3300025284 Bacteria 29001
249 Ga0209130_1000968 3300025284 Bacteria 22635
250 Ga0209130_1003333 3300025284 Bacteria 6918
251 Ga0209130_1005009 3300025284 Bacteria 4773
252 Ga0209675_1000013 3300025291 Bacteria 448220
253 Ga0209675_1000394 3300025291 Bacteria 36250
254 Ga0209675_1001363 3300025291 Bacteria 14327
255 Ga0209675_1001613 3300025291 Bacteria 12716
256 Ga0209675_1007023 3300025291 Bacteria 4395
257 Ga0209676_1006547 3300025292 Bacteria 5721
258 Ga0209025_1000005 3300025294 Bacteria 1272149
259 Ga0209025_1000054 3300025294 Bacteria 317002
260 Ga0209025_1007861 3300025294 Bacteria 7823
261 Ga0209564_1000006 3300025295 Bacteria 1100927
262 Ga0209564_1000038 3300025295 Bacteria 414357
263 Ga0209564_1000122 3300025295 Bacteria 203709
264 Ga0209564_1000142 3300025295 Bacteria 178742
265 Ga0209564_1005605 3300025295 Bacteria 7071
266 Ga0209564_1007137 3300025295 Bacteria 5832
267 Ga0209758_1000020 3300025297 Bacteria 734220
268 Ga0209758_1000062 3300025297 Bacteria 317002
269 Ga0209758_1000250 3300025297 Bacteria 109992
270 Ga0209758_1000583 3300025297 Bacteria 56955
271 Ga0209758_1007146 3300025297 Bacteria 7707
272 Ga0209050_1000058 3300025298 Bacteria 325558
273 Ga0209050_1000612 3300025298 Bacteria 56207
274 Ga0209050_1000654 3300025298 Bacteria 53586
275 Ga0209050_1001112 3300025298 Bacteria 32536
276 Ga0209050_1001305 3300025298 Bacteria 28023
277 Ga0209050_1001484 3300025298 Bacteria 24939
278 Ga0209050_1010656 3300025298 Bacteria 4492
279 Ga0209256_1000106 3300025299 Bacteria 187258
280 Ga0209256_1000184 3300025299 Bacteria 121336
281 Ga0209256_1000201 3300025299 Bacteria 112637
282 Ga0209256_1000285 3300025299 Bacteria 88890
283 Ga0209256_1000503 3300025299 Bacteria 57448
284 Ga0209256_1000875 3300025299 Bacteria 37255
285 Ga0209256_1002929 3300025299 Bacteria 12821
286 Ga0207426_1002835 3300025302 Bacteria 10323
287 Ga0207426_1005567 3300025302 Bacteria 5714
288 Ga0209257_1000003 3300025304 Bacteria 1702593
289 Ga0209257_1000123 3300025304 Bacteria 219092
290 Ga0209257_1002302 3300025304 Bacteria 19351
291 Ga0209257_1004098 3300025304 Bacteria 11660
292 Ga0207696_1000202 3300025711 Bacteria 91342
293 Ga0207696_1000949 3300025711 Bacteria 17703
294 Ga0207696_1002169 3300025711 Bacteria 9843
295 Ga0207696_1007432 3300025711 Bacteria 4291
296 Ga0207655_1000067 3300025728 Bacteria 245484
297 Ga0207655_1000111 3300025728 Bacteria 170772
298 Ga0207655_1000122 3300025728 Bacteria 154848
299 Ga0207655_1000218 3300025728 Bacteria 98543
300 Ga0207655_1001050 3300025728 Bacteria 27637
301 Ga0207655_1002313 3300025728 Bacteria 15653
302 Ga0207655_1004581 3300025728 Bacteria 9736
303 Ga0207655_1005717 3300025728 Bacteria 8399
304 Ga0207655_1029638 3300025728 Bacteria 2558
305 Ga0207713_1000184 3300025735 Bacteria 88768
306 Ga0207713_1000636 3300025735 Bacteria 34132
307 Ga0207713_1000748 3300025735 Bacteria 30270
308 Ga0207713_1002034 3300025735 Bacteria 15140
309 Ga0207713_1002094 3300025735 Bacteria 14894
310 Ga0207713_1004241 3300025735 Bacteria 9366
311 Ga0207647_10000024 3300025904 Bacteria 115153
312 Ga0207695_10000200 3300025913 Bacteria 165896
313 Ga0207695_10001553 3300025913 Bacteria 37757
314 Ga0207695_10002561 3300025913 Bacteria 26716
315 Ga0207695_10029467 3300025913 Bacteria 6063
316 Ga0207695_10077056 3300025913 Bacteria 3388
317 Ga0207671_10021575 3300025914 Bacteria 4883
318 Ga0207671_10270261 3300025914 Bacteria 1339
319 Ga0207649_10000390 3300025920 Bacteria 32941
320 Ga0207652_10083219 3300025921 Bacteria 2802
321 Ga0207694_10011349 3300025924 Bacteria 6725
322 Ga0207644_10250209 3300025931 Bacteria 1414
323 Ga0207706_10001182 3300025933 Bacteria 26340
324 Ga0207709_10000289 3300025935 Bacteria 57229
325 Ga0207679_10000003 3300025945 Bacteria 597553
326 Ga0207712_10000244 3300025961 Bacteria 53354
327 Ga0207712_10000608 3300025961 Bacteria 28444
328 Ga0207640_10000071 3300025981 Bacteria 80591
329 Ga0207677_10137142 3300026023 Bacteria 1867
330 Ga0207703_10000573 3300026035 Bacteria 37600
331 Ga0207639_10013416 3300026041 Bacteria 5736
332 Ga0207639_10030426 3300026041 Bacteria 3959
333 Ga0207678_10000175 3300026067 Bacteria 54512
334 Ga0207678_10028388 3300026067 Bacteria 4885
335 Ga0207702_10000110 3300026078 Bacteria 95353
336 Ga0207674_10000071 3300026116 Bacteria 105678
337 Ga0207674_10011098 3300026116 Bacteria 10131
338 Ga0207674_10079114 3300026116 Bacteria 3292
339 Ga0207683_10144062 3300026121 Bacteria 2148
340 Ga0209281_1000031 3300027111 Bacteria 422772
341 Ga0209281_1000080 3300027111 Bacteria 261394
342 Ga0209281_1000086 3300027111 Bacteria 250986
343 Ga0209281_1000117 3300027111 Bacteria 209272
344 Ga0209281_1000206 3300027111 Bacteria 133510
345 Ga0209281_1000261 3300027111 Bacteria 101694
346 Ga0209281_1000338 3300027111 Bacteria 79936
347 Ga0209281_1001242 3300027111 Bacteria 16718
348 Ga0209281_1002414 3300027111 Bacteria 7565
349 Ga0209371_1000005 3300027312 Bacteria 1061740
350 Ga0209371_1000029 3300027312 Bacteria 424797
351 Ga0209371_1000042 3300027312 Bacteria 333147
352 Ga0209371_1000133 3300027312 Bacteria 122145
353 Ga0209371_1000257 3300027312 Bacteria 64352
354 Ga0209371_1001693 3300027312 Bacteria 13989
355 Ga0209371_1002593 3300027312 Bacteria 9935
356 Ga0209371_1003013 3300027312 Bacteria 8707
357 Ga0209371_1011434 3300027312 Bacteria 2636
358 Ga0209371_1017609 3300027312 Bacteria 1845
359 Ga0209282_1000001 3300027666 Bacteria 2450367
360 Ga0268266_10000001 3300028379 Bacteria 4040580
361 Ga0268266_10000008 3300028379 Bacteria 1161875
362 Ga0268266_10000129 3300028379 Bacteria 148215
363 Ga0268266_10052560 3300028379 Bacteria 3499
364 Ga0268264_10035567 3300028381 Bacteria 4100
365 Ga0307517_10006778 3300028786 Bacteria 16859
366 Ga0307517_10105419 3300028786 Bacteria 2188
367 Ga0307515_10000652 3300028794 Bacteria 80185
368 Ga0268256_1000006 3300030500 Bacteria 1063991
369 Ga0268256_1000032 3300030500 Bacteria 424603
370 Ga0268256_1000042 3300030500 Bacteria 333815
371 Ga0268256_1000262 3300030500 Bacteria 55825
372 Ga0268256_1001353 3300030500 Bacteria 14953
373 Ga0268256_1001716 3300030500 Bacteria 12466
374 Ga0268256_1001932 3300030500 Bacteria 11354
375 Ga0268256_1004434 3300030500 Bacteria 5821
376 Ga0268256_1008802 3300030500 Bacteria 3426
377 Ga0268256_1009719 3300030500 Bacteria 3162
378 Ga0268256_1015762 3300030500 Bacteria 2192
379 Ga0268256_1016889 3300030500 Bacteria 2074
380 Ga0307511_10000875 3300030521 Bacteria 32041
381 Ga0307511_10004090 3300030521 Bacteria 14908
382 Ga0307512_10051335 3300030522 Bacteria 3301
383 Ga0316180_1052418 3300030736 Bacteria 2915
384 Ga0316182_1325361 3300030745 Bacteria 1568
385 Ga0307513_10206262 3300031456 Bacteria 1801
386 Ga0307513_10323942 3300031456 Bacteria 1298
387 Ga0307509_10002463 3300031507 Bacteria 29929
388 Ga0307509_10009159 3300031507 Bacteria 12441
389 Ga0307408_100000016 3300031548 Bacteria 356896
390 Ga0307408_100000082 3300031548 Bacteria 106847
391 Ga0307408_100000194 3300031548 Bacteria 65753
392 Ga0307408_100001091 3300031548 Bacteria 20747
393 Ga0307408_100004846 3300031548 Bacteria 9063
394 Ga0307508_10131442 3300031616 Bacteria 2106
395 Ga0307514_10002227 3300031649 Bacteria 20686
396 Ga0307514_10077067 3300031649 Bacteria 2481
397 Ga0265314_10009564 3300031711 Bacteria 8168
398 Ga0307516_10000348 3300031730 Bacteria 60054
399 Ga0307416_100000733 3300032002 Bacteria 17094
400 Ga0307510_10003186 3300033180 Bacteria 19042
401 Ga0307510_10015746 3300033180 Bacteria 8942
402 Ga0373939_0000113 3300035114 Bacteria 24383
403 Ga0373960_0000857 3300035121 Bacteria 6436
404 Ga0373931_0002626 3300035691 Bacteria 7997
405 Ga0395899_0000012 3300037312 Bacteria 517561
406 Ga0395900_0051003 3300037418 Bacteria 4262
407 Ga0395905_0010150 3300037471 Bacteria 9177
408 Ga0395905_0013852 3300037471 Bacteria 7714
409 Ga0395901_0056740 3300038443 Bacteria 4074
410 Ga0237819_00016 3300038705 Bacteria 57788
411 Ga0436365_0245969 3300039437 Bacteria 378821
412 Ga0436361_0080811 3300039447 Bacteria 13019
413 Ga0436361_0810533 3300039447 Bacteria 9812
414 Ga0436361_0821396 3300039447 Bacteria 16496
415 Ga0439438_001391 3300041405 Bacteria 10661
416 Ga0439447_002006 3300041407 Bacteria 7480
417 Ga0451798_0664110 3300041458 Bacteria 1498
418 Ga0439452_000012 3300042010 Bacteria 412478
419 Ga0439452_000076 3300042010 Bacteria 87445
420 Ga0439452_000494 3300042010 Bacteria 21620
421 Ga0450900_003287 3300042136 Bacteria 1787
422 Ga0439464_0015981 3300042439 Bacteria 2028
423 Ga0450918_000309 3300042531 Bacteria 10941
424 Ga0466972_0000331 3300044658 Bacteria 26574
425 Ga0466981_0000020 3300044669 Bacteria 87281
426 Ga0466965_0024779 3300044683 Bacteria 2903
427 Ga0466965_0072550 3300044683 Bacteria 1732
428 Ga0466966_0014028 3300044684 Bacteria 5304
429 Ga0466961_0004626 3300044693 Bacteria 8635
430 Ga0466968_0007269 3300044735 Bacteria 4208
431 Ga0466968_0017600 3300044735 Bacteria 2859
432 Ga0466957_0042727 3300044842 Bacteria 2743
433 Ga0466960_0048075 3300044901 Bacteria 2049
434 Ga0466960_0169611 3300044901 Bacteria 1177
435 Ga0495617_000007 3300046452 Bacteria 369986
436 Ga0495617_000460 3300046452 Bacteria 21930
437 Ga0495617_000570 3300046452 Bacteria 18943
438 Ga0495617_000947 3300046452 Bacteria 13464
439 Ga0495627_000006 3300046453 Bacteria 581750
440 Ga0495590_0000004 3300046457 Bacteria 402091
441 Ga0495591_000095 3300046458 Bacteria 100685
442 Ga0495591_000126 3300046458 Bacteria 83383
443 Ga0495591_001567 3300046458 Bacteria 13925
444 Ga0495638_0000366 3300046460 Bacteria 55970
445 Ga0495638_0002123 3300046460 Bacteria 16699
446 Ga0495638_0002285 3300046460 Bacteria 15813
447 Ga0495638_0074618 3300046460 Bacteria 2068
448 Ga0495638_0083629 3300046460 Bacteria 1933
449 Ga0495653_0000037 3300046463 Bacteria 120575
450 Ga0495653_0197745 3300046463 Bacteria 1367
451 Ga0495650_0000094 3300046471 Bacteria 219056
452 Ga0495650_0000126 3300046471 Bacteria 178143
453 Ga0495650_0000169 3300046471 Bacteria 145238
454 Ga0495650_0000177 3300046471 Bacteria 139376
455 Ga0495650_0000256 3300046471 Bacteria 103125
456 Ga0495650_0000421 3300046471 Bacteria 69019
457 Ga0495650_0003963 3300046471 Bacteria 10407
458 Ga0495605_0000003 3300046474 Bacteria 491502
459 Ga0495605_0000239 3300046474 Bacteria 65496
460 Ga0495584_0000001 3300046491 Bacteria 649329
461 Ga0495584_0000144 3300046491 Bacteria 49665
462 Ga0495584_0001913 3300046491 Bacteria 11987
463 Ga0495584_0065214 3300046491 Bacteria 1831
464 Ga0495585_0000002 3300046492 Bacteria 529316
465 Ga0495585_0000026 3300046492 Bacteria 148243
466 Ga0495585_0000922 3300046492 Bacteria 24890
467 Ga0495585_0000984 3300046492 Bacteria 23867
468 Ga0495585_0001182 3300046492 Bacteria 21187
469 Ga0495585_0007599 3300046492 Bacteria 6621
470 Ga0495585_0007857 3300046492 Bacteria 6489
471 Ga0495585_0050822 3300046492 Bacteria 2298
472 Ga0495585_0070416 3300046492 Bacteria 1908
473 Ga0495585_0189029 3300046492 Bacteria 1054
474 Ga0495594_0021495 3300046499 Bacteria 3443
475 Ga0495596_0000149 3300046500 Bacteria 48579
476 Ga0495596_0003827 3300046500 Bacteria 7488
477 Ga0495596_0004037 3300046500 Bacteria 7228
478 Ga0495596_0009020 3300046500 Bacteria 4409
479 Ga0495607_0000423 3300046501 Bacteria 43024
480 Ga0495607_0002599 3300046501 Bacteria 14519
481 Ga0495607_0002760 3300046501 Bacteria 14001
482 Ga0495607_0005270 3300046501 Bacteria 9303
483 Ga0495607_0006087 3300046501 Bacteria 8532
484 Ga0495607_0009553 3300046501 Bacteria 6554
485 Ga0495607_0078202 3300046501 Bacteria 1825
486 Ga0495583_0000008 3300046506 Bacteria 411092
487 Ga0495583_0000009 3300046506 Bacteria 372527
488 Ga0495583_0000021 3300046506 Bacteria 287046
489 Ga0495583_0000431 3300046506 Bacteria 63149
490 Ga0495583_0000508 3300046506 Bacteria 55961
491 Ga0495583_0020905 3300046506 Bacteria 3376
492 Ga0495583_0029448 3300046506 Bacteria 2686
493 Ga0495583_0045912 3300046506 Bacteria 2017
494 Ga0495606_0000024 3300046507 Bacteria 262080
495 Ga0495606_0000069 3300046507 Bacteria 179158
496 Ga0495606_0000268 3300046507 Bacteria 91857
497 Ga0495606_0002135 3300046507 Bacteria 23874
498 Ga0495606_0003645 3300046507 Bacteria 16154
499 Ga0495606_0004126 3300046507 Bacteria 14749
500 Ga0495606_0009070 3300046507 Bacteria 8481
501 Ga0495606_0012997 3300046507 Bacteria 6621
502 Ga0495606_0032074 3300046507 Bacteria 3644
503 Ga0495606_0072980 3300046507 Bacteria 2154
504 Ga0495610_0000004 3300046512 Bacteria 1006135
505 Ga0495610_0000688 3300046512 Bacteria 32625
506 Ga0495610_0001096 3300046512 Bacteria 24679
507 Ga0495610_0001354 3300046512 Bacteria 21747
508 Ga0495610_0083542 3300046512 Bacteria 1461
509 Ga0495616_0000616 3300046513 Bacteria 26772
510 Ga0495616_0002987 3300046513 Bacteria 10986
511 Ga0495616_0005767 3300046513 Bacteria 7571
512 Ga0495616_0006740 3300046513 Bacteria 6924
513 Ga0495616_0009497 3300046513 Bacteria 5682
514 Ga0495616_0028253 3300046513 Bacteria 2970
515 Ga0495616_0030102 3300046513 Bacteria 2856
516 Ga0495620_0001761 3300046515 Bacteria 12736
517 Ga0495620_0011071 3300046515 Bacteria 4723
518 Ga0495631_0003073 3300046518 Bacteria 9212
519 Ga0495631_0009757 3300046518 Bacteria 4781
520 Ga0495631_0011449 3300046518 Bacteria 4362
521 Ga0495631_0098547 3300046518 Bacteria 1258
522 Ga0495632_0001138 3300046519 Bacteria 22748
523 Ga0495632_0024916 3300046519 Bacteria 3171
524 Ga0495637_0001417 3300046520 Bacteria 14138
525 Ga0495637_0020431 3300046520 Bacteria 3047
526 Ga0495643_0000182 3300046522 Bacteria 100196
527 Ga0495643_0000383 3300046522 Bacteria 58554
528 Ga0495643_0000425 3300046522 Bacteria 54854
529 Ga0495643_0000695 3300046522 Bacteria 38698
530 Ga0495643_0040750 3300046522 Bacteria 2535
531 Ga0495644_0000347 3300046523 Bacteria 21047
532 Ga0495644_0003130 3300046523 Bacteria 6544
533 Ga0495644_0003727 3300046523 Bacteria 5998
534 Ga0495644_0006940 3300046523 Bacteria 4384
535 Ga0495648_0000012 3300046524 Bacteria 294111
536 Ga0495648_0000045 3300046524 Bacteria 172587
537 Ga0495648_0001995 3300046524 Bacteria 19327
538 Ga0495648_0002014 3300046524 Bacteria 19253
539 Ga0495648_0003262 3300046524 Bacteria 14373
540 Ga0495648_0009843 3300046524 Bacteria 7346
541 Ga0495648_0013578 3300046524 Bacteria 6009
542 Ga0495648_0066573 3300046524 Bacteria 2112
543 Ga0495648_0081834 3300046524 Bacteria 1835
544 Ga0495663_0002406 3300046525 Bacteria 5626
545 Ga0495663_0006313 3300046525 Bacteria 3275
546 Ga0495663_0026773 3300046525 Bacteria 1689
547 Ga0495666_0018861 3300046526 Bacteria 3427
548 Ga0495642_0003014 3300046528 Bacteria 6710
549 Ga0495642_0003809 3300046528 Bacteria 5910
550 Ga0495642_0007287 3300046528 Bacteria 4246
551 Ga0495642_0015571 3300046528 Bacteria 2958
552 Ga0495642_0020660 3300046528 Bacteria 2588
553 Ga0495654_0000004 3300046530 Bacteria 515304
554 Ga0495654_0000072 3300046530 Bacteria 115797
555 Ga0495654_0000133 3300046530 Bacteria 78489
556 Ga0495654_0000208 3300046530 Bacteria 55576
557 Ga0495654_0002518 3300046530 Bacteria 11773
558 Ga0495654_0003249 3300046530 Bacteria 10030
559 Ga0495654_0007878 3300046530 Bacteria 5924
560 Ga0495665_0006893 3300046531 Bacteria 6132
561 Ga0495586_0046147 3300046535 Bacteria 2349
562 Ga0495587_0015764 3300046536 Bacteria 4712
563 Ga0495609_0000771 3300046538 Bacteria 24022
564 Ga0495609_0001220 3300046538 Bacteria 17715
565 Ga0495609_0001731 3300046538 Bacteria 14095
566 Ga0495609_0002003 3300046538 Bacteria 12875
567 Ga0495609_0009992 3300046538 Bacteria 4570
568 Ga0495609_0020942 3300046538 Bacteria 3017
569 Ga0495609_0022955 3300046538 Bacteria 2872
570 Ga0495597_0000434 3300046542 Bacteria 35709
571 Ga0495597_0001158 3300046542 Bacteria 19843
572 Ga0495597_0002890 3300046542 Bacteria 10472
573 Ga0495597_0003565 3300046542 Bacteria 8981
574 Ga0495622_0000003 3300046557 Bacteria 268681
575 Ga0495622_0000489 3300046557 Bacteria 24974
576 Ga0495622_0006038 3300046557 Bacteria 5628
577 Ga0495633_0000356 3300046558 Bacteria 49639
578 Ga0495633_0000522 3300046558 Bacteria 38445
579 Ga0495633_0004410 3300046558 Bacteria 8960
580 Ga0495633_0010220 3300046558 Bacteria 5135
581 Ga0495633_0013669 3300046558 Bacteria 4269
582 Ga0495633_0014930 3300046558 Bacteria 4038
583 Ga0495633_0039794 3300046558 Bacteria 2242
584 Ga0495633_0100007 3300046558 Bacteria 1346
585 Ga0495656_0003608 3300046615 Bacteria 5243
586 Ga0495656_0055091 3300046615 Bacteria 1713
587 Ga0495668_0000025 3300046616 Bacteria 304546
588 Ga0495668_0000307 3300046616 Bacteria 67683
589 Ga0495668_0000764 3300046616 Bacteria 37666
590 Ga0495668_0001108 3300046616 Bacteria 27819
591 Ga0495668_0001920 3300046616 Bacteria 18482
592 Ga0495668_0040672 3300046616 Bacteria 2592
593 Ga0495611_0009567 3300046648 Bacteria 4094
594 Ga0495611_0014075 3300046648 Bacteria 3412
595 Ga0495611_0018688 3300046648 Bacteria 2974
596 Ga0495611_0041778 3300046648 Bacteria 2045
597 Ga0495625_0001394 3300046660 Bacteria 29641
598 Ga0495625_0001654 3300046660 Bacteria 26125
599 Ga0495625_0001834 3300046660 Bacteria 24309
600 Ga0495625_0013019 3300046660 Bacteria 6708
601 Ga0495625_0016949 3300046660 Bacteria 5716
602 Ga0495625_0125329 3300046660 Bacteria 1744
603 Ga0495625_0158286 3300046660 Bacteria 1519
604 Ga0495659_0000091 3300046664 Bacteria 39620
605 Ga0495659_0000414 3300046664 Bacteria 16287
606 Ga0495659_0003001 3300046664 Bacteria 5412
607 Ga0495659_0017389 3300046664 Bacteria 2382
608 Ga0495661_0000130 3300046665 Bacteria 91302
609 Ga0495661_0000296 3300046665 Bacteria 56421
610 Ga0495661_0008417 3300046665 Bacteria 7133
611 Ga0495661_0015865 3300046665 Bacteria 5014
612 Ga0495661_0036020 3300046665 Bacteria 3102
613 Ga0495661_0074485 3300046665 Bacteria 1975
614 Ga0495661_0080739 3300046665 Bacteria 1876
615 Ga0495661_0117611 3300046665 Bacteria 1472
616 Ga0495588_0000083 3300046674 Bacteria 197018
617 Ga0495669_0005645 3300046684 Bacteria 5222
618 Ga0495670_0000812 3300046691 Bacteria 15051
619 Ga0495670_0006970 3300046691 Bacteria 5568
620 Ga0495670_0014039 3300046691 Bacteria 3940
621 Ga0495671_0000001 3300046692 Bacteria 1169494
622 Ga0495671_0000246 3300046692 Bacteria 46812
623 Ga0495671_0037425 3300046692 Bacteria 2454
624 Ga0495671_0097571 3300046692 Bacteria 1437
625 Ga0495649_0000053 3300046694 Bacteria 107885
626 Ga0495649_0004130 3300046694 Bacteria 9537
627 Ga0495649_0008166 3300046694 Bacteria 6312
628 Ga0495649_0023194 3300046694 Bacteria 3467
629 Ga0495649_0034037 3300046694 Bacteria 2804
630 Ga0495649_0061273 3300046694 Bacteria 2023
631 Ga0495589_0000022 3300046794 Bacteria 196021
632 Ga0495589_0000076 3300046794 Bacteria 91288
633 Ga0495589_0038137 3300046794 Bacteria 2406
634 Ga0495589_0086496 3300046794 Bacteria 1522
635 Ga0495660_0000028 3300046810 Bacteria 244534
636 Ga0495660_0000044 3300046810 Bacteria 150926
637 Ga0495660_0000051 3300046810 Bacteria 138590
638 Ga0495660_0000914 3300046810 Bacteria 21739
639 Ga0495660_0002115 3300046810 Bacteria 12854
640 Ga0495660_0005694 3300046810 Bacteria 7444
641 Ga0495660_0006366 3300046810 Bacteria 6991
642 Ga0495660_0018634 3300046810 Bacteria 3990
643 Ga0495660_0021987 3300046810 Bacteria 3646
644 Ga0495660_0055889 3300046810 Bacteria 2135
645 Ga0495581_0020359 3300047315 Bacteria 3850
646 Ga0495604_0028592 3300047317 Bacteria 4435
647 Ga0495636_0000101 3300047318 Bacteria 36405
648 Ga0495636_0000430 3300047318 Bacteria 15568
649 Ga0495636_0002862 3300047318 Bacteria 6662
650 Ga0495672_0000011 3300047320 Bacteria 535362
651 Ga0495672_0000026 3300047320 Bacteria 340319
652 Ga0495672_0000039 3300047320 Bacteria 272506
653 Ga0495672_0000154 3300047320 Bacteria 100095
654 Ga0495672_0001702 3300047320 Bacteria 21328
655 Ga0495672_0034255 3300047320 Bacteria 3139
656 Ga0495676_0036890 3300047321 Bacteria 4076
657 Ga0495683_0000009 3300047323 Bacteria 241385
658 Ga0495683_0001547 3300047323 Bacteria 14899
659 Ga0495683_0006154 3300047323 Bacteria 6579
660 Ga0495683_0006907 3300047323 Bacteria 6169
661 Ga0495683_0013607 3300047323 Bacteria 4252
662 Ga0495683_0030559 3300047323 Bacteria 2748
663 Ga0495687_000099 3300047443 Bacteria 132139
664 Ga0495687_000245 3300047443 Bacteria 73990
665 Ga0495687_001356 3300047443 Bacteria 22728
666 Ga0495687_001959 3300047443 Bacteria 17586
667 Ga0495687_035568 3300047443 Bacteria 2238
668 Ga0495675_0064341 3300047444 Bacteria 2320
669 Ga0495677_0000319 3300047445 Bacteria 20801
670 Ga0495677_0002770 3300047445 Bacteria 6835
671 Ga0495677_0006013 3300047445 Bacteria 4589
672 Ga0495677_0017575 3300047445 Bacteria 2592
673 Ga0495677_0021168 3300047445 Bacteria 2357
674 Ga0495679_000016 3300047446 Bacteria 282024
675 Ga0495679_005316 3300047446 Bacteria 5728
676 Ga0495685_000045 3300047447 Bacteria 50520
677 Ga0495685_003874 3300047447 Bacteria 4800
678 Ga0495685_006938 3300047447 Bacteria 3725
679 Ga0495673_0000006 3300047469 Bacteria 908691
680 Ga0495673_0000014 3300047469 Bacteria 599202
681 Ga0495673_0000017 3300047469 Bacteria 574970
682 Ga0495673_0000020 3300047469 Bacteria 548327
683 Ga0495673_0000137 3300047469 Bacteria 134484
684 Ga0495681_0003829 3300047470 Bacteria 10409
685 Ga0495681_0004629 3300047470 Bacteria 9332
686 Ga0495681_0014546 3300047470 Bacteria 4502
687 Ga0495681_0076979 3300047470 Bacteria 1498
688 Ga0495686_0032960 3300047472 Bacteria 3348
689 Ga0495686_0034396 3300047472 Bacteria 3264
690 Ga0495626_0000014 3300048091 Bacteria 246660
691 Ga0495626_0000021 3300048091 Bacteria 217213
692 Ga0495626_0002580 3300048091 Bacteria 12392
693 Ga0495626_0004663 3300048091 Bacteria 8320
694 Ga0495626_0007450 3300048091 Bacteria 6091
695 Ga0495626_0027947 3300048091 Bacteria 2738
696 Ga0495626_0030215 3300048091 Bacteria 2614
697 Ga0496101_0000063 3300048904 Bacteria 125670
698 Ga0496102_0001073 3300048905 Bacteria 25277
699 Ga0496103_0020776 3300048906 Bacteria 3947
700 Ga0496105_0079474 3300048908 Bacteria 2708
701 Ga0496107_0038364 3300048910 Bacteria 3437
702 Ga0496114_0004140 3300048917 Bacteria 11220
703 Ga0496116_0000147 3300048919 Bacteria 142463
704 Ga0496116_0001013 3300048919 Bacteria 34257
705 Ga0496116_0001377 3300048919 Bacteria 27467
706 Ga0496116_0019647 3300048919 Bacteria 5164
707 Ga0496116_0020112 3300048919 Bacteria 5081
708 Ga0496116_0032380 3300048919 Bacteria 3726
709 Ga0496116_0036256 3300048919 Bacteria 3453
710 Ga0496116_0078490 3300048919 Bacteria 2058
711 Ga0496117_0000306 3300048920 Bacteria 85642
712 Ga0496117_0002498 3300048920 Bacteria 23080
713 Ga0496117_0009407 3300048920 Bacteria 9095
714 Ga0496117_0009676 3300048920 Bacteria 8918
715 Ga0496117_0015996 3300048920 Bacteria 6355
716 Ga0496117_0017021 3300048920 Bacteria 6088
717 Ga0496117_0035095 3300048920 Bacteria 3769
718 Ga0496117_0039174 3300048920 Bacteria 3501
719 Ga0496117_0043737 3300048920 Bacteria 3252
720 Ga0496118_0000384 3300048921 Bacteria 74482
721 Ga0496118_0001557 3300048921 Bacteria 34088
722 Ga0496118_0012632 3300048921 Bacteria 8081
723 Ga0496118_0017872 3300048921 Bacteria 6433
724 Ga0496118_0037006 3300048921 Bacteria 3935
725 Ga0496118_0051567 3300048921 Bacteria 3146
726 Ga0496119_0000105 3300048922 Bacteria 119993
727 Ga0496119_0000606 3300048922 Bacteria 48440
728 Ga0496119_0000748 3300048922 Bacteria 43680
729 Ga0496119_0000942 3300048922 Bacteria 37503
730 Ga0496119_0003515 3300048922 Bacteria 16199
731 Ga0496119_0003913 3300048922 Bacteria 15134
732 Ga0496119_0006590 3300048922 Bacteria 10697
733 Ga0496119_0013225 3300048922 Bacteria 6597
734 Ga0496119_0014214 3300048922 Bacteria 6253
735 Ga0496119_0016199 3300048922 Bacteria 5693
736 Ga0496119_0017141 3300048922 Bacteria 5469
737 Ga0496119_0048063 3300048922 Bacteria 2649
738 Ga0496119_0076576 3300048922 Bacteria 1940
739 Ga0496120_0000013 3300048923 Bacteria 331109
740 Ga0496120_0000016 3300048923 Bacteria 307608
741 Ga0496120_0000217 3300048923 Bacteria 99402
742 Ga0496120_0000308 3300048923 Bacteria 81512
743 Ga0496120_0001434 3300048923 Bacteria 28732
744 Ga0496120_0002024 3300048923 Bacteria 22036
745 Ga0496120_0003312 3300048923 Bacteria 14796
746 Ga0496120_0014157 3300048923 Bacteria 5324
747 Ga0496120_0017818 3300048923 Bacteria 4590
748 Ga0496120_0036893 3300048923 Bacteria 2904
749 Ga0496120_0044801 3300048923 Bacteria 2568
750 Ga0496121_0000531 3300048924 Bacteria 72444
751 Ga0496121_0002595 3300048924 Bacteria 27283
752 Ga0496121_0008153 3300048924 Bacteria 12443
753 Ga0496121_0013651 3300048924 Bacteria 8708
754 Ga0496121_0024031 3300048924 Bacteria 5841
755 Ga0496121_0027721 3300048924 Bacteria 5294
756 Ga0496121_0046770 3300048924 Bacteria 3699
757 Ga0496121_0116053 3300048924 Bacteria 2031
758 Ga0496122_0000104 3300048925 Bacteria 195617
759 Ga0496122_0000441 3300048925 Bacteria 87041
760 Ga0496122_0001479 3300048925 Bacteria 37819
761 Ga0496122_0001663 3300048925 Bacteria 34489
762 Ga0496122_0008000 3300048925 Bacteria 11552
763 Ga0496122_0016924 3300048925 Bacteria 6851
764 Ga0496122_0018321 3300048925 Bacteria 6479
765 Ga0496122_0044424 3300048925 Bacteria 3467
766 Ga0496122_0049718 3300048925 Bacteria 3206
767 Ga0496122_0051031 3300048925 Bacteria 3148
768 Ga0496122_0078593 3300048925 Bacteria 2310
769 Ga0496123_0000060 3300048926 Bacteria 224015
770 Ga0496123_0000342 3300048926 Bacteria 87798
771 Ga0496123_0001369 3300048926 Bacteria 34241
772 Ga0496123_0001529 3300048926 Bacteria 31947
773 Ga0496123_0009004 3300048926 Bacteria 9056
774 Ga0496123_0009956 3300048926 Bacteria 8476
775 Ga0496123_0010076 3300048926 Bacteria 8409
776 Ga0496123_0014537 3300048926 Bacteria 6517
777 Ga0496123_0017255 3300048926 Bacteria 5819
778 Ga0496123_0023406 3300048926 Bacteria 4728
779 Ga0496124_0000092 3300048927 Bacteria 189213
780 Ga0496124_0000578 3300048927 Bacteria 61876
781 Ga0496124_0005071 3300048927 Bacteria 15020
782 Ga0496124_0007962 3300048927 Bacteria 11153
783 Ga0496124_0115640 3300048927 Bacteria 2152
784 Ga0496124_0175138 3300048927 Bacteria 1656
785 Ga0496125_0000103 3300048928 Bacteria 201675
786 Ga0496125_0004496 3300048928 Bacteria 16046
787 Ga0496125_0012969 3300048928 Bacteria 8228
788 Ga0496125_0015333 3300048928 Bacteria 7418
789 Ga0496125_0160247 3300048928 Bacteria 1529
790 Ga0496126_0000595 3300048929 Bacteria 68485
791 Ga0496126_0001015 3300048929 Bacteria 47751
792 Ga0496126_0001327 3300048929 Bacteria 39329
793 Ga0496126_0002274 3300048929 Bacteria 26481
794 Ga0496126_0004373 3300048929 Bacteria 16940
795 Ga0496126_0020389 3300048929 Bacteria 6501
796 Ga0496126_0025845 3300048929 Bacteria 5641
797 Ga0496126_0025931 3300048929 Bacteria 5628
798 Ga0496126_0107569 3300048929 Bacteria 2432
799 Ga0496126_0151035 3300048929 Bacteria 1991
800 Ga0496126_0270736 3300048929 Bacteria 1409
801 Ga0495678_000042 3300049459 Bacteria 174125
802 Ga0495678_000851 3300049459 Bacteria 27256
803 Ga0495678_004796 3300049459 Bacteria 7695
804 Ga0495678_008053 3300049459 Bacteria 5374
805 Ga0495678_023944 3300049459 Bacteria 2644
806 Ga0495682_0000005 3300049460 Bacteria 360387
807 Ga0495682_0005672 3300049460 Bacteria 5157
808 Ga0495682_0008727 3300049460 Bacteria 3988
809 Ga0501230_002225 3300049667 Bacteria 2450
810 Ga0501249_014021 3300049679 Bacteria 1706
811 Ga0501269_000091 3300049766 Bacteria 28366
812 Ga0501279_000517 3300049775 Bacteria 5073
813 Ga0501279_004804 3300049775 Bacteria 1775
814 nmdc:mga03n38_42233_c1 3300050490 Bacteria 1992
815 nmdc:mga00v17_2595_c1 3300050491 Bacteria 7591
816 nmdc:mga0k408_95_c1 3300050493 Bacteria 37179
817 Ga0500608_006237 3300053122 Bacteria 4836
818 Ga0500618_000008 3300053125 Bacteria 214678
819 Ga0500618_000172 3300053125 Bacteria 53899
820 Ga0500618_017365 3300053125 Bacteria 1791
821 Ga0500621_000012 3300053126 Bacteria 138999
822 Ga0500634_0000047 3300053161 Bacteria 55541
823 2508849961 2508501071 Bacteria 5454741
824 2511380186 2511231025 Bacteria 5324661
825 2511437547 2511231035 Bacteria 5341610
826 2538428623 2537561728 Bacteria 5149301
827 2555262312 2554235234 Bacteria 5762085
828 2597031810 2596583598 Bacteria 5251611
829 2599413300 2599185169 Bacteria 5441380
830 2599446508 2599185178 Bacteria 5365746
831 2601525954 2600255254 Bacteria 5281859
832 2601531029 2600255255 Bacteria 5282785
833 2601617846 2600255280 Bacteria 5292309
834 2601622880 2600255281 Bacteria 5288753
835 2601646374 2600255287 Bacteria 5210468
836 2601651264 2600255288 Bacteria 5282738
837 2601656220 2600255289 Bacteria 5281907
838 2601661243 2600255290 Bacteria 5282218
839 2601666356 2600255291 Bacteria 5217298
840 2601699331 2600255298 Bacteria 5215185
841 2601704226 2600255299 Bacteria 5218662
842 2601709068 2600255300 Bacteria 5287774
843 2601714117 2600255301 Bacteria 5280532
844 2601719151 2600255302 Bacteria 5288235
845 2601724161 2600255303 Bacteria 5219315
846 2601729073 2600255304 Bacteria 5283973
847 2601734115 2600255305 Bacteria 5282329
848 2601739101 2600255306 Bacteria 5281613
849 2601743872 2600255307 Bacteria 5439064
850 2601754715 2600255309 Bacteria 5431045
851 2602021886 2600255392 Bacteria 5437392
852 2603659109 2602042052 Bacteria 5215873
853 2603663984 2602042053 Bacteria 5214361
854 2603701633 2602042066 Bacteria 4423871
855 2603836443 2602042103 Bacteria 5284714
856 2603841523 2602042104 Bacteria 5281639
857 2603846594 2602042105 Bacteria 5282303
858 2603851666 2602042106 Bacteria 5282744
859 2603864588 2602042109 Bacteria 5152801
860 2603874334 2602042110 Bacteria 5283285
861 2603874629 2602042111 Bacteria 5212080
862 2606051513 2603880178 Bacteria 5283018
863 2606068431 2603880184 Bacteria 5217896
864 2606149198 2603880202 Bacteria 5284684
865 2606174330 2603880211 Bacteria 5284226
866 2608671479 2608642108 Bacteria 4104624
867 2609910887 2609459761 Bacteria 5513740
868 2637224607 2636415599 Bacteria 5718434
869 2643789494 2643221554 Bacteria 6603920
870 2643791530 2643221554 Bacteria 6603920
871 2643976653 2643221593 Bacteria 6296053
872 2644211382 2643221638 Bacteria 6579467
873 2644216048 2643221638 Bacteria 6579467
874 2644246410 2643221644 Bacteria 6865017
875 2644255149 2643221645 Bacteria 7207331
876 2644359067 2643221664 Bacteria 7272945
877 2671104805 2667528172 Bacteria 5170840
878 2671585146 2671180115 Bacteria 5353919
879 2676410095 2675903046 Bacteria 5451247
880 2681995014 2681812866 Bacteria 4552357
881 2682009518 2681812869 Bacteria 5014465
882 2712471758 2711768156 Bacteria 4471618
883 2738738509 2738541280 Bacteria 6630198
884 2738825210 2738541297 Bacteria 6549566
885 2738842689 2738541300 Bacteria 6675882
886 2739149007 2738541357 Bacteria 6549408
887 2739190926 2738543003 Bacteria 6549560
888 2739251856 2738543013 Bacteria 5618633
889 2739273437 2738543018 Bacteria 6718814
890 2739317403 2738543026 Bacteria 6549408
891 2739335644 2738543029 Bacteria 6549249
892 2739342481 2738543030 Bacteria 6719714
893 2748015585 2747842501 Bacteria 5293829
894 2753853910 2751185917 Bacteria 4551186
895 2765586807 2765235842 Bacteria 4799256
896 2777022987 2775507074 Bacteria 5532402
897 2821133803 2821131069 Bacteria 6108407
898 2823377995 2823373977 Bacteria 4779415
899 2842716737 2842711865 Bacteria 7155354
900 2842759315 2842757796 Bacteria 3981385
901 2844425500 2844425489 Bacteria 4854065
902 2854603226 2854601825 Bacteria 4797592
903 2855195653 2855195626 Bacteria 4927512
904 2857553913 2857553236 Bacteria 6166726
905 2857560295 2857558681 Bacteria 6617694
906 2857565595 2857564685 Bacteria 6290584
907 2858470438 2858466076 Bacteria 4722413
908 2871274747 2871272651 Bacteria 5042015
909 2871283410 2871282230 Bacteria 4917173
910 2876603563 2876601092 Bacteria 5114497
911 2885270317 2885266251 Bacteria 4796748
912 2888375734 2888373701 Bacteria 5098052
913 2894417640 2894414249 Bacteria 4405451
914 2895499116 2895498888 Bacteria 5283788
915 2895512137 2895511927 Bacteria 6802080
916 2895522146 2895522137 Bacteria 3284416
917 2895527408 2895525241 Bacteria 3388457
918 2900580959 2900577576 Bacteria 5438534
919 2904453302 2904449895 Bacteria 6927402
920 2904479132 2904474040 Bacteria 5504324
921 2904514460 2904513164 Bacteria 5476410
922 2919113565 2919108558 Bacteria 5897419
923 2919155436 2919150387 Bacteria 5500879
924 2919480528 2919476304 Bacteria 5888696
925 2923637307 2923634449 Bacteria 4753480
926 2927148850 2927143783 Bacteria 5504251
927 2927836261 2927833300 Bacteria 4923934
928 2928061571 2928058823 Bacteria 5520022
929 2935628695 2935625433 Bacteria 5042964
930 2939571913 2939568625 Bacteria 4542555
931 2939606482 2939602548 Bacteria 4950493
932 2939621000 2939617950 Bacteria 4820956
933 2939646230 2939642701 Bacteria 4475280
934 2945875255 2945874760 Bacteria 5527237
935 2969081650 2969079654 Bacteria 5439582
936 2971820978 2971820967 Bacteria 5823634
937 2974314323 2974310843 Bacteria 4947816
938 2974436189 2974435778 Bacteria 4876478
939 2984564064 2984559226 Bacteria 5683096
940 2984596798 2984595703 Bacteria 5682994
941 640935529 640753048 Bacteria 5495657
942 8016737907 8016733728 Bacteria 5274317
943 8018225586 8018221730 Bacteria 4616064
944 8018406388 8018405270 Bacteria 4978981
945 8019503732 8019499862 Bacteria 5169538
946 8019507043 8019504834 Bacteria 4819156
947 8054845111 8054844752 Bacteria 4450330
948 8054852549 8054849141 Bacteria 5232694
949 8055093439 8055092621 Bacteria 4873875
950 8055693950 8055693939 Bacteria 4772047
951 Ga0495643_0014701
952 JGI24741J21665_1000408
953 JGI24740J21852_10001196
954 JGI24740J21852_10002395
955 JGI24740J21852_10003713
956 JGI25158J39367_1000429
957 JGI25158J39367_1000753
958 JGI25163J39215_1000118
959 JGI25164J39214_1000302
960 JGI25152J39213_1000026
961 JGI25152J39213_1000153
962 JGI25150J39212_1000117
963 JGI25150J39212_1000280
964 JGI25150J39212_1013003
965 JGI25159J45721_1004491
966 JGI25159J45721_1005331
967 JGI25151J46595_10000148
968 JGI25151J46595_10000207
969 JGI25153J46596_10000146
970 JGI25153J46596_10004004
971 JGI25153J46596_10007834
972 rootH1_10018743
973 rootL2_10012396
974 JGI25161J50226_1000266
975 Ga0055538_1000217
976 Ga0055538_1002216
977 Ga0055538_1002256
978 Ga0055539_1000259
979 Ga0055539_1000443
980 Ga0055533_1000250
981 Ga0055533_1001778
982 Ga0055533_1003737
983 Ga0055532_1000008
984 Ga0055525_1000347
985 Ga0055525_1000500
986 Ga0055527_1002530
987 Ga0055535_1000006
988 Ga0055529_1000025
989 Ga0055526_1000020
990 Ga0055526_1000031
991 Ga0055526_1000487
992 Ga0055526_1000911
993 Ga0055537_1000035
994 Ga0055537_1010321
995 Ga0055537_1012918
996 Ga0055524_1000129
997 Ga0055524_1000322
998 Ga0055524_1000727
999 Ga0055524_1001062
1000 Ga0055524_1001522
1001 Ga0055524_1010727
1002 Ga0055534_1000325
1003 Ga0055534_1005326
1004 Ga0055534_1011124
1005 Ga0055528_1000058
1006 Ga0055530_10000037
1007 Ga0055530_10000499
1008 Ga0055530_10007754
1009 Ga0055530_10009349
1010 Ga0055531_10002721
1011 Ga0055541_1003489
1012 Ga0058692_1000122
1013 Ga0058692_1000871
1014 Ga0058692_1001369
1015 Ga0055543_1000339
1016 Ga0055543_1005717
1017 Ga0065165_1000224
1018 Ga0065165_1001110
1019 Ga0065704_10000581
1020 Ga0065704_10002543
1021 Ga0065704_10002719
1022 Ga0065704_10003295
1023 Ga0065704_10003831
1024 Ga0070666_10082178
1025 Ga0070661_100000417
1026 Ga0070661_100104382
1027 Ga0070667_100001671
1028 Ga0070678_100103219
1029 Ga0070662_100015699
1030 Ga0070681_10143255
1031 Ga0070685_10000588
1032 Ga0070679_100003714
1033 Ga0068853_100070789
1034 Ga0070665_100000057
1035 Ga0070665_100000160
1036 Ga0070665_100016979
1037 Ga0070665_100174268
1038 Ga0070664_100000001
1039 Ga0068857_100000013
1040 Ga0068857_100017469
1041 Ga0068857_100043166
1042 Ga0068854_100000060
1043 Ga0068854_100007812
1044 Ga0068856_100002389
1045 Ga0068856_100133320
1046 Ga0068858_100000741
1047 Ga0068860_100023779
1048 Ga0075364_10000771
1049 Ga0075364_10004224
1050 Ga0075364_10011667
1051 Ga0075364_10080678
1052 Ga0075364_10153041
1053 Ga0075366_10000439
1054 Ga0079104_1000036
1055 Ga0079104_1000122
1056 Ga0079104_1000203
1057 Ga0079104_1000437
1058 Ga0079104_1001827
1059 Ga0079104_1002423
1060 Ga0079104_1002630
1061 Ga0079104_1005598
1062 Ga0079104_1011891
1063 Ga0099826_10000001
1064 Ga0105251_10000277
1065 Ga0105251_10001409
1066 Ga0105251_10003581
1067 Ga0105251_10004348
1068 Ga0105251_10039575
1069 Ga0105244_10001959
1070 Ga0105244_10002307
1071 Ga0105244_10002367
1072 Ga0105244_10003041
1073 Ga0105244_10010955
1074 Ga0105250_10000855
1075 Ga0105250_10003442
1076 Ga0105250_10023228
1077 Ga0105240_10007862
1078 Ga0105240_10007892
1079 Ga0105240_10022027
1080 Ga0105240_10044181
1081 Ga0105240_10074091
1082 Ga0105240_10094914
1083 Ga0105240_10246122
1084 Ga0105243_10000259
1085 Ga0105237_10000774
1086 Ga0105238_10004980
1087 Ga0105249_10003765
1088 Ga0099796_10055307
1089 Ga0105239_10000480
1090 Ga0105239_10000644
1091 Ga0105246_10035707
1092 Ga0105246_10076771
1093 Ga0157373_10000646
1094 Ga0157373_10002943
1095 Ga0157373_10033962
1096 Ga0157373_10051163
1097 Ga0157373_10223152
1098 Ga0157371_10000404
1099 Ga0157371_10001363
1100 Ga0157371_10005803
1101 Ga0157371_10016673
1102 Ga0157371_10029511
1103 Ga0157371_10091166
1104 Ga0157370_10006219
1105 Ga0157370_10007229
1106 Ga0157370_10183156
1107 Ga0157369_10004570
1108 Ga0157369_10005312
1109 Ga0157369_10239450
1110 Ga0163162_10034844
1111 Ga0157372_10000062
1112 Ga0157372_10006644
1113 Ga0157372_10023640
1114 Ga0157372_10030390
1115 Ga0157372_10039194
1116 Ga0157372_10040945
1117 Ga0157372_10105763
1118 Ga0163163_10110438
1119 Ga0182008_10000147
1120 Ga0182006_1000212
1121 Ga0182006_1006900
1122 Ga0182006_1010041
1123 Ga0182007_10027739
1124 Ga0182005_1000018
1125 Ga0183366_1004
1126 Ga0183370_1004
1127 Ga0183369_1010
1128 Ga0183368_1008
1129 Ga0163161_10169939
1130 Ga0163161_10222672
1131 Ga0197907_10544216
1132 Ga0206351_10076999
1133 Ga0154015_1694190
1134 Ga0213872_10000654
1135 Ga0213872_10001316
1136 Ga0213872_10001452
1137 Ga0213872_10004382
1138 Ga0213872_10009443
1139 Ga0213876_10000049
1140 Ga0209760_100179
1141 Ga0209436_100178
1142 Ga0209436_100211
1143 Ga0209436_100684
1144 Ga0209784_100001
1145 Ga0209784_100063
1146 Ga0209566_100001
1147 Ga0209566_100048
1148 Ga0209566_102596
1149 Ga0209674_100002
1150 Ga0209674_100071
1151 Ga0209674_103236
1152 Ga0209672_100199
1153 Ga0209672_100339
1154 Ga0209147_100002
1155 Ga0209563_100002
1156 Ga0209563_100085
1157 Ga0207427_100032
1158 Ga0209437_100001
1159 Ga0209437_100092
1160 Ga0209258_100002
1161 Ga0207425_1000001
1162 Ga0207425_1000011
1163 Ga0207425_1000017
1164 Ga0207425_1000067
1165 Ga0207425_1000085
1166 Ga0207425_1001571
1167 Ga0207425_1005801
1168 Ga0209646_1000028
1169 Ga0209677_100002
1170 Ga0209677_100040
1171 Ga0209759_1002426
1172 Ga0209759_1009418
1173 Ga0209129_1000003
1174 Ga0209129_1000021
1175 Ga0209129_1000162
1176 Ga0209129_1000273
1177 Ga0209129_1002118
1178 Ga0209129_1005230
1179 Ga0209129_1013492
1180 Ga0209233_1001209
1181 Ga0209233_1001959
1182 Ga0209565_1000009
1183 Ga0209565_1000452
1184 Ga0209565_1000613
1185 Ga0209565_1000665
1186 Ga0209565_1001924
1187 Ga0209565_1002725
1188 Ga0209565_1003902
1189 Ga0209565_1004983
1190 Ga0209565_1005250
1191 Ga0209455_1000009
1192 Ga0209455_1000049
1193 Ga0209673_1000036
1194 Ga0209673_1007399
1195 Ga0209673_1015512
1196 Ga0209130_1000044
1197 Ga0209130_1000059
1198 Ga0209130_1000733
1199 Ga0209130_1000968
1200 Ga0209130_1003333
1201 Ga0209130_1005009
1202 Ga0209675_1000013
1203 Ga0209675_1000394
1204 Ga0209675_1001363
1205 Ga0209675_1001613
1206 Ga0209675_1007023
1207 Ga0209676_1006547
1208 Ga0209025_1000005
1209 Ga0209025_1000054
1210 Ga0209025_1007861
1211 Ga0209564_1000006
1212 Ga0209564_1000038
1213 Ga0209564_1000122
1214 Ga0209564_1000142
1215 Ga0209564_1005605
1216 Ga0209564_1007137
1217 Ga0209758_1000020
1218 Ga0209758_1000062
1219 Ga0209758_1000250
1220 Ga0209758_1000583
1221 Ga0209758_1007146
1222 Ga0209050_1000058
1223 Ga0209050_1000612
1224 Ga0209050_1000654
1225 Ga0209050_1001112
1226 Ga0209050_1001305
1227 Ga0209050_1001484
1228 Ga0209050_1010656
1229 Ga0209256_1000106
1230 Ga0209256_1000184
1231 Ga0209256_1000201
1232 Ga0209256_1000285
1233 Ga0209256_1000503
1234 Ga0209256_1000875
1235 Ga0209256_1002929
1236 Ga0207426_1002835
1237 Ga0207426_1005567
1238 Ga0209257_1000003
1239 Ga0209257_1000123
1240 Ga0209257_1002302
1241 Ga0209257_1004098
1242 Ga0207696_1000202
1243 Ga0207696_1000949
1244 Ga0207696_1002169
1245 Ga0207696_1007432
1246 Ga0207655_1000067
1247 Ga0207655_1000111
1248 Ga0207655_1000122
1249 Ga0207655_1000218
1250 Ga0207655_1001050
1251 Ga0207655_1002313
1252 Ga0207655_1004581
1253 Ga0207655_1005717
1254 Ga0207655_1029638
1255 Ga0207713_1000184
1256 Ga0207713_1000636
1257 Ga0207713_1000748
1258 Ga0207713_1002034
1259 Ga0207713_1002094
1260 Ga0207713_1004241
1261 Ga0207647_10000024
1262 Ga0207695_10000200
1263 Ga0207695_10001553
1264 Ga0207695_10002561
1265 Ga0207695_10029467
1266 Ga0207695_10077056
1267 Ga0207671_10021575
1268 Ga0207671_10270261
1269 Ga0207649_10000390
1270 Ga0207652_10083219
1271 Ga0207694_10011349
1272 Ga0207644_10250209
1273 Ga0207706_10001182
1274 Ga0207709_10000289
1275 Ga0207679_10000003
1276 Ga0207712_10000244
1277 Ga0207712_10000608
1278 Ga0207640_10000071
1279 Ga0207677_10137142
1280 Ga0207703_10000573
1281 Ga0207639_10013416
1282 Ga0207639_10030426
1283 Ga0207678_10000175
1284 Ga0207678_10028388
1285 Ga0207702_10000110
1286 Ga0207674_10000071
1287 Ga0207674_10011098
1288 Ga0207674_10079114
1289 Ga0207683_10144062
1290 Ga0209281_1000031
1291 Ga0209281_1000080
1292 Ga0209281_1000086
1293 Ga0209281_1000117
1294 Ga0209281_1000206
1295 Ga0209281_1000261
1296 Ga0209281_1000338
1297 Ga0209281_1001242
1298 Ga0209281_1002414
1299 Ga0209371_1000005
1300 Ga0209371_1000029
1301 Ga0209371_1000042
1302 Ga0209371_1000133
1303 Ga0209371_1000257
1304 Ga0209371_1001693
1305 Ga0209371_1002593
1306 Ga0209371_1003013
1307 Ga0209371_1011434
1308 Ga0209371_1017609
1309 Ga0209282_1000001
1310 Ga0268266_10000001
1311 Ga0268266_10000008
1312 Ga0268266_10000129
1313 Ga0268266_10052560
1314 Ga0268264_10035567
1315 Ga0307517_10006778
1316 Ga0307517_10105419
1317 Ga0307515_10000652
1318 Ga0268256_1000006
1319 Ga0268256_1000032
1320 Ga0268256_1000042
1321 Ga0268256_1000262
1322 Ga0268256_1001353
1323 Ga0268256_1001716
1324 Ga0268256_1001932
1325 Ga0268256_1004434
1326 Ga0268256_1008802
1327 Ga0268256_1009719
1328 Ga0268256_1015762
1329 Ga0268256_1016889
1330 Ga0307511_10000875
1331 Ga0307511_10004090
1332 Ga0307512_10051335
1333 Ga0316180_1052418
1334 Ga0316182_1325361
1335 Ga0307513_10206262
1336 Ga0307513_10323942
1337 Ga0307509_10002463
1338 Ga0307509_10009159
1339 Ga0307408_100000016
1340 Ga0307408_100000082
1341 Ga0307408_100000194
1342 Ga0307408_100001091
1343 Ga0307408_100004846
1344 Ga0307508_10131442
1345 Ga0307514_10002227
1346 Ga0307514_10077067
1347 Ga0265314_10009564
1348 Ga0307516_10000348
1349 Ga0307416_100000733
1350 Ga0307510_10003186
1351 Ga0307510_10015746
1352 Ga0373939_0000113
1353 Ga0373960_0000857
1354 Ga0373931_0002626
1355 Ga0395899_0000012
1356 Ga0395900_0051003
1357 Ga0395905_0010150
1358 Ga0395905_0013852
1359 Ga0395901_0056740
1360 Ga0237819_00016
1361 Ga0436365_0245969
1362 Ga0436361_0080811
1363 Ga0436361_0810533
1364 Ga0436361_0821396
1365 Ga0439438_001391
1366 Ga0439447_002006
1367 Ga0451798_0664110
1368 Ga0439452_000012
1369 Ga0439452_000076
1370 Ga0439452_000494
1371 Ga0450900_003287
1372 Ga0439464_0015981
1373 Ga0450918_000309
1374 Ga0466972_0000331
1375 Ga0466981_0000020
1376 Ga0466965_0024779
1377 Ga0466965_0072550
1378 Ga0466966_0014028
1379 Ga0466961_0004626
1380 Ga0466968_0007269
1381 Ga0466968_0017600
1382 Ga0466957_0042727
1383 Ga0466960_0048075
1384 Ga0466960_0169611
1385 Ga0495617_000007
1386 Ga0495617_000460
1387 Ga0495617_000570
1388 Ga0495617_000947
1389 Ga0495627_000006
1390 Ga0495590_0000004
1391 Ga0495591_000095
1392 Ga0495591_000126
1393 Ga0495591_001567
1394 Ga0495638_0000366
1395 Ga0495638_0002123
1396 Ga0495638_0002285
1397 Ga0495638_0074618
1398 Ga0495638_0083629
1399 Ga0495653_0000037
1400 Ga0495653_0197745
1401 Ga0495650_0000094
1402 Ga0495650_0000126
1403 Ga0495650_0000169
1404 Ga0495650_0000177
1405 Ga0495650_0000256
1406 Ga0495650_0000421
1407 Ga0495650_0003963
1408 Ga0495605_0000003
1409 Ga0495605_0000239
1410 Ga0495584_0000001
1411 Ga0495584_0000144
1412 Ga0495584_0001913
1413 Ga0495584_0065214
1414 Ga0495585_0000002
1415 Ga0495585_0000026
1416 Ga0495585_0000922
1417 Ga0495585_0000984
1418 Ga0495585_0001182
1419 Ga0495585_0007599
1420 Ga0495585_0007857
1421 Ga0495585_0050822
1422 Ga0495585_0070416
1423 Ga0495585_0189029
1424 Ga0495594_0021495
1425 Ga0495596_0000149
1426 Ga0495596_0003827
1427 Ga0495596_0004037
1428 Ga0495596_0009020
1429 Ga0495607_0000423
1430 Ga0495607_0002599
1431 Ga0495607_0002760
1432 Ga0495607_0005270
1433 Ga0495607_0006087
1434 Ga0495607_0009553
1435 Ga0495607_0078202
1436 Ga0495583_0000008
1437 Ga0495583_0000009
1438 Ga0495583_0000021
1439 Ga0495583_0000431
1440 Ga0495583_0000508
1441 Ga0495583_0020905
1442 Ga0495583_0029448
1443 Ga0495583_0045912
1444 Ga0495606_0000024
1445 Ga0495606_0000069
1446 Ga0495606_0000268
1447 Ga0495606_0002135
1448 Ga0495606_0003645
1449 Ga0495606_0004126
1450 Ga0495606_0009070
1451 Ga0495606_0012997
1452 Ga0495606_0032074
1453 Ga0495606_0072980
1454 Ga0495610_0000004
1455 Ga0495610_0000688
1456 Ga0495610_0001096
1457 Ga0495610_0001354
1458 Ga0495610_0083542
1459 Ga0495616_0000616
1460 Ga0495616_0002987
1461 Ga0495616_0005767
1462 Ga0495616_0006740
1463 Ga0495616_0009497
1464 Ga0495616_0028253
1465 Ga0495616_0030102
1466 Ga0495620_0001761
1467 Ga0495620_0011071
1468 Ga0495631_0003073
1469 Ga0495631_0009757
1470 Ga0495631_0011449
1471 Ga0495631_0098547
1472 Ga0495632_0001138
1473 Ga0495632_0024916
1474 Ga0495637_0001417
1475 Ga0495637_0020431
1476 Ga0495643_0000182
1477 Ga0495643_0000383
1478 Ga0495643_0000425
1479 Ga0495643_0000695
1480 Ga0495643_0040750
1481 Ga0495644_0000347
1482 Ga0495644_0003130
1483 Ga0495644_0003727
1484 Ga0495644_0006940
1485 Ga0495648_0000012
1486 Ga0495648_0000045
1487 Ga0495648_0001995
1488 Ga0495648_0002014
1489 Ga0495648_0003262
1490 Ga0495648_0009843
1491 Ga0495648_0013578
1492 Ga0495648_0066573
1493 Ga0495648_0081834
1494 Ga0495663_0002406
1495 Ga0495663_0006313
1496 Ga0495663_0026773
1497 Ga0495666_0018861
1498 Ga0495642_0003014
1499 Ga0495642_0003809
1500 Ga0495642_0007287
1501 Ga0495642_0015571
1502 Ga0495642_0020660
1503 Ga0495654_0000004
1504 Ga0495654_0000072
1505 Ga0495654_0000133
1506 Ga0495654_0000208
1507 Ga0495654_0002518
1508 Ga0495654_0003249
1509 Ga0495654_0007878
1510 Ga0495665_0006893
1511 Ga0495586_0046147
1512 Ga0495587_0015764
1513 Ga0495609_0000771
1514 Ga0495609_0001220
1515 Ga0495609_0001731
1516 Ga0495609_0002003
1517 Ga0495609_0009992
1518 Ga0495609_0020942
1519 Ga0495609_0022955
1520 Ga0495597_0000434
1521 Ga0495597_0001158
1522 Ga0495597_0002890
1523 Ga0495597_0003565
1524 Ga0495622_0000003
1525 Ga0495622_0000489
1526 Ga0495622_0006038
1527 Ga0495633_0000356
1528 Ga0495633_0000522
1529 Ga0495633_0004410
1530 Ga0495633_0010220
1531 Ga0495633_0013669
1532 Ga0495633_0014930
1533 Ga0495633_0039794
1534 Ga0495633_0100007
1535 Ga0495656_0003608
1536 Ga0495656_0055091
1537 Ga0495668_0000025
1538 Ga0495668_0000307
1539 Ga0495668_0000764
1540 Ga0495668_0001108
1541 Ga0495668_0001920
1542 Ga0495668_0040672
1543 Ga0495611_0009567
1544 Ga0495611_0014075
1545 Ga0495611_0018688
1546 Ga0495611_0041778
1547 Ga0495625_0001394
1548 Ga0495625_0001654
1549 Ga0495625_0001834
1550 Ga0495625_0013019
1551 Ga0495625_0016949
1552 Ga0495625_0125329
1553 Ga0495625_0158286
1554 Ga0495659_0000091
1555 Ga0495659_0000414
1556 Ga0495659_0003001
1557 Ga0495659_0017389
1558 Ga0495661_0000130
1559 Ga0495661_0000296
1560 Ga0495661_0008417
1561 Ga0495661_0015865
1562 Ga0495661_0036020
1563 Ga0495661_0074485
1564 Ga0495661_0080739
1565 Ga0495661_0117611
1566 Ga0495588_0000083
1567 Ga0495669_0005645
1568 Ga0495670_0000812
1569 Ga0495670_0006970
1570 Ga0495670_0014039
1571 Ga0495671_0000001
1572 Ga0495671_0000246
1573 Ga0495671_0037425
1574 Ga0495671_0097571
1575 Ga0495649_0000053
1576 Ga0495649_0004130
1577 Ga0495649_0008166
1578 Ga0495649_0023194
1579 Ga0495649_0034037
1580 Ga0495649_0061273
1581 Ga0495589_0000022
1582 Ga0495589_0000076
1583 Ga0495589_0038137
1584 Ga0495589_0086496
1585 Ga0495660_0000028
1586 Ga0495660_0000044
1587 Ga0495660_0000051
1588 Ga0495660_0000914
1589 Ga0495660_0002115
1590 Ga0495660_0005694
1591 Ga0495660_0006366
1592 Ga0495660_0018634
1593 Ga0495660_0021987
1594 Ga0495660_0055889
1595 Ga0495581_0020359
1596 Ga0495604_0028592
1597 Ga0495636_0000101
1598 Ga0495636_0000430
1599 Ga0495636_0002862
1600 Ga0495672_0000011
1601 Ga0495672_0000026
1602 Ga0495672_0000039
1603 Ga0495672_0000154
1604 Ga0495672_0001702
1605 Ga0495672_0034255
1606 Ga0495676_0036890
1607 Ga0495683_0000009
1608 Ga0495683_0001547
1609 Ga0495683_0006154
1610 Ga0495683_0006907
1611 Ga0495683_0013607
1612 Ga0495683_0030559
1613 Ga0495687_000099
1614 Ga0495687_000245
1615 Ga0495687_001356
1616 Ga0495687_001959
1617 Ga0495687_035568
1618 Ga0495675_0064341
1619 Ga0495677_0000319
1620 Ga0495677_0002770
1621 Ga0495677_0006013
1622 Ga0495677_0017575
1623 Ga0495677_0021168
1624 Ga0495679_000016
1625 Ga0495679_005316
1626 Ga0495685_000045
1627 Ga0495685_003874
1628 Ga0495685_006938
1629 Ga0495673_0000006
1630 Ga0495673_0000014
1631 Ga0495673_0000017
1632 Ga0495673_0000020
1633 Ga0495673_0000137
1634 Ga0495681_0003829
1635 Ga0495681_0004629
1636 Ga0495681_0014546
1637 Ga0495681_0076979
1638 Ga0495686_0032960
1639 Ga0495686_0034396
1640 Ga0495626_0000014
1641 Ga0495626_0000021
1642 Ga0495626_0002580
1643 Ga0495626_0004663
1644 Ga0495626_0007450
1645 Ga0495626_0027947
1646 Ga0495626_0030215
1647 Ga0496101_0000063
1648 Ga0496102_0001073
1649 Ga0496103_0020776
1650 Ga0496105_0079474
1651 Ga0496107_0038364
1652 Ga0496114_0004140
1653 Ga0496116_0000147
1654 Ga0496116_0001013
1655 Ga0496116_0001377
1656 Ga0496116_0019647
1657 Ga0496116_0020112
1658 Ga0496116_0032380
1659 Ga0496116_0036256
1660 Ga0496116_0078490
1661 Ga0496117_0000306
1662 Ga0496117_0002498
1663 Ga0496117_0009407
1664 Ga0496117_0009676
1665 Ga0496117_0015996
1666 Ga0496117_0017021
1667 Ga0496117_0035095
1668 Ga0496117_0039174
1669 Ga0496117_0043737
1670 Ga0496118_0000384
1671 Ga0496118_0001557
1672 Ga0496118_0012632
1673 Ga0496118_0017872
1674 Ga0496118_0037006
1675 Ga0496118_0051567
1676 Ga0496119_0000105
1677 Ga0496119_0000606
1678 Ga0496119_0000748
1679 Ga0496119_0000942
1680 Ga0496119_0003515
1681 Ga0496119_0003913
1682 Ga0496119_0006590
1683 Ga0496119_0013225
1684 Ga0496119_0014214
1685 Ga0496119_0016199
1686 Ga0496119_0017141
1687 Ga0496119_0048063
1688 Ga0496119_0076576
1689 Ga0496120_0000013
1690 Ga0496120_0000016
1691 Ga0496120_0000217
1692 Ga0496120_0000308
1693 Ga0496120_0001434
1694 Ga0496120_0002024
1695 Ga0496120_0003312
1696 Ga0496120_0014157
1697 Ga0496120_0017818
1698 Ga0496120_0036893
1699 Ga0496120_0044801
1700 Ga0496121_0000531
1701 Ga0496121_0002595
1702 Ga0496121_0008153
1703 Ga0496121_0013651
1704 Ga0496121_0024031
1705 Ga0496121_0027721
1706 Ga0496121_0046770
1707 Ga0496121_0116053
1708 Ga0496122_0000104
1709 Ga0496122_0000441
1710 Ga0496122_0001479
1711 Ga0496122_0001663
1712 Ga0496122_0008000
1713 Ga0496122_0016924
1714 Ga0496122_0018321
1715 Ga0496122_0044424
1716 Ga0496122_0049718
1717 Ga0496122_0051031
1718 Ga0496122_0078593
1719 Ga0496123_0000060
1720 Ga0496123_0000342
1721 Ga0496123_0001369
1722 Ga0496123_0001529
1723 Ga0496123_0009004
1724 Ga0496123_0009956
1725 Ga0496123_0010076
1726 Ga0496123_0014537
1727 Ga0496123_0017255
1728 Ga0496123_0023406
1729 Ga0496124_0000092
1730 Ga0496124_0000578
1731 Ga0496124_0005071
1732 Ga0496124_0007962
1733 Ga0496124_0115640
1734 Ga0496124_0175138
1735 Ga0496125_0000103
1736 Ga0496125_0004496
1737 Ga0496125_0012969
1738 Ga0496125_0015333
1739 Ga0496125_0160247
1740 Ga0496126_0000595
1741 Ga0496126_0001015
1742 Ga0496126_0001327
1743 Ga0496126_0002274
1744 Ga0496126_0004373
1745 Ga0496126_0020389
1746 Ga0496126_0025845
1747 Ga0496126_0025931
1748 Ga0496126_0107569
1749 Ga0496126_0151035
1750 Ga0496126_0270736
1751 Ga0495678_000042
1752 Ga0495678_000851
1753 Ga0495678_004796
1754 Ga0495678_008053
1755 Ga0495678_023944
1756 Ga0495682_0000005
1757 Ga0495682_0005672
1758 Ga0495682_0008727
1759 Ga0501230_002225
1760 Ga0501249_014021
1761 Ga0501269_000091
1762 Ga0501279_000517
1763 Ga0501279_004804
1764 nmdc:mga03n38_42233_c1
1765 nmdc:mga00v17_2595_c1
1766 nmdc:mga0k408_95_c1
1767 Ga0500608_006237
1768 Ga0500618_000008
1769 Ga0500618_000172
1770 Ga0500618_017365
1771 Ga0500621_000012
1772 Ga0500634_0000047
1773 2508849961
1774 2511380186
1775 2511437547
1776 2538428623
1777 2555262312
1778 2597031810
1779 2599413300
1780 2599446508
1781 2601525954
1782 2601531029
1783 2601617846
1784 2601622880
1785 2601646374
1786 2601651264
1787 2601656220
1788 2601661243
1789 2601666356
1790 2601699331
1791 2601704226
1792 2601709068
1793 2601714117
1794 2601719151
1795 2601724161
1796 2601729073
1797 2601734115
1798 2601739101
1799 2601743872
1800 2601754715
1801 2602021886
1802 2603659109
1803 2603663984
1804 2603701633
1805 2603836443
1806 2603841523
1807 2603846594
1808 2603851666
1809 2603864588
1810 2603874334
1811 2603874629
1812 2606051513
1813 2606068431
1814 2606149198
1815 2606174330
1816 2608671479
1817 2609910887
1818 2637224607
1819 2643789494
1820 2643791530
1821 2643976653
1822 2644211382
1823 2644216048
1824 2644246410
1825 2644255149
1826 2644359067
1827 2671104805
1828 2671585146
1829 2676410095
1830 2681995014
1831 2682009518
1832 2712471758
1833 2738738509
1834 2738825210
1835 2738842689
1836 2739149007
1837 2739190926
1838 2739251856
1839 2739273437
1840 2739317403
1841 2739335644
1842 2739342481
1843 2748015585
1844 2753853910
1845 2765586807
1846 2777022987
1847 2821133803
1848 2823377995
1849 2842716737
1850 2842759315
1851 2844425500
1852 2854603226
1853 2855195653
1854 2857553913
1855 2857560295
1856 2857565595
1857 2858470438
1858 2871274747
1859 2871283410
1860 2876603563
1861 2885270317
1862 2888375734
1863 2894417640
1864 2895499116
1865 2895512137
1866 2895522146
1867 2895527408
1868 2900580959
1869 2904453302
1870 2904479132
1871 2904514460
1872 2919113565
1873 2919155436
1874 2919480528
1875 2923637307
1876 2927148850
1877 2927836261
1878 2928061571
1879 2935628695
1880 2939571913
1881 2939606482
1882 2939621000
1883 2939646230
1884 2945875255
1885 2969081650
1886 2971820978
1887 2974314323
1888 2974436189
1889 2984564064
1890 2984596798
1891 640935529
1892 8016737907
1893 8018225586
1894 8018406388
1895 8019503732
1896 8019507043
1897 8054845111
1898 8054852549
1899 8055093439
1900 8055693950

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

10

107

0.97

PF13378

MR_MLE_C

Enolase C-terminal domain-like

112

328

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rr1-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9335 2 382
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9326 2 382
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9311 1 382
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9306 2 382
3rr1-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9238 2 382
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9644 1 105 3.30.390.10
4jn8A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.951 1 98 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9467 1 105 3.30.390.10
4ggbA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9313 1 99 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9223 2 98 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A378B4F3-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.9609 1 241 GO:0008869
GO:0009063
AF-S6V6Z6-F1-model_v4 Galactonate dehydratase 0.9527 1 211 GO:0009063
GO:0016829
AF-A0A378B4F3-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.9494 1 241 GO:0008869
GO:0009063
AF-S6V6Z6-F1-model_v4 Galactonate dehydratase 0.9484 1 211 GO:0009063
GO:0016829
AF-A0A0A2W2Y1-F1-model_v4 D-galactonate dehydratase 0.9382 2 382 GO:0003677
GO:0003700
GO:0008671
GO:0008869
GO:0009063
GO:0034194

Map