F486569

General Info

Members Datasets Scaffolds Average Seq Length
950 570 1900 267

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_056431|Ga0500595_056431_102_1034
Length 310
Sequence MLSCPAKAGHRVSVAARIIARVARLHRPVELGDDVRKIKWSVPTMQDLMKGKRGLIMGIANDHSIAWGIAKALATQGAELAFSYQGEAQSKRLKPLVQPFGFDIVLPCDVEDIASVDQMFAALRERWDRLDFLVHAIGFTEKNELRGRYADTTRENFSRTMLISCFSFTEIAKRAAGMMPATGGSMITLTYGASMRAMPNYNVMGVAKAALEASVRYLAADFGPQGVRVNAISAGPVRTLAGSVIGDARAMFAFQQKHSPLGRGVTLDELGGSALYLLSDLAGGVTGEIHYVDSGYNIVLQPRPENMAPE

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
95 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
226 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
356 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
361 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
362 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
363 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
364 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
365 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
366 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
372 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
373 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
376 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
377 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
380 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
381 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
382 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
383 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
384 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
385 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
386 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
387 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
388 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
389 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
390 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
391 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
392 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
393 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
394 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
395 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
396 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
397 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
398 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
399 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
400 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
401 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
402 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
403 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
404 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
405 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
406 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
407 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
408 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
409 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
410 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
411 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
412 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
413 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
414 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
415 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
416 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
417 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
418 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
419 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
420 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
421 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
422 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
423 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
424 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
425 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
426 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
427 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
428 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
429 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
430 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
431 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
432 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
433 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
434 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
435 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
436 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
437 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
438 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
439 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
440 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
441 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
442 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
443 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
444 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
445 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
446 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
447 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
448 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
449 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
450 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
451 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
452 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
453 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
454 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
455 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
456 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
457 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
458 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
459 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
460 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
461 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
462 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
463 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
464 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
465 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
466 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
467 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
468 2922368715
469 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
470 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
471 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
472 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
473 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
474 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
475 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
476 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
477 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
478 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
479 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
480 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
481 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
482 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
483 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
484 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
485 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
486 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
487 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
488 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
489 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
490 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
491 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
492 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
493 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
494 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
495 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
496 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
497 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
498 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
499 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
500 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
501 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
502 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
503 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
504 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
505 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
506 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
507 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
508 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
516 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
517 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
518 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
519 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
520 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
521 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
522 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
523 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
524 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
525 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
526 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
527 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
528 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
529 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
530 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
531 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
532 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
533 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
534 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
535 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
536 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
537 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
538 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
539 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
540 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
541 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
542 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
543 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
544 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
545 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
548 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
549 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
550 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
551 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
552 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
553 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
554 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
555 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
556 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
557 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
558 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
559 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
560 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
561 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
562 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
563 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
564 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
565 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
566 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
567 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
568 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
569 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
570 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.66
Metatranscriptomes 0.32
Isolates 20.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.32
Nodule 16.42
Rhizoplane 7.37
Rhizosphere 57.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_056431 3300053119 Bacteria 1200
2 JGI25153J46596_10003121 3300003215 Bacteria 9344
3 JGI25153J46596_10003625 3300003215 Bacteria 8573
4 JGI25153J46596_10005115 3300003215 Bacteria 6918
5 JGI25153J46596_10010926 3300003215 Bacteria 4058
6 JGI25160J50197_1001001 3300003354 Bacteria 14647
7 JGI25160J50197_1003544 3300003354 Bacteria 6950
8 Ga0055531_10003282 3300003794 Bacteria 10366
9 Ga0055543_1003105 3300004625 Bacteria 5088
10 Ga0055543_1012639 3300004625 Bacteria 1689
11 Ga0065165_1006509 3300005262 Bacteria 6097
12 Ga0065165_1007472 3300005262 Bacteria 5358
13 Ga0065715_10303924 3300005293 Bacteria 1035
14 Ga0070658_10029625 3300005327 Bacteria 4398
15 Ga0070658_10065949 3300005327 Bacteria 2956
16 Ga0070658_10086288 3300005327 Bacteria 2582
17 Ga0070676_10283124 3300005328 Bacteria 1118
18 Ga0070683_100019421 3300005329 Bacteria 6036
19 Ga0070683_100037636 3300005329 Bacteria 4429
20 Ga0070683_100082862 3300005329 Bacteria 3004
21 Ga0070683_100201118 3300005329 Bacteria 1892
22 Ga0068869_100184781 3300005334 Bacteria 1636
23 Ga0070666_10067804 3300005335 Bacteria 2423
24 Ga0070666_10137472 3300005335 Bacteria 1701
25 Ga0070680_100005994 3300005336 Bacteria 9221
26 Ga0070680_100023189 3300005336 Bacteria 4948
27 Ga0070680_100038993 3300005336 Bacteria 3843
28 Ga0070680_100409143 3300005336 Bacteria 1157
29 Ga0070682_100099940 3300005337 Bacteria 1913
30 Ga0068868_100006519 3300005338 Bacteria 8266
31 Ga0070660_100009116 3300005339 Bacteria 6963
32 Ga0070689_100017799 3300005340 Bacteria 5224
33 Ga0070691_10119312 3300005341 Bacteria 1327
34 Ga0070661_100230067 3300005344 Bacteria 1424
35 Ga0070675_100066168 3300005354 Bacteria 2989
36 Ga0070671_100082907 3300005355 Bacteria 2682
37 Ga0070671_100438802 3300005355 Bacteria 1119
38 Ga0070673_100179111 3300005364 Bacteria 1814
39 Ga0070688_100013010 3300005365 Bacteria 4682
40 Ga0070688_100354506 3300005365 Bacteria 1075
41 Ga0070667_100184122 3300005367 Bacteria 1848
42 Ga0070709_10408689 3300005434 Bacteria 1015
43 Ga0070710_10071421 3300005437 Bacteria 2002
44 Ga0070711_100048433 3300005439 Bacteria 2906
45 Ga0070711_100048890 3300005439 Bacteria 2894
46 Ga0070711_100093270 3300005439 Bacteria 2174
47 Ga0070711_100102626 3300005439 Bacteria 2083
48 Ga0070700_100133379 3300005441 Bacteria 1679
49 Ga0070663_100117697 3300005455 Bacteria 2004
50 Ga0070678_100149557 3300005456 Bacteria 1879
51 Ga0070681_10013547 3300005458 Bacteria 8109
52 Ga0070681_10020781 3300005458 Bacteria 6576
53 Ga0070681_10155095 3300005458 Bacteria 2215
54 Ga0070685_10189807 3300005466 Bacteria 1328
55 Ga0070679_100054647 3300005530 Bacteria 3976
56 Ga0070679_100337085 3300005530 Bacteria 1456
57 Ga0070684_100012686 3300005535 Bacteria 6762
58 Ga0070684_100055646 3300005535 Bacteria 3450
59 Ga0070684_100061498 3300005535 Bacteria 3287
60 Ga0070697_100000586 3300005536 Bacteria 27495
61 Ga0068853_100007407 3300005539 Bacteria 8778
62 Ga0068853_100191638 3300005539 Bacteria 1857
63 Ga0068853_100475340 3300005539 Bacteria 1178
64 Ga0070665_100078771 3300005548 Bacteria 3302
65 Ga0070704_100124084 3300005549 Bacteria 1989
66 Ga0068855_100317504 3300005563 Bacteria 1723
67 Ga0068855_100526079 3300005563 Bacteria 1282
68 Ga0068855_100628085 3300005563 Bacteria 1156
69 Ga0068855_100722856 3300005563 Bacteria 1064
70 Ga0070664_100431590 3300005564 Bacteria 1208
71 Ga0070664_100439030 3300005564 Bacteria 1197
72 Ga0068857_100015264 3300005577 Bacteria 6704
73 Ga0068857_100106530 3300005577 Bacteria 2518
74 Ga0068854_100129752 3300005578 Bacteria 1923
75 Ga0068856_100019802 3300005614 Bacteria 6532
76 Ga0068856_100025298 3300005614 Bacteria 5786
77 Ga0068856_100064181 3300005614 Bacteria 3629
78 Ga0068852_100011334 3300005616 Bacteria 6707
79 Ga0068852_100735459 3300005616 Bacteria 998
80 Ga0068864_100024902 3300005618 Bacteria 5034
81 Ga0068864_100072754 3300005618 Bacteria 2997
82 Ga0068864_100583628 3300005618 Bacteria 1083
83 Ga0068866_10025845 3300005718 Bacteria 2766
84 Ga0068851_10192968 3300005834 Bacteria 1133
85 Ga0068863_100287447 3300005841 Bacteria 1594
86 Ga0068858_100051636 3300005842 Bacteria 3804
87 Ga0068858_100379450 3300005842 Bacteria 1356
88 Ga0068858_100544947 3300005842 Bacteria 1123
89 Ga0068860_100001623 3300005843 Bacteria 24139
90 Ga0068860_100100464 3300005843 Bacteria 2760
91 Ga0068862_100412492 3300005844 Bacteria 1266
92 Ga0068862_100640029 3300005844 Bacteria 1025
93 Ga0081455_10002724 3300005937 Bacteria 20860
94 Ga0081538_10073681 3300005981 Bacteria 1864
95 Ga0081540_1005028 3300005983 Bacteria 9926
96 Ga0081540_1097565 3300005983 Bacteria 1275
97 Ga0081540_1148590 3300005983 Bacteria 928
98 Ga0070717_10013327 3300006028 Bacteria 6296
99 Ga0075365_10087924 3300006038 Bacteria 2113
100 Ga0075365_10324439 3300006038 Bacteria 1084
101 Ga0075368_10028712 3300006042 Bacteria 2150
102 Ga0075363_100046693 3300006048 Bacteria 2299
103 Ga0075363_100058425 3300006048 Bacteria 2072
104 Ga0075364_10016682 3300006051 Bacteria 4572
105 Ga0075364_10110569 3300006051 Bacteria 1833
106 Ga0070715_10188242 3300006163 Bacteria 1040
107 Ga0070716_100113562 3300006173 Bacteria 1683
108 Ga0070712_100152731 3300006175 Bacteria 1774
109 Ga0070712_100170594 3300006175 Bacteria 1688
110 Ga0075367_10016821 3300006178 Bacteria 4000
111 Ga0075367_10018650 3300006178 Bacteria 3832
112 Ga0075367_10033232 3300006178 Bacteria 2972
113 Ga0075366_10002189 3300006195 Bacteria 9977
114 Ga0075366_10010105 3300006195 Bacteria 5291
115 Ga0097621_100156763 3300006237 Bacteria 1955
116 Ga0097621_100177899 3300006237 Bacteria 1837
117 Ga0075370_10145107 3300006353 Bacteria 1389
118 Ga0075370_10182249 3300006353 Bacteria 1236
119 Ga0075434_100334058 3300006871 Bacteria 1536
120 Ga0075436_100040321 3300006914 Bacteria 3223
121 Ga0099824_1031610 3300006942 Bacteria 1988
122 Ga0099823_1022934 3300006944 Bacteria 5747
123 Ga0105240_10002261 3300009093 Bacteria 31223
124 Ga0105240_10062622 3300009093 Bacteria 4630
125 Ga0105245_10013837 3300009098 Bacteria 7028
126 Ga0105245_10043050 3300009098 Bacteria 4028
127 Ga0105247_10054065 3300009101 Bacteria 2478
128 Ga0114129_10271364 3300009147 Bacteria 2269
129 Ga0105241_10029766 3300009174 Bacteria 4076
130 Ga0105241_10046596 3300009174 Bacteria 3293
131 Ga0105241_10560854 3300009174 Bacteria 1027
132 Ga0105242_10109173 3300009176 Bacteria 2356
133 Ga0105242_10229813 3300009176 Bacteria 1662
134 Ga0105242_10426952 3300009176 Bacteria 1243
135 Ga0105248_10041110 3300009177 Bacteria 5183
136 Ga0105248_10138209 3300009177 Bacteria 2748
137 Ga0105248_10175253 3300009177 Bacteria 2417
138 Ga0105248_10215497 3300009177 Bacteria 2163
139 Ga0105237_10003763 3300009545 Bacteria 17858
140 Ga0105237_10145812 3300009545 Bacteria 2362
141 Ga0105237_10174664 3300009545 Bacteria 2149
142 Ga0105237_10273079 3300009545 Bacteria 1693
143 Ga0105237_10579255 3300009545 Bacteria 1129
144 Ga0105237_10659413 3300009545 Bacteria 1053
145 Ga0105238_10015969 3300009551 Bacteria 7597
146 Ga0105238_10069807 3300009551 Bacteria 3514
147 Ga0105238_10193609 3300009551 Bacteria 2009
148 Ga0105238_10371555 3300009551 Bacteria 1420
149 Ga0105239_10023195 3300010375 Bacteria 6839
150 Ga0105239_10094285 3300010375 Bacteria 3306
151 Ga0105239_10216930 3300010375 Bacteria 2145
152 Ga0105246_10325764 3300011119 Bacteria 1250
153 Ga0105246_10372420 3300011119 Bacteria 1177
154 Ga0105246_10403074 3300011119 Bacteria 1136
155 Ga0157370_10035814 3300013104 Bacteria 4820
156 Ga0157370_10159270 3300013104 Bacteria 2101
157 Ga0157370_10317136 3300013104 Bacteria 1438
158 Ga0157369_10053722 3300013105 Bacteria 4352
159 Ga0157369_10106099 3300013105 Bacteria 2990
160 Ga0157374_10003265 3300013296 Bacteria 13623
161 Ga0157374_10040674 3300013296 Bacteria 4282
162 Ga0157378_10451639 3300013297 Bacteria 1276
163 Ga0163162_10081555 3300013306 Bacteria 3305
164 Ga0163162_10268331 3300013306 Bacteria 1838
165 Ga0157372_10350627 3300013307 Bacteria 1720
166 Ga0157372_10484785 3300013307 Bacteria 1441
167 Ga0157375_10144815 3300013308 Bacteria 2506
168 Ga0157375_10682301 3300013308 Bacteria 1182
169 Ga0163163_10013126 3300014325 Bacteria 7568
170 Ga0163163_10036751 3300014325 Bacteria 4759
171 Ga0163163_10193639 3300014325 Bacteria 2081
172 Ga0163163_10475585 3300014325 Bacteria 1310
173 Ga0157376_10064439 3300014969 Bacteria 3091
174 Ga0157376_10577463 3300014969 Bacteria 1116
175 Ga0182007_10047038 3300015262 Bacteria 1427
176 Ga0197907_10378139 3300020069 Bacteria 2098
177 Ga0214544_1000056 3300021320 Bacteria 132760
178 Ga0214544_1016313 3300021320 Bacteria 7228
179 Ga0214542_1000071 3300021321 Bacteria 124568
180 Ga0214542_1016361 3300021321 Bacteria 7226
181 Ga0214545_1000033 3300021324 Bacteria 124568
182 Ga0214545_1015478 3300021324 Bacteria 8323
183 Ga0214543_1000105 3300021327 Bacteria 108404
184 Ga0214543_1018322 3300021327 Bacteria 6472
185 Ga0213874_10014038 3300021377 Bacteria 2088
186 Ga0213876_10078817 3300021384 Bacteria 1741
187 Ga0213876_10107567 3300021384 Bacteria 1480
188 Ga0213871_10000532 3300021441 Bacteria 5293
189 Ga0224712_10019051 3300022467 Bacteria 2307
190 Ga0228598_1006636 3300024227 Bacteria 2390
191 Ga0207425_1027375 3300025245 Bacteria 1163
192 Ga0209148_1000308 3300025254 Bacteria 70131
193 Ga0209233_1008097 3300025261 Bacteria 3281
194 Ga0209455_1001786 3300025272 Bacteria 9080
195 Ga0209673_1023416 3300025273 Bacteria 2103
196 Ga0209564_1006612 3300025295 Bacteria 6206
197 Ga0209758_1000182 3300025297 Bacteria 140630
198 Ga0209758_1000293 3300025297 Bacteria 98643
199 Ga0209758_1000363 3300025297 Bacteria 80753
200 Ga0209758_1002068 3300025297 Bacteria 21433
201 Ga0209758_1003509 3300025297 Bacteria 14159
202 Ga0209758_1003517 3300025297 Bacteria 14133
203 Ga0209758_1005730 3300025297 Bacteria 9361
204 Ga0209758_1041376 3300025297 Bacteria 1723
205 Ga0209256_1004270 3300025299 Bacteria 9131
206 Ga0207426_1000628 3300025302 Bacteria 44820
207 Ga0207426_1000992 3300025302 Bacteria 27820
208 Ga0207426_1004958 3300025302 Bacteria 6274
209 Ga0207426_1051290 3300025302 Bacteria 1226
210 Ga0209257_1004239 3300025304 Bacteria 11331
211 Ga0207682_10039152 3300025893 Bacteria 1926
212 Ga0207692_10055491 3300025898 Bacteria 2028
213 Ga0207710_10049316 3300025900 Bacteria 1886
214 Ga0207688_10054132 3300025901 Bacteria 2251
215 Ga0207680_10483967 3300025903 Bacteria 880
216 Ga0207647_10025176 3300025904 Bacteria 3915
217 Ga0207647_10071165 3300025904 Bacteria 2098
218 Ga0207699_10006255 3300025906 Bacteria 5750
219 Ga0207699_10060143 3300025906 Bacteria 2280
220 Ga0207705_10120850 3300025909 Bacteria 1943
221 Ga0207684_10036512 3300025910 Bacteria 4170
222 Ga0207684_10710782 3300025910 Bacteria 853
223 Ga0207654_10014572 3300025911 Bacteria 4063
224 Ga0207654_10035456 3300025911 Bacteria 2780
225 Ga0207654_10065304 3300025911 Bacteria 2142
226 Ga0207707_10001497 3300025912 Bacteria 21565
227 Ga0207707_10008114 3300025912 Bacteria 9117
228 Ga0207707_10227578 3300025912 Bacteria 1623
229 Ga0207707_10242364 3300025912 Bacteria 1567
230 Ga0207695_10000107 3300025913 Bacteria 252606
231 Ga0207695_10075896 3300025913 Bacteria 3419
232 Ga0207695_10302167 3300025913 Bacteria 1491
233 Ga0207671_10004749 3300025914 Bacteria 12824
234 Ga0207671_10039127 3300025914 Bacteria 3513
235 Ga0207671_10082792 3300025914 Bacteria 2408
236 Ga0207671_10212429 3300025914 Bacteria 1514
237 Ga0207693_10009900 3300025915 Bacteria 7752
238 Ga0207693_10010117 3300025915 Bacteria 7662
239 Ga0207693_10027198 3300025915 Bacteria 4522
240 Ga0207693_10208324 3300025915 Bacteria 1537
241 Ga0207693_10297614 3300025915 Bacteria 1264
242 Ga0207663_10099417 3300025916 Bacteria 1950
243 Ga0207663_10230344 3300025916 Bacteria 1353
244 Ga0207663_10295252 3300025916 Bacteria 1209
245 Ga0207663_10406573 3300025916 Bacteria 1042
246 Ga0207660_10005316 3300025917 Bacteria 8367
247 Ga0207660_10010250 3300025917 Bacteria 6075
248 Ga0207660_10086834 3300025917 Bacteria 2310
249 Ga0207662_10025921 3300025918 Bacteria 3379
250 Ga0207657_10015131 3300025919 Bacteria 7492
251 Ga0207657_10108627 3300025919 Bacteria 2293
252 Ga0207652_10001692 3300025921 Bacteria 19294
253 Ga0207652_10010419 3300025921 Bacteria 7483
254 Ga0207652_10020006 3300025921 Bacteria 5511
255 Ga0207652_10036040 3300025921 Bacteria 4181
256 Ga0207652_10174700 3300025921 Bacteria 1929
257 Ga0207646_10193674 3300025922 Bacteria 1836
258 Ga0207694_10105768 3300025924 Bacteria 2234
259 Ga0207694_10111282 3300025924 Bacteria 2179
260 Ga0207694_10276473 3300025924 Bacteria 1378
261 Ga0207694_10290509 3300025924 Bacteria 1344
262 Ga0207659_10146537 3300025926 Bacteria 1839
263 Ga0207687_10008035 3300025927 Bacteria 6906
264 Ga0207687_10078731 3300025927 Bacteria 2374
265 Ga0207700_10069113 3300025928 Bacteria 2710
266 Ga0207644_10023803 3300025931 Bacteria 4199
267 Ga0207686_10183825 3300025934 Bacteria 1484
268 Ga0207686_10239349 3300025934 Bacteria 1320
269 Ga0207709_10023155 3300025935 Bacteria 3532
270 Ga0207709_10348394 3300025935 Bacteria 1117
271 Ga0207670_10012150 3300025936 Bacteria 5026
272 Ga0207665_10180376 3300025939 Bacteria 1529
273 Ga0207665_10206960 3300025939 Bacteria 1432
274 Ga0207691_10099020 3300025940 Bacteria 2604
275 Ga0207711_10076621 3300025941 Bacteria 2913
276 Ga0207689_10110600 3300025942 Bacteria 2258
277 Ga0207689_10114552 3300025942 Bacteria 2216
278 Ga0207661_10000579 3300025944 Bacteria 23347
279 Ga0207661_10002114 3300025944 Bacteria 13669
280 Ga0207661_10009038 3300025944 Bacteria 7139
281 Ga0207661_10193615 3300025944 Bacteria 1784
282 Ga0207667_10003118 3300025949 Bacteria 20511
283 Ga0207667_10235698 3300025949 Bacteria 1873
284 Ga0207651_10111548 3300025960 Bacteria 2054
285 Ga0207640_10134797 3300025981 Bacteria 1791
286 Ga0207640_10369666 3300025981 Bacteria 1158
287 Ga0207677_10008707 3300026023 Bacteria 5681
288 Ga0207703_10038775 3300026035 Bacteria 3805
289 Ga0207639_10009580 3300026041 Bacteria 6687
290 Ga0207639_10269549 3300026041 Bacteria 1493
291 Ga0207639_10493629 3300026041 Bacteria 1117
292 Ga0207639_10536094 3300026041 Bacteria 1073
293 Ga0207639_10852155 3300026041 Bacteria 851
294 Ga0207678_10196358 3300026067 Bacteria 1725
295 Ga0207678_10214204 3300026067 Bacteria 1648
296 Ga0207708_10047301 3300026075 Bacteria 3275
297 Ga0207702_10000350 3300026078 Bacteria 52867
298 Ga0207702_10143796 3300026078 Bacteria 2161
299 Ga0207702_10363389 3300026078 Bacteria 1388
300 Ga0207641_10122834 3300026088 Bacteria 2320
301 Ga0207648_10616534 3300026089 Bacteria 1001
302 Ga0207676_10095607 3300026095 Bacteria 2450
303 Ga0207676_10132387 3300026095 Bacteria 2122
304 Ga0207676_10541246 3300026095 Bacteria 1111
305 Ga0207674_10011007 3300026116 Bacteria 10173
306 Ga0207674_10117504 3300026116 Bacteria 2630
307 Ga0207675_100137407 3300026118 Bacteria 2320
308 Ga0207683_10019572 3300026121 Bacteria 5781
309 Ga0207683_10058673 3300026121 Bacteria 3379
310 Ga0207683_10299206 3300026121 Bacteria 1472
311 Ga0207698_10018469 3300026142 Bacteria 4752
312 Ga0207698_10318921 3300026142 Bacteria 1454
313 Ga0207698_10530778 3300026142 Bacteria 1150
314 Ga0207698_10628096 3300026142 Bacteria 1062
315 Ga0209389_1000208 3300027296 Bacteria 42287
316 Ga0209389_1000217 3300027296 Bacteria 39758
317 Ga0209589_1000032 3300027357 Bacteria 141881
318 Ga0209489_101970 3300027361 Bacteria 42287
319 Ga0209489_102214 3300027361 Bacteria 39758
320 Ga0209700_100011 3300027363 Bacteria 362159
321 Ga0209813_10010120 3300027866 Bacteria 2431
322 Ga0268266_10369146 3300028379 Bacteria 1351
323 Ga0268264_10000227 3300028381 Bacteria 109454
324 Ga0265337_1028055 3300028556 Bacteria 1693
325 Ga0265326_10016944 3300028558 Bacteria 2104
326 Ga0265319_1005200 3300028563 Bacteria 6286
327 Ga0265334_10015788 3300028573 Bacteria 3133
328 Ga0265318_10008563 3300028577 Bacteria 4544
329 Ga0265323_10001243 3300028653 Bacteria 12808
330 Ga0265322_10014422 3300028654 Bacteria 2283
331 Ga0265336_10000410 3300028666 Bacteria 26721
332 Ga0265338_10000277 3300028800 Bacteria 93095
333 Ga0265324_10005967 3300029957 Bacteria 5159
334 Ga0265760_10037980 3300031090 Bacteria 1430
335 Ga0265330_10039036 3300031235 Bacteria 2110
336 Ga0265332_10019622 3300031238 Bacteria 2984
337 Ga0265325_10000061 3300031241 Bacteria 75502
338 Ga0265325_10079574 3300031241 Bacteria 1631
339 Ga0265339_10022187 3300031249 Bacteria 3681
340 Ga0265331_10032820 3300031250 Bacteria 2570
341 Ga0265331_10071962 3300031250 Bacteria 1616
342 Ga0265331_10076691 3300031250 Bacteria 1558
343 Ga0307508_10000002 3300031616 Bacteria 407635
344 Ga0307508_10226053 3300031616 Bacteria 1471
345 Ga0265342_10022741 3300031712 Bacteria 3981
346 Ga0307516_10035775 3300031730 Bacteria 4978
347 Ga0307409_100639120 3300031995 Bacteria 1056
348 Ga0307510_10006388 3300033180 Bacteria 14055
349 Ga0307510_10145934 3300033180 Bacteria 1998
350 Ga0373930_0041962 3300034816 Bacteria 978
351 Ga0373934_0004728 3300035086 Bacteria 5034
352 Ga0373934_0069340 3300035086 Bacteria 1409
353 Ga0373923_0010717 3300035111 Bacteria 3344
354 Ga0373923_0014593 3300035111 Bacteria 2954
355 Ga0373923_0032775 3300035111 Bacteria 2100
356 Ga0373932_0020906 3300035112 Bacteria 1721
357 Ga0373936_0093673 3300035113 Bacteria 1261
358 Ga0373945_0062313 3300035116 Bacteria 1394
359 Ga0373953_0000653 3300035117 Bacteria 9634
360 Ga0373953_0075295 3300035117 Bacteria 1397
361 Ga0373954_0015067 3300035118 Bacteria 3453
362 Ga0373956_0001298 3300035119 Bacteria 10347
363 Ga0373957_0004778 3300035120 Bacteria 4150
364 Ga0373957_0050678 3300035120 Bacteria 1587
365 Ga0373960_0017880 3300035121 Bacteria 1842
366 Ga0373943_0024874 3300035170 Bacteria 2795
367 Ga0373946_0028416 3300035171 Bacteria 2218
368 Ga0373955_0000648 3300035172 Bacteria 14857
369 Ga0373955_0007599 3300035172 Bacteria 4992
370 Ga0373924_0004102 3300035410 Bacteria 5069
371 Ga0373924_0048843 3300035410 Bacteria 1749
372 Ga0373924_0099467 3300035410 Bacteria 1250
373 Ga0373931_0005720 3300035691 Bacteria 5776
374 Ga0373935_0004102 3300035692 Bacteria 8522
375 Ga0373935_0204600 3300035692 Bacteria 1365
376 Ga0373935_0335606 3300035692 Bacteria 1075
377 Ga0373927_0003439 3300035695 Bacteria 11340
378 Ga0373927_0018648 3300035695 Bacteria 4555
379 Ga0373927_0028077 3300035695 Bacteria 3672
380 Ga0373927_0078821 3300035695 Bacteria 2133
381 Ga0373927_0195756 3300035695 Bacteria 1326
382 Ga0373933_0000655 3300035724 Bacteria 21529
383 Ga0373947_0005223 3300035725 Bacteria 7588
384 Ga0373947_0016157 3300035725 Bacteria 4289
385 Ga0373947_0070390 3300035725 Bacteria 2143
386 Ga0373937_0021124 3300036401 Bacteria 5842
387 Ga0373937_0231133 3300036401 Bacteria 1742
388 Ga0373937_0680877 3300036401 Bacteria 974
389 Ga0373925_0003059 3300037068 Bacteria 13150
390 Ga0373925_0022013 3300037068 Bacteria 4645
391 Ga0373925_0168079 3300037068 Bacteria 1730
392 Ga0373925_0247068 3300037068 Bacteria 1430
393 Ga0395899_0080697 3300037312 Bacteria 2367
394 Ga0395899_0134770 3300037312 Bacteria 1761
395 Ga0395900_0001316 3300037418 Bacteria 30150
396 Ga0395900_0166608 3300037418 Bacteria 2245
397 Ga0395900_0314598 3300037418 Bacteria 1548
398 Ga0395898_0010275 3300037466 Bacteria 9797
399 Ga0395898_0261031 3300037466 Bacteria 1652
400 Ga0395905_0019550 3300037471 Bacteria 6419
401 Ga0395905_0060353 3300037471 Bacteria 3546
402 Ga0395905_0417953 3300037471 Bacteria 1237
403 Ga0395905_0539360 3300037471 Bacteria 1067
404 Ga0436364_1211788 3300037853 Bacteria 1106
405 Ga0395901_0002762 3300038443 Bacteria 17695
406 Ga0395901_0256059 3300038443 Bacteria 1823
407 Ga0395901_0516788 3300038443 Bacteria 1214
408 Ga0436365_0478600 3300039437 Bacteria 4835
409 Ga0436365_0766912 3300039437 Bacteria 1919
410 Ga0436365_1108887 3300039437 Bacteria 1837
411 Ga0436365_1246013 3300039437 Bacteria 3666
412 Ga0436365_1695882 3300039437 Bacteria 3026
413 Ga0436365_1830473 3300039437 Bacteria 2714
414 Ga0436360_0784628 3300039438 Bacteria 1889
415 Ga0436361_0734729 3300039447 Bacteria 2078
416 Ga0436363_0071431 3300039450 Bacteria 2133
417 Ga0436363_0532985 3300039450 Bacteria 7779
418 Ga0436362_0566318 3300039453 Bacteria 1572
419 Ga0439453_0006071 3300041408 Bacteria 1866
420 Ga0451793_0431397 3300041452 Bacteria 1029
421 Ga0451800_0533584 3300041459 Bacteria 1059
422 Ga0451847_0528921 3300041503 Bacteria 851
423 Ga0450923_022894 3300042125 Bacteria 1228
424 Ga0466969_0030926 3300044656 Bacteria 2726
425 Ga0466972_0000233 3300044658 Bacteria 38493
426 Ga0466965_0080097 3300044683 Bacteria 1650
427 Ga0466965_0208720 3300044683 Bacteria 1038
428 Ga0466966_0002503 3300044684 Bacteria 12045
429 Ga0466961_0003092 3300044693 Bacteria 10344
430 Ga0466963_0026147 3300044694 Bacteria 3731
431 Ga0466963_0167611 3300044694 Bacteria 1530
432 Ga0466964_0099624 3300044706 Bacteria 1279
433 Ga0466968_0003054 3300044735 Bacteria 6190
434 Ga0466970_0043302 3300044765 Bacteria 2395
435 Ga0466957_0023758 3300044842 Bacteria 3626
436 Ga0466957_0122872 3300044842 Bacteria 1656
437 Ga0466960_0141135 3300044901 Bacteria 1280
438 Ga0466959_0002845 3300045049 Bacteria 11154
439 Ga0466959_0178884 3300045049 Bacteria 1484
440 Ga0466958_0042367 3300045836 Bacteria 2741
441 Ga0466967_0073867 3300045976 Bacteria 3060
442 Ga0466967_0230673 3300045976 Bacteria 1762
443 Ga0466967_0236391 3300045976 Bacteria 1741
444 Ga0466967_0286657 3300045976 Bacteria 1581
445 Ga0495592_0000614 3300046454 Bacteria 25241
446 Ga0495592_0008192 3300046454 Bacteria 7850
447 Ga0495592_0038952 3300046454 Bacteria 3573
448 Ga0495592_0079136 3300046454 Bacteria 2379
449 Ga0495603_0000048 3300046455 Bacteria 51928
450 Ga0495629_0000849 3300046459 Bacteria 24681
451 Ga0495629_0001230 3300046459 Bacteria 20107
452 Ga0495629_0008274 3300046459 Bacteria 7648
453 Ga0495629_0061767 3300046459 Bacteria 2618
454 Ga0495638_0002713 3300046460 Bacteria 14241
455 Ga0495641_0001887 3300046461 Bacteria 17166
456 Ga0495651_0001002 3300046462 Bacteria 21924
457 Ga0495651_0030344 3300046462 Bacteria 4216
458 Ga0495651_0322730 3300046462 Bacteria 1029
459 Ga0495651_0401786 3300046462 Bacteria 894
460 Ga0495653_0015208 3300046463 Bacteria 6272
461 Ga0495653_0036319 3300046463 Bacteria 3882
462 Ga0495653_0074237 3300046463 Bacteria 2535
463 Ga0495653_0092087 3300046463 Bacteria 2214
464 Ga0495650_0058010 3300046471 Bacteria 1565
465 Ga0495580_0000084 3300046472 Bacteria 60217
466 Ga0495580_0006567 3300046472 Bacteria 9456
467 Ga0495580_0348048 3300046472 Bacteria 1004
468 Ga0495580_0368426 3300046472 Bacteria 972
469 Ga0495582_0002918 3300046473 Bacteria 9560
470 Ga0495582_0013677 3300046473 Bacteria 4467
471 Ga0495639_0000009 3300046475 Bacteria 94240
472 Ga0495639_0023943 3300046475 Bacteria 2685
473 Ga0495662_0004398 3300046476 Bacteria 7075
474 Ga0495662_0117605 3300046476 Bacteria 1304
475 Ga0495664_0010080 3300046477 Bacteria 5301
476 Ga0495664_0040457 3300046477 Bacteria 2757
477 Ga0495664_0178097 3300046477 Bacteria 1289
478 Ga0495584_0221532 3300046491 Bacteria 962
479 Ga0495594_0000603 3300046499 Bacteria 18524
480 Ga0495594_0084913 3300046499 Bacteria 1771
481 Ga0495606_0032899 3300046507 Bacteria 3585
482 Ga0495608_0001026 3300046511 Bacteria 19595
483 Ga0495620_0060542 3300046515 Bacteria 1578
484 Ga0495628_0002528 3300046516 Bacteria 16449
485 Ga0495628_0042727 3300046516 Bacteria 3614
486 Ga0495628_0044189 3300046516 Bacteria 3546
487 Ga0495628_0048772 3300046516 Bacteria 3355
488 Ga0495628_0158703 3300046516 Bacteria 1719
489 Ga0495630_0025806 3300046517 Bacteria 4346
490 Ga0495630_0033567 3300046517 Bacteria 3828
491 Ga0495643_0109135 3300046522 Bacteria 1408
492 Ga0495648_0001769 3300046524 Bacteria 20843
493 Ga0495648_0016435 3300046524 Bacteria 5337
494 Ga0495666_0036789 3300046526 Bacteria 2383
495 Ga0495666_0101122 3300046526 Bacteria 1358
496 Ga0495652_0020043 3300046529 Bacteria 5948
497 Ga0495652_0023863 3300046529 Bacteria 5418
498 Ga0495652_0129656 3300046529 Bacteria 1998
499 Ga0495652_0393116 3300046529 Bacteria 983
500 Ga0495665_0016436 3300046531 Bacteria 3987
501 Ga0495665_0039184 3300046531 Bacteria 2524
502 Ga0495640_0006145 3300046533 Bacteria 9520
503 Ga0495640_0013322 3300046533 Bacteria 6249
504 Ga0495640_0017715 3300046533 Bacteria 5300
505 Ga0495640_0043150 3300046533 Bacteria 3142
506 Ga0495640_0330461 3300046533 Bacteria 943
507 Ga0495586_0036735 3300046535 Bacteria 2630
508 Ga0495587_0005697 3300046536 Bacteria 8116
509 Ga0495587_0015864 3300046536 Bacteria 4694
510 Ga0495587_0164813 3300046536 Bacteria 1260
511 Ga0495597_0082949 3300046542 Bacteria 1369
512 Ga0495645_0016024 3300046543 Bacteria 5343
513 Ga0495645_0017296 3300046543 Bacteria 5164
514 Ga0495645_0132541 3300046543 Bacteria 1745
515 Ga0495645_0171734 3300046543 Bacteria 1492
516 Ga0495622_0000771 3300046557 Bacteria 17886
517 Ga0495667_0001358 3300046559 Bacteria 16077
518 Ga0495667_0100245 3300046559 Bacteria 1874
519 Ga0495667_0128869 3300046559 Bacteria 1632
520 Ga0495634_0001541 3300046642 Bacteria 20331
521 Ga0495634_0038726 3300046642 Bacteria 3249
522 Ga0495634_0071770 3300046642 Bacteria 2278
523 Ga0495634_0099512 3300046642 Bacteria 1880
524 Ga0495634_0103258 3300046642 Bacteria 1840
525 Ga0495634_0167516 3300046642 Bacteria 1382
526 Ga0495635_0000119 3300046663 Bacteria 47408
527 Ga0495635_0000809 3300046663 Bacteria 20486
528 Ga0495635_0220597 3300046663 Bacteria 1282
529 Ga0495657_0006732 3300046675 Bacteria 8961
530 Ga0495657_0009585 3300046675 Bacteria 7335
531 Ga0495657_0012863 3300046675 Bacteria 6200
532 Ga0495599_0000513 3300046678 Bacteria 22163
533 Ga0495599_0099618 3300046678 Bacteria 1811
534 Ga0495599_0248148 3300046678 Bacteria 1084
535 Ga0495623_0009766 3300046679 Bacteria 6224
536 Ga0495623_0011049 3300046679 Bacteria 5841
537 Ga0495623_0022025 3300046679 Bacteria 4116
538 Ga0495646_0001869 3300046680 Bacteria 12662
539 Ga0495646_0054721 3300046680 Bacteria 2399
540 Ga0495646_0056971 3300046680 Bacteria 2341
541 Ga0495646_0074070 3300046680 Bacteria 1999
542 Ga0495658_0000420 3300046683 Bacteria 23768
543 Ga0495658_0009910 3300046683 Bacteria 4753
544 Ga0495613_0001484 3300046689 Bacteria 17888
545 Ga0495613_0153011 3300046689 Bacteria 1644
546 Ga0495624_0003095 3300046690 Bacteria 12447
547 Ga0495649_0002747 3300046694 Bacteria 12249
548 Ga0495649_0115963 3300046694 Bacteria 1418
549 Ga0495600_0004615 3300046809 Bacteria 8256
550 Ga0495600_0004930 3300046809 Bacteria 8013
551 Ga0495600_0021201 3300046809 Bacteria 4160
552 Ga0495600_0104968 3300046809 Bacteria 1841
553 Ga0495581_0000103 3300047315 Bacteria 35265
554 Ga0495581_0007321 3300047315 Bacteria 6387
555 Ga0495581_0193376 3300047315 Bacteria 1190
556 Ga0495604_0010711 3300047317 Bacteria 7277
557 Ga0495604_0020575 3300047317 Bacteria 5269
558 Ga0495604_0022153 3300047317 Bacteria 5071
559 Ga0495604_0223845 3300047317 Bacteria 1294
560 Ga0495674_0000367 3300047319 Bacteria 40173
561 Ga0495674_0011448 3300047319 Bacteria 8369
562 Ga0495674_0028981 3300047319 Bacteria 5043
563 Ga0495674_0093154 3300047319 Bacteria 2571
564 Ga0495674_0098456 3300047319 Bacteria 2490
565 Ga0495674_0325532 3300047319 Bacteria 1251
566 Ga0495672_0037918 3300047320 Bacteria 2945
567 Ga0495676_0344750 3300047321 Bacteria 997
568 Ga0495676_0387975 3300047321 Bacteria 928
569 Ga0495680_0002243 3300047322 Bacteria 19932
570 Ga0495680_0012531 3300047322 Bacteria 7457
571 Ga0495687_110629 3300047443 Bacteria 1010
572 Ga0495675_0000978 3300047444 Bacteria 17349
573 Ga0495675_0014791 3300047444 Bacteria 4934
574 Ga0495677_0083420 3300047445 Bacteria 1200
575 Ga0495673_0017078 3300047469 Bacteria 3695
576 Ga0495684_0000081 3300047471 Bacteria 65985
577 Ga0495684_0021483 3300047471 Bacteria 4970
578 Ga0495684_0110828 3300047471 Bacteria 2071
579 Ga0495684_0160475 3300047471 Bacteria 1677
580 Ga0495686_0053018 3300047472 Bacteria 2542
581 Ga0495593_0000134 3300047673 Bacteria 35634
582 Ga0495593_0006901 3300047673 Bacteria 6650
583 Ga0495593_0017419 3300047673 Bacteria 4044
584 Ga0495593_0054985 3300047673 Bacteria 2097
585 Ga0495602_0002985 3300048088 Bacteria 17343
586 Ga0495602_0015795 3300048088 Bacteria 7604
587 Ga0495602_0021964 3300048088 Bacteria 6258
588 Ga0495614_0051930 3300048089 Bacteria 1757
589 Ga0495626_0064666 3300048091 Bacteria 1657
590 Ga0496100_0076046 3300048903 Bacteria 2254
591 Ga0496100_0088745 3300048903 Bacteria 2105
592 Ga0496100_0139127 3300048903 Bacteria 1718
593 Ga0496100_0284854 3300048903 Bacteria 1233
594 Ga0496101_0036649 3300048904 Bacteria 3474
595 Ga0496101_0070038 3300048904 Bacteria 2567
596 Ga0496101_0074061 3300048904 Bacteria 2503
597 Ga0496101_0107324 3300048904 Bacteria 2097
598 Ga0496101_0120096 3300048904 Bacteria 1986
599 Ga0496101_0332696 3300048904 Bacteria 1192
600 Ga0496102_0061667 3300048905 Bacteria 3432
601 Ga0496102_0172121 3300048905 Bacteria 2038
602 Ga0496102_0181350 3300048905 Bacteria 1984
603 Ga0496103_0009458 3300048906 Bacteria 5770
604 Ga0496103_0072886 3300048906 Bacteria 2151
605 Ga0496104_0020661 3300048907 Bacteria 6039
606 Ga0496104_0023555 3300048907 Bacteria 5661
607 Ga0496104_0170732 3300048907 Bacteria 2085
608 Ga0496104_0187611 3300048907 Bacteria 1978
609 Ga0496104_0191155 3300048907 Bacteria 1958
610 Ga0496104_0295438 3300048907 Bacteria 1533
611 Ga0496105_0009535 3300048908 Bacteria 7597
612 Ga0496105_0073846 3300048908 Bacteria 2817
613 Ga0496105_0248252 3300048908 Bacteria 1442
614 Ga0496106_0001576 3300048909 Bacteria 17151
615 Ga0496106_0007942 3300048909 Bacteria 7839
616 Ga0496106_0014219 3300048909 Bacteria 5878
617 Ga0496106_0108285 3300048909 Bacteria 2161
618 Ga0496107_0003437 3300048910 Bacteria 10586
619 Ga0496107_0012956 3300048910 Bacteria 5827
620 Ga0496108_0000803 3300048911 Bacteria 24388
621 Ga0496108_0035470 3300048911 Bacteria 4146
622 Ga0496108_0059942 3300048911 Bacteria 3201
623 Ga0496108_0082787 3300048911 Bacteria 2721
624 Ga0496109_0017599 3300048912 Bacteria 6268
625 Ga0496109_0035686 3300048912 Bacteria 4487
626 Ga0496109_0180998 3300048912 Bacteria 1980
627 Ga0496109_0207305 3300048912 Bacteria 1843
628 Ga0496110_0033090 3300048913 Bacteria 4470
629 Ga0496110_0035078 3300048913 Bacteria 4349
630 Ga0496111_0034758 3300048914 Bacteria 3600
631 Ga0496111_0081365 3300048914 Bacteria 2364
632 Ga0496112_0002678 3300048915 Bacteria 14403
633 Ga0496112_0031886 3300048915 Bacteria 5114
634 Ga0496112_0041336 3300048915 Bacteria 4511
635 Ga0496112_0059955 3300048915 Bacteria 3750
636 Ga0496112_0065372 3300048915 Bacteria 3589
637 Ga0496112_0084420 3300048915 Bacteria 3141
638 Ga0496112_0122679 3300048915 Bacteria 2569
639 Ga0496112_0174083 3300048915 Bacteria 2117
640 Ga0496112_0276693 3300048915 Bacteria 1626
641 Ga0496112_0403036 3300048915 Bacteria 1307
642 Ga0496113_0006745 3300048916 Bacteria 7318
643 Ga0496113_0030431 3300048916 Bacteria 3908
644 Ga0496113_0076620 3300048916 Bacteria 2555
645 Ga0496113_0333899 3300048916 Bacteria 1215
646 Ga0496113_0417594 3300048916 Bacteria 1077
647 Ga0496114_0122685 3300048917 Bacteria 2236
648 Ga0496115_0030558 3300048918 Bacteria 4238
649 Ga0496115_0034886 3300048918 Bacteria 3976
650 Ga0496115_0051161 3300048918 Bacteria 3312
651 Ga0496115_0073670 3300048918 Bacteria 2772
652 Ga0496115_0078638 3300048918 Bacteria 2683
653 Ga0496115_0087988 3300048918 Bacteria 2535
654 Ga0496115_0132941 3300048918 Bacteria 2051
655 Ga0496115_0185976 3300048918 Bacteria 1717
656 Ga0496115_0256936 3300048918 Bacteria 1437
657 Ga0496115_0376093 3300048918 Bacteria 1156
658 Ga0496116_0010704 3300048919 Bacteria 7658
659 Ga0496118_0091668 3300048921 Bacteria 2089
660 Ga0496118_0099405 3300048921 Bacteria 1972
661 Ga0496119_0008410 3300048922 Bacteria 9066
662 Ga0496121_0000786 3300048924 Bacteria 57998
663 Ga0496121_0027631 3300048924 Bacteria 5305
664 Ga0496121_0048983 3300048924 Bacteria 3588
665 Ga0496122_0024213 3300048925 Bacteria 5319
666 Ga0496122_0177556 3300048925 Bacteria 1275
667 Ga0496124_0128793 3300048927 Bacteria 2013
668 Ga0496125_0016759 3300048928 Bacteria 7025
669 Ga0496125_0120442 3300048928 Bacteria 1873
670 Ga0496126_0003797 3300048929 Bacteria 18757
671 Ga0496126_0008016 3300048929 Bacteria 11461
672 Ga0496126_0088722 3300048929 Bacteria 2723
673 Ga0496126_0130468 3300048929 Bacteria 2172
674 Ga0501032_0000011 3300049569 Bacteria 198158
675 Ga0501032_0006585 3300049569 Bacteria 8527
676 Ga0501034_0000001 3300049571 Bacteria 2184493
677 Ga0501034_0080206 3300049571 Bacteria 3267
678 Ga0501034_0284372 3300049571 Bacteria 1593
679 Ga0501039_0000243 3300049575 Bacteria 39697
680 Ga0501046_0163524 3300049580 Bacteria 1673
681 Ga0501047_0024350 3300049581 Bacteria 5811
682 Ga0501067_0021642 3300049583 Bacteria 3558
683 Ga0501069_0025177 3300049585 Bacteria 3250
684 Ga0501070_0354137 3300049586 Bacteria 1191
685 Ga0501072_0137362 3300049588 Bacteria 1949
686 Ga0501073_0320723 3300049589 Bacteria 1069
687 Ga0501074_0029125 3300049590 Bacteria 4000
688 Ga0501076_0460983 3300049592 Bacteria 1047
689 Ga0501080_0085994 3300049742 Bacteria 2921
690 Ga0501083_0187680 3300049744 Bacteria 1349
691 Ga0501083_0212691 3300049744 Bacteria 1260
692 nmdc:mga03n38_51196_c1 3300050490 Bacteria 1843
693 nmdc:mga03n38_6973_c1 3300050490 Bacteria 3969
694 nmdc:mga00v17_247168_c1 3300050491 Bacteria 1157
695 nmdc:mga0yw44_264557_c1 3300050492 Bacteria 1147
696 nmdc:mga0k408_10614_c1 3300050493 Bacteria 4987
697 nmdc:mga0k408_68103_c1 3300050493 Bacteria 2076
698 nmdc:mga06z11_161856_c1 3300050494 Bacteria 1280
699 nmdc:mga06z11_275423_c1 3300050494 Bacteria 996
700 nmdc:mga07m45_157538_c1 3300050496 Bacteria 1318
701 nmdc:mga07m45_274344_c1 3300050496 Bacteria 981
702 nmdc:mga05p37_736569_c1 3300050507 Bacteria 1089
703 nmdc:mga08y16_56695_c1 3300050511 Bacteria 4094
704 nmdc:mga08y16_891197_c1 3300050511 Bacteria 876
705 nmdc:mga0n895_37552_c1 3300050512 Bacteria 4687
706 nmdc:mga0rr50_125176_c1 3300050513 Bacteria 2051
707 nmdc:mga0sz30_20473_c1 3300050516 Bacteria 2669
708 Ga0495601_0004544 3300053077 Bacteria 8018
709 Ga0495601_0122151 3300053077 Bacteria 1692
710 Ga0495601_0244302 3300053077 Bacteria 1172
711 Ga0495612_0108920 3300053078 Bacteria 1184
712 Ga0500610_0194633 3300053079 Bacteria 982
713 Ga0495595_0000924 3300053084 Bacteria 11325
714 Ga0495595_0060631 3300053084 Bacteria 1771
715 Ga0495619_0000761 3300053085 Bacteria 21031
716 Ga0495619_0045971 3300053085 Bacteria 2869
717 Ga0495619_0058480 3300053085 Bacteria 2559
718 Ga0495619_0174706 3300053085 Bacteria 1486
719 Ga0500643_000049 3300053087 Bacteria 147107
720 Ga0500647_0011817 3300053091 Bacteria 3913
721 Ga0500583_0053404 3300053092 Bacteria 1883
722 Ga0500566_0000054 3300053094 Bacteria 54975
723 Ga0500566_0002813 3300053094 Bacteria 10360
724 Ga0500566_0204817 3300053094 Bacteria 993
725 Ga0500640_124748 3300053095 Bacteria 1025
726 Ga0500641_0023389 3300053096 Bacteria 2376
727 Ga0500556_0013425 3300053104 Bacteria 2479
728 Ga0500556_0051714 3300053104 Bacteria 1489
729 Ga0500556_0127844 3300053104 Bacteria 994
730 Ga0500557_000118 3300053105 Bacteria 22375
731 Ga0500569_103259 3300053109 Bacteria 936
732 Ga0500572_030574 3300053111 Bacteria 1498
733 Ga0500592_013606 3300053116 Bacteria 1305
734 Ga0500595_008077 3300053119 Bacteria 4318
735 Ga0500595_014837 3300053119 Bacteria 2944
736 Ga0500595_021175 3300053119 Bacteria 2325
737 Ga0500607_049118 3300053121 Bacteria 2252
738 Ga0500614_022081 3300053123 Bacteria 1482
739 Ga0500642_0000164 3300053130 Bacteria 27497
740 Ga0500642_0030702 3300053130 Bacteria 2238
741 Ga0500642_0093164 3300053130 Bacteria 1394
742 Ga0500559_0014505 3300053136 Bacteria 3330
743 Ga0500559_0020595 3300053136 Bacteria 2789
744 Ga0500559_0038988 3300053136 Bacteria 2065
745 Ga0500568_0014981 3300053139 Bacteria 3480
746 Ga0500616_0011794 3300053153 Bacteria 5142
747 Ga0500620_009505 3300053155 Bacteria 2513
748 Ga0500638_004886 3300053162 Bacteria 5255
749 Ga0500639_005653 3300053163 Bacteria 6412
750 Ga0500639_158143 3300053163 Bacteria 1035
751 Ga0500636_0068534 3300053177 Bacteria 2060
752 Ga0500636_0131471 3300053177 Bacteria 1393
753 Ga0500625_022233 3300053729 Bacteria 2994
754 Ga0500596_001677 3300053735 Bacteria 4480
755 Ga0500596_013825 3300053735 Bacteria 1216
756 Ga0500601_012623 3300053737 Bacteria 954
757 Ga0501084_0274526 3300054114 Bacteria 1423
758 Ga0501084_0541863 3300054114 Bacteria 983
759 Ga0500661_008628 3300055283 Bacteria 1875
760 2507505085 2507262055 Bacteria 8048963
761 2508539020 2508501009 Bacteria 7784016
762 2508695337 2508501042 Bacteria 8719808
763 2511394522 2511231028 Bacteria 8046582
764 2513623250 2513237092 Bacteria 8341956
765 2513639769 2513237094 Bacteria 8789602
766 2513647741 2513237095 Bacteria 8976980
767 2513677545 2513237098 Bacteria 9902361
768 2513699303 2513237102 Bacteria 7703324
769 2513719842 2513237104 Bacteria 10034502
770 2513873690 2513237139 Bacteria 8737671
771 2513888900 2513237141 Bacteria 8496279
772 2514012325 2513237161 Bacteria 8871253
773 2515625647 2515154112 Bacteria 8294334
774 2517102134 2517093001 Bacteria 9002274
775 2524435942 2524023205 Bacteria 8918781
776 2524467358 2524023210 Bacteria 9029266
777 2528852496 2528768022 Bacteria 10457665
778 2617350949 2617270735 Bacteria 9163226
779 2617373604 2617270741 Bacteria 8201522
780 2745081538 2744054633 Bacteria 8678936
781 2793064941 2791355196 Bacteria 7323613
782 2805915773 2802429603 Bacteria 8777136
783 2818237504 2816332527 Bacteria 8933356
784 2824608249 2824600985 Bacteria 8488197
785 2824612177 2824609381 Bacteria 8672835
786 2824620658 2824617872 Bacteria 8814715
787 2824629915 2824626560 Bacteria 8813858
788 2824640571 2824635225 Bacteria 8785348
789 2824647486 2824644064 Bacteria 8743947
790 2824655566 2824653114 Bacteria 8493680
791 2824668988 2824661429 Bacteria 9877870
792 2824675772 2824671348 Bacteria 8369588
793 2824683796 2824679649 Bacteria 8248951
794 2824691894 2824687955 Bacteria 8360029
795 2824701034 2824696289 Bacteria 8335049
796 2824711025 2824704595 Bacteria 9667483
797 2824718274 2824714736 Bacteria 8717648
798 2824728544 2824723954 Bacteria 8758240
799 2824736205 2824732956 Bacteria 7810675
800 2824751360 2824746037 Bacteria 7911610
801 2824760397 2824753945 Bacteria 9787441
802 2824770847 2824763712 Bacteria 9792355
803 2824775673 2824773399 Bacteria 8360218
804 2838124349 2838122688 Bacteria 8803140
805 2841945042 2841941048 Bacteria 8688029
806 2841951828 2841949485 Bacteria 8680857
807 2841964764 2841957949 Bacteria 8652217
808 2841973796 2841966195 Bacteria 8673214
809 2841980122 2841974524 Bacteria 8931498
810 2841985305 2841983080 Bacteria 8395090
811 2842043655 2842038055 Bacteria 8002051
812 2842052355 2842045827 Bacteria 8006841
813 2844315141 2844315083 Bacteria 8138177
814 2847930927 2847930680 Bacteria 9342022
815 2847941982 2847939898 Bacteria 8606328
816 2849082891 2849076700 Bacteria 7039503
817 2857511777 2857509624 Bacteria 7472071
818 2874597084 2874590934 Bacteria 8299676
819 2874616678 2874612657 Bacteria 8252029
820 2874624635 2874620515 Bacteria 8290088
821 2874628965 2874628541 Bacteria 8630250
822 2874648068 2874645413 Bacteria 8214782
823 2876765595 2876761206 Bacteria 10111113
824 2876777548 2876771140 Bacteria 8287509
825 2876825630 2876818435 Bacteria 8274608
826 2879077756 2879074833 Bacteria 8279565
827 2879089816 2879083081 Bacteria 8587928
828 2879108724 2879099564 Bacteria 10442239
829 2879130914 2879127579 Bacteria 8294491
830 2879148851 2879142872 Bacteria 8267021
831 2881365827 2881364244 Bacteria 7710352
832 2881665916 2881665667 Bacteria 8175609
833 2885371189 2885366525 Bacteria 8326213
834 2885389740 2885383462 Bacteria 9473874
835 2885410547 2885409591 Bacteria 9235467
836 2888379740 2888378607 Bacteria 9652610
837 2888390827 2888388044 Bacteria 7304136
838 2888420463 2888419890 Bacteria 7857137
839 2903732043 2903727486 Bacteria 8281579
840 2903773390 2903768456 Bacteria 9749579
841 2904670410 2904666416 Bacteria 8226587
842 2904715736 2904711408 Bacteria 9771557
843 2906603091 2906602504 Bacteria 8295279
844 2906633438 2906626472 Bacteria 8826946
845 2906648668 2906643746 Bacteria 8722424
846 2908776078 2908775508 Bacteria 8092255
847 2922364140 2922361189 Bacteria 7436256
848 2922368778
849 2922396285 2922393267 Bacteria 8285685
850 2929618421 2929615660 Bacteria 9193770
851 2929628894 2929624759 Bacteria 9339455
852 2932786599 2932784394 Bacteria 9704911
853 2932794475 2932794094 Bacteria 7915132
854 2932806756 2932801729 Bacteria 7987968
855 2932812341 2932809354 Bacteria 9135765
856 2932823333 2932818245 Bacteria 9955613
857 2932829827 2932828146 Bacteria 9745859
858 2933580866 2933577622 Bacteria 9116884
859 2935615339 2935608549 Bacteria 8203142
860 2935618345 2935616580 Bacteria 9032984
861 2935641257 2935638405 Bacteria 10015038
862 2935654838 2935648319 Bacteria 8801166
863 2935663729 2935656913 Bacteria 8965014
864 2935670173 2935665750 Bacteria 9571747
865 2935680829 2935675223 Bacteria 9928132
866 2935689847 2935684952 Bacteria 9590419
867 2935698368 2935694250 Bacteria 9291695
868 2935707510 2935703347 Bacteria 10242284
869 2935717367 2935713505 Bacteria 9608509
870 2935723964 2935722832 Bacteria 9608746
871 2935740173 2935732158 Bacteria 9706831
872 2935749436 2935741537 Bacteria 9707219
873 2935757201 2935750917 Bacteria 9590372
874 2935763711 2935760218 Bacteria 9817913
875 2935773403 2935769743 Bacteria 7878163
876 2935782276 2935777560 Bacteria 8077691
877 2935789229 2935785616 Bacteria 7962367
878 2935797166 2935793552 Bacteria 8012592
879 2935804112 2935801545 Bacteria 9301974
880 2935815196 2935810662 Bacteria 9401221
881 2935825283 2935819856 Bacteria 8261050
882 2935830988 2935827899 Bacteria 10038562
883 2935841599 2935837841 Bacteria 9454360
884 2935853117 2935847175 Bacteria 8228321
885 2935862560 2935855204 Bacteria 9035059
886 2935866512 2935864058 Bacteria 9784707
887 2935874819 2935873716 Bacteria 9632195
888 2935888527 2935883170 Bacteria 7964738
889 2935910135 2935908558 Bacteria 8568796
890 2935918568 2935916978 Bacteria 9113783
891 2935927954 2935926038 Bacteria 8601059
892 2935936174 2935934488 Bacteria 8602579
893 2935944273 2935942939 Bacteria 8599779
894 2935952710 2935951376 Bacteria 8602333
895 2935962489 2935959822 Bacteria 7869783
896 2935969550 2935967501 Bacteria 8603075
897 2935977689 2935975950 Bacteria 8347125
898 2935984995 2935984226 Bacteria 8302647
899 2935994325 2935992306 Bacteria 9802711
900 2936004697 2936002035 Bacteria 9362176
901 2936017874 2936011229 Bacteria 8801034
902 2936026377 2936019824 Bacteria 8804134
903 2936031575 2936028420 Bacteria 8965941
904 2936043263 2936037263 Bacteria 9446081
905 2936053361 2936046547 Bacteria 8903709
906 2936056164 2936055302 Bacteria 8785755
907 2940563115 2940556831 Bacteria 9590747
908 2941532538 2941531003 Bacteria 7653939
909 2941543031 2941538514 Bacteria 9402094
910 3005486751 3005483717 Bacteria 7877331
911 3005509331 3005506211 Bacteria 6943378
912 3005594058 3005587118 Bacteria 7794411
913 3005594866 3005594810 Bacteria 8716512
914 3005710848 3005710791 Bacteria 7622528
915 3005718144 3005718088 Bacteria 8283608
916 8006929807 8006926726 Bacteria 6749210
917 8006969485 8006964411 Bacteria 8966052
918 8006996739 8006994254 Bacteria 8309700
919 8016518371 8016511872 Bacteria 9921665
920 8016525983 8016522445 Bacteria 8156687
921 8016539586 8016530956 Bacteria 8155261
922 8016543883 8016539877 Bacteria 8155419
923 8016549421 8016548790 Bacteria 8155074
924 8016557844 8016557553 Bacteria 8154380
925 8016581913 8016575299 Bacteria 8154085
926 8016595863 8016595262 Bacteria 8149947
927 8016606728 8016603502 Bacteria 8731218
928 8016618628 8016613128 Bacteria 8794220
929 8016623375 8016622563 Bacteria 7999408
930 8016635832 8016630954 Bacteria 9217207
931 8017058289 8017057580 Bacteria 10023680
932 8019530867 8019530166 Bacteria 8155624
933 8019540717 8019538911 Bacteria 7872763
934 8019550395 8019547302 Bacteria 7996444
935 8019577421 8019576017 Bacteria 10049540
936 8019595511 8019586578 Bacteria 10212056
937 8019606251 8019597564 Bacteria 10041141
938 8019612278 8019608314 Bacteria 10042931
939 8019622803 8019619141 Bacteria 9218857
940 8019630303 8019629233 Bacteria 8687553
941 8019640304 8019638758 Bacteria 9062356
942 8019652641 8019648815 Bacteria 10014479
943 8019667132 8019659431 Bacteria 8577854
944 8019676920 8019668869 Bacteria 8791617
945 8019679070 8019678201 Bacteria 8863603
946 8019696456 8019687851 Bacteria 8712826
947 8055742272 8055742211 Bacteria 9226248
948 8056675586 8056673599 Bacteria 7871253
949 8056687543 8056681323 Bacteria 8472857
950 8056971126 8056967851 Bacteria 9038162
951 Ga0500595_056431
952 JGI25153J46596_10003121
953 JGI25153J46596_10003625
954 JGI25153J46596_10005115
955 JGI25153J46596_10010926
956 JGI25160J50197_1001001
957 JGI25160J50197_1003544
958 Ga0055531_10003282
959 Ga0055543_1003105
960 Ga0055543_1012639
961 Ga0065165_1006509
962 Ga0065165_1007472
963 Ga0065715_10303924
964 Ga0070658_10029625
965 Ga0070658_10065949
966 Ga0070658_10086288
967 Ga0070676_10283124
968 Ga0070683_100019421
969 Ga0070683_100037636
970 Ga0070683_100082862
971 Ga0070683_100201118
972 Ga0068869_100184781
973 Ga0070666_10067804
974 Ga0070666_10137472
975 Ga0070680_100005994
976 Ga0070680_100023189
977 Ga0070680_100038993
978 Ga0070680_100409143
979 Ga0070682_100099940
980 Ga0068868_100006519
981 Ga0070660_100009116
982 Ga0070689_100017799
983 Ga0070691_10119312
984 Ga0070661_100230067
985 Ga0070675_100066168
986 Ga0070671_100082907
987 Ga0070671_100438802
988 Ga0070673_100179111
989 Ga0070688_100013010
990 Ga0070688_100354506
991 Ga0070667_100184122
992 Ga0070709_10408689
993 Ga0070710_10071421
994 Ga0070711_100048433
995 Ga0070711_100048890
996 Ga0070711_100093270
997 Ga0070711_100102626
998 Ga0070700_100133379
999 Ga0070663_100117697
1000 Ga0070678_100149557
1001 Ga0070681_10013547
1002 Ga0070681_10020781
1003 Ga0070681_10155095
1004 Ga0070685_10189807
1005 Ga0070679_100054647
1006 Ga0070679_100337085
1007 Ga0070684_100012686
1008 Ga0070684_100055646
1009 Ga0070684_100061498
1010 Ga0070697_100000586
1011 Ga0068853_100007407
1012 Ga0068853_100191638
1013 Ga0068853_100475340
1014 Ga0070665_100078771
1015 Ga0070704_100124084
1016 Ga0068855_100317504
1017 Ga0068855_100526079
1018 Ga0068855_100628085
1019 Ga0068855_100722856
1020 Ga0070664_100431590
1021 Ga0070664_100439030
1022 Ga0068857_100015264
1023 Ga0068857_100106530
1024 Ga0068854_100129752
1025 Ga0068856_100019802
1026 Ga0068856_100025298
1027 Ga0068856_100064181
1028 Ga0068852_100011334
1029 Ga0068852_100735459
1030 Ga0068864_100024902
1031 Ga0068864_100072754
1032 Ga0068864_100583628
1033 Ga0068866_10025845
1034 Ga0068851_10192968
1035 Ga0068863_100287447
1036 Ga0068858_100051636
1037 Ga0068858_100379450
1038 Ga0068858_100544947
1039 Ga0068860_100001623
1040 Ga0068860_100100464
1041 Ga0068862_100412492
1042 Ga0068862_100640029
1043 Ga0081455_10002724
1044 Ga0081538_10073681
1045 Ga0081540_1005028
1046 Ga0081540_1097565
1047 Ga0081540_1148590
1048 Ga0070717_10013327
1049 Ga0075365_10087924
1050 Ga0075365_10324439
1051 Ga0075368_10028712
1052 Ga0075363_100046693
1053 Ga0075363_100058425
1054 Ga0075364_10016682
1055 Ga0075364_10110569
1056 Ga0070715_10188242
1057 Ga0070716_100113562
1058 Ga0070712_100152731
1059 Ga0070712_100170594
1060 Ga0075367_10016821
1061 Ga0075367_10018650
1062 Ga0075367_10033232
1063 Ga0075366_10002189
1064 Ga0075366_10010105
1065 Ga0097621_100156763
1066 Ga0097621_100177899
1067 Ga0075370_10145107
1068 Ga0075370_10182249
1069 Ga0075434_100334058
1070 Ga0075436_100040321
1071 Ga0099824_1031610
1072 Ga0099823_1022934
1073 Ga0105240_10002261
1074 Ga0105240_10062622
1075 Ga0105245_10013837
1076 Ga0105245_10043050
1077 Ga0105247_10054065
1078 Ga0114129_10271364
1079 Ga0105241_10029766
1080 Ga0105241_10046596
1081 Ga0105241_10560854
1082 Ga0105242_10109173
1083 Ga0105242_10229813
1084 Ga0105242_10426952
1085 Ga0105248_10041110
1086 Ga0105248_10138209
1087 Ga0105248_10175253
1088 Ga0105248_10215497
1089 Ga0105237_10003763
1090 Ga0105237_10145812
1091 Ga0105237_10174664
1092 Ga0105237_10273079
1093 Ga0105237_10579255
1094 Ga0105237_10659413
1095 Ga0105238_10015969
1096 Ga0105238_10069807
1097 Ga0105238_10193609
1098 Ga0105238_10371555
1099 Ga0105239_10023195
1100 Ga0105239_10094285
1101 Ga0105239_10216930
1102 Ga0105246_10325764
1103 Ga0105246_10372420
1104 Ga0105246_10403074
1105 Ga0157370_10035814
1106 Ga0157370_10159270
1107 Ga0157370_10317136
1108 Ga0157369_10053722
1109 Ga0157369_10106099
1110 Ga0157374_10003265
1111 Ga0157374_10040674
1112 Ga0157378_10451639
1113 Ga0163162_10081555
1114 Ga0163162_10268331
1115 Ga0157372_10350627
1116 Ga0157372_10484785
1117 Ga0157375_10144815
1118 Ga0157375_10682301
1119 Ga0163163_10013126
1120 Ga0163163_10036751
1121 Ga0163163_10193639
1122 Ga0163163_10475585
1123 Ga0157376_10064439
1124 Ga0157376_10577463
1125 Ga0182007_10047038
1126 Ga0197907_10378139
1127 Ga0214544_1000056
1128 Ga0214544_1016313
1129 Ga0214542_1000071
1130 Ga0214542_1016361
1131 Ga0214545_1000033
1132 Ga0214545_1015478
1133 Ga0214543_1000105
1134 Ga0214543_1018322
1135 Ga0213874_10014038
1136 Ga0213876_10078817
1137 Ga0213876_10107567
1138 Ga0213871_10000532
1139 Ga0224712_10019051
1140 Ga0228598_1006636
1141 Ga0207425_1027375
1142 Ga0209148_1000308
1143 Ga0209233_1008097
1144 Ga0209455_1001786
1145 Ga0209673_1023416
1146 Ga0209564_1006612
1147 Ga0209758_1000182
1148 Ga0209758_1000293
1149 Ga0209758_1000363
1150 Ga0209758_1002068
1151 Ga0209758_1003509
1152 Ga0209758_1003517
1153 Ga0209758_1005730
1154 Ga0209758_1041376
1155 Ga0209256_1004270
1156 Ga0207426_1000628
1157 Ga0207426_1000992
1158 Ga0207426_1004958
1159 Ga0207426_1051290
1160 Ga0209257_1004239
1161 Ga0207682_10039152
1162 Ga0207692_10055491
1163 Ga0207710_10049316
1164 Ga0207688_10054132
1165 Ga0207680_10483967
1166 Ga0207647_10025176
1167 Ga0207647_10071165
1168 Ga0207699_10006255
1169 Ga0207699_10060143
1170 Ga0207705_10120850
1171 Ga0207684_10036512
1172 Ga0207684_10710782
1173 Ga0207654_10014572
1174 Ga0207654_10035456
1175 Ga0207654_10065304
1176 Ga0207707_10001497
1177 Ga0207707_10008114
1178 Ga0207707_10227578
1179 Ga0207707_10242364
1180 Ga0207695_10000107
1181 Ga0207695_10075896
1182 Ga0207695_10302167
1183 Ga0207671_10004749
1184 Ga0207671_10039127
1185 Ga0207671_10082792
1186 Ga0207671_10212429
1187 Ga0207693_10009900
1188 Ga0207693_10010117
1189 Ga0207693_10027198
1190 Ga0207693_10208324
1191 Ga0207693_10297614
1192 Ga0207663_10099417
1193 Ga0207663_10230344
1194 Ga0207663_10295252
1195 Ga0207663_10406573
1196 Ga0207660_10005316
1197 Ga0207660_10010250
1198 Ga0207660_10086834
1199 Ga0207662_10025921
1200 Ga0207657_10015131
1201 Ga0207657_10108627
1202 Ga0207652_10001692
1203 Ga0207652_10010419
1204 Ga0207652_10020006
1205 Ga0207652_10036040
1206 Ga0207652_10174700
1207 Ga0207646_10193674
1208 Ga0207694_10105768
1209 Ga0207694_10111282
1210 Ga0207694_10276473
1211 Ga0207694_10290509
1212 Ga0207659_10146537
1213 Ga0207687_10008035
1214 Ga0207687_10078731
1215 Ga0207700_10069113
1216 Ga0207644_10023803
1217 Ga0207686_10183825
1218 Ga0207686_10239349
1219 Ga0207709_10023155
1220 Ga0207709_10348394
1221 Ga0207670_10012150
1222 Ga0207665_10180376
1223 Ga0207665_10206960
1224 Ga0207691_10099020
1225 Ga0207711_10076621
1226 Ga0207689_10110600
1227 Ga0207689_10114552
1228 Ga0207661_10000579
1229 Ga0207661_10002114
1230 Ga0207661_10009038
1231 Ga0207661_10193615
1232 Ga0207667_10003118
1233 Ga0207667_10235698
1234 Ga0207651_10111548
1235 Ga0207640_10134797
1236 Ga0207640_10369666
1237 Ga0207677_10008707
1238 Ga0207703_10038775
1239 Ga0207639_10009580
1240 Ga0207639_10269549
1241 Ga0207639_10493629
1242 Ga0207639_10536094
1243 Ga0207639_10852155
1244 Ga0207678_10196358
1245 Ga0207678_10214204
1246 Ga0207708_10047301
1247 Ga0207702_10000350
1248 Ga0207702_10143796
1249 Ga0207702_10363389
1250 Ga0207641_10122834
1251 Ga0207648_10616534
1252 Ga0207676_10095607
1253 Ga0207676_10132387
1254 Ga0207676_10541246
1255 Ga0207674_10011007
1256 Ga0207674_10117504
1257 Ga0207675_100137407
1258 Ga0207683_10019572
1259 Ga0207683_10058673
1260 Ga0207683_10299206
1261 Ga0207698_10018469
1262 Ga0207698_10318921
1263 Ga0207698_10530778
1264 Ga0207698_10628096
1265 Ga0209389_1000208
1266 Ga0209389_1000217
1267 Ga0209589_1000032
1268 Ga0209489_101970
1269 Ga0209489_102214
1270 Ga0209700_100011
1271 Ga0209813_10010120
1272 Ga0268266_10369146
1273 Ga0268264_10000227
1274 Ga0265337_1028055
1275 Ga0265326_10016944
1276 Ga0265319_1005200
1277 Ga0265334_10015788
1278 Ga0265318_10008563
1279 Ga0265323_10001243
1280 Ga0265322_10014422
1281 Ga0265336_10000410
1282 Ga0265338_10000277
1283 Ga0265324_10005967
1284 Ga0265760_10037980
1285 Ga0265330_10039036
1286 Ga0265332_10019622
1287 Ga0265325_10000061
1288 Ga0265325_10079574
1289 Ga0265339_10022187
1290 Ga0265331_10032820
1291 Ga0265331_10071962
1292 Ga0265331_10076691
1293 Ga0307508_10000002
1294 Ga0307508_10226053
1295 Ga0265342_10022741
1296 Ga0307516_10035775
1297 Ga0307409_100639120
1298 Ga0307510_10006388
1299 Ga0307510_10145934
1300 Ga0373930_0041962
1301 Ga0373934_0004728
1302 Ga0373934_0069340
1303 Ga0373923_0010717
1304 Ga0373923_0014593
1305 Ga0373923_0032775
1306 Ga0373932_0020906
1307 Ga0373936_0093673
1308 Ga0373945_0062313
1309 Ga0373953_0000653
1310 Ga0373953_0075295
1311 Ga0373954_0015067
1312 Ga0373956_0001298
1313 Ga0373957_0004778
1314 Ga0373957_0050678
1315 Ga0373960_0017880
1316 Ga0373943_0024874
1317 Ga0373946_0028416
1318 Ga0373955_0000648
1319 Ga0373955_0007599
1320 Ga0373924_0004102
1321 Ga0373924_0048843
1322 Ga0373924_0099467
1323 Ga0373931_0005720
1324 Ga0373935_0004102
1325 Ga0373935_0204600
1326 Ga0373935_0335606
1327 Ga0373927_0003439
1328 Ga0373927_0018648
1329 Ga0373927_0028077
1330 Ga0373927_0078821
1331 Ga0373927_0195756
1332 Ga0373933_0000655
1333 Ga0373947_0005223
1334 Ga0373947_0016157
1335 Ga0373947_0070390
1336 Ga0373937_0021124
1337 Ga0373937_0231133
1338 Ga0373937_0680877
1339 Ga0373925_0003059
1340 Ga0373925_0022013
1341 Ga0373925_0168079
1342 Ga0373925_0247068
1343 Ga0395899_0080697
1344 Ga0395899_0134770
1345 Ga0395900_0001316
1346 Ga0395900_0166608
1347 Ga0395900_0314598
1348 Ga0395898_0010275
1349 Ga0395898_0261031
1350 Ga0395905_0019550
1351 Ga0395905_0060353
1352 Ga0395905_0417953
1353 Ga0395905_0539360
1354 Ga0436364_1211788
1355 Ga0395901_0002762
1356 Ga0395901_0256059
1357 Ga0395901_0516788
1358 Ga0436365_0478600
1359 Ga0436365_0766912
1360 Ga0436365_1108887
1361 Ga0436365_1246013
1362 Ga0436365_1695882
1363 Ga0436365_1830473
1364 Ga0436360_0784628
1365 Ga0436361_0734729
1366 Ga0436363_0071431
1367 Ga0436363_0532985
1368 Ga0436362_0566318
1369 Ga0439453_0006071
1370 Ga0451793_0431397
1371 Ga0451800_0533584
1372 Ga0451847_0528921
1373 Ga0450923_022894
1374 Ga0466969_0030926
1375 Ga0466972_0000233
1376 Ga0466965_0080097
1377 Ga0466965_0208720
1378 Ga0466966_0002503
1379 Ga0466961_0003092
1380 Ga0466963_0026147
1381 Ga0466963_0167611
1382 Ga0466964_0099624
1383 Ga0466968_0003054
1384 Ga0466970_0043302
1385 Ga0466957_0023758
1386 Ga0466957_0122872
1387 Ga0466960_0141135
1388 Ga0466959_0002845
1389 Ga0466959_0178884
1390 Ga0466958_0042367
1391 Ga0466967_0073867
1392 Ga0466967_0230673
1393 Ga0466967_0236391
1394 Ga0466967_0286657
1395 Ga0495592_0000614
1396 Ga0495592_0008192
1397 Ga0495592_0038952
1398 Ga0495592_0079136
1399 Ga0495603_0000048
1400 Ga0495629_0000849
1401 Ga0495629_0001230
1402 Ga0495629_0008274
1403 Ga0495629_0061767
1404 Ga0495638_0002713
1405 Ga0495641_0001887
1406 Ga0495651_0001002
1407 Ga0495651_0030344
1408 Ga0495651_0322730
1409 Ga0495651_0401786
1410 Ga0495653_0015208
1411 Ga0495653_0036319
1412 Ga0495653_0074237
1413 Ga0495653_0092087
1414 Ga0495650_0058010
1415 Ga0495580_0000084
1416 Ga0495580_0006567
1417 Ga0495580_0348048
1418 Ga0495580_0368426
1419 Ga0495582_0002918
1420 Ga0495582_0013677
1421 Ga0495639_0000009
1422 Ga0495639_0023943
1423 Ga0495662_0004398
1424 Ga0495662_0117605
1425 Ga0495664_0010080
1426 Ga0495664_0040457
1427 Ga0495664_0178097
1428 Ga0495584_0221532
1429 Ga0495594_0000603
1430 Ga0495594_0084913
1431 Ga0495606_0032899
1432 Ga0495608_0001026
1433 Ga0495620_0060542
1434 Ga0495628_0002528
1435 Ga0495628_0042727
1436 Ga0495628_0044189
1437 Ga0495628_0048772
1438 Ga0495628_0158703
1439 Ga0495630_0025806
1440 Ga0495630_0033567
1441 Ga0495643_0109135
1442 Ga0495648_0001769
1443 Ga0495648_0016435
1444 Ga0495666_0036789
1445 Ga0495666_0101122
1446 Ga0495652_0020043
1447 Ga0495652_0023863
1448 Ga0495652_0129656
1449 Ga0495652_0393116
1450 Ga0495665_0016436
1451 Ga0495665_0039184
1452 Ga0495640_0006145
1453 Ga0495640_0013322
1454 Ga0495640_0017715
1455 Ga0495640_0043150
1456 Ga0495640_0330461
1457 Ga0495586_0036735
1458 Ga0495587_0005697
1459 Ga0495587_0015864
1460 Ga0495587_0164813
1461 Ga0495597_0082949
1462 Ga0495645_0016024
1463 Ga0495645_0017296
1464 Ga0495645_0132541
1465 Ga0495645_0171734
1466 Ga0495622_0000771
1467 Ga0495667_0001358
1468 Ga0495667_0100245
1469 Ga0495667_0128869
1470 Ga0495634_0001541
1471 Ga0495634_0038726
1472 Ga0495634_0071770
1473 Ga0495634_0099512
1474 Ga0495634_0103258
1475 Ga0495634_0167516
1476 Ga0495635_0000119
1477 Ga0495635_0000809
1478 Ga0495635_0220597
1479 Ga0495657_0006732
1480 Ga0495657_0009585
1481 Ga0495657_0012863
1482 Ga0495599_0000513
1483 Ga0495599_0099618
1484 Ga0495599_0248148
1485 Ga0495623_0009766
1486 Ga0495623_0011049
1487 Ga0495623_0022025
1488 Ga0495646_0001869
1489 Ga0495646_0054721
1490 Ga0495646_0056971
1491 Ga0495646_0074070
1492 Ga0495658_0000420
1493 Ga0495658_0009910
1494 Ga0495613_0001484
1495 Ga0495613_0153011
1496 Ga0495624_0003095
1497 Ga0495649_0002747
1498 Ga0495649_0115963
1499 Ga0495600_0004615
1500 Ga0495600_0004930
1501 Ga0495600_0021201
1502 Ga0495600_0104968
1503 Ga0495581_0000103
1504 Ga0495581_0007321
1505 Ga0495581_0193376
1506 Ga0495604_0010711
1507 Ga0495604_0020575
1508 Ga0495604_0022153
1509 Ga0495604_0223845
1510 Ga0495674_0000367
1511 Ga0495674_0011448
1512 Ga0495674_0028981
1513 Ga0495674_0093154
1514 Ga0495674_0098456
1515 Ga0495674_0325532
1516 Ga0495672_0037918
1517 Ga0495676_0344750
1518 Ga0495676_0387975
1519 Ga0495680_0002243
1520 Ga0495680_0012531
1521 Ga0495687_110629
1522 Ga0495675_0000978
1523 Ga0495675_0014791
1524 Ga0495677_0083420
1525 Ga0495673_0017078
1526 Ga0495684_0000081
1527 Ga0495684_0021483
1528 Ga0495684_0110828
1529 Ga0495684_0160475
1530 Ga0495686_0053018
1531 Ga0495593_0000134
1532 Ga0495593_0006901
1533 Ga0495593_0017419
1534 Ga0495593_0054985
1535 Ga0495602_0002985
1536 Ga0495602_0015795
1537 Ga0495602_0021964
1538 Ga0495614_0051930
1539 Ga0495626_0064666
1540 Ga0496100_0076046
1541 Ga0496100_0088745
1542 Ga0496100_0139127
1543 Ga0496100_0284854
1544 Ga0496101_0036649
1545 Ga0496101_0070038
1546 Ga0496101_0074061
1547 Ga0496101_0107324
1548 Ga0496101_0120096
1549 Ga0496101_0332696
1550 Ga0496102_0061667
1551 Ga0496102_0172121
1552 Ga0496102_0181350
1553 Ga0496103_0009458
1554 Ga0496103_0072886
1555 Ga0496104_0020661
1556 Ga0496104_0023555
1557 Ga0496104_0170732
1558 Ga0496104_0187611
1559 Ga0496104_0191155
1560 Ga0496104_0295438
1561 Ga0496105_0009535
1562 Ga0496105_0073846
1563 Ga0496105_0248252
1564 Ga0496106_0001576
1565 Ga0496106_0007942
1566 Ga0496106_0014219
1567 Ga0496106_0108285
1568 Ga0496107_0003437
1569 Ga0496107_0012956
1570 Ga0496108_0000803
1571 Ga0496108_0035470
1572 Ga0496108_0059942
1573 Ga0496108_0082787
1574 Ga0496109_0017599
1575 Ga0496109_0035686
1576 Ga0496109_0180998
1577 Ga0496109_0207305
1578 Ga0496110_0033090
1579 Ga0496110_0035078
1580 Ga0496111_0034758
1581 Ga0496111_0081365
1582 Ga0496112_0002678
1583 Ga0496112_0031886
1584 Ga0496112_0041336
1585 Ga0496112_0059955
1586 Ga0496112_0065372
1587 Ga0496112_0084420
1588 Ga0496112_0122679
1589 Ga0496112_0174083
1590 Ga0496112_0276693
1591 Ga0496112_0403036
1592 Ga0496113_0006745
1593 Ga0496113_0030431
1594 Ga0496113_0076620
1595 Ga0496113_0333899
1596 Ga0496113_0417594
1597 Ga0496114_0122685
1598 Ga0496115_0030558
1599 Ga0496115_0034886
1600 Ga0496115_0051161
1601 Ga0496115_0073670
1602 Ga0496115_0078638
1603 Ga0496115_0087988
1604 Ga0496115_0132941
1605 Ga0496115_0185976
1606 Ga0496115_0256936
1607 Ga0496115_0376093
1608 Ga0496116_0010704
1609 Ga0496118_0091668
1610 Ga0496118_0099405
1611 Ga0496119_0008410
1612 Ga0496121_0000786
1613 Ga0496121_0027631
1614 Ga0496121_0048983
1615 Ga0496122_0024213
1616 Ga0496122_0177556
1617 Ga0496124_0128793
1618 Ga0496125_0016759
1619 Ga0496125_0120442
1620 Ga0496126_0003797
1621 Ga0496126_0008016
1622 Ga0496126_0088722
1623 Ga0496126_0130468
1624 Ga0501032_0000011
1625 Ga0501032_0006585
1626 Ga0501034_0000001
1627 Ga0501034_0080206
1628 Ga0501034_0284372
1629 Ga0501039_0000243
1630 Ga0501046_0163524
1631 Ga0501047_0024350
1632 Ga0501067_0021642
1633 Ga0501069_0025177
1634 Ga0501070_0354137
1635 Ga0501072_0137362
1636 Ga0501073_0320723
1637 Ga0501074_0029125
1638 Ga0501076_0460983
1639 Ga0501080_0085994
1640 Ga0501083_0187680
1641 Ga0501083_0212691
1642 nmdc:mga03n38_51196_c1
1643 nmdc:mga03n38_6973_c1
1644 nmdc:mga00v17_247168_c1
1645 nmdc:mga0yw44_264557_c1
1646 nmdc:mga0k408_10614_c1
1647 nmdc:mga0k408_68103_c1
1648 nmdc:mga06z11_161856_c1
1649 nmdc:mga06z11_275423_c1
1650 nmdc:mga07m45_157538_c1
1651 nmdc:mga07m45_274344_c1
1652 nmdc:mga05p37_736569_c1
1653 nmdc:mga08y16_56695_c1
1654 nmdc:mga08y16_891197_c1
1655 nmdc:mga0n895_37552_c1
1656 nmdc:mga0rr50_125176_c1
1657 nmdc:mga0sz30_20473_c1
1658 Ga0495601_0004544
1659 Ga0495601_0122151
1660 Ga0495601_0244302
1661 Ga0495612_0108920
1662 Ga0500610_0194633
1663 Ga0495595_0000924
1664 Ga0495595_0060631
1665 Ga0495619_0000761
1666 Ga0495619_0045971
1667 Ga0495619_0058480
1668 Ga0495619_0174706
1669 Ga0500643_000049
1670 Ga0500647_0011817
1671 Ga0500583_0053404
1672 Ga0500566_0000054
1673 Ga0500566_0002813
1674 Ga0500566_0204817
1675 Ga0500640_124748
1676 Ga0500641_0023389
1677 Ga0500556_0013425
1678 Ga0500556_0051714
1679 Ga0500556_0127844
1680 Ga0500557_000118
1681 Ga0500569_103259
1682 Ga0500572_030574
1683 Ga0500592_013606
1684 Ga0500595_008077
1685 Ga0500595_014837
1686 Ga0500595_021175
1687 Ga0500607_049118
1688 Ga0500614_022081
1689 Ga0500642_0000164
1690 Ga0500642_0030702
1691 Ga0500642_0093164
1692 Ga0500559_0014505
1693 Ga0500559_0020595
1694 Ga0500559_0038988
1695 Ga0500568_0014981
1696 Ga0500616_0011794
1697 Ga0500620_009505
1698 Ga0500638_004886
1699 Ga0500639_005653
1700 Ga0500639_158143
1701 Ga0500636_0068534
1702 Ga0500636_0131471
1703 Ga0500625_022233
1704 Ga0500596_001677
1705 Ga0500596_013825
1706 Ga0500601_012623
1707 Ga0501084_0274526
1708 Ga0501084_0541863
1709 Ga0500661_008628
1710 2507505085
1711 2508539020
1712 2508695337
1713 2511394522
1714 2513623250
1715 2513639769
1716 2513647741
1717 2513677545
1718 2513699303
1719 2513719842
1720 2513873690
1721 2513888900
1722 2514012325
1723 2515625647
1724 2517102134
1725 2524435942
1726 2524467358
1727 2528852496
1728 2617350949
1729 2617373604
1730 2745081538
1731 2793064941
1732 2805915773
1733 2818237504
1734 2824608249
1735 2824612177
1736 2824620658
1737 2824629915
1738 2824640571
1739 2824647486
1740 2824655566
1741 2824668988
1742 2824675772
1743 2824683796
1744 2824691894
1745 2824701034
1746 2824711025
1747 2824718274
1748 2824728544
1749 2824736205
1750 2824751360
1751 2824760397
1752 2824770847
1753 2824775673
1754 2838124349
1755 2841945042
1756 2841951828
1757 2841964764
1758 2841973796
1759 2841980122
1760 2841985305
1761 2842043655
1762 2842052355
1763 2844315141
1764 2847930927
1765 2847941982
1766 2849082891
1767 2857511777
1768 2874597084
1769 2874616678
1770 2874624635
1771 2874628965
1772 2874648068
1773 2876765595
1774 2876777548
1775 2876825630
1776 2879077756
1777 2879089816
1778 2879108724
1779 2879130914
1780 2879148851
1781 2881365827
1782 2881665916
1783 2885371189
1784 2885389740
1785 2885410547
1786 2888379740
1787 2888390827
1788 2888420463
1789 2903732043
1790 2903773390
1791 2904670410
1792 2904715736
1793 2906603091
1794 2906633438
1795 2906648668
1796 2908776078
1797 2922364140
1798 2922368778
1799 2922396285
1800 2929618421
1801 2929628894
1802 2932786599
1803 2932794475
1804 2932806756
1805 2932812341
1806 2932823333
1807 2932829827
1808 2933580866
1809 2935615339
1810 2935618345
1811 2935641257
1812 2935654838
1813 2935663729
1814 2935670173
1815 2935680829
1816 2935689847
1817 2935698368
1818 2935707510
1819 2935717367
1820 2935723964
1821 2935740173
1822 2935749436
1823 2935757201
1824 2935763711
1825 2935773403
1826 2935782276
1827 2935789229
1828 2935797166
1829 2935804112
1830 2935815196
1831 2935825283
1832 2935830988
1833 2935841599
1834 2935853117
1835 2935862560
1836 2935866512
1837 2935874819
1838 2935888527
1839 2935910135
1840 2935918568
1841 2935927954
1842 2935936174
1843 2935944273
1844 2935952710
1845 2935962489
1846 2935969550
1847 2935977689
1848 2935984995
1849 2935994325
1850 2936004697
1851 2936017874
1852 2936026377
1853 2936031575
1854 2936043263
1855 2936053361
1856 2936056164
1857 2940563115
1858 2941532538
1859 2941543031
1860 3005486751
1861 3005509331
1862 3005594058
1863 3005594866
1864 3005710848
1865 3005718144
1866 8006929807
1867 8006969485
1868 8006996739
1869 8016518371
1870 8016525983
1871 8016539586
1872 8016543883
1873 8016549421
1874 8016557844
1875 8016581913
1876 8016595863
1877 8016606728
1878 8016618628
1879 8016623375
1880 8016635832
1881 8017058289
1882 8019530867
1883 8019540717
1884 8019550395
1885 8019577421
1886 8019595511
1887 8019606251
1888 8019612278
1889 8019622803
1890 8019630303
1891 8019640304
1892 8019652641
1893 8019667132
1894 8019676920
1895 8019679070
1896 8019696456
1897 8055742272
1898 8056675586
1899 8056687543
1900 8056971126

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

297

0.99

PF00106

adh_short

short chain dehydrogenase

54

249

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tf4-assembly2.cif.gz_F crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad 0.9827 3 254
3grk-assembly2.cif.gz_G crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis 0.9815 3 254
4eit-assembly2.cif.gz_E-2 crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.9815 2 254
8jfm-assembly2.cif.gz_E crystal structure of enoyl-acp reductase fabi in complex with nadh from helicobacter pylori 0.9814 3 254
2p91-assembly1.cif.gz_A crystal structure of enoyl-[acyl-carrier-protein] reductase (nadh) from aquifex aeolicus vf5 0.9793 3 254
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9802 3 254 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 3 254 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 5 254 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9696 5 254 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 3 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A431MZJ8-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.996 5 138 GO:0004318
GO:0006633
AF-A0A357X796-F1-model_v4 deleted 0.9955 1 189
AF-A0A531N3K7-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9941 1 177 GO:0004318
GO:0006633
AF-A0A530H3P2-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.994 1 198 GO:0004318
GO:0006633
GO:0016746
AF-A0A356HZB3-F1-model_v4 NADH-specific enoyl-ACP reductase 0.9928 3 166 GO:0004318
GO:0006633

Map