F486575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 951 | 298 | 1902 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100083925|Ga0070683_1000839251 |
| Length | 354 |
| Sequence | LRREIYFPVLTNPSIIIIPTSVGIFLLLFLTISRCFIPLPVYQKYKRNCSPIPIPLLLNKTLFMLKSMTGFGRSEQAVGDKTFQVDIKSLNGKQFELLLKLPGFLKPLEFDIRRILSAKLGRGSVDCAISLKETGNAKPVSINTDLAKAYYKPLSELSQALNLDPSHILSTLVKLPEVITPTADTLSDAEWVNFQKVLNAAIDDLNLHRAEEGRSLEEDLLLRIDNIQRQQEEILKLEPGRQQKIRDGLTKLLEENVGKENYDGNRLEQEMIYYIEKIDISEEQVRLKNHCDYFKAIMSEAEESKGKKLSFILQEIGREINTTGAKAYDATIQKCVVIMKDELEKAKEQILNVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 198 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 199 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 200 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 253 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 255 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 260 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 262 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 279 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 280 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 282 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 289 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 294 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 295 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 298 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.15 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 94.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100083925 | 3300005329 | Bacteria | 2984 |
| 2 | MBSR1b_contig_334244 | 2162886012 | Bacteria | 2124 |
| 3 | CNXas_1001191 | 3300000545 | Bacteria | 1720 |
| 4 | JGI24736J21556_1003024 | 3300001904 | Bacteria | 2937 |
| 5 | JGI24740J21852_10031413 | 3300001979 | Bacteria | 1713 |
| 6 | JGI24751J29686_10021868 | 3300002459 | Bacteria | 1326 |
| 7 | rootH2_10001613 | 3300003320 | Bacteria | 20111 |
| 8 | rootH2_10001614 | 3300003320 | Bacteria | 29985 |
| 9 | rootH2_10023604 | 3300003320 | Bacteria | 13207 |
| 10 | rootH2_10039966 | 3300003320 | Bacteria | 1236 |
| 11 | rootL2_10113255 | 3300003322 | Bacteria | 2187 |
| 12 | rootH1_10066431 | 3300003323 | Bacteria | 1919 |
| 13 | rootH1_10222292 | 3300003323 | Bacteria | 4137 |
| 14 | rootH1_10270826 | 3300003323 | Bacteria | 1377 |
| 15 | JGI25160J50197_1000262 | 3300003354 | Bacteria | 39642 |
| 16 | Ga0065704_10031790 | 3300005289 | Bacteria | 1043 |
| 17 | Ga0065704_10123993 | 3300005289 | Bacteria | 1725 |
| 18 | Ga0065704_10168158 | 3300005289 | Bacteria | 1299 |
| 19 | Ga0065712_10014215 | 3300005290 | Bacteria | 1595 |
| 20 | Ga0065712_10017724 | 3300005290 | Bacteria | 2968 |
| 21 | Ga0065712_10082292 | 3300005290 | Bacteria | 2929 |
| 22 | Ga0065712_10131098 | 3300005290 | Bacteria | 1545 |
| 23 | Ga0065715_10017649 | 3300005293 | Bacteria | 3021 |
| 24 | Ga0065715_10107768 | 3300005293 | Bacteria | 2754 |
| 25 | Ga0065707_10208036 | 3300005295 | Bacteria | 1265 |
| 26 | Ga0070658_10000563 | 3300005327 | Bacteria | 32232 |
| 27 | Ga0070658_10043116 | 3300005327 | Bacteria | 3645 |
| 28 | Ga0070676_10000218 | 3300005328 | Bacteria | 24620 |
| 29 | Ga0070676_10012670 | 3300005328 | Bacteria | 4609 |
| 30 | Ga0070676_10016335 | 3300005328 | Bacteria | 4103 |
| 31 | Ga0070676_10063489 | 3300005328 | Bacteria | 2200 |
| 32 | Ga0070676_10120344 | 3300005328 | Bacteria | 1647 |
| 33 | Ga0070683_100002723 | 3300005329 | Bacteria | 14112 |
| 34 | Ga0070683_100010919 | 3300005329 | Bacteria | 7822 |
| 35 | Ga0070683_100013457 | 3300005329 | Bacteria | 7135 |
| 36 | Ga0070683_100120086 | 3300005329 | Bacteria | 2482 |
| 37 | Ga0070690_100008208 | 3300005330 | Bacteria | 6006 |
| 38 | Ga0070690_100163166 | 3300005330 | Bacteria | 1528 |
| 39 | Ga0070690_100275366 | 3300005330 | Bacteria | 1199 |
| 40 | Ga0070670_100017530 | 3300005331 | Bacteria | 6144 |
| 41 | Ga0070670_100027025 | 3300005331 | Bacteria | 4936 |
| 42 | Ga0070670_100041055 | 3300005331 | Bacteria | 3976 |
| 43 | Ga0070670_100042974 | 3300005331 | Unclassified | 3886 |
| 44 | Ga0070670_100045367 | 3300005331 | Bacteria | 3778 |
| 45 | Ga0070670_100109684 | 3300005331 | Unclassified | 2378 |
| 46 | Ga0070670_100142938 | 3300005331 | Bacteria | 2069 |
| 47 | Ga0070670_100282343 | 3300005331 | Bacteria | 1450 |
| 48 | Ga0070670_100311675 | 3300005331 | Bacteria | 1378 |
| 49 | Ga0070677_10050904 | 3300005333 | Bacteria | 1674 |
| 50 | Ga0068869_100010867 | 3300005334 | Bacteria | 5954 |
| 51 | Ga0068869_100010963 | 3300005334 | Bacteria | 5935 |
| 52 | Ga0068869_100035886 | 3300005334 | Bacteria | 3517 |
| 53 | Ga0068869_100043025 | 3300005334 | Bacteria | 3241 |
| 54 | Ga0068869_100049082 | 3300005334 | Bacteria | 3054 |
| 55 | Ga0068869_100052642 | 3300005334 | Bacteria | 2956 |
| 56 | Ga0068869_100053388 | 3300005334 | Bacteria | 2938 |
| 57 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 58 | Ga0070666_10000969 | 3300005335 | Bacteria | 17521 |
| 59 | Ga0070666_10138495 | 3300005335 | Bacteria | 1695 |
| 60 | Ga0070666_10176280 | 3300005335 | Bacteria | 1499 |
| 61 | Ga0070666_10193496 | 3300005335 | Bacteria | 1429 |
| 62 | Ga0070680_100008932 | 3300005336 | Bacteria | 7683 |
| 63 | Ga0070680_100289070 | 3300005336 | Unclassified | 1389 |
| 64 | Ga0070682_100005089 | 3300005337 | Bacteria | 7306 |
| 65 | Ga0068868_100000770 | 3300005338 | Bacteria | 21666 |
| 66 | Ga0068868_100004154 | 3300005338 | Bacteria | 10119 |
| 67 | Ga0068868_100111604 | 3300005338 | Bacteria | 2222 |
| 68 | Ga0068868_100226016 | 3300005338 | Bacteria | 1568 |
| 69 | Ga0070689_100053208 | 3300005340 | Bacteria | 3132 |
| 70 | Ga0070689_100105074 | 3300005340 | Bacteria | 2240 |
| 71 | Ga0070689_100300424 | 3300005340 | Bacteria | 1336 |
| 72 | Ga0070689_100362621 | 3300005340 | Bacteria | 1218 |
| 73 | Ga0070691_10014568 | 3300005341 | Bacteria | 3609 |
| 74 | Ga0070691_10017921 | 3300005341 | Bacteria | 3260 |
| 75 | Ga0070691_10049530 | 3300005341 | Unclassified | 2002 |
| 76 | Ga0070687_100077735 | 3300005343 | Bacteria | 1801 |
| 77 | Ga0070687_100079238 | 3300005343 | Bacteria | 1787 |
| 78 | Ga0070661_100010396 | 3300005344 | Bacteria | 6469 |
| 79 | Ga0070661_100036341 | 3300005344 | Bacteria | 3581 |
| 80 | Ga0070668_100000110 | 3300005347 | Bacteria | 50766 |
| 81 | Ga0070668_100043857 | 3300005347 | Bacteria | 3430 |
| 82 | Ga0070668_100084636 | 3300005347 | Bacteria | 2491 |
| 83 | Ga0070668_100085712 | 3300005347 | Bacteria | 2476 |
| 84 | Ga0070668_100139189 | 3300005347 | Bacteria | 1955 |
| 85 | Ga0070668_100236555 | 3300005347 | Bacteria | 1512 |
| 86 | Ga0070669_100001473 | 3300005353 | Bacteria | 17021 |
| 87 | Ga0070669_100002379 | 3300005353 | Bacteria | 13607 |
| 88 | Ga0070669_100068742 | 3300005353 | Bacteria | 2615 |
| 89 | Ga0070669_100097648 | 3300005353 | Bacteria | 2211 |
| 90 | Ga0070669_100472716 | 3300005353 | Unclassified | 1036 |
| 91 | Ga0070669_100525920 | 3300005353 | Unclassified | 984 |
| 92 | Ga0070675_100002848 | 3300005354 | Bacteria | 13041 |
| 93 | Ga0070675_100018980 | 3300005354 | Bacteria | 5477 |
| 94 | Ga0070675_100029656 | 3300005354 | Bacteria | 4414 |
| 95 | Ga0070675_100031505 | 3300005354 | Bacteria | 4287 |
| 96 | Ga0070675_100041514 | 3300005354 | Bacteria | 3758 |
| 97 | Ga0070675_100067038 | 3300005354 | Bacteria | 2969 |
| 98 | Ga0070675_100081817 | 3300005354 | Bacteria | 2693 |
| 99 | Ga0070675_100414487 | 3300005354 | Bacteria | 1204 |
| 100 | Ga0070671_100094844 | 3300005355 | Bacteria | 2501 |
| 101 | Ga0070671_100260952 | 3300005355 | Bacteria | 1472 |
| 102 | Ga0070671_100268718 | 3300005355 | Bacteria | 1449 |
| 103 | Ga0070671_100324490 | 3300005355 | Unclassified | 1312 |
| 104 | Ga0070674_100021561 | 3300005356 | Bacteria | 4140 |
| 105 | Ga0070674_100060310 | 3300005356 | Unclassified | 2644 |
| 106 | Ga0070674_100174733 | 3300005356 | Bacteria | 1640 |
| 107 | Ga0070674_100189387 | 3300005356 | Unclassified | 1581 |
| 108 | Ga0070674_100247367 | 3300005356 | Bacteria | 1399 |
| 109 | Ga0070674_100330890 | 3300005356 | Unclassified | 1224 |
| 110 | Ga0070674_100331303 | 3300005356 | Bacteria | 1224 |
| 111 | Ga0070673_100000676 | 3300005364 | Bacteria | 18803 |
| 112 | Ga0070673_100007165 | 3300005364 | Bacteria | 7327 |
| 113 | Ga0070673_100099761 | 3300005364 | Bacteria | 2389 |
| 114 | Ga0070673_100124049 | 3300005364 | Bacteria | 2159 |
| 115 | Ga0070673_100331052 | 3300005364 | Bacteria | 1347 |
| 116 | Ga0070688_100044280 | 3300005365 | Bacteria | 2746 |
| 117 | Ga0070688_100052281 | 3300005365 | Bacteria | 2551 |
| 118 | Ga0070688_100058779 | 3300005365 | Bacteria | 2422 |
| 119 | Ga0070688_100065318 | 3300005365 | Bacteria | 2312 |
| 120 | Ga0070659_100002166 | 3300005366 | Bacteria | 13998 |
| 121 | Ga0070667_100000867 | 3300005367 | Bacteria | 28069 |
| 122 | Ga0070667_100005066 | 3300005367 | Bacteria | 11030 |
| 123 | Ga0070667_100082127 | 3300005367 | Bacteria | 2759 |
| 124 | Ga0070667_100144802 | 3300005367 | Unclassified | 2083 |
| 125 | Ga0070667_100159093 | 3300005367 | Bacteria | 1988 |
| 126 | Ga0070667_100161702 | 3300005367 | Bacteria | 1972 |
| 127 | Ga0070667_100216068 | 3300005367 | Bacteria | 1705 |
| 128 | Ga0070701_10011234 | 3300005438 | Bacteria | 3996 |
| 129 | Ga0070701_10051278 | 3300005438 | Unclassified | 2140 |
| 130 | Ga0070705_100469234 | 3300005440 | Bacteria | 948 |
| 131 | Ga0070700_100017034 | 3300005441 | Bacteria | 4150 |
| 132 | Ga0070700_100117854 | 3300005441 | Bacteria | 1775 |
| 133 | Ga0070694_100428125 | 3300005444 | Bacteria | 1041 |
| 134 | Ga0070663_100394720 | 3300005455 | Bacteria | 1129 |
| 135 | Ga0070678_100012152 | 3300005456 | Bacteria | 5340 |
| 136 | Ga0070678_100018402 | 3300005456 | Bacteria | 4526 |
| 137 | Ga0070678_100060775 | 3300005456 | Bacteria | 2783 |
| 138 | Ga0070678_100072731 | 3300005456 | Bacteria | 2578 |
| 139 | Ga0070678_100238553 | 3300005456 | Bacteria | 1519 |
| 140 | Ga0070662_100003337 | 3300005457 | Bacteria | 10011 |
| 141 | Ga0070662_100007311 | 3300005457 | Bacteria | 7156 |
| 142 | Ga0070662_100071331 | 3300005457 | Bacteria | 2561 |
| 143 | Ga0070681_10031472 | 3300005458 | Bacteria | 5327 |
| 144 | Ga0070681_10047183 | 3300005458 | Bacteria | 4306 |
| 145 | Ga0070681_10226800 | 3300005458 | Unclassified | 1783 |
| 146 | Ga0068867_100002557 | 3300005459 | Bacteria | 12824 |
| 147 | Ga0068867_100003149 | 3300005459 | Bacteria | 11633 |
| 148 | Ga0068867_100011145 | 3300005459 | Bacteria | 6342 |
| 149 | Ga0068867_100039464 | 3300005459 | Bacteria | 3442 |
| 150 | Ga0068867_100101990 | 3300005459 | Bacteria | 2193 |
| 151 | Ga0068867_100127529 | 3300005459 | Bacteria | 1973 |
| 152 | Ga0068867_100141137 | 3300005459 | Unclassified | 1883 |
| 153 | Ga0068867_100165249 | 3300005459 | Bacteria | 1748 |
| 154 | Ga0068867_100269827 | 3300005459 | Bacteria | 1391 |
| 155 | Ga0068867_100325030 | 3300005459 | Bacteria | 1276 |
| 156 | Ga0070685_10004008 | 3300005466 | Bacteria | 7437 |
| 157 | Ga0070685_10005889 | 3300005466 | Bacteria | 6238 |
| 158 | Ga0070685_10041642 | 3300005466 | Bacteria | 2618 |
| 159 | Ga0070685_10080691 | 3300005466 | Bacteria | 1949 |
| 160 | Ga0070698_100003130 | 3300005471 | Bacteria | 18229 |
| 161 | Ga0070698_100008121 | 3300005471 | Bacteria | 11346 |
| 162 | Ga0070698_100083795 | 3300005471 | Bacteria | 3177 |
| 163 | Ga0070679_100026175 | 3300005530 | Bacteria | 5727 |
| 164 | Ga0070684_100002319 | 3300005535 | Bacteria | 14029 |
| 165 | Ga0070684_100300283 | 3300005535 | Unclassified | 1473 |
| 166 | Ga0068853_100001650 | 3300005539 | Bacteria | 16317 |
| 167 | Ga0068853_100012660 | 3300005539 | Bacteria | 6868 |
| 168 | Ga0068853_100023980 | 3300005539 | Bacteria | 5114 |
| 169 | Ga0068853_100067584 | 3300005539 | Bacteria | 3105 |
| 170 | Ga0068853_100187709 | 3300005539 | Bacteria | 1877 |
| 171 | Ga0070672_100000020 | 3300005543 | Bacteria | 69277 |
| 172 | Ga0070672_100005102 | 3300005543 | Bacteria | 8661 |
| 173 | Ga0070672_100014302 | 3300005543 | Bacteria | 5623 |
| 174 | Ga0070672_100071516 | 3300005543 | Bacteria | 2760 |
| 175 | Ga0070672_100121732 | 3300005543 | Bacteria | 2136 |
| 176 | Ga0070672_100146590 | 3300005543 | Bacteria | 1951 |
| 177 | Ga0070686_100002348 | 3300005544 | Bacteria | 10422 |
| 178 | Ga0070686_100058584 | 3300005544 | Bacteria | 2478 |
| 179 | Ga0070693_100012647 | 3300005547 | Unclassified | 4276 |
| 180 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 181 | Ga0070665_100000318 | 3300005548 | Bacteria | 74326 |
| 182 | Ga0070665_100010501 | 3300005548 | Bacteria | 9368 |
| 183 | Ga0068855_100002787 | 3300005563 | Bacteria | 21515 |
| 184 | Ga0068855_100078411 | 3300005563 | Bacteria | 3832 |
| 185 | Ga0068855_100121294 | 3300005563 | Bacteria | 2992 |
| 186 | Ga0068855_100452504 | 3300005563 | Unclassified | 1401 |
| 187 | Ga0068855_100779546 | 3300005563 | Bacteria | 1017 |
| 188 | Ga0070664_100001959 | 3300005564 | Bacteria | 16513 |
| 189 | Ga0070664_100020090 | 3300005564 | Bacteria | 5499 |
| 190 | Ga0070664_100055149 | 3300005564 | Bacteria | 3373 |
| 191 | Ga0070664_100194779 | 3300005564 | Unclassified | 1807 |
| 192 | Ga0070664_100215762 | 3300005564 | Bacteria | 1715 |
| 193 | Ga0070664_100241149 | 3300005564 | Bacteria | 1623 |
| 194 | Ga0070664_100248832 | 3300005564 | Unclassified | 1597 |
| 195 | Ga0068857_100009364 | 3300005577 | Bacteria | 8503 |
| 196 | Ga0068857_100056966 | 3300005577 | Bacteria | 3469 |
| 197 | Ga0068857_100146526 | 3300005577 | Bacteria | 2136 |
| 198 | Ga0068857_100159105 | 3300005577 | Bacteria | 2049 |
| 199 | Ga0068857_100209724 | 3300005577 | Bacteria | 1777 |
| 200 | Ga0068857_100387008 | 3300005577 | Unclassified | 1299 |
| 201 | Ga0068854_100005213 | 3300005578 | Bacteria | 8197 |
| 202 | Ga0068854_100012243 | 3300005578 | Bacteria | 5615 |
| 203 | Ga0068854_100052881 | 3300005578 | Bacteria | 2914 |
| 204 | Ga0068854_100097041 | 3300005578 | Bacteria | 2203 |
| 205 | Ga0068856_100400170 | 3300005614 | Unclassified | 1393 |
| 206 | Ga0070702_100012795 | 3300005615 | Bacteria | 4220 |
| 207 | Ga0068852_100000706 | 3300005616 | Bacteria | 21835 |
| 208 | Ga0068852_100005115 | 3300005616 | Bacteria | 9343 |
| 209 | Ga0068852_100027749 | 3300005616 | Bacteria | 4619 |
| 210 | Ga0068852_100034227 | 3300005616 | Bacteria | 4225 |
| 211 | Ga0068852_100039363 | 3300005616 | Unclassified | 3980 |
| 212 | Ga0068852_100085807 | 3300005616 | Bacteria | 2805 |
| 213 | Ga0068852_100100072 | 3300005616 | Bacteria | 2614 |
| 214 | Ga0068852_100103271 | 3300005616 | Bacteria | 2577 |
| 215 | Ga0068852_100323991 | 3300005616 | Bacteria | 1497 |
| 216 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 217 | Ga0068859_100008596 | 3300005617 | Bacteria | 10325 |
| 218 | Ga0068859_100052034 | 3300005617 | Bacteria | 4118 |
| 219 | Ga0068859_100059293 | 3300005617 | Bacteria | 3856 |
| 220 | Ga0068859_100064397 | 3300005617 | Bacteria | 3698 |
| 221 | Ga0068859_100094417 | 3300005617 | Bacteria | 3043 |
| 222 | Ga0068859_100139763 | 3300005617 | Bacteria | 2495 |
| 223 | Ga0068859_100149959 | 3300005617 | Bacteria | 2407 |
| 224 | Ga0068859_100304771 | 3300005617 | Bacteria | 1686 |
| 225 | Ga0068859_100363937 | 3300005617 | Bacteria | 1541 |
| 226 | Ga0068859_100471436 | 3300005617 | Bacteria | 1351 |
| 227 | Ga0068859_100494489 | 3300005617 | Bacteria | 1318 |
| 228 | Ga0068864_100019039 | 3300005618 | Bacteria | 5738 |
| 229 | Ga0068864_100023009 | 3300005618 | Bacteria | 5229 |
| 230 | Ga0068864_100080256 | 3300005618 | Bacteria | 2858 |
| 231 | Ga0068864_100181149 | 3300005618 | Unclassified | 1926 |
| 232 | Ga0068864_100242209 | 3300005618 | Unclassified | 1671 |
| 233 | Ga0068864_100285423 | 3300005618 | Unclassified | 1542 |
| 234 | Ga0068864_100337116 | 3300005618 | Bacteria | 1420 |
| 235 | Ga0068864_100360640 | 3300005618 | Bacteria | 1373 |
| 236 | Ga0068864_100362923 | 3300005618 | Bacteria | 1369 |
| 237 | Ga0068864_100472784 | 3300005618 | Unclassified | 1202 |
| 238 | Ga0068861_100005965 | 3300005719 | Bacteria | 8274 |
| 239 | Ga0068861_100006160 | 3300005719 | Bacteria | 8159 |
| 240 | Ga0068861_100017923 | 3300005719 | Bacteria | 5034 |
| 241 | Ga0068861_100098334 | 3300005719 | Bacteria | 2323 |
| 242 | Ga0068861_100139407 | 3300005719 | Bacteria | 1978 |
| 243 | Ga0068861_100268506 | 3300005719 | Bacteria | 1464 |
| 244 | Ga0068851_10002057 | 3300005834 | Bacteria | 8863 |
| 245 | Ga0068851_10060315 | 3300005834 | Bacteria | 1942 |
| 246 | Ga0068851_10093321 | 3300005834 | Bacteria | 1588 |
| 247 | Ga0068870_10010085 | 3300005840 | Bacteria | 4322 |
| 248 | Ga0068863_100000678 | 3300005841 | Bacteria | 34425 |
| 249 | Ga0068863_100044914 | 3300005841 | Bacteria | 4193 |
| 250 | Ga0068863_100052243 | 3300005841 | Bacteria | 3874 |
| 251 | Ga0068863_100053424 | 3300005841 | Bacteria | 3830 |
| 252 | Ga0068863_100054049 | 3300005841 | Bacteria | 3806 |
| 253 | Ga0068863_100104393 | 3300005841 | Bacteria | 2696 |
| 254 | Ga0068863_100141393 | 3300005841 | Bacteria | 2300 |
| 255 | Ga0068863_100177321 | 3300005841 | Bacteria | 2045 |
| 256 | Ga0068863_100221922 | 3300005841 | Bacteria | 1821 |
| 257 | Ga0068863_100320082 | 3300005841 | Unclassified | 1506 |
| 258 | Ga0068863_100503015 | 3300005841 | Bacteria | 1193 |
| 259 | Ga0068858_100001487 | 3300005842 | Bacteria | 24140 |
| 260 | Ga0068858_100004205 | 3300005842 | Bacteria | 14172 |
| 261 | Ga0068858_100077777 | 3300005842 | Bacteria | 3082 |
| 262 | Ga0068858_100457631 | 3300005842 | Unclassified | 1230 |
| 263 | Ga0068858_100584948 | 3300005842 | Bacteria | 1082 |
| 264 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 265 | Ga0068860_100001096 | 3300005843 | Bacteria | 29818 |
| 266 | Ga0068860_100002430 | 3300005843 | Bacteria | 19567 |
| 267 | Ga0068860_100004305 | 3300005843 | Bacteria | 14551 |
| 268 | Ga0068860_100012083 | 3300005843 | Bacteria | 8504 |
| 269 | Ga0068860_100072898 | 3300005843 | Bacteria | 3264 |
| 270 | Ga0068860_100106190 | 3300005843 | Bacteria | 2682 |
| 271 | Ga0068860_100203402 | 3300005843 | Bacteria | 1920 |
| 272 | Ga0068860_100650241 | 3300005843 | Bacteria | 1062 |
| 273 | Ga0068862_100003320 | 3300005844 | Bacteria | 13899 |
| 274 | Ga0068862_100034416 | 3300005844 | Bacteria | 4286 |
| 275 | Ga0068862_100078194 | 3300005844 | Bacteria | 2866 |
| 276 | Ga0081540_1010602 | 3300005983 | Bacteria | 6223 |
| 277 | Ga0081539_10008868 | 3300005985 | Bacteria | 8597 |
| 278 | Ga0075366_10008445 | 3300006195 | Bacteria | 5728 |
| 279 | Ga0075366_10046150 | 3300006195 | Bacteria | 2582 |
| 280 | Ga0075366_10213953 | 3300006195 | Bacteria | 1174 |
| 281 | Ga0097621_100000408 | 3300006237 | Bacteria | 30010 |
| 282 | Ga0097621_100002080 | 3300006237 | Bacteria | 13697 |
| 283 | Ga0097621_100034071 | 3300006237 | Bacteria | 4059 |
| 284 | Ga0097621_100044792 | 3300006237 | Bacteria | 3571 |
| 285 | Ga0097621_100052284 | 3300006237 | Bacteria | 3328 |
| 286 | Ga0097621_100086952 | 3300006237 | Bacteria | 2609 |
| 287 | Ga0097621_100144943 | 3300006237 | Bacteria | 2032 |
| 288 | Ga0097621_100224492 | 3300006237 | Unclassified | 1638 |
| 289 | Ga0068871_100001316 | 3300006358 | Bacteria | 16589 |
| 290 | Ga0068871_100009317 | 3300006358 | Bacteria | 7107 |
| 291 | Ga0068871_100013565 | 3300006358 | Bacteria | 6050 |
| 292 | Ga0068871_100074802 | 3300006358 | Bacteria | 2795 |
| 293 | Ga0068871_100093902 | 3300006358 | Bacteria | 2503 |
| 294 | Ga0068871_100110820 | 3300006358 | Bacteria | 2308 |
| 295 | Ga0068871_100118969 | 3300006358 | Bacteria | 2229 |
| 296 | Ga0068871_100195166 | 3300006358 | Bacteria | 1745 |
| 297 | Ga0068871_100219032 | 3300006358 | Bacteria | 1648 |
| 298 | Ga0068871_100303670 | 3300006358 | Bacteria | 1401 |
| 299 | Ga0068871_100554324 | 3300006358 | Bacteria | 1041 |
| 300 | Ga0075428_100011391 | 3300006844 | Bacteria | 9893 |
| 301 | Ga0075430_100002480 | 3300006846 | Bacteria | 15380 |
| 302 | Ga0075431_100012701 | 3300006847 | Bacteria | 8505 |
| 303 | Ga0075431_100028634 | 3300006847 | Bacteria | 5727 |
| 304 | Ga0075434_100058540 | 3300006871 | Bacteria | 3829 |
| 305 | Ga0075429_100011160 | 3300006880 | Bacteria | 7778 |
| 306 | Ga0075429_100162753 | 3300006880 | Bacteria | 1954 |
| 307 | Ga0075429_100219034 | 3300006880 | Bacteria | 1667 |
| 308 | Ga0075429_100363176 | 3300006880 | Bacteria | 1268 |
| 309 | Ga0068865_100000289 | 3300006881 | Bacteria | 27735 |
| 310 | Ga0068865_100014376 | 3300006881 | Bacteria | 5028 |
| 311 | Ga0068865_100119405 | 3300006881 | Bacteria | 1958 |
| 312 | Ga0068865_100156102 | 3300006881 | Bacteria | 1736 |
| 313 | Ga0068865_100218889 | 3300006881 | Bacteria | 1488 |
| 314 | Ga0068865_100269325 | 3300006881 | Bacteria | 1352 |
| 315 | Ga0068865_100468022 | 3300006881 | Bacteria | 1045 |
| 316 | Ga0068865_100536709 | 3300006881 | Bacteria | 980 |
| 317 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 318 | Ga0097620_100008596 | 3300006931 | Bacteria | 10325 |
| 319 | Ga0097620_100052035 | 3300006931 | Bacteria | 4118 |
| 320 | Ga0097620_100059292 | 3300006931 | Bacteria | 3856 |
| 321 | Ga0097620_100064396 | 3300006931 | Bacteria | 3698 |
| 322 | Ga0097620_100094417 | 3300006931 | Bacteria | 3043 |
| 323 | Ga0097620_100139757 | 3300006931 | Bacteria | 2495 |
| 324 | Ga0097620_100149967 | 3300006931 | Bacteria | 2407 |
| 325 | Ga0097620_100304769 | 3300006931 | Bacteria | 1686 |
| 326 | Ga0097620_100363919 | 3300006931 | Bacteria | 1541 |
| 327 | Ga0097620_100471430 | 3300006931 | Bacteria | 1351 |
| 328 | Ga0097620_100494484 | 3300006931 | Bacteria | 1318 |
| 329 | Ga0075435_100532694 | 3300007076 | Bacteria | 1016 |
| 330 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 331 | Ga0105240_10001787 | 3300009093 | Bacteria | 36277 |
| 332 | Ga0105240_10001808 | 3300009093 | Bacteria | 36002 |
| 333 | Ga0105240_10004358 | 3300009093 | Bacteria | 21601 |
| 334 | Ga0105240_10006347 | 3300009093 | Bacteria | 17410 |
| 335 | Ga0105240_10027103 | 3300009093 | Bacteria | 7508 |
| 336 | Ga0105240_10030313 | 3300009093 | Bacteria | 7030 |
| 337 | Ga0105240_10077939 | 3300009093 | Bacteria | 4082 |
| 338 | Ga0105240_10130026 | 3300009093 | Bacteria | 3021 |
| 339 | Ga0111539_10005159 | 3300009094 | Bacteria | 16933 |
| 340 | Ga0111539_10011279 | 3300009094 | Bacteria | 11226 |
| 341 | Ga0111539_10973921 | 3300009094 | Bacteria | 986 |
| 342 | Ga0105245_10075256 | 3300009098 | Bacteria | 3074 |
| 343 | Ga0105245_10348637 | 3300009098 | Bacteria | 1466 |
| 344 | Ga0105247_10000312 | 3300009101 | Bacteria | 43730 |
| 345 | Ga0105247_10143840 | 3300009101 | Bacteria | 1565 |
| 346 | Ga0114129_10065303 | 3300009147 | Bacteria | 5079 |
| 347 | Ga0105243_10257374 | 3300009148 | Bacteria | 1561 |
| 348 | Ga0105241_10000608 | 3300009174 | Bacteria | 26997 |
| 349 | Ga0105241_10002863 | 3300009174 | Bacteria | 12889 |
| 350 | Ga0105241_10007807 | 3300009174 | Bacteria | 7866 |
| 351 | Ga0105241_10118363 | 3300009174 | Bacteria | 2130 |
| 352 | Ga0105241_10407171 | 3300009174 | Bacteria | 1194 |
| 353 | Ga0105242_10023950 | 3300009176 | Bacteria | 4817 |
| 354 | Ga0105242_10027545 | 3300009176 | Bacteria | 4514 |
| 355 | Ga0105242_10040915 | 3300009176 | Bacteria | 3736 |
| 356 | Ga0105242_10049420 | 3300009176 | Bacteria | 3423 |
| 357 | Ga0105242_10054712 | 3300009176 | Bacteria | 3263 |
| 358 | Ga0105242_10112344 | 3300009176 | Unclassified | 2325 |
| 359 | Ga0105242_10170647 | 3300009176 | Bacteria | 1912 |
| 360 | Ga0105242_10340543 | 3300009176 | Bacteria | 1382 |
| 361 | Ga0105248_10004712 | 3300009177 | Bacteria | 15092 |
| 362 | Ga0105248_10311544 | 3300009177 | Bacteria | 1773 |
| 363 | Ga0105237_10005526 | 3300009545 | Bacteria | 14250 |
| 364 | Ga0105237_10006018 | 3300009545 | Bacteria | 13573 |
| 365 | Ga0105237_10017111 | 3300009545 | Bacteria | 7521 |
| 366 | Ga0105237_10029264 | 3300009545 | Bacteria | 5602 |
| 367 | Ga0105237_10045917 | 3300009545 | Bacteria | 4396 |
| 368 | Ga0105237_10105188 | 3300009545 | Bacteria | 2813 |
| 369 | Ga0105237_10437648 | 3300009545 | Unclassified | 1313 |
| 370 | Ga0105237_10464807 | 3300009545 | Bacteria | 1271 |
| 371 | Ga0105238_10001710 | 3300009551 | Bacteria | 22126 |
| 372 | Ga0105238_10068041 | 3300009551 | Bacteria | 3562 |
| 373 | Ga0105238_10206644 | 3300009551 | Bacteria | 1940 |
| 374 | Ga0105249_10000623 | 3300009553 | Bacteria | 32238 |
| 375 | Ga0105249_10003608 | 3300009553 | Bacteria | 13384 |
| 376 | Ga0105249_10005813 | 3300009553 | Bacteria | 10667 |
| 377 | Ga0105249_10013950 | 3300009553 | Bacteria | 7102 |
| 378 | Ga0105249_10017890 | 3300009553 | Bacteria | 6298 |
| 379 | Ga0105249_10043810 | 3300009553 | Bacteria | 4070 |
| 380 | Ga0105249_10044259 | 3300009553 | Bacteria | 4048 |
| 381 | Ga0105249_10304953 | 3300009553 | Bacteria | 1599 |
| 382 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 383 | Ga0105239_10001405 | 3300010375 | Bacteria | 32195 |
| 384 | Ga0105239_10004672 | 3300010375 | Bacteria | 16278 |
| 385 | Ga0105239_10010217 | 3300010375 | Bacteria | 10512 |
| 386 | Ga0105239_10027401 | 3300010375 | Bacteria | 6272 |
| 387 | Ga0105239_10074269 | 3300010375 | Bacteria | 3739 |
| 388 | Ga0105239_10143777 | 3300010375 | Bacteria | 2659 |
| 389 | Ga0105239_10160955 | 3300010375 | Bacteria | 2508 |
| 390 | Ga0105239_10233100 | 3300010375 | Unclassified | 2066 |
| 391 | Ga0105239_10355450 | 3300010375 | Bacteria | 1654 |
| 392 | Ga0105246_10063575 | 3300011119 | Bacteria | 2575 |
| 393 | Ga0105246_10086076 | 3300011119 | Bacteria | 2252 |
| 394 | Ga0105246_10087450 | 3300011119 | Bacteria | 2237 |
| 395 | Ga0157373_10019205 | 3300013100 | Bacteria | 4977 |
| 396 | Ga0157373_10210729 | 3300013100 | Unclassified | 1370 |
| 397 | Ga0157373_10267940 | 3300013100 | Bacteria | 1209 |
| 398 | Ga0157371_10010719 | 3300013102 | Bacteria | 7118 |
| 399 | Ga0157371_10014278 | 3300013102 | Bacteria | 6000 |
| 400 | Ga0157371_10030627 | 3300013102 | Unclassified | 3880 |
| 401 | Ga0157371_10055082 | 3300013102 | Bacteria | 2822 |
| 402 | Ga0157371_10174001 | 3300013102 | Bacteria | 1539 |
| 403 | Ga0157371_10291797 | 3300013102 | Bacteria | 1179 |
| 404 | Ga0157370_10005564 | 3300013104 | Bacteria | 14125 |
| 405 | Ga0157370_10052594 | 3300013104 | Bacteria | 3888 |
| 406 | Ga0157370_10311304 | 3300013104 | Bacteria | 1453 |
| 407 | Ga0157369_10021357 | 3300013105 | Bacteria | 7240 |
| 408 | Ga0157369_10034211 | 3300013105 | Bacteria | 5579 |
| 409 | Ga0157369_10122496 | 3300013105 | Bacteria | 2758 |
| 410 | Ga0157369_10140261 | 3300013105 | Unclassified | 2558 |
| 411 | Ga0157369_10198452 | 3300013105 | Unclassified | 2106 |
| 412 | Ga0157369_10375477 | 3300013105 | Unclassified | 1476 |
| 413 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 414 | Ga0157374_10001355 | 3300013296 | Bacteria | 20853 |
| 415 | Ga0157374_10042729 | 3300013296 | Bacteria | 4182 |
| 416 | Ga0157374_10051696 | 3300013296 | Bacteria | 3824 |
| 417 | Ga0157374_10126335 | 3300013296 | Bacteria | 2472 |
| 418 | Ga0157374_10414507 | 3300013296 | Bacteria | 1345 |
| 419 | Ga0157378_10005523 | 3300013297 | Bacteria | 11078 |
| 420 | Ga0157378_10006154 | 3300013297 | Bacteria | 10506 |
| 421 | Ga0157378_10009255 | 3300013297 | Bacteria | 8579 |
| 422 | Ga0157378_10015741 | 3300013297 | Bacteria | 6623 |
| 423 | Ga0157378_10037242 | 3300013297 | Bacteria | 4308 |
| 424 | Ga0157378_10045192 | 3300013297 | Bacteria | 3913 |
| 425 | Ga0157378_10066444 | 3300013297 | Bacteria | 3230 |
| 426 | Ga0157378_10076627 | 3300013297 | Bacteria | 3013 |
| 427 | Ga0157378_10162582 | 3300013297 | Bacteria | 2089 |
| 428 | Ga0157378_10317684 | 3300013297 | Bacteria | 1512 |
| 429 | Ga0157378_10377871 | 3300013297 | Bacteria | 1391 |
| 430 | Ga0163162_10000131 | 3300013306 | Bacteria | 67924 |
| 431 | Ga0163162_10001474 | 3300013306 | Bacteria | 21898 |
| 432 | Ga0163162_10002714 | 3300013306 | Bacteria | 16800 |
| 433 | Ga0163162_10002819 | 3300013306 | Bacteria | 16526 |
| 434 | Ga0163162_10004708 | 3300013306 | Bacteria | 13154 |
| 435 | Ga0163162_10005290 | 3300013306 | Bacteria | 12454 |
| 436 | Ga0163162_10073172 | 3300013306 | Bacteria | 3483 |
| 437 | Ga0163162_10079568 | 3300013306 | Bacteria | 3344 |
| 438 | Ga0163162_10163192 | 3300013306 | Bacteria | 2351 |
| 439 | Ga0163162_10166432 | 3300013306 | Bacteria | 2329 |
| 440 | Ga0163162_10331241 | 3300013306 | Bacteria | 1655 |
| 441 | Ga0157372_10002419 | 3300013307 | Bacteria | 20209 |
| 442 | Ga0157372_10003581 | 3300013307 | Bacteria | 16712 |
| 443 | Ga0157372_10012118 | 3300013307 | Bacteria | 9184 |
| 444 | Ga0157372_10031379 | 3300013307 | Bacteria | 5818 |
| 445 | Ga0157372_10088905 | 3300013307 | Bacteria | 3508 |
| 446 | Ga0157372_10095354 | 3300013307 | Bacteria | 3390 |
| 447 | Ga0157372_10111601 | 3300013307 | Unclassified | 3133 |
| 448 | Ga0157372_10121540 | 3300013307 | Bacteria | 3000 |
| 449 | Ga0157372_10135074 | 3300013307 | Bacteria | 2840 |
| 450 | Ga0157372_10198053 | 3300013307 | Bacteria | 2326 |
| 451 | Ga0157372_10249217 | 3300013307 | Bacteria | 2061 |
| 452 | Ga0157372_10312210 | 3300013307 | Bacteria | 1830 |
| 453 | Ga0157372_10320584 | 3300013307 | Bacteria | 1804 |
| 454 | Ga0157372_10337333 | 3300013307 | Bacteria | 1756 |
| 455 | Ga0157372_10376870 | 3300013307 | Bacteria | 1653 |
| 456 | Ga0157372_10667920 | 3300013307 | Bacteria | 1210 |
| 457 | Ga0157375_10000534 | 3300013308 | Bacteria | 34107 |
| 458 | Ga0157375_10001533 | 3300013308 | Bacteria | 19889 |
| 459 | Ga0157375_10022629 | 3300013308 | Bacteria | 5786 |
| 460 | Ga0157375_10049186 | 3300013308 | Bacteria | 4130 |
| 461 | Ga0157375_10055499 | 3300013308 | Bacteria | 3907 |
| 462 | Ga0157375_10135758 | 3300013308 | Bacteria | 2583 |
| 463 | Ga0157375_10162963 | 3300013308 | Bacteria | 2373 |
| 464 | Ga0157375_10251366 | 3300013308 | Bacteria | 1929 |
| 465 | Ga0157375_10301043 | 3300013308 | Bacteria | 1767 |
| 466 | Ga0157375_10323198 | 3300013308 | Bacteria | 1707 |
| 467 | Ga0157375_10478130 | 3300013308 | Bacteria | 1411 |
| 468 | Ga0157375_10492302 | 3300013308 | Bacteria | 1391 |
| 469 | Ga0157375_10508317 | 3300013308 | Unclassified | 1369 |
| 470 | Ga0163163_10002613 | 3300014325 | Bacteria | 15252 |
| 471 | Ga0163163_10004467 | 3300014325 | Bacteria | 11931 |
| 472 | Ga0163163_10035392 | 3300014325 | Bacteria | 4843 |
| 473 | Ga0163163_10093147 | 3300014325 | Bacteria | 3029 |
| 474 | Ga0163163_10278130 | 3300014325 | Bacteria | 1725 |
| 475 | Ga0163163_10288629 | 3300014325 | Bacteria | 1693 |
| 476 | Ga0163163_10421339 | 3300014325 | Unclassified | 1394 |
| 477 | Ga0163163_10560322 | 3300014325 | Bacteria | 1205 |
| 478 | Ga0163163_10608057 | 3300014325 | Bacteria | 1156 |
| 479 | Ga0157380_10001169 | 3300014326 | Bacteria | 17017 |
| 480 | Ga0157380_10013173 | 3300014326 | Bacteria | 6022 |
| 481 | Ga0157380_10022426 | 3300014326 | Bacteria | 4753 |
| 482 | Ga0157380_10828707 | 3300014326 | Bacteria | 945 |
| 483 | Ga0157377_10000583 | 3300014745 | Bacteria | 15210 |
| 484 | Ga0157377_10057983 | 3300014745 | Unclassified | 2203 |
| 485 | Ga0157377_10063241 | 3300014745 | Bacteria | 2119 |
| 486 | Ga0157377_10096611 | 3300014745 | Bacteria | 1753 |
| 487 | Ga0157377_10276421 | 3300014745 | Unclassified | 1099 |
| 488 | Ga0157377_10316485 | 3300014745 | Bacteria | 1035 |
| 489 | Ga0157379_10000115 | 3300014968 | Bacteria | 55499 |
| 490 | Ga0157379_10017714 | 3300014968 | Bacteria | 6276 |
| 491 | Ga0157379_10031686 | 3300014968 | Bacteria | 4711 |
| 492 | Ga0157379_10067925 | 3300014968 | Bacteria | 3187 |
| 493 | Ga0157379_10086798 | 3300014968 | Bacteria | 2806 |
| 494 | Ga0157379_10149640 | 3300014968 | Bacteria | 2105 |
| 495 | Ga0157376_10004633 | 3300014969 | Bacteria | 9582 |
| 496 | Ga0157376_10005109 | 3300014969 | Bacteria | 9147 |
| 497 | Ga0157376_10007481 | 3300014969 | Bacteria | 7803 |
| 498 | Ga0157376_10036869 | 3300014969 | Bacteria | 3964 |
| 499 | Ga0157376_10050594 | 3300014969 | Bacteria | 3448 |
| 500 | Ga0157376_10079536 | 3300014969 | Bacteria | 2810 |
| 501 | Ga0157376_10204202 | 3300014969 | Bacteria | 1820 |
| 502 | Ga0157376_10211572 | 3300014969 | Bacteria | 1790 |
| 503 | Ga0157376_10230924 | 3300014969 | Bacteria | 1719 |
| 504 | Ga0157376_10276935 | 3300014969 | Bacteria | 1578 |
| 505 | Ga0157376_10321458 | 3300014969 | Bacteria | 1471 |
| 506 | Ga0163161_10000594 | 3300017792 | Bacteria | 29004 |
| 507 | Ga0163161_10007476 | 3300017792 | Bacteria | 7550 |
| 508 | Ga0163161_10014248 | 3300017792 | Bacteria | 5536 |
| 509 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 510 | Ga0207697_10018729 | 3300025315 | Bacteria | 2838 |
| 511 | Ga0207697_10067362 | 3300025315 | Bacteria | 1497 |
| 512 | Ga0207697_10109413 | 3300025315 | Bacteria | 1183 |
| 513 | Ga0207656_10001813 | 3300025321 | Bacteria | 7104 |
| 514 | Ga0207656_10007399 | 3300025321 | Bacteria | 3996 |
| 515 | Ga0207656_10080025 | 3300025321 | Bacteria | 1467 |
| 516 | Ga0207656_10083501 | 3300025321 | Bacteria | 1439 |
| 517 | Ga0207682_10068582 | 3300025893 | Bacteria | 1499 |
| 518 | Ga0207642_10110989 | 3300025899 | Unclassified | 1396 |
| 519 | Ga0207710_10006622 | 3300025900 | Bacteria | 4936 |
| 520 | Ga0207688_10018843 | 3300025901 | Bacteria | 3754 |
| 521 | Ga0207688_10025328 | 3300025901 | Bacteria | 3257 |
| 522 | Ga0207680_10000024 | 3300025903 | Bacteria | 82106 |
| 523 | Ga0207680_10020369 | 3300025903 | Bacteria | 3568 |
| 524 | Ga0207680_10066563 | 3300025903 | Bacteria | 2216 |
| 525 | Ga0207680_10077488 | 3300025903 | Bacteria | 2079 |
| 526 | Ga0207680_10160491 | 3300025903 | Bacteria | 1507 |
| 527 | Ga0207647_10000131 | 3300025904 | Bacteria | 58960 |
| 528 | Ga0207647_10013850 | 3300025904 | Bacteria | 5584 |
| 529 | Ga0207647_10022796 | 3300025904 | Bacteria | 4153 |
| 530 | Ga0207647_10044160 | 3300025904 | Bacteria | 2786 |
| 531 | Ga0207647_10074042 | 3300025904 | Bacteria | 2052 |
| 532 | Ga0207647_10111255 | 3300025904 | Bacteria | 1619 |
| 533 | Ga0207645_10001052 | 3300025907 | Bacteria | 22849 |
| 534 | Ga0207645_10002259 | 3300025907 | Bacteria | 15319 |
| 535 | Ga0207645_10010466 | 3300025907 | Bacteria | 6369 |
| 536 | Ga0207645_10027967 | 3300025907 | Bacteria | 3640 |
| 537 | Ga0207645_10106191 | 3300025907 | Bacteria | 1815 |
| 538 | Ga0207645_10207047 | 3300025907 | Bacteria | 1291 |
| 539 | Ga0207643_10001726 | 3300025908 | Bacteria | 12257 |
| 540 | Ga0207643_10002959 | 3300025908 | Bacteria | 9169 |
| 541 | Ga0207643_10029533 | 3300025908 | Bacteria | 3049 |
| 542 | Ga0207643_10047925 | 3300025908 | Bacteria | 2419 |
| 543 | Ga0207705_10008349 | 3300025909 | Bacteria | 7561 |
| 544 | Ga0207705_10233803 | 3300025909 | Bacteria | 1399 |
| 545 | Ga0207654_10001668 | 3300025911 | Bacteria | 11602 |
| 546 | Ga0207654_10003181 | 3300025911 | Bacteria | 8295 |
| 547 | Ga0207654_10008261 | 3300025911 | Bacteria | 5256 |
| 548 | Ga0207654_10032260 | 3300025911 | Bacteria | 2893 |
| 549 | Ga0207654_10081319 | 3300025911 | Bacteria | 1950 |
| 550 | Ga0207707_10000747 | 3300025912 | Bacteria | 32068 |
| 551 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 552 | Ga0207695_10000863 | 3300025913 | Bacteria | 55452 |
| 553 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 554 | Ga0207695_10001645 | 3300025913 | Bacteria | 35984 |
| 555 | Ga0207695_10016157 | 3300025913 | Bacteria | 8752 |
| 556 | Ga0207695_10044762 | 3300025913 | Bacteria | 4704 |
| 557 | Ga0207695_10259584 | 3300025913 | Unclassified | 1635 |
| 558 | Ga0207695_10271311 | 3300025913 | Bacteria | 1592 |
| 559 | Ga0207671_10000311 | 3300025914 | Bacteria | 71753 |
| 560 | Ga0207671_10000931 | 3300025914 | Bacteria | 36651 |
| 561 | Ga0207671_10039084 | 3300025914 | Bacteria | 3515 |
| 562 | Ga0207671_10049647 | 3300025914 | Bacteria | 3106 |
| 563 | Ga0207671_10069010 | 3300025914 | Bacteria | 2635 |
| 564 | Ga0207671_10122605 | 3300025914 | Bacteria | 1988 |
| 565 | Ga0207671_10155347 | 3300025914 | Bacteria | 1769 |
| 566 | Ga0207660_10005421 | 3300025917 | Bacteria | 8278 |
| 567 | Ga0207657_10122150 | 3300025919 | Bacteria | 2142 |
| 568 | Ga0207649_10009764 | 3300025920 | Bacteria | 5257 |
| 569 | Ga0207649_10036540 | 3300025920 | Bacteria | 2959 |
| 570 | Ga0207652_10025159 | 3300025921 | Unclassified | 4946 |
| 571 | Ga0207681_10005188 | 3300025923 | Bacteria | 8000 |
| 572 | Ga0207681_10031440 | 3300025923 | Bacteria | 3467 |
| 573 | Ga0207681_10071625 | 3300025923 | Bacteria | 2418 |
| 574 | Ga0207681_10111065 | 3300025923 | Bacteria | 1994 |
| 575 | Ga0207681_10122538 | 3300025923 | Bacteria | 1909 |
| 576 | Ga0207694_10066214 | 3300025924 | Unclassified | 2818 |
| 577 | Ga0207650_10008659 | 3300025925 | Bacteria | 6950 |
| 578 | Ga0207650_10022166 | 3300025925 | Bacteria | 4496 |
| 579 | Ga0207650_10038385 | 3300025925 | Bacteria | 3497 |
| 580 | Ga0207650_10046516 | 3300025925 | Bacteria | 3195 |
| 581 | Ga0207650_10066501 | 3300025925 | Bacteria | 2703 |
| 582 | Ga0207650_10073163 | 3300025925 | Bacteria | 2581 |
| 583 | Ga0207650_10188484 | 3300025925 | Bacteria | 1647 |
| 584 | Ga0207659_10022069 | 3300025926 | Bacteria | 4235 |
| 585 | Ga0207659_10022166 | 3300025926 | Bacteria | 4226 |
| 586 | Ga0207659_10028366 | 3300025926 | Bacteria | 3804 |
| 587 | Ga0207659_10032919 | 3300025926 | Bacteria | 3562 |
| 588 | Ga0207659_10036550 | 3300025926 | Bacteria | 3403 |
| 589 | Ga0207659_10058207 | 3300025926 | Bacteria | 2774 |
| 590 | Ga0207659_10173720 | 3300025926 | Bacteria | 1701 |
| 591 | Ga0207659_10192856 | 3300025926 | Bacteria | 1622 |
| 592 | Ga0207687_10414689 | 3300025927 | Bacteria | 1110 |
| 593 | Ga0207706_10027202 | 3300025933 | Bacteria | 5115 |
| 594 | Ga0207706_10029176 | 3300025933 | Bacteria | 4926 |
| 595 | Ga0207706_10047628 | 3300025933 | Bacteria | 3792 |
| 596 | Ga0207706_10313409 | 3300025933 | Unclassified | 1366 |
| 597 | Ga0207686_10000764 | 3300025934 | Bacteria | 19790 |
| 598 | Ga0207686_10133123 | 3300025934 | Bacteria | 1708 |
| 599 | Ga0207686_10162045 | 3300025934 | Bacteria | 1568 |
| 600 | Ga0207686_10177238 | 3300025934 | Bacteria | 1509 |
| 601 | Ga0207686_10322037 | 3300025934 | Bacteria | 1155 |
| 602 | Ga0207670_10004555 | 3300025936 | Bacteria | 7485 |
| 603 | Ga0207670_10013292 | 3300025936 | Bacteria | 4847 |
| 604 | Ga0207670_10067994 | 3300025936 | Bacteria | 2453 |
| 605 | Ga0207670_10075052 | 3300025936 | Unclassified | 2349 |
| 606 | Ga0207670_10169114 | 3300025936 | Bacteria | 1637 |
| 607 | Ga0207670_10263937 | 3300025936 | Bacteria | 1336 |
| 608 | Ga0207669_10027676 | 3300025937 | Bacteria | 3108 |
| 609 | Ga0207669_10063085 | 3300025937 | Unclassified | 2285 |
| 610 | Ga0207669_10152083 | 3300025937 | Unclassified | 1622 |
| 611 | Ga0207704_10000955 | 3300025938 | Bacteria | 12788 |
| 612 | Ga0207704_10002540 | 3300025938 | Bacteria | 8226 |
| 613 | Ga0207704_10093206 | 3300025938 | Bacteria | 1985 |
| 614 | Ga0207704_10107338 | 3300025938 | Bacteria | 1878 |
| 615 | Ga0207704_10134542 | 3300025938 | Bacteria | 1718 |
| 616 | Ga0207704_10388415 | 3300025938 | Bacteria | 1098 |
| 617 | Ga0207665_10297302 | 3300025939 | Bacteria | 1206 |
| 618 | Ga0207691_10000673 | 3300025940 | Bacteria | 33764 |
| 619 | Ga0207691_10004686 | 3300025940 | Bacteria | 13245 |
| 620 | Ga0207691_10016625 | 3300025940 | Bacteria | 6985 |
| 621 | Ga0207691_10021620 | 3300025940 | Bacteria | 6074 |
| 622 | Ga0207691_10021958 | 3300025940 | Bacteria | 6023 |
| 623 | Ga0207691_10056993 | 3300025940 | Bacteria | 3558 |
| 624 | Ga0207691_10155520 | 3300025940 | Unclassified | 2008 |
| 625 | Ga0207691_10259994 | 3300025940 | Bacteria | 1496 |
| 626 | Ga0207691_10385230 | 3300025940 | Bacteria | 1197 |
| 627 | Ga0207711_10024780 | 3300025941 | Bacteria | 5033 |
| 628 | Ga0207711_10198325 | 3300025941 | Bacteria | 1831 |
| 629 | Ga0207711_10272353 | 3300025941 | Bacteria | 1558 |
| 630 | Ga0207689_10002915 | 3300025942 | Bacteria | 15788 |
| 631 | Ga0207689_10004743 | 3300025942 | Bacteria | 12259 |
| 632 | Ga0207689_10007600 | 3300025942 | Bacteria | 9495 |
| 633 | Ga0207689_10024890 | 3300025942 | Bacteria | 5018 |
| 634 | Ga0207689_10030935 | 3300025942 | Bacteria | 4459 |
| 635 | Ga0207689_10031405 | 3300025942 | Bacteria | 4422 |
| 636 | Ga0207689_10067924 | 3300025942 | Bacteria | 2929 |
| 637 | Ga0207689_10077158 | 3300025942 | Bacteria | 2739 |
| 638 | Ga0207689_10082541 | 3300025942 | Unclassified | 2642 |
| 639 | Ga0207661_10002997 | 3300025944 | Bacteria | 11677 |
| 640 | Ga0207661_10100523 | 3300025944 | Bacteria | 2427 |
| 641 | Ga0207661_10110151 | 3300025944 | Bacteria | 2327 |
| 642 | Ga0207661_10256916 | 3300025944 | Bacteria | 1555 |
| 643 | Ga0207661_10295833 | 3300025944 | Bacteria | 1450 |
| 644 | Ga0207679_10002990 | 3300025945 | Bacteria | 10485 |
| 645 | Ga0207679_10174403 | 3300025945 | Bacteria | 1773 |
| 646 | Ga0207679_10201105 | 3300025945 | Unclassified | 1664 |
| 647 | Ga0207679_10322146 | 3300025945 | Bacteria | 1339 |
| 648 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 649 | Ga0207667_10000279 | 3300025949 | Bacteria | 70460 |
| 650 | Ga0207667_10013613 | 3300025949 | Bacteria | 9298 |
| 651 | Ga0207667_10098454 | 3300025949 | Bacteria | 3018 |
| 652 | Ga0207667_10330288 | 3300025949 | Bacteria | 1557 |
| 653 | Ga0207651_10021555 | 3300025960 | Bacteria | 3919 |
| 654 | Ga0207651_10060479 | 3300025960 | Bacteria | 2630 |
| 655 | Ga0207651_10103452 | 3300025960 | Bacteria | 2119 |
| 656 | Ga0207651_10107531 | 3300025960 | Bacteria | 2085 |
| 657 | Ga0207651_10134621 | 3300025960 | Bacteria | 1898 |
| 658 | Ga0207712_10001013 | 3300025961 | Bacteria | 20020 |
| 659 | Ga0207712_10009604 | 3300025961 | Bacteria | 6126 |
| 660 | Ga0207712_10013894 | 3300025961 | Bacteria | 5164 |
| 661 | Ga0207712_10021178 | 3300025961 | Bacteria | 4265 |
| 662 | Ga0207712_10143649 | 3300025961 | Unclassified | 1835 |
| 663 | Ga0207712_10213942 | 3300025961 | Bacteria | 1537 |
| 664 | Ga0207712_10235571 | 3300025961 | Bacteria | 1472 |
| 665 | Ga0207712_10328564 | 3300025961 | Bacteria | 1264 |
| 666 | Ga0207668_10003855 | 3300025972 | Bacteria | 8835 |
| 667 | Ga0207668_10026061 | 3300025972 | Bacteria | 3792 |
| 668 | Ga0207668_10035626 | 3300025972 | Bacteria | 3316 |
| 669 | Ga0207668_10320037 | 3300025972 | Bacteria | 1287 |
| 670 | Ga0207640_10127534 | 3300025981 | Bacteria | 1834 |
| 671 | Ga0207640_10130645 | 3300025981 | Unclassified | 1815 |
| 672 | Ga0207640_10138679 | 3300025981 | Bacteria | 1769 |
| 673 | Ga0207640_10163837 | 3300025981 | Bacteria | 1648 |
| 674 | Ga0207658_10005210 | 3300025986 | Bacteria | 8947 |
| 675 | Ga0207658_10021680 | 3300025986 | Bacteria | 4464 |
| 676 | Ga0207658_10076133 | 3300025986 | Bacteria | 2555 |
| 677 | Ga0207658_10095362 | 3300025986 | Bacteria | 2318 |
| 678 | Ga0207658_10156645 | 3300025986 | Bacteria | 1862 |
| 679 | Ga0207658_10253111 | 3300025986 | Bacteria | 1497 |
| 680 | Ga0207658_10297000 | 3300025986 | Bacteria | 1390 |
| 681 | Ga0207677_10002707 | 3300026023 | Bacteria | 9343 |
| 682 | Ga0207677_10005874 | 3300026023 | Bacteria | 6679 |
| 683 | Ga0207677_10102951 | 3300026023 | Unclassified | 2106 |
| 684 | Ga0207677_10106758 | 3300026023 | Bacteria | 2075 |
| 685 | Ga0207677_10118348 | 3300026023 | Bacteria | 1987 |
| 686 | Ga0207677_10221359 | 3300026023 | Bacteria | 1518 |
| 687 | Ga0207677_10253912 | 3300026023 | Bacteria | 1429 |
| 688 | Ga0207703_10006076 | 3300026035 | Bacteria | 9658 |
| 689 | Ga0207703_10050142 | 3300026035 | Bacteria | 3377 |
| 690 | Ga0207703_10575321 | 3300026035 | Bacteria | 1064 |
| 691 | Ga0207639_10016717 | 3300026041 | Bacteria | 5198 |
| 692 | Ga0207639_10130805 | 3300026041 | Bacteria | 2077 |
| 693 | Ga0207639_10182681 | 3300026041 | Unclassified | 1785 |
| 694 | Ga0207639_10393500 | 3300026041 | Bacteria | 1247 |
| 695 | Ga0207678_10028489 | 3300026067 | Bacteria | 4876 |
| 696 | Ga0207708_10091271 | 3300026075 | Bacteria | 2349 |
| 697 | Ga0207708_10161730 | 3300026075 | Bacteria | 1768 |
| 698 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 699 | Ga0207641_10002531 | 3300026088 | Bacteria | 16833 |
| 700 | Ga0207641_10009677 | 3300026088 | Bacteria | 7940 |
| 701 | Ga0207641_10021342 | 3300026088 | Bacteria | 5323 |
| 702 | Ga0207641_10022680 | 3300026088 | Bacteria | 5167 |
| 703 | Ga0207641_10028151 | 3300026088 | Bacteria | 4642 |
| 704 | Ga0207641_10047497 | 3300026088 | Bacteria | 3620 |
| 705 | Ga0207641_10079275 | 3300026088 | Bacteria | 2846 |
| 706 | Ga0207641_10348247 | 3300026088 | Bacteria | 1411 |
| 707 | Ga0207641_10413807 | 3300026088 | Unclassified | 1297 |
| 708 | Ga0207648_10002473 | 3300026089 | Bacteria | 19851 |
| 709 | Ga0207648_10003197 | 3300026089 | Bacteria | 17252 |
| 710 | Ga0207648_10005503 | 3300026089 | Bacteria | 12764 |
| 711 | Ga0207648_10054782 | 3300026089 | Bacteria | 3483 |
| 712 | Ga0207648_10057905 | 3300026089 | Bacteria | 3380 |
| 713 | Ga0207648_10073855 | 3300026089 | Bacteria | 2972 |
| 714 | Ga0207648_10161159 | 3300026089 | Bacteria | 1981 |
| 715 | Ga0207648_10209594 | 3300026089 | Bacteria | 1729 |
| 716 | Ga0207648_10247373 | 3300026089 | Bacteria | 1589 |
| 717 | Ga0207648_10258483 | 3300026089 | Unclassified | 1553 |
| 718 | Ga0207648_10410297 | 3300026089 | Bacteria | 1228 |
| 719 | Ga0207676_10017880 | 3300026095 | Bacteria | 5144 |
| 720 | Ga0207676_10073438 | 3300026095 | Bacteria | 2753 |
| 721 | Ga0207676_10102025 | 3300026095 | Bacteria | 2380 |
| 722 | Ga0207676_10263818 | 3300026095 | Unclassified | 1556 |
| 723 | Ga0207676_10343813 | 3300026095 | Unclassified | 1377 |
| 724 | Ga0207676_10406674 | 3300026095 | Unclassified | 1273 |
| 725 | Ga0207674_10000969 | 3300026116 | Bacteria | 37567 |
| 726 | Ga0207674_10009448 | 3300026116 | Bacteria | 11142 |
| 727 | Ga0207674_10047506 | 3300026116 | Bacteria | 4399 |
| 728 | Ga0207674_10092246 | 3300026116 | Bacteria | 3018 |
| 729 | Ga0207674_10103835 | 3300026116 | Bacteria | 2821 |
| 730 | Ga0207674_10168255 | 3300026116 | Unclassified | 2146 |
| 731 | Ga0207674_10188457 | 3300026116 | Bacteria | 2013 |
| 732 | Ga0207674_10197404 | 3300026116 | Bacteria | 1962 |
| 733 | Ga0207674_10207920 | 3300026116 | Bacteria | 1906 |
| 734 | Ga0207674_10371009 | 3300026116 | Bacteria | 1383 |
| 735 | Ga0207675_100000654 | 3300026118 | Bacteria | 34117 |
| 736 | Ga0207675_100003600 | 3300026118 | Bacteria | 15104 |
| 737 | Ga0207675_100010374 | 3300026118 | Bacteria | 8728 |
| 738 | Ga0207675_100021212 | 3300026118 | Bacteria | 6051 |
| 739 | Ga0207675_100027904 | 3300026118 | Bacteria | 5258 |
| 740 | Ga0207675_100160045 | 3300026118 | Bacteria | 2147 |
| 741 | Ga0207675_100165405 | 3300026118 | Bacteria | 2112 |
| 742 | Ga0207675_100261491 | 3300026118 | Bacteria | 1677 |
| 743 | Ga0207675_100288116 | 3300026118 | Bacteria | 1597 |
| 744 | Ga0207675_100376951 | 3300026118 | Bacteria | 1394 |
| 745 | Ga0207683_10001428 | 3300026121 | Bacteria | 21608 |
| 746 | Ga0207683_10009987 | 3300026121 | Bacteria | 8101 |
| 747 | Ga0207683_10051269 | 3300026121 | Bacteria | 3615 |
| 748 | Ga0207683_10053470 | 3300026121 | Bacteria | 3541 |
| 749 | Ga0207683_10110422 | 3300026121 | Bacteria | 2462 |
| 750 | Ga0207698_10027806 | 3300026142 | Bacteria | 4021 |
| 751 | Ga0207698_10030751 | 3300026142 | Bacteria | 3866 |
| 752 | Ga0207698_10087624 | 3300026142 | Bacteria | 2536 |
| 753 | Ga0207698_10090005 | 3300026142 | Bacteria | 2509 |
| 754 | Ga0207698_10135981 | 3300026142 | Bacteria | 2109 |
| 755 | Ga0207698_10144695 | 3300026142 | Bacteria | 2054 |
| 756 | Ga0207698_10206670 | 3300026142 | Bacteria | 1763 |
| 757 | Ga0207698_10452436 | 3300026142 | Bacteria | 1240 |
| 758 | Ga0207698_10504352 | 3300026142 | Bacteria | 1178 |
| 759 | Ga0209995_1014712 | 3300027471 | Bacteria | 1283 |
| 760 | Ga0209995_1016379 | 3300027471 | Bacteria | 1218 |
| 761 | Ga0209974_10057345 | 3300027876 | Bacteria | 1315 |
| 762 | Ga0207428_10009020 | 3300027907 | Bacteria | 8978 |
| 763 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 764 | Ga0268266_10019825 | 3300028379 | Bacteria | 5731 |
| 765 | Ga0268266_10078457 | 3300028379 | Bacteria | 2873 |
| 766 | Ga0268265_10040553 | 3300028380 | Bacteria | 3439 |
| 767 | Ga0268265_10197355 | 3300028380 | Bacteria | 1743 |
| 768 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 769 | Ga0268264_10002921 | 3300028381 | Bacteria | 14854 |
| 770 | Ga0268264_10027605 | 3300028381 | Bacteria | 4640 |
| 771 | Ga0268264_10027818 | 3300028381 | Bacteria | 4622 |
| 772 | Ga0268264_10043127 | 3300028381 | Bacteria | 3737 |
| 773 | Ga0268264_10079918 | 3300028381 | Bacteria | 2791 |
| 774 | Ga0268264_10142359 | 3300028381 | Bacteria | 2140 |
| 775 | Ga0268264_10196391 | 3300028381 | Unclassified | 1843 |
| 776 | Ga0307517_10001481 | 3300028786 | Bacteria | 39285 |
| 777 | Ga0307517_10086390 | 3300028786 | Bacteria | 2618 |
| 778 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 779 | Ga0307511_10000201 | 3300030521 | Bacteria | 60079 |
| 780 | Ga0265327_10015178 | 3300031251 | Bacteria | 4990 |
| 781 | Ga0265327_10026468 | 3300031251 | Bacteria | 3358 |
| 782 | Ga0307513_10099658 | 3300031456 | Bacteria | 2933 |
| 783 | Ga0307509_10006019 | 3300031507 | Bacteria | 16547 |
| 784 | Ga0307509_10237319 | 3300031507 | Bacteria | 1620 |
| 785 | Ga0307509_10257114 | 3300031507 | Bacteria | 1525 |
| 786 | Ga0307408_100062316 | 3300031548 | Bacteria | 2725 |
| 787 | Ga0307508_10001083 | 3300031616 | Bacteria | 31499 |
| 788 | Ga0307516_10003458 | 3300031730 | Bacteria | 20249 |
| 789 | Ga0307516_10403578 | 3300031730 | Unclassified | 1026 |
| 790 | Ga0307410_10048863 | 3300031852 | Bacteria | 2837 |
| 791 | Ga0307412_10037746 | 3300031911 | Bacteria | 3106 |
| 792 | Ga0307414_10062858 | 3300032004 | Bacteria | 2637 |
| 793 | Ga0307415_100015507 | 3300032126 | Bacteria | 4515 |
| 794 | Ga0307510_10008700 | 3300033180 | Bacteria | 12090 |
| 795 | Ga0373934_0054869 | 3300035086 | Unclassified | 1583 |
| 796 | Ga0373955_0112140 | 3300035172 | Bacteria | 1578 |
| 797 | Ga0373937_0041388 | 3300036401 | Bacteria | 4202 |
| 798 | Ga0373937_0088634 | 3300036401 | Bacteria | 2865 |
| 799 | Ga0395900_0015164 | 3300037418 | Bacteria | 7859 |
| 800 | Ga0395898_0354951 | 3300037466 | Bacteria | 1398 |
| 801 | Ga0395905_0009899 | 3300037471 | Bacteria | 9291 |
| 802 | Ga0395905_0622916 | 3300037471 | Bacteria | 981 |
| 803 | Ga0451800_1252777 | 3300041459 | Bacteria | 1375 |
| 804 | Ga0439442_029952 | 3300042002 | Unclassified | 1136 |
| 805 | Ga0439449_0019236 | 3300042007 | Bacteria | 2560 |
| 806 | Ga0439449_0021721 | 3300042007 | Bacteria | 2403 |
| 807 | Ga0439457_000363 | 3300042014 | Bacteria | 12689 |
| 808 | Ga0450923_033651 | 3300042125 | Bacteria | 1054 |
| 809 | Ga0450899_005210 | 3300042135 | Bacteria | 1396 |
| 810 | Ga0439434_0001630 | 3300042435 | Bacteria | 6486 |
| 811 | Ga0466969_0000305 | 3300044656 | Bacteria | 27063 |
| 812 | Ga0466972_0000082 | 3300044658 | Bacteria | 88592 |
| 813 | Ga0466972_0008143 | 3300044658 | Bacteria | 5257 |
| 814 | Ga0466972_0010489 | 3300044658 | Bacteria | 4651 |
| 815 | Ga0453683_0026921 | 3300044673 | Bacteria | 3651 |
| 816 | Ga0453683_0218193 | 3300044673 | Bacteria | 1212 |
| 817 | Ga0466965_0047663 | 3300044683 | Unclassified | 2122 |
| 818 | Ga0466966_0000015 | 3300044684 | Bacteria | 127402 |
| 819 | Ga0466966_0313281 | 3300044684 | Bacteria | 943 |
| 820 | Ga0466961_0123026 | 3300044693 | Bacteria | 1628 |
| 821 | Ga0453684_0020334 | 3300044712 | Bacteria | 10022 |
| 822 | Ga0453684_0096964 | 3300044712 | Bacteria | 3620 |
| 823 | Ga0466968_0080778 | 3300044735 | Bacteria | 1428 |
| 824 | Ga0466957_0017897 | 3300044842 | Bacteria | 4157 |
| 825 | Ga0466957_0028242 | 3300044842 | Bacteria | 3339 |
| 826 | Ga0466957_0108948 | 3300044842 | Bacteria | 1755 |
| 827 | Ga0466959_0000030 | 3300045049 | Bacteria | 111343 |
| 828 | Ga0466959_0029310 | 3300045049 | Bacteria | 4078 |
| 829 | Ga0495629_0313922 | 3300046459 | Unclassified | 1072 |
| 830 | Ga0495638_0059897 | 3300046460 | Bacteria | 2356 |
| 831 | Ga0495638_0100674 | 3300046460 | Bacteria | 1729 |
| 832 | Ga0495650_0081857 | 3300046471 | Bacteria | 1243 |
| 833 | Ga0495606_0003421 | 3300046507 | Bacteria | 16858 |
| 834 | Ga0495628_0057514 | 3300046516 | Bacteria | 3059 |
| 835 | Ga0495643_0028977 | 3300046522 | Bacteria | 3100 |
| 836 | Ga0495648_0003136 | 3300046524 | Bacteria | 14739 |
| 837 | Ga0495621_0040448 | 3300046539 | Bacteria | 1634 |
| 838 | Ga0495621_0041191 | 3300046539 | Bacteria | 1621 |
| 839 | Ga0495622_0138752 | 3300046557 | Bacteria | 1104 |
| 840 | Ga0495634_0225813 | 3300046642 | Bacteria | 1154 |
| 841 | Ga0495611_0000026 | 3300046648 | Bacteria | 118428 |
| 842 | Ga0495625_0043643 | 3300046660 | Bacteria | 3251 |
| 843 | Ga0495625_0101230 | 3300046660 | Bacteria | 1979 |
| 844 | Ga0495635_0040108 | 3300046663 | Bacteria | 3237 |
| 845 | Ga0495647_0018872 | 3300046681 | Bacteria | 2462 |
| 846 | Ga0495670_0033375 | 3300046691 | Unclassified | 2561 |
| 847 | Ga0495649_0064266 | 3300046694 | Bacteria | 1971 |
| 848 | Ga0495600_0242525 | 3300046809 | Bacteria | 1148 |
| 849 | Ga0495672_0036043 | 3300047320 | Bacteria | 3041 |
| 850 | Ga0495687_001838 | 3300047443 | Bacteria | 18636 |
| 851 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 852 | Ga0495686_0037770 | 3300047472 | Bacteria | 3092 |
| 853 | Ga0496100_0270075 | 3300048903 | Bacteria | 1264 |
| 854 | Ga0496105_0304438 | 3300048908 | Bacteria | 1281 |
| 855 | Ga0496106_0232139 | 3300048909 | Bacteria | 1473 |
| 856 | Ga0496110_0190814 | 3300048913 | Bacteria | 1861 |
| 857 | Ga0496114_0026179 | 3300048917 | Bacteria | 4774 |
| 858 | Ga0501031_0013457 | 3300049568 | Bacteria | 5334 |
| 859 | Ga0501032_0038258 | 3300049569 | Bacteria | 3269 |
| 860 | Ga0501034_0005186 | 3300049571 | Bacteria | 14296 |
| 861 | Ga0501034_0555011 | 3300049571 | Bacteria | 1058 |
| 862 | Ga0501036_0319937 | 3300049572 | Bacteria | 1296 |
| 863 | Ga0501037_0004139 | 3300049573 | Bacteria | 10526 |
| 864 | Ga0501037_0005433 | 3300049573 | Bacteria | 9280 |
| 865 | Ga0501037_0021327 | 3300049573 | Bacteria | 4786 |
| 866 | Ga0501038_0013654 | 3300049574 | Bacteria | 7404 |
| 867 | Ga0501039_0111846 | 3300049575 | Bacteria | 2135 |
| 868 | Ga0501043_0007747 | 3300049579 | Bacteria | 8498 |
| 869 | Ga0501043_0042317 | 3300049579 | Bacteria | 3580 |
| 870 | Ga0501043_0049505 | 3300049579 | Bacteria | 3303 |
| 871 | Ga0501043_0148930 | 3300049579 | Unclassified | 1832 |
| 872 | Ga0501046_0013771 | 3300049580 | Bacteria | 6837 |
| 873 | Ga0501046_0124260 | 3300049580 | Unclassified | 1962 |
| 874 | Ga0501047_0016908 | 3300049581 | Bacteria | 6973 |
| 875 | Ga0501047_0053720 | 3300049581 | Bacteria | 3896 |
| 876 | Ga0501047_0119443 | 3300049581 | Bacteria | 2518 |
| 877 | Ga0501067_0091302 | 3300049583 | Bacteria | 1691 |
| 878 | Ga0501069_0010220 | 3300049585 | Bacteria | 4965 |
| 879 | Ga0501070_0294149 | 3300049586 | Unclassified | 1323 |
| 880 | Ga0501072_0256483 | 3300049588 | Bacteria | 1392 |
| 881 | Ga0501072_0289795 | 3300049588 | Unclassified | 1302 |
| 882 | Ga0501073_0057525 | 3300049589 | Unclassified | 2718 |
| 883 | Ga0501074_0056911 | 3300049590 | Bacteria | 2817 |
| 884 | Ga0501198_010451 | 3300049649 | Unclassified | 1373 |
| 885 | Ga0501201_000950 | 3300049651 | Unclassified | 2715 |
| 886 | Ga0501222_001674 | 3300049662 | Bacteria | 3076 |
| 887 | Ga0501223_001801 | 3300049663 | Bacteria | 4834 |
| 888 | Ga0501235_004186 | 3300049669 | Bacteria | 3124 |
| 889 | Ga0501235_015906 | 3300049669 | Bacteria | 1660 |
| 890 | Ga0501240_008635 | 3300049673 | Unclassified | 1313 |
| 891 | Ga0501242_000786 | 3300049674 | Unclassified | 2959 |
| 892 | Ga0501243_001866 | 3300049675 | Unclassified | 3064 |
| 893 | Ga0501243_002072 | 3300049675 | Bacteria | 2916 |
| 894 | Ga0501252_008870 | 3300049682 | Unclassified | 1163 |
| 895 | Ga0501257_004100 | 3300049686 | Bacteria | 3164 |
| 896 | Ga0501259_000241 | 3300049688 | Bacteria | 8521 |
| 897 | Ga0501259_000548 | 3300049688 | Bacteria | 6027 |
| 898 | Ga0501261_002098 | 3300049690 | Bacteria | 2449 |
| 899 | Ga0501225_0000523 | 3300049705 | Bacteria | 11998 |
| 900 | Ga0501225_0001327 | 3300049705 | Bacteria | 7688 |
| 901 | Ga0501225_0003132 | 3300049705 | Bacteria | 5054 |
| 902 | Ga0501245_003413 | 3300049708 | Unclassified | 2156 |
| 903 | Ga0501080_0108217 | 3300049742 | Unclassified | 2576 |
| 904 | Ga0501080_0146836 | 3300049742 | Bacteria | 2180 |
| 905 | Ga0501266_001945 | 3300049763 | Bacteria | 2600 |
| 906 | Ga0501035_0023604 | 3300049822 | Bacteria | 5643 |
| 907 | Ga0501044_0006596 | 3300049823 | Bacteria | 12806 |
| 908 | Ga0501044_0026792 | 3300049823 | Bacteria | 6100 |
| 909 | Ga0501044_0072751 | 3300049823 | Bacteria | 3495 |
| 910 | Ga0501044_0078434 | 3300049823 | Bacteria | 3347 |
| 911 | Ga0501044_0187664 | 3300049823 | Bacteria | 2031 |
| 912 | nmdc:mga0k408_206451_c1 | 3300050493 | Bacteria | 1173 |
| 913 | nmdc:mga0k408_2243_c1 | 3300050493 | Bacteria | 2831 |
| 914 | nmdc:mga0k408_28278_c1 | 3300050493 | Unclassified | 3187 |
| 915 | nmdc:mga09592_146433_c1 | 3300050508 | Bacteria | 2037 |
| 916 | nmdc:mga09592_158560_c1 | 3300050508 | Bacteria | 1954 |
| 917 | nmdc:mga0qj67_4627_c1 | 3300050509 | Bacteria | 9984 |
| 918 | nmdc:mga06r32_15626_c1 | 3300050510 | Bacteria | 6897 |
| 919 | nmdc:mga06r32_35876_c1 | 3300050510 | Bacteria | 4680 |
| 920 | nmdc:mga08y16_14158_c1 | 3300050511 | Bacteria | 8395 |
| 921 | nmdc:mga08y16_17376_c1 | 3300050511 | Bacteria | 7574 |
| 922 | nmdc:mga08y16_379105_c1 | 3300050511 | Bacteria | 1450 |
| 923 | nmdc:mga08y16_393156_c1 | 3300050511 | Unclassified | 1420 |
| 924 | nmdc:mga0n895_111335_c1 | 3300050512 | Bacteria | 2754 |
| 925 | Ga0495619_0063266 | 3300053085 | Bacteria | 2465 |
| 926 | Ga0500578_0000063 | 3300053086 | Bacteria | 117869 |
| 927 | Ga0500646_0001629 | 3300053090 | Bacteria | 5935 |
| 928 | Ga0500646_0052160 | 3300053090 | Bacteria | 1183 |
| 929 | Ga0500583_0000076 | 3300053092 | Bacteria | 59162 |
| 930 | Ga0500583_0000557 | 3300053092 | Bacteria | 11283 |
| 931 | Ga0500583_0000662 | 3300053092 | Bacteria | 10175 |
| 932 | Ga0500556_0140753 | 3300053104 | Bacteria | 948 |
| 933 | Ga0500562_011924 | 3300053108 | Bacteria | 2207 |
| 934 | Ga0500652_007218 | 3300053131 | Bacteria | 3624 |
| 935 | Ga0500658_0142492 | 3300053134 | Bacteria | 1076 |
| 936 | Ga0500559_0023907 | 3300053136 | Bacteria | 2596 |
| 937 | Ga0500568_0001023 | 3300053139 | Bacteria | 19133 |
| 938 | Ga0500568_0043626 | 3300053139 | Bacteria | 1792 |
| 939 | Ga0500573_0158259 | 3300053140 | Bacteria | 1235 |
| 940 | Ga0500577_0045296 | 3300053142 | Bacteria | 1625 |
| 941 | Ga0500588_0001514 | 3300053146 | Bacteria | 4450 |
| 942 | Ga0500589_133366 | 3300053147 | Bacteria | 1034 |
| 943 | Ga0500616_0004133 | 3300053153 | Bacteria | 10506 |
| 944 | Ga0500622_0001733 | 3300053156 | Bacteria | 16854 |
| 945 | Ga0500636_0076299 | 3300053177 | Bacteria | 1938 |
| 946 | Ga0500637_0232392 | 3300053178 | Bacteria | 1038 |
| 947 | Ga0500611_000101 | 3300053727 | Bacteria | 21697 |
| 948 | Ga0501084_0104772 | 3300054114 | Bacteria | 2375 |
| 949 | Ga0501082_0132502 | 3300060353 | Unclassified | 2162 |
| 950 | Ga0466962_0016166 | 3300061719 | Bacteria | 3599 |
| 951 | 2738725633 | 2738541278 | Bacteria | 9755573 |
| 952 | Ga0070683_100083925 | |||
| 953 | MBSR1b_contig_334244 | |||
| 954 | CNXas_1001191 | |||
| 955 | JGI24736J21556_1003024 | |||
| 956 | JGI24740J21852_10031413 | |||
| 957 | JGI24751J29686_10021868 | |||
| 958 | rootH2_10001613 | |||
| 959 | rootH2_10001614 | |||
| 960 | rootH2_10023604 | |||
| 961 | rootH2_10039966 | |||
| 962 | rootL2_10113255 | |||
| 963 | rootH1_10066431 | |||
| 964 | rootH1_10222292 | |||
| 965 | rootH1_10270826 | |||
| 966 | JGI25160J50197_1000262 | |||
| 967 | Ga0065704_10031790 | |||
| 968 | Ga0065704_10123993 | |||
| 969 | Ga0065704_10168158 | |||
| 970 | Ga0065712_10014215 | |||
| 971 | Ga0065712_10017724 | |||
| 972 | Ga0065712_10082292 | |||
| 973 | Ga0065712_10131098 | |||
| 974 | Ga0065715_10017649 | |||
| 975 | Ga0065715_10107768 | |||
| 976 | Ga0065707_10208036 | |||
| 977 | Ga0070658_10000563 | |||
| 978 | Ga0070658_10043116 | |||
| 979 | Ga0070676_10000218 | |||
| 980 | Ga0070676_10012670 | |||
| 981 | Ga0070676_10016335 | |||
| 982 | Ga0070676_10063489 | |||
| 983 | Ga0070676_10120344 | |||
| 984 | Ga0070683_100002723 | |||
| 985 | Ga0070683_100010919 | |||
| 986 | Ga0070683_100013457 | |||
| 987 | Ga0070683_100120086 | |||
| 988 | Ga0070690_100008208 | |||
| 989 | Ga0070690_100163166 | |||
| 990 | Ga0070690_100275366 | |||
| 991 | Ga0070670_100017530 | |||
| 992 | Ga0070670_100027025 | |||
| 993 | Ga0070670_100041055 | |||
| 994 | Ga0070670_100042974 | |||
| 995 | Ga0070670_100045367 | |||
| 996 | Ga0070670_100109684 | |||
| 997 | Ga0070670_100142938 | |||
| 998 | Ga0070670_100282343 | |||
| 999 | Ga0070670_100311675 | |||
| 1000 | Ga0070677_10050904 | |||
| 1001 | Ga0068869_100010867 | |||
| 1002 | Ga0068869_100010963 | |||
| 1003 | Ga0068869_100035886 | |||
| 1004 | Ga0068869_100043025 | |||
| 1005 | Ga0068869_100049082 | |||
| 1006 | Ga0068869_100052642 | |||
| 1007 | Ga0068869_100053388 | |||
| 1008 | Ga0070666_10000072 | |||
| 1009 | Ga0070666_10000969 | |||
| 1010 | Ga0070666_10138495 | |||
| 1011 | Ga0070666_10176280 | |||
| 1012 | Ga0070666_10193496 | |||
| 1013 | Ga0070680_100008932 | |||
| 1014 | Ga0070680_100289070 | |||
| 1015 | Ga0070682_100005089 | |||
| 1016 | Ga0068868_100000770 | |||
| 1017 | Ga0068868_100004154 | |||
| 1018 | Ga0068868_100111604 | |||
| 1019 | Ga0068868_100226016 | |||
| 1020 | Ga0070689_100053208 | |||
| 1021 | Ga0070689_100105074 | |||
| 1022 | Ga0070689_100300424 | |||
| 1023 | Ga0070689_100362621 | |||
| 1024 | Ga0070691_10014568 | |||
| 1025 | Ga0070691_10017921 | |||
| 1026 | Ga0070691_10049530 | |||
| 1027 | Ga0070687_100077735 | |||
| 1028 | Ga0070687_100079238 | |||
| 1029 | Ga0070661_100010396 | |||
| 1030 | Ga0070661_100036341 | |||
| 1031 | Ga0070668_100000110 | |||
| 1032 | Ga0070668_100043857 | |||
| 1033 | Ga0070668_100084636 | |||
| 1034 | Ga0070668_100085712 | |||
| 1035 | Ga0070668_100139189 | |||
| 1036 | Ga0070668_100236555 | |||
| 1037 | Ga0070669_100001473 | |||
| 1038 | Ga0070669_100002379 | |||
| 1039 | Ga0070669_100068742 | |||
| 1040 | Ga0070669_100097648 | |||
| 1041 | Ga0070669_100472716 | |||
| 1042 | Ga0070669_100525920 | |||
| 1043 | Ga0070675_100002848 | |||
| 1044 | Ga0070675_100018980 | |||
| 1045 | Ga0070675_100029656 | |||
| 1046 | Ga0070675_100031505 | |||
| 1047 | Ga0070675_100041514 | |||
| 1048 | Ga0070675_100067038 | |||
| 1049 | Ga0070675_100081817 | |||
| 1050 | Ga0070675_100414487 | |||
| 1051 | Ga0070671_100094844 | |||
| 1052 | Ga0070671_100260952 | |||
| 1053 | Ga0070671_100268718 | |||
| 1054 | Ga0070671_100324490 | |||
| 1055 | Ga0070674_100021561 | |||
| 1056 | Ga0070674_100060310 | |||
| 1057 | Ga0070674_100174733 | |||
| 1058 | Ga0070674_100189387 | |||
| 1059 | Ga0070674_100247367 | |||
| 1060 | Ga0070674_100330890 | |||
| 1061 | Ga0070674_100331303 | |||
| 1062 | Ga0070673_100000676 | |||
| 1063 | Ga0070673_100007165 | |||
| 1064 | Ga0070673_100099761 | |||
| 1065 | Ga0070673_100124049 | |||
| 1066 | Ga0070673_100331052 | |||
| 1067 | Ga0070688_100044280 | |||
| 1068 | Ga0070688_100052281 | |||
| 1069 | Ga0070688_100058779 | |||
| 1070 | Ga0070688_100065318 | |||
| 1071 | Ga0070659_100002166 | |||
| 1072 | Ga0070667_100000867 | |||
| 1073 | Ga0070667_100005066 | |||
| 1074 | Ga0070667_100082127 | |||
| 1075 | Ga0070667_100144802 | |||
| 1076 | Ga0070667_100159093 | |||
| 1077 | Ga0070667_100161702 | |||
| 1078 | Ga0070667_100216068 | |||
| 1079 | Ga0070701_10011234 | |||
| 1080 | Ga0070701_10051278 | |||
| 1081 | Ga0070705_100469234 | |||
| 1082 | Ga0070700_100017034 | |||
| 1083 | Ga0070700_100117854 | |||
| 1084 | Ga0070694_100428125 | |||
| 1085 | Ga0070663_100394720 | |||
| 1086 | Ga0070678_100012152 | |||
| 1087 | Ga0070678_100018402 | |||
| 1088 | Ga0070678_100060775 | |||
| 1089 | Ga0070678_100072731 | |||
| 1090 | Ga0070678_100238553 | |||
| 1091 | Ga0070662_100003337 | |||
| 1092 | Ga0070662_100007311 | |||
| 1093 | Ga0070662_100071331 | |||
| 1094 | Ga0070681_10031472 | |||
| 1095 | Ga0070681_10047183 | |||
| 1096 | Ga0070681_10226800 | |||
| 1097 | Ga0068867_100002557 | |||
| 1098 | Ga0068867_100003149 | |||
| 1099 | Ga0068867_100011145 | |||
| 1100 | Ga0068867_100039464 | |||
| 1101 | Ga0068867_100101990 | |||
| 1102 | Ga0068867_100127529 | |||
| 1103 | Ga0068867_100141137 | |||
| 1104 | Ga0068867_100165249 | |||
| 1105 | Ga0068867_100269827 | |||
| 1106 | Ga0068867_100325030 | |||
| 1107 | Ga0070685_10004008 | |||
| 1108 | Ga0070685_10005889 | |||
| 1109 | Ga0070685_10041642 | |||
| 1110 | Ga0070685_10080691 | |||
| 1111 | Ga0070698_100003130 | |||
| 1112 | Ga0070698_100008121 | |||
| 1113 | Ga0070698_100083795 | |||
| 1114 | Ga0070679_100026175 | |||
| 1115 | Ga0070684_100002319 | |||
| 1116 | Ga0070684_100300283 | |||
| 1117 | Ga0068853_100001650 | |||
| 1118 | Ga0068853_100012660 | |||
| 1119 | Ga0068853_100023980 | |||
| 1120 | Ga0068853_100067584 | |||
| 1121 | Ga0068853_100187709 | |||
| 1122 | Ga0070672_100000020 | |||
| 1123 | Ga0070672_100005102 | |||
| 1124 | Ga0070672_100014302 | |||
| 1125 | Ga0070672_100071516 | |||
| 1126 | Ga0070672_100121732 | |||
| 1127 | Ga0070672_100146590 | |||
| 1128 | Ga0070686_100002348 | |||
| 1129 | Ga0070686_100058584 | |||
| 1130 | Ga0070693_100012647 | |||
| 1131 | Ga0070665_100000014 | |||
| 1132 | Ga0070665_100000318 | |||
| 1133 | Ga0070665_100010501 | |||
| 1134 | Ga0068855_100002787 | |||
| 1135 | Ga0068855_100078411 | |||
| 1136 | Ga0068855_100121294 | |||
| 1137 | Ga0068855_100452504 | |||
| 1138 | Ga0068855_100779546 | |||
| 1139 | Ga0070664_100001959 | |||
| 1140 | Ga0070664_100020090 | |||
| 1141 | Ga0070664_100055149 | |||
| 1142 | Ga0070664_100194779 | |||
| 1143 | Ga0070664_100215762 | |||
| 1144 | Ga0070664_100241149 | |||
| 1145 | Ga0070664_100248832 | |||
| 1146 | Ga0068857_100009364 | |||
| 1147 | Ga0068857_100056966 | |||
| 1148 | Ga0068857_100146526 | |||
| 1149 | Ga0068857_100159105 | |||
| 1150 | Ga0068857_100209724 | |||
| 1151 | Ga0068857_100387008 | |||
| 1152 | Ga0068854_100005213 | |||
| 1153 | Ga0068854_100012243 | |||
| 1154 | Ga0068854_100052881 | |||
| 1155 | Ga0068854_100097041 | |||
| 1156 | Ga0068856_100400170 | |||
| 1157 | Ga0070702_100012795 | |||
| 1158 | Ga0068852_100000706 | |||
| 1159 | Ga0068852_100005115 | |||
| 1160 | Ga0068852_100027749 | |||
| 1161 | Ga0068852_100034227 | |||
| 1162 | Ga0068852_100039363 | |||
| 1163 | Ga0068852_100085807 | |||
| 1164 | Ga0068852_100100072 | |||
| 1165 | Ga0068852_100103271 | |||
| 1166 | Ga0068852_100323991 | |||
| 1167 | Ga0068859_100000006 | |||
| 1168 | Ga0068859_100008596 | |||
| 1169 | Ga0068859_100052034 | |||
| 1170 | Ga0068859_100059293 | |||
| 1171 | Ga0068859_100064397 | |||
| 1172 | Ga0068859_100094417 | |||
| 1173 | Ga0068859_100139763 | |||
| 1174 | Ga0068859_100149959 | |||
| 1175 | Ga0068859_100304771 | |||
| 1176 | Ga0068859_100363937 | |||
| 1177 | Ga0068859_100471436 | |||
| 1178 | Ga0068859_100494489 | |||
| 1179 | Ga0068864_100019039 | |||
| 1180 | Ga0068864_100023009 | |||
| 1181 | Ga0068864_100080256 | |||
| 1182 | Ga0068864_100181149 | |||
| 1183 | Ga0068864_100242209 | |||
| 1184 | Ga0068864_100285423 | |||
| 1185 | Ga0068864_100337116 | |||
| 1186 | Ga0068864_100360640 | |||
| 1187 | Ga0068864_100362923 | |||
| 1188 | Ga0068864_100472784 | |||
| 1189 | Ga0068861_100005965 | |||
| 1190 | Ga0068861_100006160 | |||
| 1191 | Ga0068861_100017923 | |||
| 1192 | Ga0068861_100098334 | |||
| 1193 | Ga0068861_100139407 | |||
| 1194 | Ga0068861_100268506 | |||
| 1195 | Ga0068851_10002057 | |||
| 1196 | Ga0068851_10060315 | |||
| 1197 | Ga0068851_10093321 | |||
| 1198 | Ga0068870_10010085 | |||
| 1199 | Ga0068863_100000678 | |||
| 1200 | Ga0068863_100044914 | |||
| 1201 | Ga0068863_100052243 | |||
| 1202 | Ga0068863_100053424 | |||
| 1203 | Ga0068863_100054049 | |||
| 1204 | Ga0068863_100104393 | |||
| 1205 | Ga0068863_100141393 | |||
| 1206 | Ga0068863_100177321 | |||
| 1207 | Ga0068863_100221922 | |||
| 1208 | Ga0068863_100320082 | |||
| 1209 | Ga0068863_100503015 | |||
| 1210 | Ga0068858_100001487 | |||
| 1211 | Ga0068858_100004205 | |||
| 1212 | Ga0068858_100077777 | |||
| 1213 | Ga0068858_100457631 | |||
| 1214 | Ga0068858_100584948 | |||
| 1215 | Ga0068860_100000061 | |||
| 1216 | Ga0068860_100001096 | |||
| 1217 | Ga0068860_100002430 | |||
| 1218 | Ga0068860_100004305 | |||
| 1219 | Ga0068860_100012083 | |||
| 1220 | Ga0068860_100072898 | |||
| 1221 | Ga0068860_100106190 | |||
| 1222 | Ga0068860_100203402 | |||
| 1223 | Ga0068860_100650241 | |||
| 1224 | Ga0068862_100003320 | |||
| 1225 | Ga0068862_100034416 | |||
| 1226 | Ga0068862_100078194 | |||
| 1227 | Ga0081540_1010602 | |||
| 1228 | Ga0081539_10008868 | |||
| 1229 | Ga0075366_10008445 | |||
| 1230 | Ga0075366_10046150 | |||
| 1231 | Ga0075366_10213953 | |||
| 1232 | Ga0097621_100000408 | |||
| 1233 | Ga0097621_100002080 | |||
| 1234 | Ga0097621_100034071 | |||
| 1235 | Ga0097621_100044792 | |||
| 1236 | Ga0097621_100052284 | |||
| 1237 | Ga0097621_100086952 | |||
| 1238 | Ga0097621_100144943 | |||
| 1239 | Ga0097621_100224492 | |||
| 1240 | Ga0068871_100001316 | |||
| 1241 | Ga0068871_100009317 | |||
| 1242 | Ga0068871_100013565 | |||
| 1243 | Ga0068871_100074802 | |||
| 1244 | Ga0068871_100093902 | |||
| 1245 | Ga0068871_100110820 | |||
| 1246 | Ga0068871_100118969 | |||
| 1247 | Ga0068871_100195166 | |||
| 1248 | Ga0068871_100219032 | |||
| 1249 | Ga0068871_100303670 | |||
| 1250 | Ga0068871_100554324 | |||
| 1251 | Ga0075428_100011391 | |||
| 1252 | Ga0075430_100002480 | |||
| 1253 | Ga0075431_100012701 | |||
| 1254 | Ga0075431_100028634 | |||
| 1255 | Ga0075434_100058540 | |||
| 1256 | Ga0075429_100011160 | |||
| 1257 | Ga0075429_100162753 | |||
| 1258 | Ga0075429_100219034 | |||
| 1259 | Ga0075429_100363176 | |||
| 1260 | Ga0068865_100000289 | |||
| 1261 | Ga0068865_100014376 | |||
| 1262 | Ga0068865_100119405 | |||
| 1263 | Ga0068865_100156102 | |||
| 1264 | Ga0068865_100218889 | |||
| 1265 | Ga0068865_100269325 | |||
| 1266 | Ga0068865_100468022 | |||
| 1267 | Ga0068865_100536709 | |||
| 1268 | Ga0097620_100000006 | |||
| 1269 | Ga0097620_100008596 | |||
| 1270 | Ga0097620_100052035 | |||
| 1271 | Ga0097620_100059292 | |||
| 1272 | Ga0097620_100064396 | |||
| 1273 | Ga0097620_100094417 | |||
| 1274 | Ga0097620_100139757 | |||
| 1275 | Ga0097620_100149967 | |||
| 1276 | Ga0097620_100304769 | |||
| 1277 | Ga0097620_100363919 | |||
| 1278 | Ga0097620_100471430 | |||
| 1279 | Ga0097620_100494484 | |||
| 1280 | Ga0075435_100532694 | |||
| 1281 | Ga0105240_10000800 | |||
| 1282 | Ga0105240_10001787 | |||
| 1283 | Ga0105240_10001808 | |||
| 1284 | Ga0105240_10004358 | |||
| 1285 | Ga0105240_10006347 | |||
| 1286 | Ga0105240_10027103 | |||
| 1287 | Ga0105240_10030313 | |||
| 1288 | Ga0105240_10077939 | |||
| 1289 | Ga0105240_10130026 | |||
| 1290 | Ga0111539_10005159 | |||
| 1291 | Ga0111539_10011279 | |||
| 1292 | Ga0111539_10973921 | |||
| 1293 | Ga0105245_10075256 | |||
| 1294 | Ga0105245_10348637 | |||
| 1295 | Ga0105247_10000312 | |||
| 1296 | Ga0105247_10143840 | |||
| 1297 | Ga0114129_10065303 | |||
| 1298 | Ga0105243_10257374 | |||
| 1299 | Ga0105241_10000608 | |||
| 1300 | Ga0105241_10002863 | |||
| 1301 | Ga0105241_10007807 | |||
| 1302 | Ga0105241_10118363 | |||
| 1303 | Ga0105241_10407171 | |||
| 1304 | Ga0105242_10023950 | |||
| 1305 | Ga0105242_10027545 | |||
| 1306 | Ga0105242_10040915 | |||
| 1307 | Ga0105242_10049420 | |||
| 1308 | Ga0105242_10054712 | |||
| 1309 | Ga0105242_10112344 | |||
| 1310 | Ga0105242_10170647 | |||
| 1311 | Ga0105242_10340543 | |||
| 1312 | Ga0105248_10004712 | |||
| 1313 | Ga0105248_10311544 | |||
| 1314 | Ga0105237_10005526 | |||
| 1315 | Ga0105237_10006018 | |||
| 1316 | Ga0105237_10017111 | |||
| 1317 | Ga0105237_10029264 | |||
| 1318 | Ga0105237_10045917 | |||
| 1319 | Ga0105237_10105188 | |||
| 1320 | Ga0105237_10437648 | |||
| 1321 | Ga0105237_10464807 | |||
| 1322 | Ga0105238_10001710 | |||
| 1323 | Ga0105238_10068041 | |||
| 1324 | Ga0105238_10206644 | |||
| 1325 | Ga0105249_10000623 | |||
| 1326 | Ga0105249_10003608 | |||
| 1327 | Ga0105249_10005813 | |||
| 1328 | Ga0105249_10013950 | |||
| 1329 | Ga0105249_10017890 | |||
| 1330 | Ga0105249_10043810 | |||
| 1331 | Ga0105249_10044259 | |||
| 1332 | Ga0105249_10304953 | |||
| 1333 | Ga0105239_10000019 | |||
| 1334 | Ga0105239_10001405 | |||
| 1335 | Ga0105239_10004672 | |||
| 1336 | Ga0105239_10010217 | |||
| 1337 | Ga0105239_10027401 | |||
| 1338 | Ga0105239_10074269 | |||
| 1339 | Ga0105239_10143777 | |||
| 1340 | Ga0105239_10160955 | |||
| 1341 | Ga0105239_10233100 | |||
| 1342 | Ga0105239_10355450 | |||
| 1343 | Ga0105246_10063575 | |||
| 1344 | Ga0105246_10086076 | |||
| 1345 | Ga0105246_10087450 | |||
| 1346 | Ga0157373_10019205 | |||
| 1347 | Ga0157373_10210729 | |||
| 1348 | Ga0157373_10267940 | |||
| 1349 | Ga0157371_10010719 | |||
| 1350 | Ga0157371_10014278 | |||
| 1351 | Ga0157371_10030627 | |||
| 1352 | Ga0157371_10055082 | |||
| 1353 | Ga0157371_10174001 | |||
| 1354 | Ga0157371_10291797 | |||
| 1355 | Ga0157370_10005564 | |||
| 1356 | Ga0157370_10052594 | |||
| 1357 | Ga0157370_10311304 | |||
| 1358 | Ga0157369_10021357 | |||
| 1359 | Ga0157369_10034211 | |||
| 1360 | Ga0157369_10122496 | |||
| 1361 | Ga0157369_10140261 | |||
| 1362 | Ga0157369_10198452 | |||
| 1363 | Ga0157369_10375477 | |||
| 1364 | Ga0157374_10000011 | |||
| 1365 | Ga0157374_10001355 | |||
| 1366 | Ga0157374_10042729 | |||
| 1367 | Ga0157374_10051696 | |||
| 1368 | Ga0157374_10126335 | |||
| 1369 | Ga0157374_10414507 | |||
| 1370 | Ga0157378_10005523 | |||
| 1371 | Ga0157378_10006154 | |||
| 1372 | Ga0157378_10009255 | |||
| 1373 | Ga0157378_10015741 | |||
| 1374 | Ga0157378_10037242 | |||
| 1375 | Ga0157378_10045192 | |||
| 1376 | Ga0157378_10066444 | |||
| 1377 | Ga0157378_10076627 | |||
| 1378 | Ga0157378_10162582 | |||
| 1379 | Ga0157378_10317684 | |||
| 1380 | Ga0157378_10377871 | |||
| 1381 | Ga0163162_10000131 | |||
| 1382 | Ga0163162_10001474 | |||
| 1383 | Ga0163162_10002714 | |||
| 1384 | Ga0163162_10002819 | |||
| 1385 | Ga0163162_10004708 | |||
| 1386 | Ga0163162_10005290 | |||
| 1387 | Ga0163162_10073172 | |||
| 1388 | Ga0163162_10079568 | |||
| 1389 | Ga0163162_10163192 | |||
| 1390 | Ga0163162_10166432 | |||
| 1391 | Ga0163162_10331241 | |||
| 1392 | Ga0157372_10002419 | |||
| 1393 | Ga0157372_10003581 | |||
| 1394 | Ga0157372_10012118 | |||
| 1395 | Ga0157372_10031379 | |||
| 1396 | Ga0157372_10088905 | |||
| 1397 | Ga0157372_10095354 | |||
| 1398 | Ga0157372_10111601 | |||
| 1399 | Ga0157372_10121540 | |||
| 1400 | Ga0157372_10135074 | |||
| 1401 | Ga0157372_10198053 | |||
| 1402 | Ga0157372_10249217 | |||
| 1403 | Ga0157372_10312210 | |||
| 1404 | Ga0157372_10320584 | |||
| 1405 | Ga0157372_10337333 | |||
| 1406 | Ga0157372_10376870 | |||
| 1407 | Ga0157372_10667920 | |||
| 1408 | Ga0157375_10000534 | |||
| 1409 | Ga0157375_10001533 | |||
| 1410 | Ga0157375_10022629 | |||
| 1411 | Ga0157375_10049186 | |||
| 1412 | Ga0157375_10055499 | |||
| 1413 | Ga0157375_10135758 | |||
| 1414 | Ga0157375_10162963 | |||
| 1415 | Ga0157375_10251366 | |||
| 1416 | Ga0157375_10301043 | |||
| 1417 | Ga0157375_10323198 | |||
| 1418 | Ga0157375_10478130 | |||
| 1419 | Ga0157375_10492302 | |||
| 1420 | Ga0157375_10508317 | |||
| 1421 | Ga0163163_10002613 | |||
| 1422 | Ga0163163_10004467 | |||
| 1423 | Ga0163163_10035392 | |||
| 1424 | Ga0163163_10093147 | |||
| 1425 | Ga0163163_10278130 | |||
| 1426 | Ga0163163_10288629 | |||
| 1427 | Ga0163163_10421339 | |||
| 1428 | Ga0163163_10560322 | |||
| 1429 | Ga0163163_10608057 | |||
| 1430 | Ga0157380_10001169 | |||
| 1431 | Ga0157380_10013173 | |||
| 1432 | Ga0157380_10022426 | |||
| 1433 | Ga0157380_10828707 | |||
| 1434 | Ga0157377_10000583 | |||
| 1435 | Ga0157377_10057983 | |||
| 1436 | Ga0157377_10063241 | |||
| 1437 | Ga0157377_10096611 | |||
| 1438 | Ga0157377_10276421 | |||
| 1439 | Ga0157377_10316485 | |||
| 1440 | Ga0157379_10000115 | |||
| 1441 | Ga0157379_10017714 | |||
| 1442 | Ga0157379_10031686 | |||
| 1443 | Ga0157379_10067925 | |||
| 1444 | Ga0157379_10086798 | |||
| 1445 | Ga0157379_10149640 | |||
| 1446 | Ga0157376_10004633 | |||
| 1447 | Ga0157376_10005109 | |||
| 1448 | Ga0157376_10007481 | |||
| 1449 | Ga0157376_10036869 | |||
| 1450 | Ga0157376_10050594 | |||
| 1451 | Ga0157376_10079536 | |||
| 1452 | Ga0157376_10204202 | |||
| 1453 | Ga0157376_10211572 | |||
| 1454 | Ga0157376_10230924 | |||
| 1455 | Ga0157376_10276935 | |||
| 1456 | Ga0157376_10321458 | |||
| 1457 | Ga0163161_10000594 | |||
| 1458 | Ga0163161_10007476 | |||
| 1459 | Ga0163161_10014248 | |||
| 1460 | Ga0207426_1000059 | |||
| 1461 | Ga0207697_10018729 | |||
| 1462 | Ga0207697_10067362 | |||
| 1463 | Ga0207697_10109413 | |||
| 1464 | Ga0207656_10001813 | |||
| 1465 | Ga0207656_10007399 | |||
| 1466 | Ga0207656_10080025 | |||
| 1467 | Ga0207656_10083501 | |||
| 1468 | Ga0207682_10068582 | |||
| 1469 | Ga0207642_10110989 | |||
| 1470 | Ga0207710_10006622 | |||
| 1471 | Ga0207688_10018843 | |||
| 1472 | Ga0207688_10025328 | |||
| 1473 | Ga0207680_10000024 | |||
| 1474 | Ga0207680_10020369 | |||
| 1475 | Ga0207680_10066563 | |||
| 1476 | Ga0207680_10077488 | |||
| 1477 | Ga0207680_10160491 | |||
| 1478 | Ga0207647_10000131 | |||
| 1479 | Ga0207647_10013850 | |||
| 1480 | Ga0207647_10022796 | |||
| 1481 | Ga0207647_10044160 | |||
| 1482 | Ga0207647_10074042 | |||
| 1483 | Ga0207647_10111255 | |||
| 1484 | Ga0207645_10001052 | |||
| 1485 | Ga0207645_10002259 | |||
| 1486 | Ga0207645_10010466 | |||
| 1487 | Ga0207645_10027967 | |||
| 1488 | Ga0207645_10106191 | |||
| 1489 | Ga0207645_10207047 | |||
| 1490 | Ga0207643_10001726 | |||
| 1491 | Ga0207643_10002959 | |||
| 1492 | Ga0207643_10029533 | |||
| 1493 | Ga0207643_10047925 | |||
| 1494 | Ga0207705_10008349 | |||
| 1495 | Ga0207705_10233803 | |||
| 1496 | Ga0207654_10001668 | |||
| 1497 | Ga0207654_10003181 | |||
| 1498 | Ga0207654_10008261 | |||
| 1499 | Ga0207654_10032260 | |||
| 1500 | Ga0207654_10081319 | |||
| 1501 | Ga0207707_10000747 | |||
| 1502 | Ga0207695_10000087 | |||
| 1503 | Ga0207695_10000863 | |||
| 1504 | Ga0207695_10001230 | |||
| 1505 | Ga0207695_10001645 | |||
| 1506 | Ga0207695_10016157 | |||
| 1507 | Ga0207695_10044762 | |||
| 1508 | Ga0207695_10259584 | |||
| 1509 | Ga0207695_10271311 | |||
| 1510 | Ga0207671_10000311 | |||
| 1511 | Ga0207671_10000931 | |||
| 1512 | Ga0207671_10039084 | |||
| 1513 | Ga0207671_10049647 | |||
| 1514 | Ga0207671_10069010 | |||
| 1515 | Ga0207671_10122605 | |||
| 1516 | Ga0207671_10155347 | |||
| 1517 | Ga0207660_10005421 | |||
| 1518 | Ga0207657_10122150 | |||
| 1519 | Ga0207649_10009764 | |||
| 1520 | Ga0207649_10036540 | |||
| 1521 | Ga0207652_10025159 | |||
| 1522 | Ga0207681_10005188 | |||
| 1523 | Ga0207681_10031440 | |||
| 1524 | Ga0207681_10071625 | |||
| 1525 | Ga0207681_10111065 | |||
| 1526 | Ga0207681_10122538 | |||
| 1527 | Ga0207694_10066214 | |||
| 1528 | Ga0207650_10008659 | |||
| 1529 | Ga0207650_10022166 | |||
| 1530 | Ga0207650_10038385 | |||
| 1531 | Ga0207650_10046516 | |||
| 1532 | Ga0207650_10066501 | |||
| 1533 | Ga0207650_10073163 | |||
| 1534 | Ga0207650_10188484 | |||
| 1535 | Ga0207659_10022069 | |||
| 1536 | Ga0207659_10022166 | |||
| 1537 | Ga0207659_10028366 | |||
| 1538 | Ga0207659_10032919 | |||
| 1539 | Ga0207659_10036550 | |||
| 1540 | Ga0207659_10058207 | |||
| 1541 | Ga0207659_10173720 | |||
| 1542 | Ga0207659_10192856 | |||
| 1543 | Ga0207687_10414689 | |||
| 1544 | Ga0207706_10027202 | |||
| 1545 | Ga0207706_10029176 | |||
| 1546 | Ga0207706_10047628 | |||
| 1547 | Ga0207706_10313409 | |||
| 1548 | Ga0207686_10000764 | |||
| 1549 | Ga0207686_10133123 | |||
| 1550 | Ga0207686_10162045 | |||
| 1551 | Ga0207686_10177238 | |||
| 1552 | Ga0207686_10322037 | |||
| 1553 | Ga0207670_10004555 | |||
| 1554 | Ga0207670_10013292 | |||
| 1555 | Ga0207670_10067994 | |||
| 1556 | Ga0207670_10075052 | |||
| 1557 | Ga0207670_10169114 | |||
| 1558 | Ga0207670_10263937 | |||
| 1559 | Ga0207669_10027676 | |||
| 1560 | Ga0207669_10063085 | |||
| 1561 | Ga0207669_10152083 | |||
| 1562 | Ga0207704_10000955 | |||
| 1563 | Ga0207704_10002540 | |||
| 1564 | Ga0207704_10093206 | |||
| 1565 | Ga0207704_10107338 | |||
| 1566 | Ga0207704_10134542 | |||
| 1567 | Ga0207704_10388415 | |||
| 1568 | Ga0207665_10297302 | |||
| 1569 | Ga0207691_10000673 | |||
| 1570 | Ga0207691_10004686 | |||
| 1571 | Ga0207691_10016625 | |||
| 1572 | Ga0207691_10021620 | |||
| 1573 | Ga0207691_10021958 | |||
| 1574 | Ga0207691_10056993 | |||
| 1575 | Ga0207691_10155520 | |||
| 1576 | Ga0207691_10259994 | |||
| 1577 | Ga0207691_10385230 | |||
| 1578 | Ga0207711_10024780 | |||
| 1579 | Ga0207711_10198325 | |||
| 1580 | Ga0207711_10272353 | |||
| 1581 | Ga0207689_10002915 | |||
| 1582 | Ga0207689_10004743 | |||
| 1583 | Ga0207689_10007600 | |||
| 1584 | Ga0207689_10024890 | |||
| 1585 | Ga0207689_10030935 | |||
| 1586 | Ga0207689_10031405 | |||
| 1587 | Ga0207689_10067924 | |||
| 1588 | Ga0207689_10077158 | |||
| 1589 | Ga0207689_10082541 | |||
| 1590 | Ga0207661_10002997 | |||
| 1591 | Ga0207661_10100523 | |||
| 1592 | Ga0207661_10110151 | |||
| 1593 | Ga0207661_10256916 | |||
| 1594 | Ga0207661_10295833 | |||
| 1595 | Ga0207679_10002990 | |||
| 1596 | Ga0207679_10174403 | |||
| 1597 | Ga0207679_10201105 | |||
| 1598 | Ga0207679_10322146 | |||
| 1599 | Ga0207667_10000098 | |||
| 1600 | Ga0207667_10000279 | |||
| 1601 | Ga0207667_10013613 | |||
| 1602 | Ga0207667_10098454 | |||
| 1603 | Ga0207667_10330288 | |||
| 1604 | Ga0207651_10021555 | |||
| 1605 | Ga0207651_10060479 | |||
| 1606 | Ga0207651_10103452 | |||
| 1607 | Ga0207651_10107531 | |||
| 1608 | Ga0207651_10134621 | |||
| 1609 | Ga0207712_10001013 | |||
| 1610 | Ga0207712_10009604 | |||
| 1611 | Ga0207712_10013894 | |||
| 1612 | Ga0207712_10021178 | |||
| 1613 | Ga0207712_10143649 | |||
| 1614 | Ga0207712_10213942 | |||
| 1615 | Ga0207712_10235571 | |||
| 1616 | Ga0207712_10328564 | |||
| 1617 | Ga0207668_10003855 | |||
| 1618 | Ga0207668_10026061 | |||
| 1619 | Ga0207668_10035626 | |||
| 1620 | Ga0207668_10320037 | |||
| 1621 | Ga0207640_10127534 | |||
| 1622 | Ga0207640_10130645 | |||
| 1623 | Ga0207640_10138679 | |||
| 1624 | Ga0207640_10163837 | |||
| 1625 | Ga0207658_10005210 | |||
| 1626 | Ga0207658_10021680 | |||
| 1627 | Ga0207658_10076133 | |||
| 1628 | Ga0207658_10095362 | |||
| 1629 | Ga0207658_10156645 | |||
| 1630 | Ga0207658_10253111 | |||
| 1631 | Ga0207658_10297000 | |||
| 1632 | Ga0207677_10002707 | |||
| 1633 | Ga0207677_10005874 | |||
| 1634 | Ga0207677_10102951 | |||
| 1635 | Ga0207677_10106758 | |||
| 1636 | Ga0207677_10118348 | |||
| 1637 | Ga0207677_10221359 | |||
| 1638 | Ga0207677_10253912 | |||
| 1639 | Ga0207703_10006076 | |||
| 1640 | Ga0207703_10050142 | |||
| 1641 | Ga0207703_10575321 | |||
| 1642 | Ga0207639_10016717 | |||
| 1643 | Ga0207639_10130805 | |||
| 1644 | Ga0207639_10182681 | |||
| 1645 | Ga0207639_10393500 | |||
| 1646 | Ga0207678_10028489 | |||
| 1647 | Ga0207708_10091271 | |||
| 1648 | Ga0207708_10161730 | |||
| 1649 | Ga0207641_10000058 | |||
| 1650 | Ga0207641_10002531 | |||
| 1651 | Ga0207641_10009677 | |||
| 1652 | Ga0207641_10021342 | |||
| 1653 | Ga0207641_10022680 | |||
| 1654 | Ga0207641_10028151 | |||
| 1655 | Ga0207641_10047497 | |||
| 1656 | Ga0207641_10079275 | |||
| 1657 | Ga0207641_10348247 | |||
| 1658 | Ga0207641_10413807 | |||
| 1659 | Ga0207648_10002473 | |||
| 1660 | Ga0207648_10003197 | |||
| 1661 | Ga0207648_10005503 | |||
| 1662 | Ga0207648_10054782 | |||
| 1663 | Ga0207648_10057905 | |||
| 1664 | Ga0207648_10073855 | |||
| 1665 | Ga0207648_10161159 | |||
| 1666 | Ga0207648_10209594 | |||
| 1667 | Ga0207648_10247373 | |||
| 1668 | Ga0207648_10258483 | |||
| 1669 | Ga0207648_10410297 | |||
| 1670 | Ga0207676_10017880 | |||
| 1671 | Ga0207676_10073438 | |||
| 1672 | Ga0207676_10102025 | |||
| 1673 | Ga0207676_10263818 | |||
| 1674 | Ga0207676_10343813 | |||
| 1675 | Ga0207676_10406674 | |||
| 1676 | Ga0207674_10000969 | |||
| 1677 | Ga0207674_10009448 | |||
| 1678 | Ga0207674_10047506 | |||
| 1679 | Ga0207674_10092246 | |||
| 1680 | Ga0207674_10103835 | |||
| 1681 | Ga0207674_10168255 | |||
| 1682 | Ga0207674_10188457 | |||
| 1683 | Ga0207674_10197404 | |||
| 1684 | Ga0207674_10207920 | |||
| 1685 | Ga0207674_10371009 | |||
| 1686 | Ga0207675_100000654 | |||
| 1687 | Ga0207675_100003600 | |||
| 1688 | Ga0207675_100010374 | |||
| 1689 | Ga0207675_100021212 | |||
| 1690 | Ga0207675_100027904 | |||
| 1691 | Ga0207675_100160045 | |||
| 1692 | Ga0207675_100165405 | |||
| 1693 | Ga0207675_100261491 | |||
| 1694 | Ga0207675_100288116 | |||
| 1695 | Ga0207675_100376951 | |||
| 1696 | Ga0207683_10001428 | |||
| 1697 | Ga0207683_10009987 | |||
| 1698 | Ga0207683_10051269 | |||
| 1699 | Ga0207683_10053470 | |||
| 1700 | Ga0207683_10110422 | |||
| 1701 | Ga0207698_10027806 | |||
| 1702 | Ga0207698_10030751 | |||
| 1703 | Ga0207698_10087624 | |||
| 1704 | Ga0207698_10090005 | |||
| 1705 | Ga0207698_10135981 | |||
| 1706 | Ga0207698_10144695 | |||
| 1707 | Ga0207698_10206670 | |||
| 1708 | Ga0207698_10452436 | |||
| 1709 | Ga0207698_10504352 | |||
| 1710 | Ga0209995_1014712 | |||
| 1711 | Ga0209995_1016379 | |||
| 1712 | Ga0209974_10057345 | |||
| 1713 | Ga0207428_10009020 | |||
| 1714 | Ga0268266_10000068 | |||
| 1715 | Ga0268266_10019825 | |||
| 1716 | Ga0268266_10078457 | |||
| 1717 | Ga0268265_10040553 | |||
| 1718 | Ga0268265_10197355 | |||
| 1719 | Ga0268264_10000079 | |||
| 1720 | Ga0268264_10002921 | |||
| 1721 | Ga0268264_10027605 | |||
| 1722 | Ga0268264_10027818 | |||
| 1723 | Ga0268264_10043127 | |||
| 1724 | Ga0268264_10079918 | |||
| 1725 | Ga0268264_10142359 | |||
| 1726 | Ga0268264_10196391 | |||
| 1727 | Ga0307517_10001481 | |||
| 1728 | Ga0307517_10086390 | |||
| 1729 | Ga0307515_10000059 | |||
| 1730 | Ga0307511_10000201 | |||
| 1731 | Ga0265327_10015178 | |||
| 1732 | Ga0265327_10026468 | |||
| 1733 | Ga0307513_10099658 | |||
| 1734 | Ga0307509_10006019 | |||
| 1735 | Ga0307509_10237319 | |||
| 1736 | Ga0307509_10257114 | |||
| 1737 | Ga0307408_100062316 | |||
| 1738 | Ga0307508_10001083 | |||
| 1739 | Ga0307516_10003458 | |||
| 1740 | Ga0307516_10403578 | |||
| 1741 | Ga0307410_10048863 | |||
| 1742 | Ga0307412_10037746 | |||
| 1743 | Ga0307414_10062858 | |||
| 1744 | Ga0307415_100015507 | |||
| 1745 | Ga0307510_10008700 | |||
| 1746 | Ga0373934_0054869 | |||
| 1747 | Ga0373955_0112140 | |||
| 1748 | Ga0373937_0041388 | |||
| 1749 | Ga0373937_0088634 | |||
| 1750 | Ga0395900_0015164 | |||
| 1751 | Ga0395898_0354951 | |||
| 1752 | Ga0395905_0009899 | |||
| 1753 | Ga0395905_0622916 | |||
| 1754 | Ga0451800_1252777 | |||
| 1755 | Ga0439442_029952 | |||
| 1756 | Ga0439449_0019236 | |||
| 1757 | Ga0439449_0021721 | |||
| 1758 | Ga0439457_000363 | |||
| 1759 | Ga0450923_033651 | |||
| 1760 | Ga0450899_005210 | |||
| 1761 | Ga0439434_0001630 | |||
| 1762 | Ga0466969_0000305 | |||
| 1763 | Ga0466972_0000082 | |||
| 1764 | Ga0466972_0008143 | |||
| 1765 | Ga0466972_0010489 | |||
| 1766 | Ga0453683_0026921 | |||
| 1767 | Ga0453683_0218193 | |||
| 1768 | Ga0466965_0047663 | |||
| 1769 | Ga0466966_0000015 | |||
| 1770 | Ga0466966_0313281 | |||
| 1771 | Ga0466961_0123026 | |||
| 1772 | Ga0453684_0020334 | |||
| 1773 | Ga0453684_0096964 | |||
| 1774 | Ga0466968_0080778 | |||
| 1775 | Ga0466957_0017897 | |||
| 1776 | Ga0466957_0028242 | |||
| 1777 | Ga0466957_0108948 | |||
| 1778 | Ga0466959_0000030 | |||
| 1779 | Ga0466959_0029310 | |||
| 1780 | Ga0495629_0313922 | |||
| 1781 | Ga0495638_0059897 | |||
| 1782 | Ga0495638_0100674 | |||
| 1783 | Ga0495650_0081857 | |||
| 1784 | Ga0495606_0003421 | |||
| 1785 | Ga0495628_0057514 | |||
| 1786 | Ga0495643_0028977 | |||
| 1787 | Ga0495648_0003136 | |||
| 1788 | Ga0495621_0040448 | |||
| 1789 | Ga0495621_0041191 | |||
| 1790 | Ga0495622_0138752 | |||
| 1791 | Ga0495634_0225813 | |||
| 1792 | Ga0495611_0000026 | |||
| 1793 | Ga0495625_0043643 | |||
| 1794 | Ga0495625_0101230 | |||
| 1795 | Ga0495635_0040108 | |||
| 1796 | Ga0495647_0018872 | |||
| 1797 | Ga0495670_0033375 | |||
| 1798 | Ga0495649_0064266 | |||
| 1799 | Ga0495600_0242525 | |||
| 1800 | Ga0495672_0036043 | |||
| 1801 | Ga0495687_001838 | |||
| 1802 | Ga0495686_0000005 | |||
| 1803 | Ga0495686_0037770 | |||
| 1804 | Ga0496100_0270075 | |||
| 1805 | Ga0496105_0304438 | |||
| 1806 | Ga0496106_0232139 | |||
| 1807 | Ga0496110_0190814 | |||
| 1808 | Ga0496114_0026179 | |||
| 1809 | Ga0501031_0013457 | |||
| 1810 | Ga0501032_0038258 | |||
| 1811 | Ga0501034_0005186 | |||
| 1812 | Ga0501034_0555011 | |||
| 1813 | Ga0501036_0319937 | |||
| 1814 | Ga0501037_0004139 | |||
| 1815 | Ga0501037_0005433 | |||
| 1816 | Ga0501037_0021327 | |||
| 1817 | Ga0501038_0013654 | |||
| 1818 | Ga0501039_0111846 | |||
| 1819 | Ga0501043_0007747 | |||
| 1820 | Ga0501043_0042317 | |||
| 1821 | Ga0501043_0049505 | |||
| 1822 | Ga0501043_0148930 | |||
| 1823 | Ga0501046_0013771 | |||
| 1824 | Ga0501046_0124260 | |||
| 1825 | Ga0501047_0016908 | |||
| 1826 | Ga0501047_0053720 | |||
| 1827 | Ga0501047_0119443 | |||
| 1828 | Ga0501067_0091302 | |||
| 1829 | Ga0501069_0010220 | |||
| 1830 | Ga0501070_0294149 | |||
| 1831 | Ga0501072_0256483 | |||
| 1832 | Ga0501072_0289795 | |||
| 1833 | Ga0501073_0057525 | |||
| 1834 | Ga0501074_0056911 | |||
| 1835 | Ga0501198_010451 | |||
| 1836 | Ga0501201_000950 | |||
| 1837 | Ga0501222_001674 | |||
| 1838 | Ga0501223_001801 | |||
| 1839 | Ga0501235_004186 | |||
| 1840 | Ga0501235_015906 | |||
| 1841 | Ga0501240_008635 | |||
| 1842 | Ga0501242_000786 | |||
| 1843 | Ga0501243_001866 | |||
| 1844 | Ga0501243_002072 | |||
| 1845 | Ga0501252_008870 | |||
| 1846 | Ga0501257_004100 | |||
| 1847 | Ga0501259_000241 | |||
| 1848 | Ga0501259_000548 | |||
| 1849 | Ga0501261_002098 | |||
| 1850 | Ga0501225_0000523 | |||
| 1851 | Ga0501225_0001327 | |||
| 1852 | Ga0501225_0003132 | |||
| 1853 | Ga0501245_003413 | |||
| 1854 | Ga0501080_0108217 | |||
| 1855 | Ga0501080_0146836 | |||
| 1856 | Ga0501266_001945 | |||
| 1857 | Ga0501035_0023604 | |||
| 1858 | Ga0501044_0006596 | |||
| 1859 | Ga0501044_0026792 | |||
| 1860 | Ga0501044_0072751 | |||
| 1861 | Ga0501044_0078434 | |||
| 1862 | Ga0501044_0187664 | |||
| 1863 | nmdc:mga0k408_206451_c1 | |||
| 1864 | nmdc:mga0k408_2243_c1 | |||
| 1865 | nmdc:mga0k408_28278_c1 | |||
| 1866 | nmdc:mga09592_146433_c1 | |||
| 1867 | nmdc:mga09592_158560_c1 | |||
| 1868 | nmdc:mga0qj67_4627_c1 | |||
| 1869 | nmdc:mga06r32_15626_c1 | |||
| 1870 | nmdc:mga06r32_35876_c1 | |||
| 1871 | nmdc:mga08y16_14158_c1 | |||
| 1872 | nmdc:mga08y16_17376_c1 | |||
| 1873 | nmdc:mga08y16_379105_c1 | |||
| 1874 | nmdc:mga08y16_393156_c1 | |||
| 1875 | nmdc:mga0n895_111335_c1 | |||
| 1876 | Ga0495619_0063266 | |||
| 1877 | Ga0500578_0000063 | |||
| 1878 | Ga0500646_0001629 | |||
| 1879 | Ga0500646_0052160 | |||
| 1880 | Ga0500583_0000076 | |||
| 1881 | Ga0500583_0000557 | |||
| 1882 | Ga0500583_0000662 | |||
| 1883 | Ga0500556_0140753 | |||
| 1884 | Ga0500562_011924 | |||
| 1885 | Ga0500652_007218 | |||
| 1886 | Ga0500658_0142492 | |||
| 1887 | Ga0500559_0023907 | |||
| 1888 | Ga0500568_0001023 | |||
| 1889 | Ga0500568_0043626 | |||
| 1890 | Ga0500573_0158259 | |||
| 1891 | Ga0500577_0045296 | |||
| 1892 | Ga0500588_0001514 | |||
| 1893 | Ga0500589_133366 | |||
| 1894 | Ga0500616_0004133 | |||
| 1895 | Ga0500622_0001733 | |||
| 1896 | Ga0500636_0076299 | |||
| 1897 | Ga0500637_0232392 | |||
| 1898 | Ga0500611_000101 | |||
| 1899 | Ga0501084_0104772 | |||
| 1900 | Ga0501082_0132502 | |||
| 1901 | Ga0466962_0016166 | |||
| 1902 | 2738725633 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hvj-assembly1.cif.gz_C-2 | the structure of the e. coli mrna endoonuclease yicc | 0.8562 | 18 | 285 |
| 8hvj-assembly1.cif.gz_C-2 | the structure of the e. coli mrna endoonuclease yicc | 0.8465 | 18 | 285 |
| 8hvj-assembly1.cif.gz_A-2 | the structure of the e. coli mrna endoonuclease yicc | 0.8343 | 4 | 285 |
| 8hvj-assembly1.cif.gz_A-2 | the structure of the e. coli mrna endoonuclease yicc | 0.8236 | 4 | 285 |
| 8hvj-assembly1.cif.gz_B-2 | the structure of the e. coli mrna endoonuclease yicc | 0.7172 | 8 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23839_203_287_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9568 | 203 | 285 | 1.20.58.220 |
| af_P23839_203_287_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.914 | 203 | 285 | 1.20.58.220 |
| 2vkhB01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8577 | 216 | 287 | 1.20.58.1190 |
| 3ss1A01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8146 | 216 | 285 | 1.20.58.1190 |
| 2vk9A01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8117 | 216 | 284 | 1.20.58.1190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7CAN2-F1-model_v4 | YicC family protein | 0.9457 | 1 | 284 |
GO:0004521
|
| AF-A0A2D9EBZ3-F1-model_v4 | YicC family protein | 0.9349 | 1 | 285 |
GO:0004521
|
| AF-A0A4Q5Y496-F1-model_v4 | deleted | 0.9228 | 124 | 287 |
|
| AF-A0A2D9EBZ3-F1-model_v4 | YicC family protein | 0.9225 | 1 | 285 |
GO:0004521
|
| AF-A0A521CRG6-F1-model_v4 | TIGR00255 family protein | 0.9213 | 1 | 287 |
GO:0004521
|