F486575

General Info

Members Datasets Scaffolds Average Seq Length
951 298 1902 292

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100083925|Ga0070683_1000839251
Length 354
Sequence LRREIYFPVLTNPSIIIIPTSVGIFLLLFLTISRCFIPLPVYQKYKRNCSPIPIPLLLNKTLFMLKSMTGFGRSEQAVGDKTFQVDIKSLNGKQFELLLKLPGFLKPLEFDIRRILSAKLGRGSVDCAISLKETGNAKPVSINTDLAKAYYKPLSELSQALNLDPSHILSTLVKLPEVITPTADTLSDAEWVNFQKVLNAAIDDLNLHRAEEGRSLEEDLLLRIDNIQRQQEEILKLEPGRQQKIRDGLTKLLEENVGKENYDGNRLEQEMIYYIEKIDISEEQVRLKNHCDYFKAIMSEAEESKGKKLSFILQEIGREINTTGAKAYDATIQKCVVIMKDELEKAKEQILNVL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
199 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
253 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
254 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
258 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
259 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
260 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
261 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
262 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
263 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
282 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
289 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0
Rhizoplane 0.63
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100083925 3300005329 Bacteria 2984
2 MBSR1b_contig_334244 2162886012 Bacteria 2124
3 CNXas_1001191 3300000545 Bacteria 1720
4 JGI24736J21556_1003024 3300001904 Bacteria 2937
5 JGI24740J21852_10031413 3300001979 Bacteria 1713
6 JGI24751J29686_10021868 3300002459 Bacteria 1326
7 rootH2_10001613 3300003320 Bacteria 20111
8 rootH2_10001614 3300003320 Bacteria 29985
9 rootH2_10023604 3300003320 Bacteria 13207
10 rootH2_10039966 3300003320 Bacteria 1236
11 rootL2_10113255 3300003322 Bacteria 2187
12 rootH1_10066431 3300003323 Bacteria 1919
13 rootH1_10222292 3300003323 Bacteria 4137
14 rootH1_10270826 3300003323 Bacteria 1377
15 JGI25160J50197_1000262 3300003354 Bacteria 39642
16 Ga0065704_10031790 3300005289 Bacteria 1043
17 Ga0065704_10123993 3300005289 Bacteria 1725
18 Ga0065704_10168158 3300005289 Bacteria 1299
19 Ga0065712_10014215 3300005290 Bacteria 1595
20 Ga0065712_10017724 3300005290 Bacteria 2968
21 Ga0065712_10082292 3300005290 Bacteria 2929
22 Ga0065712_10131098 3300005290 Bacteria 1545
23 Ga0065715_10017649 3300005293 Bacteria 3021
24 Ga0065715_10107768 3300005293 Bacteria 2754
25 Ga0065707_10208036 3300005295 Bacteria 1265
26 Ga0070658_10000563 3300005327 Bacteria 32232
27 Ga0070658_10043116 3300005327 Bacteria 3645
28 Ga0070676_10000218 3300005328 Bacteria 24620
29 Ga0070676_10012670 3300005328 Bacteria 4609
30 Ga0070676_10016335 3300005328 Bacteria 4103
31 Ga0070676_10063489 3300005328 Bacteria 2200
32 Ga0070676_10120344 3300005328 Bacteria 1647
33 Ga0070683_100002723 3300005329 Bacteria 14112
34 Ga0070683_100010919 3300005329 Bacteria 7822
35 Ga0070683_100013457 3300005329 Bacteria 7135
36 Ga0070683_100120086 3300005329 Bacteria 2482
37 Ga0070690_100008208 3300005330 Bacteria 6006
38 Ga0070690_100163166 3300005330 Bacteria 1528
39 Ga0070690_100275366 3300005330 Bacteria 1199
40 Ga0070670_100017530 3300005331 Bacteria 6144
41 Ga0070670_100027025 3300005331 Bacteria 4936
42 Ga0070670_100041055 3300005331 Bacteria 3976
43 Ga0070670_100042974 3300005331 Unclassified 3886
44 Ga0070670_100045367 3300005331 Bacteria 3778
45 Ga0070670_100109684 3300005331 Unclassified 2378
46 Ga0070670_100142938 3300005331 Bacteria 2069
47 Ga0070670_100282343 3300005331 Bacteria 1450
48 Ga0070670_100311675 3300005331 Bacteria 1378
49 Ga0070677_10050904 3300005333 Bacteria 1674
50 Ga0068869_100010867 3300005334 Bacteria 5954
51 Ga0068869_100010963 3300005334 Bacteria 5935
52 Ga0068869_100035886 3300005334 Bacteria 3517
53 Ga0068869_100043025 3300005334 Bacteria 3241
54 Ga0068869_100049082 3300005334 Bacteria 3054
55 Ga0068869_100052642 3300005334 Bacteria 2956
56 Ga0068869_100053388 3300005334 Bacteria 2938
57 Ga0070666_10000072 3300005335 Bacteria 75356
58 Ga0070666_10000969 3300005335 Bacteria 17521
59 Ga0070666_10138495 3300005335 Bacteria 1695
60 Ga0070666_10176280 3300005335 Bacteria 1499
61 Ga0070666_10193496 3300005335 Bacteria 1429
62 Ga0070680_100008932 3300005336 Bacteria 7683
63 Ga0070680_100289070 3300005336 Unclassified 1389
64 Ga0070682_100005089 3300005337 Bacteria 7306
65 Ga0068868_100000770 3300005338 Bacteria 21666
66 Ga0068868_100004154 3300005338 Bacteria 10119
67 Ga0068868_100111604 3300005338 Bacteria 2222
68 Ga0068868_100226016 3300005338 Bacteria 1568
69 Ga0070689_100053208 3300005340 Bacteria 3132
70 Ga0070689_100105074 3300005340 Bacteria 2240
71 Ga0070689_100300424 3300005340 Bacteria 1336
72 Ga0070689_100362621 3300005340 Bacteria 1218
73 Ga0070691_10014568 3300005341 Bacteria 3609
74 Ga0070691_10017921 3300005341 Bacteria 3260
75 Ga0070691_10049530 3300005341 Unclassified 2002
76 Ga0070687_100077735 3300005343 Bacteria 1801
77 Ga0070687_100079238 3300005343 Bacteria 1787
78 Ga0070661_100010396 3300005344 Bacteria 6469
79 Ga0070661_100036341 3300005344 Bacteria 3581
80 Ga0070668_100000110 3300005347 Bacteria 50766
81 Ga0070668_100043857 3300005347 Bacteria 3430
82 Ga0070668_100084636 3300005347 Bacteria 2491
83 Ga0070668_100085712 3300005347 Bacteria 2476
84 Ga0070668_100139189 3300005347 Bacteria 1955
85 Ga0070668_100236555 3300005347 Bacteria 1512
86 Ga0070669_100001473 3300005353 Bacteria 17021
87 Ga0070669_100002379 3300005353 Bacteria 13607
88 Ga0070669_100068742 3300005353 Bacteria 2615
89 Ga0070669_100097648 3300005353 Bacteria 2211
90 Ga0070669_100472716 3300005353 Unclassified 1036
91 Ga0070669_100525920 3300005353 Unclassified 984
92 Ga0070675_100002848 3300005354 Bacteria 13041
93 Ga0070675_100018980 3300005354 Bacteria 5477
94 Ga0070675_100029656 3300005354 Bacteria 4414
95 Ga0070675_100031505 3300005354 Bacteria 4287
96 Ga0070675_100041514 3300005354 Bacteria 3758
97 Ga0070675_100067038 3300005354 Bacteria 2969
98 Ga0070675_100081817 3300005354 Bacteria 2693
99 Ga0070675_100414487 3300005354 Bacteria 1204
100 Ga0070671_100094844 3300005355 Bacteria 2501
101 Ga0070671_100260952 3300005355 Bacteria 1472
102 Ga0070671_100268718 3300005355 Bacteria 1449
103 Ga0070671_100324490 3300005355 Unclassified 1312
104 Ga0070674_100021561 3300005356 Bacteria 4140
105 Ga0070674_100060310 3300005356 Unclassified 2644
106 Ga0070674_100174733 3300005356 Bacteria 1640
107 Ga0070674_100189387 3300005356 Unclassified 1581
108 Ga0070674_100247367 3300005356 Bacteria 1399
109 Ga0070674_100330890 3300005356 Unclassified 1224
110 Ga0070674_100331303 3300005356 Bacteria 1224
111 Ga0070673_100000676 3300005364 Bacteria 18803
112 Ga0070673_100007165 3300005364 Bacteria 7327
113 Ga0070673_100099761 3300005364 Bacteria 2389
114 Ga0070673_100124049 3300005364 Bacteria 2159
115 Ga0070673_100331052 3300005364 Bacteria 1347
116 Ga0070688_100044280 3300005365 Bacteria 2746
117 Ga0070688_100052281 3300005365 Bacteria 2551
118 Ga0070688_100058779 3300005365 Bacteria 2422
119 Ga0070688_100065318 3300005365 Bacteria 2312
120 Ga0070659_100002166 3300005366 Bacteria 13998
121 Ga0070667_100000867 3300005367 Bacteria 28069
122 Ga0070667_100005066 3300005367 Bacteria 11030
123 Ga0070667_100082127 3300005367 Bacteria 2759
124 Ga0070667_100144802 3300005367 Unclassified 2083
125 Ga0070667_100159093 3300005367 Bacteria 1988
126 Ga0070667_100161702 3300005367 Bacteria 1972
127 Ga0070667_100216068 3300005367 Bacteria 1705
128 Ga0070701_10011234 3300005438 Bacteria 3996
129 Ga0070701_10051278 3300005438 Unclassified 2140
130 Ga0070705_100469234 3300005440 Bacteria 948
131 Ga0070700_100017034 3300005441 Bacteria 4150
132 Ga0070700_100117854 3300005441 Bacteria 1775
133 Ga0070694_100428125 3300005444 Bacteria 1041
134 Ga0070663_100394720 3300005455 Bacteria 1129
135 Ga0070678_100012152 3300005456 Bacteria 5340
136 Ga0070678_100018402 3300005456 Bacteria 4526
137 Ga0070678_100060775 3300005456 Bacteria 2783
138 Ga0070678_100072731 3300005456 Bacteria 2578
139 Ga0070678_100238553 3300005456 Bacteria 1519
140 Ga0070662_100003337 3300005457 Bacteria 10011
141 Ga0070662_100007311 3300005457 Bacteria 7156
142 Ga0070662_100071331 3300005457 Bacteria 2561
143 Ga0070681_10031472 3300005458 Bacteria 5327
144 Ga0070681_10047183 3300005458 Bacteria 4306
145 Ga0070681_10226800 3300005458 Unclassified 1783
146 Ga0068867_100002557 3300005459 Bacteria 12824
147 Ga0068867_100003149 3300005459 Bacteria 11633
148 Ga0068867_100011145 3300005459 Bacteria 6342
149 Ga0068867_100039464 3300005459 Bacteria 3442
150 Ga0068867_100101990 3300005459 Bacteria 2193
151 Ga0068867_100127529 3300005459 Bacteria 1973
152 Ga0068867_100141137 3300005459 Unclassified 1883
153 Ga0068867_100165249 3300005459 Bacteria 1748
154 Ga0068867_100269827 3300005459 Bacteria 1391
155 Ga0068867_100325030 3300005459 Bacteria 1276
156 Ga0070685_10004008 3300005466 Bacteria 7437
157 Ga0070685_10005889 3300005466 Bacteria 6238
158 Ga0070685_10041642 3300005466 Bacteria 2618
159 Ga0070685_10080691 3300005466 Bacteria 1949
160 Ga0070698_100003130 3300005471 Bacteria 18229
161 Ga0070698_100008121 3300005471 Bacteria 11346
162 Ga0070698_100083795 3300005471 Bacteria 3177
163 Ga0070679_100026175 3300005530 Bacteria 5727
164 Ga0070684_100002319 3300005535 Bacteria 14029
165 Ga0070684_100300283 3300005535 Unclassified 1473
166 Ga0068853_100001650 3300005539 Bacteria 16317
167 Ga0068853_100012660 3300005539 Bacteria 6868
168 Ga0068853_100023980 3300005539 Bacteria 5114
169 Ga0068853_100067584 3300005539 Bacteria 3105
170 Ga0068853_100187709 3300005539 Bacteria 1877
171 Ga0070672_100000020 3300005543 Bacteria 69277
172 Ga0070672_100005102 3300005543 Bacteria 8661
173 Ga0070672_100014302 3300005543 Bacteria 5623
174 Ga0070672_100071516 3300005543 Bacteria 2760
175 Ga0070672_100121732 3300005543 Bacteria 2136
176 Ga0070672_100146590 3300005543 Bacteria 1951
177 Ga0070686_100002348 3300005544 Bacteria 10422
178 Ga0070686_100058584 3300005544 Bacteria 2478
179 Ga0070693_100012647 3300005547 Unclassified 4276
180 Ga0070665_100000014 3300005548 Bacteria 484881
181 Ga0070665_100000318 3300005548 Bacteria 74326
182 Ga0070665_100010501 3300005548 Bacteria 9368
183 Ga0068855_100002787 3300005563 Bacteria 21515
184 Ga0068855_100078411 3300005563 Bacteria 3832
185 Ga0068855_100121294 3300005563 Bacteria 2992
186 Ga0068855_100452504 3300005563 Unclassified 1401
187 Ga0068855_100779546 3300005563 Bacteria 1017
188 Ga0070664_100001959 3300005564 Bacteria 16513
189 Ga0070664_100020090 3300005564 Bacteria 5499
190 Ga0070664_100055149 3300005564 Bacteria 3373
191 Ga0070664_100194779 3300005564 Unclassified 1807
192 Ga0070664_100215762 3300005564 Bacteria 1715
193 Ga0070664_100241149 3300005564 Bacteria 1623
194 Ga0070664_100248832 3300005564 Unclassified 1597
195 Ga0068857_100009364 3300005577 Bacteria 8503
196 Ga0068857_100056966 3300005577 Bacteria 3469
197 Ga0068857_100146526 3300005577 Bacteria 2136
198 Ga0068857_100159105 3300005577 Bacteria 2049
199 Ga0068857_100209724 3300005577 Bacteria 1777
200 Ga0068857_100387008 3300005577 Unclassified 1299
201 Ga0068854_100005213 3300005578 Bacteria 8197
202 Ga0068854_100012243 3300005578 Bacteria 5615
203 Ga0068854_100052881 3300005578 Bacteria 2914
204 Ga0068854_100097041 3300005578 Bacteria 2203
205 Ga0068856_100400170 3300005614 Unclassified 1393
206 Ga0070702_100012795 3300005615 Bacteria 4220
207 Ga0068852_100000706 3300005616 Bacteria 21835
208 Ga0068852_100005115 3300005616 Bacteria 9343
209 Ga0068852_100027749 3300005616 Bacteria 4619
210 Ga0068852_100034227 3300005616 Bacteria 4225
211 Ga0068852_100039363 3300005616 Unclassified 3980
212 Ga0068852_100085807 3300005616 Bacteria 2805
213 Ga0068852_100100072 3300005616 Bacteria 2614
214 Ga0068852_100103271 3300005616 Bacteria 2577
215 Ga0068852_100323991 3300005616 Bacteria 1497
216 Ga0068859_100000006 3300005617 Bacteria 421509
217 Ga0068859_100008596 3300005617 Bacteria 10325
218 Ga0068859_100052034 3300005617 Bacteria 4118
219 Ga0068859_100059293 3300005617 Bacteria 3856
220 Ga0068859_100064397 3300005617 Bacteria 3698
221 Ga0068859_100094417 3300005617 Bacteria 3043
222 Ga0068859_100139763 3300005617 Bacteria 2495
223 Ga0068859_100149959 3300005617 Bacteria 2407
224 Ga0068859_100304771 3300005617 Bacteria 1686
225 Ga0068859_100363937 3300005617 Bacteria 1541
226 Ga0068859_100471436 3300005617 Bacteria 1351
227 Ga0068859_100494489 3300005617 Bacteria 1318
228 Ga0068864_100019039 3300005618 Bacteria 5738
229 Ga0068864_100023009 3300005618 Bacteria 5229
230 Ga0068864_100080256 3300005618 Bacteria 2858
231 Ga0068864_100181149 3300005618 Unclassified 1926
232 Ga0068864_100242209 3300005618 Unclassified 1671
233 Ga0068864_100285423 3300005618 Unclassified 1542
234 Ga0068864_100337116 3300005618 Bacteria 1420
235 Ga0068864_100360640 3300005618 Bacteria 1373
236 Ga0068864_100362923 3300005618 Bacteria 1369
237 Ga0068864_100472784 3300005618 Unclassified 1202
238 Ga0068861_100005965 3300005719 Bacteria 8274
239 Ga0068861_100006160 3300005719 Bacteria 8159
240 Ga0068861_100017923 3300005719 Bacteria 5034
241 Ga0068861_100098334 3300005719 Bacteria 2323
242 Ga0068861_100139407 3300005719 Bacteria 1978
243 Ga0068861_100268506 3300005719 Bacteria 1464
244 Ga0068851_10002057 3300005834 Bacteria 8863
245 Ga0068851_10060315 3300005834 Bacteria 1942
246 Ga0068851_10093321 3300005834 Bacteria 1588
247 Ga0068870_10010085 3300005840 Bacteria 4322
248 Ga0068863_100000678 3300005841 Bacteria 34425
249 Ga0068863_100044914 3300005841 Bacteria 4193
250 Ga0068863_100052243 3300005841 Bacteria 3874
251 Ga0068863_100053424 3300005841 Bacteria 3830
252 Ga0068863_100054049 3300005841 Bacteria 3806
253 Ga0068863_100104393 3300005841 Bacteria 2696
254 Ga0068863_100141393 3300005841 Bacteria 2300
255 Ga0068863_100177321 3300005841 Bacteria 2045
256 Ga0068863_100221922 3300005841 Bacteria 1821
257 Ga0068863_100320082 3300005841 Unclassified 1506
258 Ga0068863_100503015 3300005841 Bacteria 1193
259 Ga0068858_100001487 3300005842 Bacteria 24140
260 Ga0068858_100004205 3300005842 Bacteria 14172
261 Ga0068858_100077777 3300005842 Bacteria 3082
262 Ga0068858_100457631 3300005842 Unclassified 1230
263 Ga0068858_100584948 3300005842 Bacteria 1082
264 Ga0068860_100000061 3300005843 Bacteria 192548
265 Ga0068860_100001096 3300005843 Bacteria 29818
266 Ga0068860_100002430 3300005843 Bacteria 19567
267 Ga0068860_100004305 3300005843 Bacteria 14551
268 Ga0068860_100012083 3300005843 Bacteria 8504
269 Ga0068860_100072898 3300005843 Bacteria 3264
270 Ga0068860_100106190 3300005843 Bacteria 2682
271 Ga0068860_100203402 3300005843 Bacteria 1920
272 Ga0068860_100650241 3300005843 Bacteria 1062
273 Ga0068862_100003320 3300005844 Bacteria 13899
274 Ga0068862_100034416 3300005844 Bacteria 4286
275 Ga0068862_100078194 3300005844 Bacteria 2866
276 Ga0081540_1010602 3300005983 Bacteria 6223
277 Ga0081539_10008868 3300005985 Bacteria 8597
278 Ga0075366_10008445 3300006195 Bacteria 5728
279 Ga0075366_10046150 3300006195 Bacteria 2582
280 Ga0075366_10213953 3300006195 Bacteria 1174
281 Ga0097621_100000408 3300006237 Bacteria 30010
282 Ga0097621_100002080 3300006237 Bacteria 13697
283 Ga0097621_100034071 3300006237 Bacteria 4059
284 Ga0097621_100044792 3300006237 Bacteria 3571
285 Ga0097621_100052284 3300006237 Bacteria 3328
286 Ga0097621_100086952 3300006237 Bacteria 2609
287 Ga0097621_100144943 3300006237 Bacteria 2032
288 Ga0097621_100224492 3300006237 Unclassified 1638
289 Ga0068871_100001316 3300006358 Bacteria 16589
290 Ga0068871_100009317 3300006358 Bacteria 7107
291 Ga0068871_100013565 3300006358 Bacteria 6050
292 Ga0068871_100074802 3300006358 Bacteria 2795
293 Ga0068871_100093902 3300006358 Bacteria 2503
294 Ga0068871_100110820 3300006358 Bacteria 2308
295 Ga0068871_100118969 3300006358 Bacteria 2229
296 Ga0068871_100195166 3300006358 Bacteria 1745
297 Ga0068871_100219032 3300006358 Bacteria 1648
298 Ga0068871_100303670 3300006358 Bacteria 1401
299 Ga0068871_100554324 3300006358 Bacteria 1041
300 Ga0075428_100011391 3300006844 Bacteria 9893
301 Ga0075430_100002480 3300006846 Bacteria 15380
302 Ga0075431_100012701 3300006847 Bacteria 8505
303 Ga0075431_100028634 3300006847 Bacteria 5727
304 Ga0075434_100058540 3300006871 Bacteria 3829
305 Ga0075429_100011160 3300006880 Bacteria 7778
306 Ga0075429_100162753 3300006880 Bacteria 1954
307 Ga0075429_100219034 3300006880 Bacteria 1667
308 Ga0075429_100363176 3300006880 Bacteria 1268
309 Ga0068865_100000289 3300006881 Bacteria 27735
310 Ga0068865_100014376 3300006881 Bacteria 5028
311 Ga0068865_100119405 3300006881 Bacteria 1958
312 Ga0068865_100156102 3300006881 Bacteria 1736
313 Ga0068865_100218889 3300006881 Bacteria 1488
314 Ga0068865_100269325 3300006881 Bacteria 1352
315 Ga0068865_100468022 3300006881 Bacteria 1045
316 Ga0068865_100536709 3300006881 Bacteria 980
317 Ga0097620_100000006 3300006931 Bacteria 421509
318 Ga0097620_100008596 3300006931 Bacteria 10325
319 Ga0097620_100052035 3300006931 Bacteria 4118
320 Ga0097620_100059292 3300006931 Bacteria 3856
321 Ga0097620_100064396 3300006931 Bacteria 3698
322 Ga0097620_100094417 3300006931 Bacteria 3043
323 Ga0097620_100139757 3300006931 Bacteria 2495
324 Ga0097620_100149967 3300006931 Bacteria 2407
325 Ga0097620_100304769 3300006931 Bacteria 1686
326 Ga0097620_100363919 3300006931 Bacteria 1541
327 Ga0097620_100471430 3300006931 Bacteria 1351
328 Ga0097620_100494484 3300006931 Bacteria 1318
329 Ga0075435_100532694 3300007076 Bacteria 1016
330 Ga0105240_10000800 3300009093 Bacteria 56989
331 Ga0105240_10001787 3300009093 Bacteria 36277
332 Ga0105240_10001808 3300009093 Bacteria 36002
333 Ga0105240_10004358 3300009093 Bacteria 21601
334 Ga0105240_10006347 3300009093 Bacteria 17410
335 Ga0105240_10027103 3300009093 Bacteria 7508
336 Ga0105240_10030313 3300009093 Bacteria 7030
337 Ga0105240_10077939 3300009093 Bacteria 4082
338 Ga0105240_10130026 3300009093 Bacteria 3021
339 Ga0111539_10005159 3300009094 Bacteria 16933
340 Ga0111539_10011279 3300009094 Bacteria 11226
341 Ga0111539_10973921 3300009094 Bacteria 986
342 Ga0105245_10075256 3300009098 Bacteria 3074
343 Ga0105245_10348637 3300009098 Bacteria 1466
344 Ga0105247_10000312 3300009101 Bacteria 43730
345 Ga0105247_10143840 3300009101 Bacteria 1565
346 Ga0114129_10065303 3300009147 Bacteria 5079
347 Ga0105243_10257374 3300009148 Bacteria 1561
348 Ga0105241_10000608 3300009174 Bacteria 26997
349 Ga0105241_10002863 3300009174 Bacteria 12889
350 Ga0105241_10007807 3300009174 Bacteria 7866
351 Ga0105241_10118363 3300009174 Bacteria 2130
352 Ga0105241_10407171 3300009174 Bacteria 1194
353 Ga0105242_10023950 3300009176 Bacteria 4817
354 Ga0105242_10027545 3300009176 Bacteria 4514
355 Ga0105242_10040915 3300009176 Bacteria 3736
356 Ga0105242_10049420 3300009176 Bacteria 3423
357 Ga0105242_10054712 3300009176 Bacteria 3263
358 Ga0105242_10112344 3300009176 Unclassified 2325
359 Ga0105242_10170647 3300009176 Bacteria 1912
360 Ga0105242_10340543 3300009176 Bacteria 1382
361 Ga0105248_10004712 3300009177 Bacteria 15092
362 Ga0105248_10311544 3300009177 Bacteria 1773
363 Ga0105237_10005526 3300009545 Bacteria 14250
364 Ga0105237_10006018 3300009545 Bacteria 13573
365 Ga0105237_10017111 3300009545 Bacteria 7521
366 Ga0105237_10029264 3300009545 Bacteria 5602
367 Ga0105237_10045917 3300009545 Bacteria 4396
368 Ga0105237_10105188 3300009545 Bacteria 2813
369 Ga0105237_10437648 3300009545 Unclassified 1313
370 Ga0105237_10464807 3300009545 Bacteria 1271
371 Ga0105238_10001710 3300009551 Bacteria 22126
372 Ga0105238_10068041 3300009551 Bacteria 3562
373 Ga0105238_10206644 3300009551 Bacteria 1940
374 Ga0105249_10000623 3300009553 Bacteria 32238
375 Ga0105249_10003608 3300009553 Bacteria 13384
376 Ga0105249_10005813 3300009553 Bacteria 10667
377 Ga0105249_10013950 3300009553 Bacteria 7102
378 Ga0105249_10017890 3300009553 Bacteria 6298
379 Ga0105249_10043810 3300009553 Bacteria 4070
380 Ga0105249_10044259 3300009553 Bacteria 4048
381 Ga0105249_10304953 3300009553 Bacteria 1599
382 Ga0105239_10000019 3300010375 Bacteria 273836
383 Ga0105239_10001405 3300010375 Bacteria 32195
384 Ga0105239_10004672 3300010375 Bacteria 16278
385 Ga0105239_10010217 3300010375 Bacteria 10512
386 Ga0105239_10027401 3300010375 Bacteria 6272
387 Ga0105239_10074269 3300010375 Bacteria 3739
388 Ga0105239_10143777 3300010375 Bacteria 2659
389 Ga0105239_10160955 3300010375 Bacteria 2508
390 Ga0105239_10233100 3300010375 Unclassified 2066
391 Ga0105239_10355450 3300010375 Bacteria 1654
392 Ga0105246_10063575 3300011119 Bacteria 2575
393 Ga0105246_10086076 3300011119 Bacteria 2252
394 Ga0105246_10087450 3300011119 Bacteria 2237
395 Ga0157373_10019205 3300013100 Bacteria 4977
396 Ga0157373_10210729 3300013100 Unclassified 1370
397 Ga0157373_10267940 3300013100 Bacteria 1209
398 Ga0157371_10010719 3300013102 Bacteria 7118
399 Ga0157371_10014278 3300013102 Bacteria 6000
400 Ga0157371_10030627 3300013102 Unclassified 3880
401 Ga0157371_10055082 3300013102 Bacteria 2822
402 Ga0157371_10174001 3300013102 Bacteria 1539
403 Ga0157371_10291797 3300013102 Bacteria 1179
404 Ga0157370_10005564 3300013104 Bacteria 14125
405 Ga0157370_10052594 3300013104 Bacteria 3888
406 Ga0157370_10311304 3300013104 Bacteria 1453
407 Ga0157369_10021357 3300013105 Bacteria 7240
408 Ga0157369_10034211 3300013105 Bacteria 5579
409 Ga0157369_10122496 3300013105 Bacteria 2758
410 Ga0157369_10140261 3300013105 Unclassified 2558
411 Ga0157369_10198452 3300013105 Unclassified 2106
412 Ga0157369_10375477 3300013105 Unclassified 1476
413 Ga0157374_10000011 3300013296 Bacteria 466749
414 Ga0157374_10001355 3300013296 Bacteria 20853
415 Ga0157374_10042729 3300013296 Bacteria 4182
416 Ga0157374_10051696 3300013296 Bacteria 3824
417 Ga0157374_10126335 3300013296 Bacteria 2472
418 Ga0157374_10414507 3300013296 Bacteria 1345
419 Ga0157378_10005523 3300013297 Bacteria 11078
420 Ga0157378_10006154 3300013297 Bacteria 10506
421 Ga0157378_10009255 3300013297 Bacteria 8579
422 Ga0157378_10015741 3300013297 Bacteria 6623
423 Ga0157378_10037242 3300013297 Bacteria 4308
424 Ga0157378_10045192 3300013297 Bacteria 3913
425 Ga0157378_10066444 3300013297 Bacteria 3230
426 Ga0157378_10076627 3300013297 Bacteria 3013
427 Ga0157378_10162582 3300013297 Bacteria 2089
428 Ga0157378_10317684 3300013297 Bacteria 1512
429 Ga0157378_10377871 3300013297 Bacteria 1391
430 Ga0163162_10000131 3300013306 Bacteria 67924
431 Ga0163162_10001474 3300013306 Bacteria 21898
432 Ga0163162_10002714 3300013306 Bacteria 16800
433 Ga0163162_10002819 3300013306 Bacteria 16526
434 Ga0163162_10004708 3300013306 Bacteria 13154
435 Ga0163162_10005290 3300013306 Bacteria 12454
436 Ga0163162_10073172 3300013306 Bacteria 3483
437 Ga0163162_10079568 3300013306 Bacteria 3344
438 Ga0163162_10163192 3300013306 Bacteria 2351
439 Ga0163162_10166432 3300013306 Bacteria 2329
440 Ga0163162_10331241 3300013306 Bacteria 1655
441 Ga0157372_10002419 3300013307 Bacteria 20209
442 Ga0157372_10003581 3300013307 Bacteria 16712
443 Ga0157372_10012118 3300013307 Bacteria 9184
444 Ga0157372_10031379 3300013307 Bacteria 5818
445 Ga0157372_10088905 3300013307 Bacteria 3508
446 Ga0157372_10095354 3300013307 Bacteria 3390
447 Ga0157372_10111601 3300013307 Unclassified 3133
448 Ga0157372_10121540 3300013307 Bacteria 3000
449 Ga0157372_10135074 3300013307 Bacteria 2840
450 Ga0157372_10198053 3300013307 Bacteria 2326
451 Ga0157372_10249217 3300013307 Bacteria 2061
452 Ga0157372_10312210 3300013307 Bacteria 1830
453 Ga0157372_10320584 3300013307 Bacteria 1804
454 Ga0157372_10337333 3300013307 Bacteria 1756
455 Ga0157372_10376870 3300013307 Bacteria 1653
456 Ga0157372_10667920 3300013307 Bacteria 1210
457 Ga0157375_10000534 3300013308 Bacteria 34107
458 Ga0157375_10001533 3300013308 Bacteria 19889
459 Ga0157375_10022629 3300013308 Bacteria 5786
460 Ga0157375_10049186 3300013308 Bacteria 4130
461 Ga0157375_10055499 3300013308 Bacteria 3907
462 Ga0157375_10135758 3300013308 Bacteria 2583
463 Ga0157375_10162963 3300013308 Bacteria 2373
464 Ga0157375_10251366 3300013308 Bacteria 1929
465 Ga0157375_10301043 3300013308 Bacteria 1767
466 Ga0157375_10323198 3300013308 Bacteria 1707
467 Ga0157375_10478130 3300013308 Bacteria 1411
468 Ga0157375_10492302 3300013308 Bacteria 1391
469 Ga0157375_10508317 3300013308 Unclassified 1369
470 Ga0163163_10002613 3300014325 Bacteria 15252
471 Ga0163163_10004467 3300014325 Bacteria 11931
472 Ga0163163_10035392 3300014325 Bacteria 4843
473 Ga0163163_10093147 3300014325 Bacteria 3029
474 Ga0163163_10278130 3300014325 Bacteria 1725
475 Ga0163163_10288629 3300014325 Bacteria 1693
476 Ga0163163_10421339 3300014325 Unclassified 1394
477 Ga0163163_10560322 3300014325 Bacteria 1205
478 Ga0163163_10608057 3300014325 Bacteria 1156
479 Ga0157380_10001169 3300014326 Bacteria 17017
480 Ga0157380_10013173 3300014326 Bacteria 6022
481 Ga0157380_10022426 3300014326 Bacteria 4753
482 Ga0157380_10828707 3300014326 Bacteria 945
483 Ga0157377_10000583 3300014745 Bacteria 15210
484 Ga0157377_10057983 3300014745 Unclassified 2203
485 Ga0157377_10063241 3300014745 Bacteria 2119
486 Ga0157377_10096611 3300014745 Bacteria 1753
487 Ga0157377_10276421 3300014745 Unclassified 1099
488 Ga0157377_10316485 3300014745 Bacteria 1035
489 Ga0157379_10000115 3300014968 Bacteria 55499
490 Ga0157379_10017714 3300014968 Bacteria 6276
491 Ga0157379_10031686 3300014968 Bacteria 4711
492 Ga0157379_10067925 3300014968 Bacteria 3187
493 Ga0157379_10086798 3300014968 Bacteria 2806
494 Ga0157379_10149640 3300014968 Bacteria 2105
495 Ga0157376_10004633 3300014969 Bacteria 9582
496 Ga0157376_10005109 3300014969 Bacteria 9147
497 Ga0157376_10007481 3300014969 Bacteria 7803
498 Ga0157376_10036869 3300014969 Bacteria 3964
499 Ga0157376_10050594 3300014969 Bacteria 3448
500 Ga0157376_10079536 3300014969 Bacteria 2810
501 Ga0157376_10204202 3300014969 Bacteria 1820
502 Ga0157376_10211572 3300014969 Bacteria 1790
503 Ga0157376_10230924 3300014969 Bacteria 1719
504 Ga0157376_10276935 3300014969 Bacteria 1578
505 Ga0157376_10321458 3300014969 Bacteria 1471
506 Ga0163161_10000594 3300017792 Bacteria 29004
507 Ga0163161_10007476 3300017792 Bacteria 7550
508 Ga0163161_10014248 3300017792 Bacteria 5536
509 Ga0207426_1000059 3300025302 Bacteria 363842
510 Ga0207697_10018729 3300025315 Bacteria 2838
511 Ga0207697_10067362 3300025315 Bacteria 1497
512 Ga0207697_10109413 3300025315 Bacteria 1183
513 Ga0207656_10001813 3300025321 Bacteria 7104
514 Ga0207656_10007399 3300025321 Bacteria 3996
515 Ga0207656_10080025 3300025321 Bacteria 1467
516 Ga0207656_10083501 3300025321 Bacteria 1439
517 Ga0207682_10068582 3300025893 Bacteria 1499
518 Ga0207642_10110989 3300025899 Unclassified 1396
519 Ga0207710_10006622 3300025900 Bacteria 4936
520 Ga0207688_10018843 3300025901 Bacteria 3754
521 Ga0207688_10025328 3300025901 Bacteria 3257
522 Ga0207680_10000024 3300025903 Bacteria 82106
523 Ga0207680_10020369 3300025903 Bacteria 3568
524 Ga0207680_10066563 3300025903 Bacteria 2216
525 Ga0207680_10077488 3300025903 Bacteria 2079
526 Ga0207680_10160491 3300025903 Bacteria 1507
527 Ga0207647_10000131 3300025904 Bacteria 58960
528 Ga0207647_10013850 3300025904 Bacteria 5584
529 Ga0207647_10022796 3300025904 Bacteria 4153
530 Ga0207647_10044160 3300025904 Bacteria 2786
531 Ga0207647_10074042 3300025904 Bacteria 2052
532 Ga0207647_10111255 3300025904 Bacteria 1619
533 Ga0207645_10001052 3300025907 Bacteria 22849
534 Ga0207645_10002259 3300025907 Bacteria 15319
535 Ga0207645_10010466 3300025907 Bacteria 6369
536 Ga0207645_10027967 3300025907 Bacteria 3640
537 Ga0207645_10106191 3300025907 Bacteria 1815
538 Ga0207645_10207047 3300025907 Bacteria 1291
539 Ga0207643_10001726 3300025908 Bacteria 12257
540 Ga0207643_10002959 3300025908 Bacteria 9169
541 Ga0207643_10029533 3300025908 Bacteria 3049
542 Ga0207643_10047925 3300025908 Bacteria 2419
543 Ga0207705_10008349 3300025909 Bacteria 7561
544 Ga0207705_10233803 3300025909 Bacteria 1399
545 Ga0207654_10001668 3300025911 Bacteria 11602
546 Ga0207654_10003181 3300025911 Bacteria 8295
547 Ga0207654_10008261 3300025911 Bacteria 5256
548 Ga0207654_10032260 3300025911 Bacteria 2893
549 Ga0207654_10081319 3300025911 Bacteria 1950
550 Ga0207707_10000747 3300025912 Bacteria 32068
551 Ga0207695_10000087 3300025913 Bacteria 276412
552 Ga0207695_10000863 3300025913 Bacteria 55452
553 Ga0207695_10001230 3300025913 Bacteria 43841
554 Ga0207695_10001645 3300025913 Bacteria 35984
555 Ga0207695_10016157 3300025913 Bacteria 8752
556 Ga0207695_10044762 3300025913 Bacteria 4704
557 Ga0207695_10259584 3300025913 Unclassified 1635
558 Ga0207695_10271311 3300025913 Bacteria 1592
559 Ga0207671_10000311 3300025914 Bacteria 71753
560 Ga0207671_10000931 3300025914 Bacteria 36651
561 Ga0207671_10039084 3300025914 Bacteria 3515
562 Ga0207671_10049647 3300025914 Bacteria 3106
563 Ga0207671_10069010 3300025914 Bacteria 2635
564 Ga0207671_10122605 3300025914 Bacteria 1988
565 Ga0207671_10155347 3300025914 Bacteria 1769
566 Ga0207660_10005421 3300025917 Bacteria 8278
567 Ga0207657_10122150 3300025919 Bacteria 2142
568 Ga0207649_10009764 3300025920 Bacteria 5257
569 Ga0207649_10036540 3300025920 Bacteria 2959
570 Ga0207652_10025159 3300025921 Unclassified 4946
571 Ga0207681_10005188 3300025923 Bacteria 8000
572 Ga0207681_10031440 3300025923 Bacteria 3467
573 Ga0207681_10071625 3300025923 Bacteria 2418
574 Ga0207681_10111065 3300025923 Bacteria 1994
575 Ga0207681_10122538 3300025923 Bacteria 1909
576 Ga0207694_10066214 3300025924 Unclassified 2818
577 Ga0207650_10008659 3300025925 Bacteria 6950
578 Ga0207650_10022166 3300025925 Bacteria 4496
579 Ga0207650_10038385 3300025925 Bacteria 3497
580 Ga0207650_10046516 3300025925 Bacteria 3195
581 Ga0207650_10066501 3300025925 Bacteria 2703
582 Ga0207650_10073163 3300025925 Bacteria 2581
583 Ga0207650_10188484 3300025925 Bacteria 1647
584 Ga0207659_10022069 3300025926 Bacteria 4235
585 Ga0207659_10022166 3300025926 Bacteria 4226
586 Ga0207659_10028366 3300025926 Bacteria 3804
587 Ga0207659_10032919 3300025926 Bacteria 3562
588 Ga0207659_10036550 3300025926 Bacteria 3403
589 Ga0207659_10058207 3300025926 Bacteria 2774
590 Ga0207659_10173720 3300025926 Bacteria 1701
591 Ga0207659_10192856 3300025926 Bacteria 1622
592 Ga0207687_10414689 3300025927 Bacteria 1110
593 Ga0207706_10027202 3300025933 Bacteria 5115
594 Ga0207706_10029176 3300025933 Bacteria 4926
595 Ga0207706_10047628 3300025933 Bacteria 3792
596 Ga0207706_10313409 3300025933 Unclassified 1366
597 Ga0207686_10000764 3300025934 Bacteria 19790
598 Ga0207686_10133123 3300025934 Bacteria 1708
599 Ga0207686_10162045 3300025934 Bacteria 1568
600 Ga0207686_10177238 3300025934 Bacteria 1509
601 Ga0207686_10322037 3300025934 Bacteria 1155
602 Ga0207670_10004555 3300025936 Bacteria 7485
603 Ga0207670_10013292 3300025936 Bacteria 4847
604 Ga0207670_10067994 3300025936 Bacteria 2453
605 Ga0207670_10075052 3300025936 Unclassified 2349
606 Ga0207670_10169114 3300025936 Bacteria 1637
607 Ga0207670_10263937 3300025936 Bacteria 1336
608 Ga0207669_10027676 3300025937 Bacteria 3108
609 Ga0207669_10063085 3300025937 Unclassified 2285
610 Ga0207669_10152083 3300025937 Unclassified 1622
611 Ga0207704_10000955 3300025938 Bacteria 12788
612 Ga0207704_10002540 3300025938 Bacteria 8226
613 Ga0207704_10093206 3300025938 Bacteria 1985
614 Ga0207704_10107338 3300025938 Bacteria 1878
615 Ga0207704_10134542 3300025938 Bacteria 1718
616 Ga0207704_10388415 3300025938 Bacteria 1098
617 Ga0207665_10297302 3300025939 Bacteria 1206
618 Ga0207691_10000673 3300025940 Bacteria 33764
619 Ga0207691_10004686 3300025940 Bacteria 13245
620 Ga0207691_10016625 3300025940 Bacteria 6985
621 Ga0207691_10021620 3300025940 Bacteria 6074
622 Ga0207691_10021958 3300025940 Bacteria 6023
623 Ga0207691_10056993 3300025940 Bacteria 3558
624 Ga0207691_10155520 3300025940 Unclassified 2008
625 Ga0207691_10259994 3300025940 Bacteria 1496
626 Ga0207691_10385230 3300025940 Bacteria 1197
627 Ga0207711_10024780 3300025941 Bacteria 5033
628 Ga0207711_10198325 3300025941 Bacteria 1831
629 Ga0207711_10272353 3300025941 Bacteria 1558
630 Ga0207689_10002915 3300025942 Bacteria 15788
631 Ga0207689_10004743 3300025942 Bacteria 12259
632 Ga0207689_10007600 3300025942 Bacteria 9495
633 Ga0207689_10024890 3300025942 Bacteria 5018
634 Ga0207689_10030935 3300025942 Bacteria 4459
635 Ga0207689_10031405 3300025942 Bacteria 4422
636 Ga0207689_10067924 3300025942 Bacteria 2929
637 Ga0207689_10077158 3300025942 Bacteria 2739
638 Ga0207689_10082541 3300025942 Unclassified 2642
639 Ga0207661_10002997 3300025944 Bacteria 11677
640 Ga0207661_10100523 3300025944 Bacteria 2427
641 Ga0207661_10110151 3300025944 Bacteria 2327
642 Ga0207661_10256916 3300025944 Bacteria 1555
643 Ga0207661_10295833 3300025944 Bacteria 1450
644 Ga0207679_10002990 3300025945 Bacteria 10485
645 Ga0207679_10174403 3300025945 Bacteria 1773
646 Ga0207679_10201105 3300025945 Unclassified 1664
647 Ga0207679_10322146 3300025945 Bacteria 1339
648 Ga0207667_10000098 3300025949 Bacteria 140051
649 Ga0207667_10000279 3300025949 Bacteria 70460
650 Ga0207667_10013613 3300025949 Bacteria 9298
651 Ga0207667_10098454 3300025949 Bacteria 3018
652 Ga0207667_10330288 3300025949 Bacteria 1557
653 Ga0207651_10021555 3300025960 Bacteria 3919
654 Ga0207651_10060479 3300025960 Bacteria 2630
655 Ga0207651_10103452 3300025960 Bacteria 2119
656 Ga0207651_10107531 3300025960 Bacteria 2085
657 Ga0207651_10134621 3300025960 Bacteria 1898
658 Ga0207712_10001013 3300025961 Bacteria 20020
659 Ga0207712_10009604 3300025961 Bacteria 6126
660 Ga0207712_10013894 3300025961 Bacteria 5164
661 Ga0207712_10021178 3300025961 Bacteria 4265
662 Ga0207712_10143649 3300025961 Unclassified 1835
663 Ga0207712_10213942 3300025961 Bacteria 1537
664 Ga0207712_10235571 3300025961 Bacteria 1472
665 Ga0207712_10328564 3300025961 Bacteria 1264
666 Ga0207668_10003855 3300025972 Bacteria 8835
667 Ga0207668_10026061 3300025972 Bacteria 3792
668 Ga0207668_10035626 3300025972 Bacteria 3316
669 Ga0207668_10320037 3300025972 Bacteria 1287
670 Ga0207640_10127534 3300025981 Bacteria 1834
671 Ga0207640_10130645 3300025981 Unclassified 1815
672 Ga0207640_10138679 3300025981 Bacteria 1769
673 Ga0207640_10163837 3300025981 Bacteria 1648
674 Ga0207658_10005210 3300025986 Bacteria 8947
675 Ga0207658_10021680 3300025986 Bacteria 4464
676 Ga0207658_10076133 3300025986 Bacteria 2555
677 Ga0207658_10095362 3300025986 Bacteria 2318
678 Ga0207658_10156645 3300025986 Bacteria 1862
679 Ga0207658_10253111 3300025986 Bacteria 1497
680 Ga0207658_10297000 3300025986 Bacteria 1390
681 Ga0207677_10002707 3300026023 Bacteria 9343
682 Ga0207677_10005874 3300026023 Bacteria 6679
683 Ga0207677_10102951 3300026023 Unclassified 2106
684 Ga0207677_10106758 3300026023 Bacteria 2075
685 Ga0207677_10118348 3300026023 Bacteria 1987
686 Ga0207677_10221359 3300026023 Bacteria 1518
687 Ga0207677_10253912 3300026023 Bacteria 1429
688 Ga0207703_10006076 3300026035 Bacteria 9658
689 Ga0207703_10050142 3300026035 Bacteria 3377
690 Ga0207703_10575321 3300026035 Bacteria 1064
691 Ga0207639_10016717 3300026041 Bacteria 5198
692 Ga0207639_10130805 3300026041 Bacteria 2077
693 Ga0207639_10182681 3300026041 Unclassified 1785
694 Ga0207639_10393500 3300026041 Bacteria 1247
695 Ga0207678_10028489 3300026067 Bacteria 4876
696 Ga0207708_10091271 3300026075 Bacteria 2349
697 Ga0207708_10161730 3300026075 Bacteria 1768
698 Ga0207641_10000058 3300026088 Bacteria 166385
699 Ga0207641_10002531 3300026088 Bacteria 16833
700 Ga0207641_10009677 3300026088 Bacteria 7940
701 Ga0207641_10021342 3300026088 Bacteria 5323
702 Ga0207641_10022680 3300026088 Bacteria 5167
703 Ga0207641_10028151 3300026088 Bacteria 4642
704 Ga0207641_10047497 3300026088 Bacteria 3620
705 Ga0207641_10079275 3300026088 Bacteria 2846
706 Ga0207641_10348247 3300026088 Bacteria 1411
707 Ga0207641_10413807 3300026088 Unclassified 1297
708 Ga0207648_10002473 3300026089 Bacteria 19851
709 Ga0207648_10003197 3300026089 Bacteria 17252
710 Ga0207648_10005503 3300026089 Bacteria 12764
711 Ga0207648_10054782 3300026089 Bacteria 3483
712 Ga0207648_10057905 3300026089 Bacteria 3380
713 Ga0207648_10073855 3300026089 Bacteria 2972
714 Ga0207648_10161159 3300026089 Bacteria 1981
715 Ga0207648_10209594 3300026089 Bacteria 1729
716 Ga0207648_10247373 3300026089 Bacteria 1589
717 Ga0207648_10258483 3300026089 Unclassified 1553
718 Ga0207648_10410297 3300026089 Bacteria 1228
719 Ga0207676_10017880 3300026095 Bacteria 5144
720 Ga0207676_10073438 3300026095 Bacteria 2753
721 Ga0207676_10102025 3300026095 Bacteria 2380
722 Ga0207676_10263818 3300026095 Unclassified 1556
723 Ga0207676_10343813 3300026095 Unclassified 1377
724 Ga0207676_10406674 3300026095 Unclassified 1273
725 Ga0207674_10000969 3300026116 Bacteria 37567
726 Ga0207674_10009448 3300026116 Bacteria 11142
727 Ga0207674_10047506 3300026116 Bacteria 4399
728 Ga0207674_10092246 3300026116 Bacteria 3018
729 Ga0207674_10103835 3300026116 Bacteria 2821
730 Ga0207674_10168255 3300026116 Unclassified 2146
731 Ga0207674_10188457 3300026116 Bacteria 2013
732 Ga0207674_10197404 3300026116 Bacteria 1962
733 Ga0207674_10207920 3300026116 Bacteria 1906
734 Ga0207674_10371009 3300026116 Bacteria 1383
735 Ga0207675_100000654 3300026118 Bacteria 34117
736 Ga0207675_100003600 3300026118 Bacteria 15104
737 Ga0207675_100010374 3300026118 Bacteria 8728
738 Ga0207675_100021212 3300026118 Bacteria 6051
739 Ga0207675_100027904 3300026118 Bacteria 5258
740 Ga0207675_100160045 3300026118 Bacteria 2147
741 Ga0207675_100165405 3300026118 Bacteria 2112
742 Ga0207675_100261491 3300026118 Bacteria 1677
743 Ga0207675_100288116 3300026118 Bacteria 1597
744 Ga0207675_100376951 3300026118 Bacteria 1394
745 Ga0207683_10001428 3300026121 Bacteria 21608
746 Ga0207683_10009987 3300026121 Bacteria 8101
747 Ga0207683_10051269 3300026121 Bacteria 3615
748 Ga0207683_10053470 3300026121 Bacteria 3541
749 Ga0207683_10110422 3300026121 Bacteria 2462
750 Ga0207698_10027806 3300026142 Bacteria 4021
751 Ga0207698_10030751 3300026142 Bacteria 3866
752 Ga0207698_10087624 3300026142 Bacteria 2536
753 Ga0207698_10090005 3300026142 Bacteria 2509
754 Ga0207698_10135981 3300026142 Bacteria 2109
755 Ga0207698_10144695 3300026142 Bacteria 2054
756 Ga0207698_10206670 3300026142 Bacteria 1763
757 Ga0207698_10452436 3300026142 Bacteria 1240
758 Ga0207698_10504352 3300026142 Bacteria 1178
759 Ga0209995_1014712 3300027471 Bacteria 1283
760 Ga0209995_1016379 3300027471 Bacteria 1218
761 Ga0209974_10057345 3300027876 Bacteria 1315
762 Ga0207428_10009020 3300027907 Bacteria 8978
763 Ga0268266_10000068 3300028379 Bacteria 241100
764 Ga0268266_10019825 3300028379 Bacteria 5731
765 Ga0268266_10078457 3300028379 Bacteria 2873
766 Ga0268265_10040553 3300028380 Bacteria 3439
767 Ga0268265_10197355 3300028380 Bacteria 1743
768 Ga0268264_10000079 3300028381 Bacteria 249516
769 Ga0268264_10002921 3300028381 Bacteria 14854
770 Ga0268264_10027605 3300028381 Bacteria 4640
771 Ga0268264_10027818 3300028381 Bacteria 4622
772 Ga0268264_10043127 3300028381 Bacteria 3737
773 Ga0268264_10079918 3300028381 Bacteria 2791
774 Ga0268264_10142359 3300028381 Bacteria 2140
775 Ga0268264_10196391 3300028381 Unclassified 1843
776 Ga0307517_10001481 3300028786 Bacteria 39285
777 Ga0307517_10086390 3300028786 Bacteria 2618
778 Ga0307515_10000059 3300028794 Bacteria 257520
779 Ga0307511_10000201 3300030521 Bacteria 60079
780 Ga0265327_10015178 3300031251 Bacteria 4990
781 Ga0265327_10026468 3300031251 Bacteria 3358
782 Ga0307513_10099658 3300031456 Bacteria 2933
783 Ga0307509_10006019 3300031507 Bacteria 16547
784 Ga0307509_10237319 3300031507 Bacteria 1620
785 Ga0307509_10257114 3300031507 Bacteria 1525
786 Ga0307408_100062316 3300031548 Bacteria 2725
787 Ga0307508_10001083 3300031616 Bacteria 31499
788 Ga0307516_10003458 3300031730 Bacteria 20249
789 Ga0307516_10403578 3300031730 Unclassified 1026
790 Ga0307410_10048863 3300031852 Bacteria 2837
791 Ga0307412_10037746 3300031911 Bacteria 3106
792 Ga0307414_10062858 3300032004 Bacteria 2637
793 Ga0307415_100015507 3300032126 Bacteria 4515
794 Ga0307510_10008700 3300033180 Bacteria 12090
795 Ga0373934_0054869 3300035086 Unclassified 1583
796 Ga0373955_0112140 3300035172 Bacteria 1578
797 Ga0373937_0041388 3300036401 Bacteria 4202
798 Ga0373937_0088634 3300036401 Bacteria 2865
799 Ga0395900_0015164 3300037418 Bacteria 7859
800 Ga0395898_0354951 3300037466 Bacteria 1398
801 Ga0395905_0009899 3300037471 Bacteria 9291
802 Ga0395905_0622916 3300037471 Bacteria 981
803 Ga0451800_1252777 3300041459 Bacteria 1375
804 Ga0439442_029952 3300042002 Unclassified 1136
805 Ga0439449_0019236 3300042007 Bacteria 2560
806 Ga0439449_0021721 3300042007 Bacteria 2403
807 Ga0439457_000363 3300042014 Bacteria 12689
808 Ga0450923_033651 3300042125 Bacteria 1054
809 Ga0450899_005210 3300042135 Bacteria 1396
810 Ga0439434_0001630 3300042435 Bacteria 6486
811 Ga0466969_0000305 3300044656 Bacteria 27063
812 Ga0466972_0000082 3300044658 Bacteria 88592
813 Ga0466972_0008143 3300044658 Bacteria 5257
814 Ga0466972_0010489 3300044658 Bacteria 4651
815 Ga0453683_0026921 3300044673 Bacteria 3651
816 Ga0453683_0218193 3300044673 Bacteria 1212
817 Ga0466965_0047663 3300044683 Unclassified 2122
818 Ga0466966_0000015 3300044684 Bacteria 127402
819 Ga0466966_0313281 3300044684 Bacteria 943
820 Ga0466961_0123026 3300044693 Bacteria 1628
821 Ga0453684_0020334 3300044712 Bacteria 10022
822 Ga0453684_0096964 3300044712 Bacteria 3620
823 Ga0466968_0080778 3300044735 Bacteria 1428
824 Ga0466957_0017897 3300044842 Bacteria 4157
825 Ga0466957_0028242 3300044842 Bacteria 3339
826 Ga0466957_0108948 3300044842 Bacteria 1755
827 Ga0466959_0000030 3300045049 Bacteria 111343
828 Ga0466959_0029310 3300045049 Bacteria 4078
829 Ga0495629_0313922 3300046459 Unclassified 1072
830 Ga0495638_0059897 3300046460 Bacteria 2356
831 Ga0495638_0100674 3300046460 Bacteria 1729
832 Ga0495650_0081857 3300046471 Bacteria 1243
833 Ga0495606_0003421 3300046507 Bacteria 16858
834 Ga0495628_0057514 3300046516 Bacteria 3059
835 Ga0495643_0028977 3300046522 Bacteria 3100
836 Ga0495648_0003136 3300046524 Bacteria 14739
837 Ga0495621_0040448 3300046539 Bacteria 1634
838 Ga0495621_0041191 3300046539 Bacteria 1621
839 Ga0495622_0138752 3300046557 Bacteria 1104
840 Ga0495634_0225813 3300046642 Bacteria 1154
841 Ga0495611_0000026 3300046648 Bacteria 118428
842 Ga0495625_0043643 3300046660 Bacteria 3251
843 Ga0495625_0101230 3300046660 Bacteria 1979
844 Ga0495635_0040108 3300046663 Bacteria 3237
845 Ga0495647_0018872 3300046681 Bacteria 2462
846 Ga0495670_0033375 3300046691 Unclassified 2561
847 Ga0495649_0064266 3300046694 Bacteria 1971
848 Ga0495600_0242525 3300046809 Bacteria 1148
849 Ga0495672_0036043 3300047320 Bacteria 3041
850 Ga0495687_001838 3300047443 Bacteria 18636
851 Ga0495686_0000005 3300047472 Bacteria 827143
852 Ga0495686_0037770 3300047472 Bacteria 3092
853 Ga0496100_0270075 3300048903 Bacteria 1264
854 Ga0496105_0304438 3300048908 Bacteria 1281
855 Ga0496106_0232139 3300048909 Bacteria 1473
856 Ga0496110_0190814 3300048913 Bacteria 1861
857 Ga0496114_0026179 3300048917 Bacteria 4774
858 Ga0501031_0013457 3300049568 Bacteria 5334
859 Ga0501032_0038258 3300049569 Bacteria 3269
860 Ga0501034_0005186 3300049571 Bacteria 14296
861 Ga0501034_0555011 3300049571 Bacteria 1058
862 Ga0501036_0319937 3300049572 Bacteria 1296
863 Ga0501037_0004139 3300049573 Bacteria 10526
864 Ga0501037_0005433 3300049573 Bacteria 9280
865 Ga0501037_0021327 3300049573 Bacteria 4786
866 Ga0501038_0013654 3300049574 Bacteria 7404
867 Ga0501039_0111846 3300049575 Bacteria 2135
868 Ga0501043_0007747 3300049579 Bacteria 8498
869 Ga0501043_0042317 3300049579 Bacteria 3580
870 Ga0501043_0049505 3300049579 Bacteria 3303
871 Ga0501043_0148930 3300049579 Unclassified 1832
872 Ga0501046_0013771 3300049580 Bacteria 6837
873 Ga0501046_0124260 3300049580 Unclassified 1962
874 Ga0501047_0016908 3300049581 Bacteria 6973
875 Ga0501047_0053720 3300049581 Bacteria 3896
876 Ga0501047_0119443 3300049581 Bacteria 2518
877 Ga0501067_0091302 3300049583 Bacteria 1691
878 Ga0501069_0010220 3300049585 Bacteria 4965
879 Ga0501070_0294149 3300049586 Unclassified 1323
880 Ga0501072_0256483 3300049588 Bacteria 1392
881 Ga0501072_0289795 3300049588 Unclassified 1302
882 Ga0501073_0057525 3300049589 Unclassified 2718
883 Ga0501074_0056911 3300049590 Bacteria 2817
884 Ga0501198_010451 3300049649 Unclassified 1373
885 Ga0501201_000950 3300049651 Unclassified 2715
886 Ga0501222_001674 3300049662 Bacteria 3076
887 Ga0501223_001801 3300049663 Bacteria 4834
888 Ga0501235_004186 3300049669 Bacteria 3124
889 Ga0501235_015906 3300049669 Bacteria 1660
890 Ga0501240_008635 3300049673 Unclassified 1313
891 Ga0501242_000786 3300049674 Unclassified 2959
892 Ga0501243_001866 3300049675 Unclassified 3064
893 Ga0501243_002072 3300049675 Bacteria 2916
894 Ga0501252_008870 3300049682 Unclassified 1163
895 Ga0501257_004100 3300049686 Bacteria 3164
896 Ga0501259_000241 3300049688 Bacteria 8521
897 Ga0501259_000548 3300049688 Bacteria 6027
898 Ga0501261_002098 3300049690 Bacteria 2449
899 Ga0501225_0000523 3300049705 Bacteria 11998
900 Ga0501225_0001327 3300049705 Bacteria 7688
901 Ga0501225_0003132 3300049705 Bacteria 5054
902 Ga0501245_003413 3300049708 Unclassified 2156
903 Ga0501080_0108217 3300049742 Unclassified 2576
904 Ga0501080_0146836 3300049742 Bacteria 2180
905 Ga0501266_001945 3300049763 Bacteria 2600
906 Ga0501035_0023604 3300049822 Bacteria 5643
907 Ga0501044_0006596 3300049823 Bacteria 12806
908 Ga0501044_0026792 3300049823 Bacteria 6100
909 Ga0501044_0072751 3300049823 Bacteria 3495
910 Ga0501044_0078434 3300049823 Bacteria 3347
911 Ga0501044_0187664 3300049823 Bacteria 2031
912 nmdc:mga0k408_206451_c1 3300050493 Bacteria 1173
913 nmdc:mga0k408_2243_c1 3300050493 Bacteria 2831
914 nmdc:mga0k408_28278_c1 3300050493 Unclassified 3187
915 nmdc:mga09592_146433_c1 3300050508 Bacteria 2037
916 nmdc:mga09592_158560_c1 3300050508 Bacteria 1954
917 nmdc:mga0qj67_4627_c1 3300050509 Bacteria 9984
918 nmdc:mga06r32_15626_c1 3300050510 Bacteria 6897
919 nmdc:mga06r32_35876_c1 3300050510 Bacteria 4680
920 nmdc:mga08y16_14158_c1 3300050511 Bacteria 8395
921 nmdc:mga08y16_17376_c1 3300050511 Bacteria 7574
922 nmdc:mga08y16_379105_c1 3300050511 Bacteria 1450
923 nmdc:mga08y16_393156_c1 3300050511 Unclassified 1420
924 nmdc:mga0n895_111335_c1 3300050512 Bacteria 2754
925 Ga0495619_0063266 3300053085 Bacteria 2465
926 Ga0500578_0000063 3300053086 Bacteria 117869
927 Ga0500646_0001629 3300053090 Bacteria 5935
928 Ga0500646_0052160 3300053090 Bacteria 1183
929 Ga0500583_0000076 3300053092 Bacteria 59162
930 Ga0500583_0000557 3300053092 Bacteria 11283
931 Ga0500583_0000662 3300053092 Bacteria 10175
932 Ga0500556_0140753 3300053104 Bacteria 948
933 Ga0500562_011924 3300053108 Bacteria 2207
934 Ga0500652_007218 3300053131 Bacteria 3624
935 Ga0500658_0142492 3300053134 Bacteria 1076
936 Ga0500559_0023907 3300053136 Bacteria 2596
937 Ga0500568_0001023 3300053139 Bacteria 19133
938 Ga0500568_0043626 3300053139 Bacteria 1792
939 Ga0500573_0158259 3300053140 Bacteria 1235
940 Ga0500577_0045296 3300053142 Bacteria 1625
941 Ga0500588_0001514 3300053146 Bacteria 4450
942 Ga0500589_133366 3300053147 Bacteria 1034
943 Ga0500616_0004133 3300053153 Bacteria 10506
944 Ga0500622_0001733 3300053156 Bacteria 16854
945 Ga0500636_0076299 3300053177 Bacteria 1938
946 Ga0500637_0232392 3300053178 Bacteria 1038
947 Ga0500611_000101 3300053727 Bacteria 21697
948 Ga0501084_0104772 3300054114 Bacteria 2375
949 Ga0501082_0132502 3300060353 Unclassified 2162
950 Ga0466962_0016166 3300061719 Bacteria 3599
951 2738725633 2738541278 Bacteria 9755573
952 Ga0070683_100083925
953 MBSR1b_contig_334244
954 CNXas_1001191
955 JGI24736J21556_1003024
956 JGI24740J21852_10031413
957 JGI24751J29686_10021868
958 rootH2_10001613
959 rootH2_10001614
960 rootH2_10023604
961 rootH2_10039966
962 rootL2_10113255
963 rootH1_10066431
964 rootH1_10222292
965 rootH1_10270826
966 JGI25160J50197_1000262
967 Ga0065704_10031790
968 Ga0065704_10123993
969 Ga0065704_10168158
970 Ga0065712_10014215
971 Ga0065712_10017724
972 Ga0065712_10082292
973 Ga0065712_10131098
974 Ga0065715_10017649
975 Ga0065715_10107768
976 Ga0065707_10208036
977 Ga0070658_10000563
978 Ga0070658_10043116
979 Ga0070676_10000218
980 Ga0070676_10012670
981 Ga0070676_10016335
982 Ga0070676_10063489
983 Ga0070676_10120344
984 Ga0070683_100002723
985 Ga0070683_100010919
986 Ga0070683_100013457
987 Ga0070683_100120086
988 Ga0070690_100008208
989 Ga0070690_100163166
990 Ga0070690_100275366
991 Ga0070670_100017530
992 Ga0070670_100027025
993 Ga0070670_100041055
994 Ga0070670_100042974
995 Ga0070670_100045367
996 Ga0070670_100109684
997 Ga0070670_100142938
998 Ga0070670_100282343
999 Ga0070670_100311675
1000 Ga0070677_10050904
1001 Ga0068869_100010867
1002 Ga0068869_100010963
1003 Ga0068869_100035886
1004 Ga0068869_100043025
1005 Ga0068869_100049082
1006 Ga0068869_100052642
1007 Ga0068869_100053388
1008 Ga0070666_10000072
1009 Ga0070666_10000969
1010 Ga0070666_10138495
1011 Ga0070666_10176280
1012 Ga0070666_10193496
1013 Ga0070680_100008932
1014 Ga0070680_100289070
1015 Ga0070682_100005089
1016 Ga0068868_100000770
1017 Ga0068868_100004154
1018 Ga0068868_100111604
1019 Ga0068868_100226016
1020 Ga0070689_100053208
1021 Ga0070689_100105074
1022 Ga0070689_100300424
1023 Ga0070689_100362621
1024 Ga0070691_10014568
1025 Ga0070691_10017921
1026 Ga0070691_10049530
1027 Ga0070687_100077735
1028 Ga0070687_100079238
1029 Ga0070661_100010396
1030 Ga0070661_100036341
1031 Ga0070668_100000110
1032 Ga0070668_100043857
1033 Ga0070668_100084636
1034 Ga0070668_100085712
1035 Ga0070668_100139189
1036 Ga0070668_100236555
1037 Ga0070669_100001473
1038 Ga0070669_100002379
1039 Ga0070669_100068742
1040 Ga0070669_100097648
1041 Ga0070669_100472716
1042 Ga0070669_100525920
1043 Ga0070675_100002848
1044 Ga0070675_100018980
1045 Ga0070675_100029656
1046 Ga0070675_100031505
1047 Ga0070675_100041514
1048 Ga0070675_100067038
1049 Ga0070675_100081817
1050 Ga0070675_100414487
1051 Ga0070671_100094844
1052 Ga0070671_100260952
1053 Ga0070671_100268718
1054 Ga0070671_100324490
1055 Ga0070674_100021561
1056 Ga0070674_100060310
1057 Ga0070674_100174733
1058 Ga0070674_100189387
1059 Ga0070674_100247367
1060 Ga0070674_100330890
1061 Ga0070674_100331303
1062 Ga0070673_100000676
1063 Ga0070673_100007165
1064 Ga0070673_100099761
1065 Ga0070673_100124049
1066 Ga0070673_100331052
1067 Ga0070688_100044280
1068 Ga0070688_100052281
1069 Ga0070688_100058779
1070 Ga0070688_100065318
1071 Ga0070659_100002166
1072 Ga0070667_100000867
1073 Ga0070667_100005066
1074 Ga0070667_100082127
1075 Ga0070667_100144802
1076 Ga0070667_100159093
1077 Ga0070667_100161702
1078 Ga0070667_100216068
1079 Ga0070701_10011234
1080 Ga0070701_10051278
1081 Ga0070705_100469234
1082 Ga0070700_100017034
1083 Ga0070700_100117854
1084 Ga0070694_100428125
1085 Ga0070663_100394720
1086 Ga0070678_100012152
1087 Ga0070678_100018402
1088 Ga0070678_100060775
1089 Ga0070678_100072731
1090 Ga0070678_100238553
1091 Ga0070662_100003337
1092 Ga0070662_100007311
1093 Ga0070662_100071331
1094 Ga0070681_10031472
1095 Ga0070681_10047183
1096 Ga0070681_10226800
1097 Ga0068867_100002557
1098 Ga0068867_100003149
1099 Ga0068867_100011145
1100 Ga0068867_100039464
1101 Ga0068867_100101990
1102 Ga0068867_100127529
1103 Ga0068867_100141137
1104 Ga0068867_100165249
1105 Ga0068867_100269827
1106 Ga0068867_100325030
1107 Ga0070685_10004008
1108 Ga0070685_10005889
1109 Ga0070685_10041642
1110 Ga0070685_10080691
1111 Ga0070698_100003130
1112 Ga0070698_100008121
1113 Ga0070698_100083795
1114 Ga0070679_100026175
1115 Ga0070684_100002319
1116 Ga0070684_100300283
1117 Ga0068853_100001650
1118 Ga0068853_100012660
1119 Ga0068853_100023980
1120 Ga0068853_100067584
1121 Ga0068853_100187709
1122 Ga0070672_100000020
1123 Ga0070672_100005102
1124 Ga0070672_100014302
1125 Ga0070672_100071516
1126 Ga0070672_100121732
1127 Ga0070672_100146590
1128 Ga0070686_100002348
1129 Ga0070686_100058584
1130 Ga0070693_100012647
1131 Ga0070665_100000014
1132 Ga0070665_100000318
1133 Ga0070665_100010501
1134 Ga0068855_100002787
1135 Ga0068855_100078411
1136 Ga0068855_100121294
1137 Ga0068855_100452504
1138 Ga0068855_100779546
1139 Ga0070664_100001959
1140 Ga0070664_100020090
1141 Ga0070664_100055149
1142 Ga0070664_100194779
1143 Ga0070664_100215762
1144 Ga0070664_100241149
1145 Ga0070664_100248832
1146 Ga0068857_100009364
1147 Ga0068857_100056966
1148 Ga0068857_100146526
1149 Ga0068857_100159105
1150 Ga0068857_100209724
1151 Ga0068857_100387008
1152 Ga0068854_100005213
1153 Ga0068854_100012243
1154 Ga0068854_100052881
1155 Ga0068854_100097041
1156 Ga0068856_100400170
1157 Ga0070702_100012795
1158 Ga0068852_100000706
1159 Ga0068852_100005115
1160 Ga0068852_100027749
1161 Ga0068852_100034227
1162 Ga0068852_100039363
1163 Ga0068852_100085807
1164 Ga0068852_100100072
1165 Ga0068852_100103271
1166 Ga0068852_100323991
1167 Ga0068859_100000006
1168 Ga0068859_100008596
1169 Ga0068859_100052034
1170 Ga0068859_100059293
1171 Ga0068859_100064397
1172 Ga0068859_100094417
1173 Ga0068859_100139763
1174 Ga0068859_100149959
1175 Ga0068859_100304771
1176 Ga0068859_100363937
1177 Ga0068859_100471436
1178 Ga0068859_100494489
1179 Ga0068864_100019039
1180 Ga0068864_100023009
1181 Ga0068864_100080256
1182 Ga0068864_100181149
1183 Ga0068864_100242209
1184 Ga0068864_100285423
1185 Ga0068864_100337116
1186 Ga0068864_100360640
1187 Ga0068864_100362923
1188 Ga0068864_100472784
1189 Ga0068861_100005965
1190 Ga0068861_100006160
1191 Ga0068861_100017923
1192 Ga0068861_100098334
1193 Ga0068861_100139407
1194 Ga0068861_100268506
1195 Ga0068851_10002057
1196 Ga0068851_10060315
1197 Ga0068851_10093321
1198 Ga0068870_10010085
1199 Ga0068863_100000678
1200 Ga0068863_100044914
1201 Ga0068863_100052243
1202 Ga0068863_100053424
1203 Ga0068863_100054049
1204 Ga0068863_100104393
1205 Ga0068863_100141393
1206 Ga0068863_100177321
1207 Ga0068863_100221922
1208 Ga0068863_100320082
1209 Ga0068863_100503015
1210 Ga0068858_100001487
1211 Ga0068858_100004205
1212 Ga0068858_100077777
1213 Ga0068858_100457631
1214 Ga0068858_100584948
1215 Ga0068860_100000061
1216 Ga0068860_100001096
1217 Ga0068860_100002430
1218 Ga0068860_100004305
1219 Ga0068860_100012083
1220 Ga0068860_100072898
1221 Ga0068860_100106190
1222 Ga0068860_100203402
1223 Ga0068860_100650241
1224 Ga0068862_100003320
1225 Ga0068862_100034416
1226 Ga0068862_100078194
1227 Ga0081540_1010602
1228 Ga0081539_10008868
1229 Ga0075366_10008445
1230 Ga0075366_10046150
1231 Ga0075366_10213953
1232 Ga0097621_100000408
1233 Ga0097621_100002080
1234 Ga0097621_100034071
1235 Ga0097621_100044792
1236 Ga0097621_100052284
1237 Ga0097621_100086952
1238 Ga0097621_100144943
1239 Ga0097621_100224492
1240 Ga0068871_100001316
1241 Ga0068871_100009317
1242 Ga0068871_100013565
1243 Ga0068871_100074802
1244 Ga0068871_100093902
1245 Ga0068871_100110820
1246 Ga0068871_100118969
1247 Ga0068871_100195166
1248 Ga0068871_100219032
1249 Ga0068871_100303670
1250 Ga0068871_100554324
1251 Ga0075428_100011391
1252 Ga0075430_100002480
1253 Ga0075431_100012701
1254 Ga0075431_100028634
1255 Ga0075434_100058540
1256 Ga0075429_100011160
1257 Ga0075429_100162753
1258 Ga0075429_100219034
1259 Ga0075429_100363176
1260 Ga0068865_100000289
1261 Ga0068865_100014376
1262 Ga0068865_100119405
1263 Ga0068865_100156102
1264 Ga0068865_100218889
1265 Ga0068865_100269325
1266 Ga0068865_100468022
1267 Ga0068865_100536709
1268 Ga0097620_100000006
1269 Ga0097620_100008596
1270 Ga0097620_100052035
1271 Ga0097620_100059292
1272 Ga0097620_100064396
1273 Ga0097620_100094417
1274 Ga0097620_100139757
1275 Ga0097620_100149967
1276 Ga0097620_100304769
1277 Ga0097620_100363919
1278 Ga0097620_100471430
1279 Ga0097620_100494484
1280 Ga0075435_100532694
1281 Ga0105240_10000800
1282 Ga0105240_10001787
1283 Ga0105240_10001808
1284 Ga0105240_10004358
1285 Ga0105240_10006347
1286 Ga0105240_10027103
1287 Ga0105240_10030313
1288 Ga0105240_10077939
1289 Ga0105240_10130026
1290 Ga0111539_10005159
1291 Ga0111539_10011279
1292 Ga0111539_10973921
1293 Ga0105245_10075256
1294 Ga0105245_10348637
1295 Ga0105247_10000312
1296 Ga0105247_10143840
1297 Ga0114129_10065303
1298 Ga0105243_10257374
1299 Ga0105241_10000608
1300 Ga0105241_10002863
1301 Ga0105241_10007807
1302 Ga0105241_10118363
1303 Ga0105241_10407171
1304 Ga0105242_10023950
1305 Ga0105242_10027545
1306 Ga0105242_10040915
1307 Ga0105242_10049420
1308 Ga0105242_10054712
1309 Ga0105242_10112344
1310 Ga0105242_10170647
1311 Ga0105242_10340543
1312 Ga0105248_10004712
1313 Ga0105248_10311544
1314 Ga0105237_10005526
1315 Ga0105237_10006018
1316 Ga0105237_10017111
1317 Ga0105237_10029264
1318 Ga0105237_10045917
1319 Ga0105237_10105188
1320 Ga0105237_10437648
1321 Ga0105237_10464807
1322 Ga0105238_10001710
1323 Ga0105238_10068041
1324 Ga0105238_10206644
1325 Ga0105249_10000623
1326 Ga0105249_10003608
1327 Ga0105249_10005813
1328 Ga0105249_10013950
1329 Ga0105249_10017890
1330 Ga0105249_10043810
1331 Ga0105249_10044259
1332 Ga0105249_10304953
1333 Ga0105239_10000019
1334 Ga0105239_10001405
1335 Ga0105239_10004672
1336 Ga0105239_10010217
1337 Ga0105239_10027401
1338 Ga0105239_10074269
1339 Ga0105239_10143777
1340 Ga0105239_10160955
1341 Ga0105239_10233100
1342 Ga0105239_10355450
1343 Ga0105246_10063575
1344 Ga0105246_10086076
1345 Ga0105246_10087450
1346 Ga0157373_10019205
1347 Ga0157373_10210729
1348 Ga0157373_10267940
1349 Ga0157371_10010719
1350 Ga0157371_10014278
1351 Ga0157371_10030627
1352 Ga0157371_10055082
1353 Ga0157371_10174001
1354 Ga0157371_10291797
1355 Ga0157370_10005564
1356 Ga0157370_10052594
1357 Ga0157370_10311304
1358 Ga0157369_10021357
1359 Ga0157369_10034211
1360 Ga0157369_10122496
1361 Ga0157369_10140261
1362 Ga0157369_10198452
1363 Ga0157369_10375477
1364 Ga0157374_10000011
1365 Ga0157374_10001355
1366 Ga0157374_10042729
1367 Ga0157374_10051696
1368 Ga0157374_10126335
1369 Ga0157374_10414507
1370 Ga0157378_10005523
1371 Ga0157378_10006154
1372 Ga0157378_10009255
1373 Ga0157378_10015741
1374 Ga0157378_10037242
1375 Ga0157378_10045192
1376 Ga0157378_10066444
1377 Ga0157378_10076627
1378 Ga0157378_10162582
1379 Ga0157378_10317684
1380 Ga0157378_10377871
1381 Ga0163162_10000131
1382 Ga0163162_10001474
1383 Ga0163162_10002714
1384 Ga0163162_10002819
1385 Ga0163162_10004708
1386 Ga0163162_10005290
1387 Ga0163162_10073172
1388 Ga0163162_10079568
1389 Ga0163162_10163192
1390 Ga0163162_10166432
1391 Ga0163162_10331241
1392 Ga0157372_10002419
1393 Ga0157372_10003581
1394 Ga0157372_10012118
1395 Ga0157372_10031379
1396 Ga0157372_10088905
1397 Ga0157372_10095354
1398 Ga0157372_10111601
1399 Ga0157372_10121540
1400 Ga0157372_10135074
1401 Ga0157372_10198053
1402 Ga0157372_10249217
1403 Ga0157372_10312210
1404 Ga0157372_10320584
1405 Ga0157372_10337333
1406 Ga0157372_10376870
1407 Ga0157372_10667920
1408 Ga0157375_10000534
1409 Ga0157375_10001533
1410 Ga0157375_10022629
1411 Ga0157375_10049186
1412 Ga0157375_10055499
1413 Ga0157375_10135758
1414 Ga0157375_10162963
1415 Ga0157375_10251366
1416 Ga0157375_10301043
1417 Ga0157375_10323198
1418 Ga0157375_10478130
1419 Ga0157375_10492302
1420 Ga0157375_10508317
1421 Ga0163163_10002613
1422 Ga0163163_10004467
1423 Ga0163163_10035392
1424 Ga0163163_10093147
1425 Ga0163163_10278130
1426 Ga0163163_10288629
1427 Ga0163163_10421339
1428 Ga0163163_10560322
1429 Ga0163163_10608057
1430 Ga0157380_10001169
1431 Ga0157380_10013173
1432 Ga0157380_10022426
1433 Ga0157380_10828707
1434 Ga0157377_10000583
1435 Ga0157377_10057983
1436 Ga0157377_10063241
1437 Ga0157377_10096611
1438 Ga0157377_10276421
1439 Ga0157377_10316485
1440 Ga0157379_10000115
1441 Ga0157379_10017714
1442 Ga0157379_10031686
1443 Ga0157379_10067925
1444 Ga0157379_10086798
1445 Ga0157379_10149640
1446 Ga0157376_10004633
1447 Ga0157376_10005109
1448 Ga0157376_10007481
1449 Ga0157376_10036869
1450 Ga0157376_10050594
1451 Ga0157376_10079536
1452 Ga0157376_10204202
1453 Ga0157376_10211572
1454 Ga0157376_10230924
1455 Ga0157376_10276935
1456 Ga0157376_10321458
1457 Ga0163161_10000594
1458 Ga0163161_10007476
1459 Ga0163161_10014248
1460 Ga0207426_1000059
1461 Ga0207697_10018729
1462 Ga0207697_10067362
1463 Ga0207697_10109413
1464 Ga0207656_10001813
1465 Ga0207656_10007399
1466 Ga0207656_10080025
1467 Ga0207656_10083501
1468 Ga0207682_10068582
1469 Ga0207642_10110989
1470 Ga0207710_10006622
1471 Ga0207688_10018843
1472 Ga0207688_10025328
1473 Ga0207680_10000024
1474 Ga0207680_10020369
1475 Ga0207680_10066563
1476 Ga0207680_10077488
1477 Ga0207680_10160491
1478 Ga0207647_10000131
1479 Ga0207647_10013850
1480 Ga0207647_10022796
1481 Ga0207647_10044160
1482 Ga0207647_10074042
1483 Ga0207647_10111255
1484 Ga0207645_10001052
1485 Ga0207645_10002259
1486 Ga0207645_10010466
1487 Ga0207645_10027967
1488 Ga0207645_10106191
1489 Ga0207645_10207047
1490 Ga0207643_10001726
1491 Ga0207643_10002959
1492 Ga0207643_10029533
1493 Ga0207643_10047925
1494 Ga0207705_10008349
1495 Ga0207705_10233803
1496 Ga0207654_10001668
1497 Ga0207654_10003181
1498 Ga0207654_10008261
1499 Ga0207654_10032260
1500 Ga0207654_10081319
1501 Ga0207707_10000747
1502 Ga0207695_10000087
1503 Ga0207695_10000863
1504 Ga0207695_10001230
1505 Ga0207695_10001645
1506 Ga0207695_10016157
1507 Ga0207695_10044762
1508 Ga0207695_10259584
1509 Ga0207695_10271311
1510 Ga0207671_10000311
1511 Ga0207671_10000931
1512 Ga0207671_10039084
1513 Ga0207671_10049647
1514 Ga0207671_10069010
1515 Ga0207671_10122605
1516 Ga0207671_10155347
1517 Ga0207660_10005421
1518 Ga0207657_10122150
1519 Ga0207649_10009764
1520 Ga0207649_10036540
1521 Ga0207652_10025159
1522 Ga0207681_10005188
1523 Ga0207681_10031440
1524 Ga0207681_10071625
1525 Ga0207681_10111065
1526 Ga0207681_10122538
1527 Ga0207694_10066214
1528 Ga0207650_10008659
1529 Ga0207650_10022166
1530 Ga0207650_10038385
1531 Ga0207650_10046516
1532 Ga0207650_10066501
1533 Ga0207650_10073163
1534 Ga0207650_10188484
1535 Ga0207659_10022069
1536 Ga0207659_10022166
1537 Ga0207659_10028366
1538 Ga0207659_10032919
1539 Ga0207659_10036550
1540 Ga0207659_10058207
1541 Ga0207659_10173720
1542 Ga0207659_10192856
1543 Ga0207687_10414689
1544 Ga0207706_10027202
1545 Ga0207706_10029176
1546 Ga0207706_10047628
1547 Ga0207706_10313409
1548 Ga0207686_10000764
1549 Ga0207686_10133123
1550 Ga0207686_10162045
1551 Ga0207686_10177238
1552 Ga0207686_10322037
1553 Ga0207670_10004555
1554 Ga0207670_10013292
1555 Ga0207670_10067994
1556 Ga0207670_10075052
1557 Ga0207670_10169114
1558 Ga0207670_10263937
1559 Ga0207669_10027676
1560 Ga0207669_10063085
1561 Ga0207669_10152083
1562 Ga0207704_10000955
1563 Ga0207704_10002540
1564 Ga0207704_10093206
1565 Ga0207704_10107338
1566 Ga0207704_10134542
1567 Ga0207704_10388415
1568 Ga0207665_10297302
1569 Ga0207691_10000673
1570 Ga0207691_10004686
1571 Ga0207691_10016625
1572 Ga0207691_10021620
1573 Ga0207691_10021958
1574 Ga0207691_10056993
1575 Ga0207691_10155520
1576 Ga0207691_10259994
1577 Ga0207691_10385230
1578 Ga0207711_10024780
1579 Ga0207711_10198325
1580 Ga0207711_10272353
1581 Ga0207689_10002915
1582 Ga0207689_10004743
1583 Ga0207689_10007600
1584 Ga0207689_10024890
1585 Ga0207689_10030935
1586 Ga0207689_10031405
1587 Ga0207689_10067924
1588 Ga0207689_10077158
1589 Ga0207689_10082541
1590 Ga0207661_10002997
1591 Ga0207661_10100523
1592 Ga0207661_10110151
1593 Ga0207661_10256916
1594 Ga0207661_10295833
1595 Ga0207679_10002990
1596 Ga0207679_10174403
1597 Ga0207679_10201105
1598 Ga0207679_10322146
1599 Ga0207667_10000098
1600 Ga0207667_10000279
1601 Ga0207667_10013613
1602 Ga0207667_10098454
1603 Ga0207667_10330288
1604 Ga0207651_10021555
1605 Ga0207651_10060479
1606 Ga0207651_10103452
1607 Ga0207651_10107531
1608 Ga0207651_10134621
1609 Ga0207712_10001013
1610 Ga0207712_10009604
1611 Ga0207712_10013894
1612 Ga0207712_10021178
1613 Ga0207712_10143649
1614 Ga0207712_10213942
1615 Ga0207712_10235571
1616 Ga0207712_10328564
1617 Ga0207668_10003855
1618 Ga0207668_10026061
1619 Ga0207668_10035626
1620 Ga0207668_10320037
1621 Ga0207640_10127534
1622 Ga0207640_10130645
1623 Ga0207640_10138679
1624 Ga0207640_10163837
1625 Ga0207658_10005210
1626 Ga0207658_10021680
1627 Ga0207658_10076133
1628 Ga0207658_10095362
1629 Ga0207658_10156645
1630 Ga0207658_10253111
1631 Ga0207658_10297000
1632 Ga0207677_10002707
1633 Ga0207677_10005874
1634 Ga0207677_10102951
1635 Ga0207677_10106758
1636 Ga0207677_10118348
1637 Ga0207677_10221359
1638 Ga0207677_10253912
1639 Ga0207703_10006076
1640 Ga0207703_10050142
1641 Ga0207703_10575321
1642 Ga0207639_10016717
1643 Ga0207639_10130805
1644 Ga0207639_10182681
1645 Ga0207639_10393500
1646 Ga0207678_10028489
1647 Ga0207708_10091271
1648 Ga0207708_10161730
1649 Ga0207641_10000058
1650 Ga0207641_10002531
1651 Ga0207641_10009677
1652 Ga0207641_10021342
1653 Ga0207641_10022680
1654 Ga0207641_10028151
1655 Ga0207641_10047497
1656 Ga0207641_10079275
1657 Ga0207641_10348247
1658 Ga0207641_10413807
1659 Ga0207648_10002473
1660 Ga0207648_10003197
1661 Ga0207648_10005503
1662 Ga0207648_10054782
1663 Ga0207648_10057905
1664 Ga0207648_10073855
1665 Ga0207648_10161159
1666 Ga0207648_10209594
1667 Ga0207648_10247373
1668 Ga0207648_10258483
1669 Ga0207648_10410297
1670 Ga0207676_10017880
1671 Ga0207676_10073438
1672 Ga0207676_10102025
1673 Ga0207676_10263818
1674 Ga0207676_10343813
1675 Ga0207676_10406674
1676 Ga0207674_10000969
1677 Ga0207674_10009448
1678 Ga0207674_10047506
1679 Ga0207674_10092246
1680 Ga0207674_10103835
1681 Ga0207674_10168255
1682 Ga0207674_10188457
1683 Ga0207674_10197404
1684 Ga0207674_10207920
1685 Ga0207674_10371009
1686 Ga0207675_100000654
1687 Ga0207675_100003600
1688 Ga0207675_100010374
1689 Ga0207675_100021212
1690 Ga0207675_100027904
1691 Ga0207675_100160045
1692 Ga0207675_100165405
1693 Ga0207675_100261491
1694 Ga0207675_100288116
1695 Ga0207675_100376951
1696 Ga0207683_10001428
1697 Ga0207683_10009987
1698 Ga0207683_10051269
1699 Ga0207683_10053470
1700 Ga0207683_10110422
1701 Ga0207698_10027806
1702 Ga0207698_10030751
1703 Ga0207698_10087624
1704 Ga0207698_10090005
1705 Ga0207698_10135981
1706 Ga0207698_10144695
1707 Ga0207698_10206670
1708 Ga0207698_10452436
1709 Ga0207698_10504352
1710 Ga0209995_1014712
1711 Ga0209995_1016379
1712 Ga0209974_10057345
1713 Ga0207428_10009020
1714 Ga0268266_10000068
1715 Ga0268266_10019825
1716 Ga0268266_10078457
1717 Ga0268265_10040553
1718 Ga0268265_10197355
1719 Ga0268264_10000079
1720 Ga0268264_10002921
1721 Ga0268264_10027605
1722 Ga0268264_10027818
1723 Ga0268264_10043127
1724 Ga0268264_10079918
1725 Ga0268264_10142359
1726 Ga0268264_10196391
1727 Ga0307517_10001481
1728 Ga0307517_10086390
1729 Ga0307515_10000059
1730 Ga0307511_10000201
1731 Ga0265327_10015178
1732 Ga0265327_10026468
1733 Ga0307513_10099658
1734 Ga0307509_10006019
1735 Ga0307509_10237319
1736 Ga0307509_10257114
1737 Ga0307408_100062316
1738 Ga0307508_10001083
1739 Ga0307516_10003458
1740 Ga0307516_10403578
1741 Ga0307410_10048863
1742 Ga0307412_10037746
1743 Ga0307414_10062858
1744 Ga0307415_100015507
1745 Ga0307510_10008700
1746 Ga0373934_0054869
1747 Ga0373955_0112140
1748 Ga0373937_0041388
1749 Ga0373937_0088634
1750 Ga0395900_0015164
1751 Ga0395898_0354951
1752 Ga0395905_0009899
1753 Ga0395905_0622916
1754 Ga0451800_1252777
1755 Ga0439442_029952
1756 Ga0439449_0019236
1757 Ga0439449_0021721
1758 Ga0439457_000363
1759 Ga0450923_033651
1760 Ga0450899_005210
1761 Ga0439434_0001630
1762 Ga0466969_0000305
1763 Ga0466972_0000082
1764 Ga0466972_0008143
1765 Ga0466972_0010489
1766 Ga0453683_0026921
1767 Ga0453683_0218193
1768 Ga0466965_0047663
1769 Ga0466966_0000015
1770 Ga0466966_0313281
1771 Ga0466961_0123026
1772 Ga0453684_0020334
1773 Ga0453684_0096964
1774 Ga0466968_0080778
1775 Ga0466957_0017897
1776 Ga0466957_0028242
1777 Ga0466957_0108948
1778 Ga0466959_0000030
1779 Ga0466959_0029310
1780 Ga0495629_0313922
1781 Ga0495638_0059897
1782 Ga0495638_0100674
1783 Ga0495650_0081857
1784 Ga0495606_0003421
1785 Ga0495628_0057514
1786 Ga0495643_0028977
1787 Ga0495648_0003136
1788 Ga0495621_0040448
1789 Ga0495621_0041191
1790 Ga0495622_0138752
1791 Ga0495634_0225813
1792 Ga0495611_0000026
1793 Ga0495625_0043643
1794 Ga0495625_0101230
1795 Ga0495635_0040108
1796 Ga0495647_0018872
1797 Ga0495670_0033375
1798 Ga0495649_0064266
1799 Ga0495600_0242525
1800 Ga0495672_0036043
1801 Ga0495687_001838
1802 Ga0495686_0000005
1803 Ga0495686_0037770
1804 Ga0496100_0270075
1805 Ga0496105_0304438
1806 Ga0496106_0232139
1807 Ga0496110_0190814
1808 Ga0496114_0026179
1809 Ga0501031_0013457
1810 Ga0501032_0038258
1811 Ga0501034_0005186
1812 Ga0501034_0555011
1813 Ga0501036_0319937
1814 Ga0501037_0004139
1815 Ga0501037_0005433
1816 Ga0501037_0021327
1817 Ga0501038_0013654
1818 Ga0501039_0111846
1819 Ga0501043_0007747
1820 Ga0501043_0042317
1821 Ga0501043_0049505
1822 Ga0501043_0148930
1823 Ga0501046_0013771
1824 Ga0501046_0124260
1825 Ga0501047_0016908
1826 Ga0501047_0053720
1827 Ga0501047_0119443
1828 Ga0501067_0091302
1829 Ga0501069_0010220
1830 Ga0501070_0294149
1831 Ga0501072_0256483
1832 Ga0501072_0289795
1833 Ga0501073_0057525
1834 Ga0501074_0056911
1835 Ga0501198_010451
1836 Ga0501201_000950
1837 Ga0501222_001674
1838 Ga0501223_001801
1839 Ga0501235_004186
1840 Ga0501235_015906
1841 Ga0501240_008635
1842 Ga0501242_000786
1843 Ga0501243_001866
1844 Ga0501243_002072
1845 Ga0501252_008870
1846 Ga0501257_004100
1847 Ga0501259_000241
1848 Ga0501259_000548
1849 Ga0501261_002098
1850 Ga0501225_0000523
1851 Ga0501225_0001327
1852 Ga0501225_0003132
1853 Ga0501245_003413
1854 Ga0501080_0108217
1855 Ga0501080_0146836
1856 Ga0501266_001945
1857 Ga0501035_0023604
1858 Ga0501044_0006596
1859 Ga0501044_0026792
1860 Ga0501044_0072751
1861 Ga0501044_0078434
1862 Ga0501044_0187664
1863 nmdc:mga0k408_206451_c1
1864 nmdc:mga0k408_2243_c1
1865 nmdc:mga0k408_28278_c1
1866 nmdc:mga09592_146433_c1
1867 nmdc:mga09592_158560_c1
1868 nmdc:mga0qj67_4627_c1
1869 nmdc:mga06r32_15626_c1
1870 nmdc:mga06r32_35876_c1
1871 nmdc:mga08y16_14158_c1
1872 nmdc:mga08y16_17376_c1
1873 nmdc:mga08y16_379105_c1
1874 nmdc:mga08y16_393156_c1
1875 nmdc:mga0n895_111335_c1
1876 Ga0495619_0063266
1877 Ga0500578_0000063
1878 Ga0500646_0001629
1879 Ga0500646_0052160
1880 Ga0500583_0000076
1881 Ga0500583_0000557
1882 Ga0500583_0000662
1883 Ga0500556_0140753
1884 Ga0500562_011924
1885 Ga0500652_007218
1886 Ga0500658_0142492
1887 Ga0500559_0023907
1888 Ga0500568_0001023
1889 Ga0500568_0043626
1890 Ga0500573_0158259
1891 Ga0500577_0045296
1892 Ga0500588_0001514
1893 Ga0500589_133366
1894 Ga0500616_0004133
1895 Ga0500622_0001733
1896 Ga0500636_0076299
1897 Ga0500637_0232392
1898 Ga0500611_000101
1899 Ga0501084_0104772
1900 Ga0501082_0132502
1901 Ga0466962_0016166
1902 2738725633

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08340

YicC-like_C

Endoribonuclease YicC-like, C-terminal

197

354

0.95

PF03755

YicC-like_N

Endoribonuclease YicC-like, N-terminal region

65

218

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hvj-assembly1.cif.gz_C-2 the structure of the e. coli mrna endoonuclease yicc 0.8562 18 285
8hvj-assembly1.cif.gz_C-2 the structure of the e. coli mrna endoonuclease yicc 0.8465 18 285
8hvj-assembly1.cif.gz_A-2 the structure of the e. coli mrna endoonuclease yicc 0.8343 4 285
8hvj-assembly1.cif.gz_A-2 the structure of the e. coli mrna endoonuclease yicc 0.8236 4 285
8hvj-assembly1.cif.gz_B-2 the structure of the e. coli mrna endoonuclease yicc 0.7172 8 285
ID Description Score Start End Superfamily
af_P23839_203_287_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9568 203 285 1.20.58.220
af_P23839_203_287_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.914 203 285 1.20.58.220
2vkhB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8577 216 287 1.20.58.1190
3ss1A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8146 216 285 1.20.58.1190
2vk9A01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8117 216 284 1.20.58.1190
ID Description Score Start End GO Terms
AF-A0A2E7CAN2-F1-model_v4 YicC family protein 0.9457 1 284 GO:0004521
AF-A0A2D9EBZ3-F1-model_v4 YicC family protein 0.9349 1 285 GO:0004521
AF-A0A4Q5Y496-F1-model_v4 deleted 0.9228 124 287
AF-A0A2D9EBZ3-F1-model_v4 YicC family protein 0.9225 1 285 GO:0004521
AF-A0A521CRG6-F1-model_v4 TIGR00255 family protein 0.9213 1 287 GO:0004521

Map