F486595

General Info

Members Datasets Scaffolds Average Seq Length
951 411 1902 263

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0005553|Ga0495605_0005553_6438_7301
Length 287
Sequence MYQVDRFRSRRQRLQVITLAKKGSSMPTLALPDGDLHYQLDGPLDAPVLLLSNSLGTNLAMWDGQIPVFAEHFRVLRYDTRGHGRSLVSDGPYSIEQHARDVLALMDALKIPRANFCGLSMGGLIGQWLMINAAQRLDRVVLCNTAAKIASPAVWNPRIEMVLREGKEGMLSLREATTSRWFSAQFAATQPAQVARLLDMLANTSPQGYAANCAAVRDADFAAQLGSVQLPVLVVCGNQDPVTTESDGELLKQAIAGAQRMTLSAAHLSNVEASEAFSAQVSAFLRR

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
77 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
104 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
105 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
106 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
107 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
108 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
109 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
110 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
111 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
112 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
113 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
114 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
115 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
116 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
117 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
235 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
236 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2511231004 Pseudomonas sp. GM102 Isolate Nodule
241 2511231010 Pseudomonas sp. GM25 Isolate Nodule
242 2511231011 Pseudomonas sp. GM30 Isolate Nodule
243 2511231012 Pseudomonas sp. GM33 Isolate Nodule
244 2511231016 Pseudomonas sp. GM50 Isolate Nodule
245 2511231017 Pseudomonas sp. GM55 Isolate Nodule
246 2511231019 Pseudomonas sp. GM67 Isolate Nodule
247 2511231022 Pseudomonas sp. GM79 Isolate Nodule
248 2511231023 Pseudomonas sp. GM80 Isolate Nodule
249 2511231031 Pseudomonas sp. GM16 Isolate Nodule
250 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
251 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
252 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
253 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
254 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
255 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
256 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
257 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
258 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
259 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
260 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
261 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
262 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
263 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
264 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
265 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
266 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
267 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
268 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
269 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
270 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
271 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
272 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
273 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
274 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
275 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
276 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
277 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
278 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
279 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
280 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
281 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
282 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
283 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
284 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
285 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
286 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
287 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
288 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
289 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
290 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
291 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
292 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
293 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
294 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
295 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
296 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
297 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
298 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
299 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
300 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
301 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
302 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
303 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
304 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
305 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
306 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
307 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
308 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
309 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
310 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
311 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
312 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
313 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
314 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
315 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
316 2636415599 Klebsiella variicola DX120E Isolate Unclassified
317 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
318 2643221638 Duganella sp. Root336D2 Isolate Unclassified
319 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
320 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
321 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
322 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
323 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
324 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
325 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
326 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
327 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
328 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
329 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
330 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
331 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
332 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
333 2773857670 Pseudomonas sp. 478 Isolate Unclassified
334 2775507074 Klebsiella sp. D5A Isolate Unclassified
335 2784132063 Pseudomonas sp. 424 Isolate Unclassified
336 2784132072 Pseudomonas sp. 460 Isolate Unclassified
337 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
338 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
339 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
340 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
341 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
342 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
343 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
344 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
345 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
346 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
347 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
348 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
349 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
350 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
351 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
352 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
353 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
354 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
355 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
356 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
357 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
358 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
359 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
360 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
361 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
362 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
363 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
364 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
365 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
366 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
367 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
368 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
369 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
370 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
371 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
372 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
373 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
374 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
375 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
376 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
377 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
378 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
379 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
380 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
381 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
382 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
383 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
384 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
385 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
386 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
387 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
388 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
389 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
390 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
391 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
392 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
393 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
394 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
395 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
396 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
397 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
398 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
399 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
400 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
401 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
402 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
403 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
404 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
405 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
406 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
407 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
408 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
409 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
410 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
411 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.91
Metatranscriptomes 0
Isolates 18.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 4
Nodule 1.58
Rhizoplane 7.57
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0005553 3300046474 Bacteria 7335
2 MRS2a_Contig_26459 2124908027 Bacteria 1663
3 SwRhRL2b_contig_2696906 2162886007 Bacteria 1618
4 JGI25163J39215_1000348 3300002771 Bacteria 15338
5 JGI25164J39214_1000492 3300002772 Bacteria 19394
6 JGI25165J46597_1000934 3300003214 Bacteria 20070
7 rootL2_10085104 3300003322 Bacteria 3432
8 Ga0055526_1010871 3300003771 Bacteria 4180
9 Ga0055536_1000043 3300003781 Bacteria 124663
10 Ga0055536_1001093 3300003781 Bacteria 17061
11 Ga0055530_10000031 3300003791 Bacteria 122117
12 Ga0055530_10000527 3300003791 Bacteria 33197
13 Ga0055540_1000161 3300003792 Bacteria 66740
14 Ga0055540_1000230 3300003792 Bacteria 51911
15 Ga0055540_1001131 3300003792 Bacteria 16636
16 Ga0055531_10001267 3300003794 Bacteria 19127
17 Ga0065714_10003926 3300005288 Bacteria 8412
18 Ga0065714_10007790 3300005288 Bacteria 2759
19 Ga0065714_10026140 3300005288 Bacteria 1528
20 Ga0065714_10065072 3300005288 Bacteria 13234
21 Ga0065714_10069444 3300005288 Bacteria 4226
22 Ga0065714_10070935 3300005288 Bacteria 3725
23 Ga0065714_10073836 3300005288 Bacteria 3124
24 Ga0065704_10001387 3300005289 Bacteria 12943
25 Ga0065704_10095259 3300005289 Bacteria 2497
26 Ga0065704_10142008 3300005289 Bacteria 1508
27 Ga0070683_100000933 3300005329 Bacteria 21733
28 Ga0070670_100001105 3300005331 Bacteria 21435
29 Ga0070670_100009361 3300005331 Bacteria 8361
30 Ga0070661_100000238 3300005344 Bacteria 45456
31 Ga0070669_100000150 3300005353 Bacteria 62681
32 Ga0070709_10005206 3300005434 Bacteria 7035
33 Ga0068853_100005654 3300005539 Bacteria 9830
34 Ga0070665_100251663 3300005548 Bacteria 1767
35 Ga0070664_100000233 3300005564 Bacteria 39884
36 Ga0068854_100008578 3300005578 Bacteria 6578
37 Ga0068851_10000019 3300005834 Bacteria 135877
38 Ga0075364_10294879 3300006051 Bacteria 1104
39 Ga0075432_10006266 3300006058 Bacteria 4043
40 Ga0075436_100076706 3300006914 Bacteria 2315
41 Ga0079104_1028293 3300006946 Bacteria 1425
42 Ga0105251_10000021 3300009011 Bacteria 137955
43 Ga0105251_10000477 3300009011 Bacteria 37930
44 Ga0105251_10003438 3300009011 Bacteria 11486
45 Ga0105251_10003475 3300009011 Bacteria 11417
46 Ga0105251_10009892 3300009011 Bacteria 5583
47 Ga0105251_10017479 3300009011 Bacteria 3842
48 Ga0105244_10004276 3300009036 Bacteria 9893
49 Ga0105244_10004598 3300009036 Bacteria 9449
50 Ga0105244_10010896 3300009036 Bacteria 5483
51 Ga0105244_10021200 3300009036 Bacteria 3598
52 Ga0105244_10026476 3300009036 Bacteria 3138
53 Ga0105244_10041414 3300009036 Bacteria 2387
54 Ga0105244_10072395 3300009036 Bacteria 1717
55 Ga0105244_10093887 3300009036 Bacteria 1474
56 Ga0105250_10000072 3300009092 Bacteria 94689
57 Ga0105250_10000118 3300009092 Bacteria 71419
58 Ga0105250_10002765 3300009092 Bacteria 8620
59 Ga0105250_10003322 3300009092 Bacteria 7656
60 Ga0105250_10065396 3300009092 Bacteria 1466
61 Ga0105247_10051921 3300009101 Bacteria 2526
62 Ga0105243_10001564 3300009148 Bacteria 20004
63 Ga0105243_10239895 3300009148 Bacteria 1612
64 Ga0105242_10000719 3300009176 Bacteria 25890
65 Ga0105248_10438648 3300009177 Bacteria 1471
66 Ga0105237_10005805 3300009545 Bacteria 13845
67 Ga0105246_10001731 3300011119 Bacteria 13039
68 Ga0105246_10002504 3300011119 Bacteria 11115
69 Ga0105246_10027971 3300011119 Bacteria 3701
70 Ga0157345_1000135 3300012498 Bacteria 13608
71 Ga0157373_10001969 3300013100 Bacteria 15573
72 Ga0157373_10007934 3300013100 Bacteria 7896
73 Ga0157373_10008873 3300013100 Bacteria 7443
74 Ga0157373_10031446 3300013100 Bacteria 3821
75 Ga0157373_10031805 3300013100 Bacteria 3799
76 Ga0157373_10070927 3300013100 Bacteria 2462
77 Ga0157373_10178320 3300013100 Bacteria 1496
78 Ga0157373_10312720 3300013100 Bacteria 1116
79 Ga0157371_10000281 3300013102 Bacteria 68624
80 Ga0157371_10019377 3300013102 Bacteria 5020
81 Ga0157371_10501813 3300013102 Bacteria 896
82 Ga0157370_10036138 3300013104 Bacteria 4796
83 Ga0157370_10137734 3300013104 Bacteria 2274
84 Ga0157369_10003643 3300013105 Bacteria 18275
85 Ga0157369_10010141 3300013105 Bacteria 10753
86 Ga0157369_10043869 3300013105 Bacteria 4871
87 Ga0163162_10000835 3300013306 Bacteria 28677
88 Ga0163162_10476875 3300013306 Bacteria 1379
89 Ga0157372_10004247 3300013307 Bacteria 15318
90 Ga0157375_10005491 3300013308 Bacteria 11026
91 Ga0157375_10039221 3300013308 Bacteria 4557
92 Ga0157375_10337200 3300013308 Bacteria 1673
93 Ga0182008_10007260 3300014497 Bacteria 6125
94 Ga0182008_10013392 3300014497 Bacteria 4313
95 Ga0182006_1000736 3300015261 Bacteria 22519
96 Ga0182006_1000816 3300015261 Bacteria 20884
97 Ga0182006_1008689 3300015261 Bacteria 4598
98 Ga0182006_1026599 3300015261 Bacteria 2367
99 Ga0182007_10000110 3300015262 Bacteria 56498
100 Ga0182007_10003838 3300015262 Bacteria 6987
101 Ga0182005_1000627 3300015265 Bacteria 16999
102 Ga0182005_1005224 3300015265 Bacteria 4077
103 Ga0182005_1009143 3300015265 Bacteria 2895
104 Ga0182005_1028956 3300015265 Bacteria 1510
105 Ga0163161_10002537 3300017792 Bacteria 13028
106 Ga0163161_10037516 3300017792 Bacteria 3474
107 Ga0163161_10052017 3300017792 Bacteria 2969
108 Ga0163161_10064796 3300017792 Bacteria 2666
109 Ga0163161_10113280 3300017792 Bacteria 2030
110 Ga0163161_10138446 3300017792 Bacteria 1842
111 Ga0163161_10422888 3300017792 Bacteria 1072
112 Ga0209760_100047 3300025207 Bacteria 107520
113 Ga0207427_100029 3300025231 Bacteria 376678
114 Ga0209437_100009 3300025233 Bacteria 915954
115 Ga0209233_1000032 3300025261 Bacteria 623596
116 Ga0209675_1002348 3300025291 Bacteria 9768
117 Ga0209676_1000016 3300025292 Bacteria 655561
118 Ga0209676_1000033 3300025292 Bacteria 463236
119 Ga0209676_1000080 3300025292 Bacteria 287400
120 Ga0209676_1002060 3300025292 Bacteria 15666
121 Ga0209676_1011697 3300025292 Bacteria 3513
122 Ga0209564_1001361 3300025295 Bacteria 25686
123 Ga0209050_1000036 3300025298 Bacteria 423070
124 Ga0209050_1000117 3300025298 Bacteria 202979
125 Ga0209050_1000187 3300025298 Bacteria 139437
126 Ga0209050_1001134 3300025298 Bacteria 32080
127 Ga0209051_1000077 3300025303 Bacteria 202959
128 Ga0209051_1000094 3300025303 Bacteria 168538
129 Ga0209051_1000131 3300025303 Bacteria 139437
130 Ga0209051_1007856 3300025303 Bacteria 5755
131 Ga0209257_1000173 3300025304 Bacteria 166678
132 Ga0207656_10000026 3300025321 Bacteria 86789
133 Ga0207696_1000005 3300025711 Bacteria 642078
134 Ga0207696_1000083 3300025711 Bacteria 197352
135 Ga0207696_1000111 3300025711 Bacteria 155243
136 Ga0207696_1018769 3300025711 Bacteria 2265
137 Ga0207655_1000063 3300025728 Bacteria 257028
138 Ga0207655_1000435 3300025728 Bacteria 55875
139 Ga0207655_1000893 3300025728 Bacteria 31371
140 Ga0207655_1002166 3300025728 Bacteria 16365
141 Ga0207655_1002478 3300025728 Bacteria 14954
142 Ga0207655_1002832 3300025728 Bacteria 13434
143 Ga0207655_1006801 3300025728 Bacteria 7516
144 Ga0207655_1007688 3300025728 Bacteria 6956
145 Ga0207655_1014097 3300025728 Bacteria 4540
146 Ga0207655_1025566 3300025728 Bacteria 2862
147 Ga0207655_1074812 3300025728 Bacteria 1245
148 Ga0207713_1000002 3300025735 Bacteria 1061749
149 Ga0207713_1000003 3300025735 Bacteria 860698
150 Ga0207713_1000104 3300025735 Bacteria 138310
151 Ga0207713_1000564 3300025735 Bacteria 36882
152 Ga0207713_1001593 3300025735 Bacteria 17743
153 Ga0207713_1002004 3300025735 Bacteria 15301
154 Ga0207713_1002990 3300025735 Bacteria 11815
155 Ga0207713_1003370 3300025735 Bacteria 10952
156 Ga0207713_1005039 3300025735 Bacteria 8397
157 Ga0207713_1018153 3300025735 Bacteria 3491
158 Ga0207713_1065880 3300025735 Bacteria 1358
159 Ga0207710_10141532 3300025900 Bacteria 1161
160 Ga0207699_10028489 3300025906 Bacteria 3105
161 Ga0207671_10000436 3300025914 Bacteria 57399
162 Ga0207649_10000002 3300025920 Bacteria 498633
163 Ga0207681_10000816 3300025923 Bacteria 20490
164 Ga0207650_10000559 3300025925 Bacteria 30251
165 Ga0207650_10000688 3300025925 Bacteria 26557
166 Ga0207706_10005582 3300025933 Bacteria 11722
167 Ga0207686_10005841 3300025934 Bacteria 6603
168 Ga0207709_10000036 3300025935 Bacteria 292568
169 Ga0207679_10000006 3300025945 Bacteria 498868
170 Ga0207639_10002172 3300026041 Bacteria 13210
171 Ga0209281_1004003 3300027111 Bacteria 4567
172 Ga0209281_1014772 3300027111 Bacteria 1645
173 Ga0209281_1014996 3300027111 Bacteria 1626
174 Ga0209981_1004989 3300027378 Bacteria 1755
175 Ga0209996_1001558 3300027395 Bacteria 2792
176 Ga0209968_1006918 3300027526 Bacteria 1712
177 Ga0209983_1001292 3300027665 Bacteria 5572
178 Ga0209974_10028508 3300027876 Bacteria 1849
179 Ga0207428_10038182 3300027907 Bacteria 3905
180 Ga0207428_10097691 3300027907 Bacteria 2273
181 Ga0268266_10011117 3300028379 Bacteria 7837
182 Ga0307511_10181496 3300030521 Bacteria 1133
183 Ga0316178_1175126 3300030735 Bacteria 6677
184 Ga0265340_10100814 3300031247 Bacteria 1342
185 Ga0307509_10045079 3300031507 Bacteria 4760
186 Ga0307408_100009275 3300031548 Bacteria 6487
187 Ga0307408_100047218 3300031548 Bacteria 3083
188 Ga0307408_100331416 3300031548 Bacteria 1285
189 Ga0307405_10000858 3300031731 Bacteria 11988
190 Ga0307405_10034002 3300031731 Bacteria 3029
191 Ga0307405_10042297 3300031731 Bacteria 2772
192 Ga0307405_10062191 3300031731 Bacteria 2363
193 Ga0307406_10605063 3300031901 Bacteria 904
194 Ga0307412_10013149 3300031911 Bacteria 4844
195 Ga0307412_10021104 3300031911 Bacteria 3974
196 Ga0307412_10039547 3300031911 Bacteria 3045
197 Ga0307412_10043688 3300031911 Bacteria 2919
198 Ga0307412_10044907 3300031911 Bacteria 2885
199 Ga0307412_10055324 3300031911 Bacteria 2638
200 Ga0307412_10103333 3300031911 Bacteria 2019
201 Ga0307412_10248558 3300031911 Bacteria 1380
202 Ga0307416_100040799 3300032002 Bacteria 3610
203 Ga0307416_100312825 3300032002 Bacteria 1568
204 Ga0307416_100375485 3300032002 Bacteria 1449
205 Ga0307414_10059779 3300032004 Bacteria 2693
206 Ga0307411_10015552 3300032005 Bacteria 4278
207 Ga0307411_10619895 3300032005 Bacteria 932
208 Ga0307510_10017421 3300033180 Bacteria 8472
209 Ga0307510_10107259 3300033180 Bacteria 2553
210 Ga0237819_02852 3300038705 Bacteria 3285
211 Ga0439438_000786 3300041405 Bacteria 14109
212 Ga0439438_002348 3300041405 Bacteria 8069
213 Ga0439438_003155 3300041405 Bacteria 6762
214 Ga0439438_005775 3300041405 Bacteria 4492
215 Ga0439438_007754 3300041405 Bacteria 3632
216 Ga0439438_008580 3300041405 Bacteria 3375
217 Ga0439447_000985 3300041407 Bacteria 10388
218 Ga0439447_001411 3300041407 Bacteria 8804
219 Ga0439447_006363 3300041407 Bacteria 3842
220 Ga0439447_017819 3300041407 Bacteria 1928
221 Ga0439447_046546 3300041407 Bacteria 1043
222 Ga0439466_0001571 3300041411 Bacteria 8922
223 Ga0439466_0001845 3300041411 Bacteria 8316
224 Ga0439466_0001878 3300041411 Bacteria 8225
225 Ga0439466_0008863 3300041411 Bacteria 3784
226 Ga0439466_0027775 3300041411 Bacteria 1957
227 Ga0439466_0028654 3300041411 Bacteria 1920
228 Ga0439466_0040503 3300041411 Bacteria 1557
229 Ga0439465_0007331 3300041413 Bacteria 3502
230 Ga0439431_0010252 3300041997 Bacteria 2124
231 Ga0439445_0044923 3300042004 Bacteria 1181
232 Ga0439432_000245 3300042006 Bacteria 19526
233 Ga0439432_007140 3300042006 Bacteria 3969
234 Ga0439432_058764 3300042006 Bacteria 1188
235 Ga0439432_063597 3300042006 Bacteria 1133
236 Ga0439432_082494 3300042006 Bacteria 973
237 Ga0439451_001190 3300042009 Bacteria 5124
238 Ga0439451_003397 3300042009 Bacteria 3224
239 Ga0439451_010346 3300042009 Bacteria 1881
240 Ga0439451_022469 3300042009 Bacteria 1271
241 Ga0439452_001036 3300042010 Bacteria 12293
242 Ga0439452_002729 3300042010 Bacteria 6395
243 Ga0439452_004324 3300042010 Bacteria 4792
244 Ga0439452_011394 3300042010 Bacteria 2556
245 Ga0439452_020900 3300042010 Bacteria 1711
246 Ga0439452_030104 3300042010 Bacteria 1341
247 Ga0439456_001777 3300042013 Bacteria 4361
248 Ga0439456_019846 3300042013 Bacteria 1415
249 Ga0439456_031682 3300042013 Bacteria 1133
250 Ga0439463_035129 3300042016 Bacteria 1268
251 Ga0450911_001409 3300042115 Bacteria 5552
252 Ga0450911_001580 3300042115 Bacteria 5148
253 Ga0450919_002784 3300042121 Bacteria 2249
254 Ga0450898_019753 3300042134 Bacteria 1176
255 Ga0450900_006911 3300042136 Bacteria 1385
256 Ga0450902_001140 3300042137 Bacteria 3547
257 Ga0450903_003033 3300042138 Bacteria 2930
258 Ga0450903_005287 3300042138 Bacteria 2165
259 Ga0450904_002190 3300042139 Bacteria 2391
260 Ga0450906_004159 3300042145 Bacteria 3056
261 Ga0450906_012772 3300042145 Bacteria 1554
262 Ga0450907_000173 3300042146 Bacteria 23629
263 Ga0450907_004128 3300042146 Bacteria 2515
264 Ga0450907_013304 3300042146 Bacteria 1370
265 Ga0450910_006877 3300042147 Bacteria 1576
266 Ga0450908_013324 3300042184 Bacteria 1483
267 Ga0450909_004414 3300042185 Bacteria 2006
268 Ga0439434_0001671 3300042435 Bacteria 6428
269 Ga0439460_0032672 3300042461 Bacteria 1491
270 Ga0439440_0001312 3300042993 Bacteria 4519
271 Ga0439440_0010474 3300042993 Bacteria 1939
272 Ga0495617_001213 3300046452 Bacteria 11620
273 Ga0495617_007892 3300046452 Bacteria 3682
274 Ga0495617_017307 3300046452 Bacteria 2434
275 Ga0495617_020800 3300046452 Bacteria 2217
276 Ga0495617_021109 3300046452 Bacteria 2201
277 Ga0495617_035676 3300046452 Bacteria 1669
278 Ga0495617_056969 3300046452 Bacteria 1295
279 Ga0495627_000010 3300046453 Bacteria 381168
280 Ga0495627_001278 3300046453 Bacteria 15487
281 Ga0495627_002406 3300046453 Bacteria 9068
282 Ga0495627_005495 3300046453 Bacteria 5099
283 Ga0495603_0005877 3300046455 Bacteria 7333
284 Ga0495603_0013688 3300046455 Bacteria 4908
285 Ga0495590_0001626 3300046457 Bacteria 9594
286 Ga0495590_0004603 3300046457 Bacteria 5542
287 Ga0495590_0006841 3300046457 Bacteria 4431
288 Ga0495590_0021548 3300046457 Bacteria 2284
289 Ga0495591_000002 3300046458 Bacteria 455013
290 Ga0495591_000452 3300046458 Bacteria 33368
291 Ga0495591_001442 3300046458 Bacteria 14774
292 Ga0495591_001556 3300046458 Bacteria 14002
293 Ga0495591_002486 3300046458 Bacteria 10221
294 Ga0495591_002525 3300046458 Bacteria 10110
295 Ga0495591_003543 3300046458 Bacteria 7996
296 Ga0495591_004698 3300046458 Bacteria 6557
297 Ga0495591_007226 3300046458 Bacteria 4752
298 Ga0495591_007825 3300046458 Bacteria 4468
299 Ga0495591_008402 3300046458 Bacteria 4232
300 Ga0495591_013459 3300046458 Bacteria 2991
301 Ga0495591_029909 3300046458 Bacteria 1649
302 Ga0495638_0005689 3300046460 Bacteria 9183
303 Ga0495638_0006808 3300046460 Bacteria 8254
304 Ga0495638_0007812 3300046460 Bacteria 7637
305 Ga0495638_0032131 3300046460 Bacteria 3367
306 Ga0495638_0046056 3300046460 Bacteria 2741
307 Ga0495653_0015282 3300046463 Bacteria 6256
308 Ga0495650_0003766 3300046471 Bacteria 10820
309 Ga0495650_0004073 3300046471 Bacteria 10221
310 Ga0495650_0005829 3300046471 Bacteria 7848
311 Ga0495650_0019471 3300046471 Bacteria 3338
312 Ga0495650_0026336 3300046471 Bacteria 2707
313 Ga0495650_0028975 3300046471 Bacteria 2530
314 Ga0495650_0032847 3300046471 Bacteria 2316
315 Ga0495650_0049992 3300046471 Bacteria 1731
316 Ga0495650_0056126 3300046471 Bacteria 1599
317 Ga0495582_0016390 3300046473 Bacteria 4060
318 Ga0495605_0008470 3300046474 Bacteria 5814
319 Ga0495605_0010655 3300046474 Bacteria 5138
320 Ga0495605_0022243 3300046474 Bacteria 3350
321 Ga0495605_0037769 3300046474 Bacteria 2427
322 Ga0495605_0104320 3300046474 Bacteria 1299
323 Ga0495605_0130337 3300046474 Bacteria 1134
324 Ga0495639_0000994 3300046475 Bacteria 12799
325 Ga0495584_0001291 3300046491 Bacteria 15247
326 Ga0495584_0002832 3300046491 Bacteria 9681
327 Ga0495584_0009191 3300046491 Bacteria 5096
328 Ga0495584_0010632 3300046491 Bacteria 4726
329 Ga0495584_0017755 3300046491 Bacteria 3619
330 Ga0495584_0022206 3300046491 Bacteria 3221
331 Ga0495584_0067622 3300046491 Bacteria 1795
332 Ga0495585_0007924 3300046492 Bacteria 6458
333 Ga0495585_0011257 3300046492 Bacteria 5299
334 Ga0495585_0017386 3300046492 Bacteria 4154
335 Ga0495585_0019132 3300046492 Bacteria 3952
336 Ga0495585_0076259 3300046492 Bacteria 1821
337 Ga0495594_0006698 3300046499 Bacteria 5925
338 Ga0495594_0058585 3300046499 Bacteria 2129
339 Ga0495594_0123797 3300046499 Bacteria 1462
340 Ga0495596_0001019 3300046500 Bacteria 16647
341 Ga0495607_0000025 3300046501 Bacteria 159379
342 Ga0495607_0000723 3300046501 Bacteria 31710
343 Ga0495607_0003843 3300046501 Bacteria 11330
344 Ga0495607_0005334 3300046501 Bacteria 9236
345 Ga0495607_0009730 3300046501 Bacteria 6489
346 Ga0495607_0016411 3300046501 Bacteria 4778
347 Ga0495607_0024112 3300046501 Bacteria 3797
348 Ga0495607_0039658 3300046501 Bacteria 2811
349 Ga0495607_0063469 3300046501 Bacteria 2089
350 Ga0495607_0069373 3300046501 Bacteria 1973
351 Ga0495607_0070726 3300046501 Bacteria 1948
352 Ga0495607_0074243 3300046501 Bacteria 1888
353 Ga0495583_0001907 3300046506 Bacteria 19301
354 Ga0495583_0008510 3300046506 Bacteria 6260
355 Ga0495583_0008516 3300046506 Bacteria 6258
356 Ga0495583_0018824 3300046506 Bacteria 3623
357 Ga0495583_0029479 3300046506 Bacteria 2684
358 Ga0495583_0035446 3300046506 Bacteria 2381
359 Ga0495583_0098419 3300046506 Bacteria 1250
360 Ga0495606_0000055 3300046507 Bacteria 199348
361 Ga0495606_0001543 3300046507 Bacteria 30359
362 Ga0495606_0011362 3300046507 Bacteria 7270
363 Ga0495606_0011908 3300046507 Bacteria 7035
364 Ga0495606_0016397 3300046507 Bacteria 5650
365 Ga0495606_0016942 3300046507 Bacteria 5530
366 Ga0495606_0020935 3300046507 Bacteria 4802
367 Ga0495606_0031545 3300046507 Bacteria 3682
368 Ga0495606_0035464 3300046507 Bacteria 3408
369 Ga0495606_0058330 3300046507 Bacteria 2481
370 Ga0495606_0101267 3300046507 Bacteria 1753
371 Ga0495606_0227933 3300046507 Bacteria 1046
372 Ga0495610_0004508 3300046512 Bacteria 10261
373 Ga0495610_0008798 3300046512 Bacteria 6475
374 Ga0495610_0010140 3300046512 Bacteria 5880
375 Ga0495610_0016078 3300046512 Bacteria 4325
376 Ga0495610_0023992 3300046512 Bacteria 3300
377 Ga0495610_0049979 3300046512 Bacteria 2043
378 Ga0495610_0095346 3300046512 Bacteria 1341
379 Ga0495616_0003008 3300046513 Bacteria 10938
380 Ga0495616_0006069 3300046513 Bacteria 7361
381 Ga0495616_0007496 3300046513 Bacteria 6533
382 Ga0495616_0009252 3300046513 Bacteria 5776
383 Ga0495616_0009306 3300046513 Bacteria 5756
384 Ga0495616_0012317 3300046513 Bacteria 4857
385 Ga0495616_0025253 3300046513 Bacteria 3176
386 Ga0495616_0029012 3300046513 Bacteria 2924
387 Ga0495620_0001753 3300046515 Bacteria 12769
388 Ga0495620_0002591 3300046515 Bacteria 10455
389 Ga0495620_0007857 3300046515 Bacteria 5755
390 Ga0495620_0008194 3300046515 Bacteria 5619
391 Ga0495620_0008988 3300046515 Bacteria 5336
392 Ga0495620_0014699 3300046515 Bacteria 3970
393 Ga0495620_0021640 3300046515 Bacteria 3119
394 Ga0495620_0022198 3300046515 Bacteria 3064
395 Ga0495620_0031288 3300046515 Bacteria 2440
396 Ga0495620_0034269 3300046515 Bacteria 2296
397 Ga0495630_0032621 3300046517 Bacteria 3882
398 Ga0495630_0075306 3300046517 Bacteria 2543
399 Ga0495631_0003291 3300046518 Bacteria 8883
400 Ga0495631_0019988 3300046518 Bacteria 3133
401 Ga0495631_0023185 3300046518 Bacteria 2879
402 Ga0495631_0090514 3300046518 Bacteria 1317
403 Ga0495632_0003292 3300046519 Bacteria 11535
404 Ga0495632_0005336 3300046519 Bacteria 8522
405 Ga0495632_0009359 3300046519 Bacteria 5914
406 Ga0495632_0010459 3300046519 Bacteria 5494
407 Ga0495632_0013714 3300046519 Bacteria 4612
408 Ga0495632_0017467 3300046519 Bacteria 3957
409 Ga0495632_0027429 3300046519 Bacteria 2983
410 Ga0495637_0000414 3300046520 Bacteria 31478
411 Ga0495637_0002290 3300046520 Bacteria 10607
412 Ga0495637_0002474 3300046520 Bacteria 10205
413 Ga0495637_0005314 3300046520 Bacteria 6585
414 Ga0495637_0014643 3300046520 Bacteria 3695
415 Ga0495637_0021535 3300046520 Bacteria 2954
416 Ga0495637_0093929 3300046520 Bacteria 1179
417 Ga0495643_0006744 3300046522 Bacteria 7511
418 Ga0495643_0010283 3300046522 Bacteria 5762
419 Ga0495643_0013850 3300046522 Bacteria 4811
420 Ga0495643_0017952 3300046522 Bacteria 4123
421 Ga0495643_0021971 3300046522 Bacteria 3648
422 Ga0495643_0027922 3300046522 Bacteria 3167
423 Ga0495643_0150046 3300046522 Bacteria 1155
424 Ga0495643_0186716 3300046522 Bacteria 1003
425 Ga0495644_0001339 3300046523 Bacteria 10077
426 Ga0495644_0002235 3300046523 Bacteria 7743
427 Ga0495644_0003754 3300046523 Bacteria 5977
428 Ga0495644_0011222 3300046523 Bacteria 3452
429 Ga0495648_0001887 3300046524 Bacteria 20035
430 Ga0495648_0006635 3300046524 Bacteria 9379
431 Ga0495648_0007214 3300046524 Bacteria 8929
432 Ga0495648_0013042 3300046524 Bacteria 6166
433 Ga0495648_0016559 3300046524 Bacteria 5309
434 Ga0495648_0024568 3300046524 Bacteria 4100
435 Ga0495648_0032234 3300046524 Bacteria 3441
436 Ga0495648_0036612 3300046524 Bacteria 3162
437 Ga0495648_0048425 3300046524 Bacteria 2616
438 Ga0495648_0092173 3300046524 Bacteria 1692
439 Ga0495648_0121460 3300046524 Bacteria 1403
440 Ga0495666_0010775 3300046526 Bacteria 4560
441 Ga0495666_0024064 3300046526 Bacteria 3011
442 Ga0495666_0050239 3300046526 Bacteria 2005
443 Ga0495642_0000619 3300046528 Bacteria 17900
444 Ga0495642_0018089 3300046528 Bacteria 2756
445 Ga0495654_0000673 3300046530 Bacteria 26934
446 Ga0495654_0001952 3300046530 Bacteria 13616
447 Ga0495654_0023755 3300046530 Bacteria 3172
448 Ga0495654_0027139 3300046530 Bacteria 2938
449 Ga0495654_0027278 3300046530 Bacteria 2929
450 Ga0495654_0037975 3300046530 Bacteria 2410
451 Ga0495654_0093213 3300046530 Bacteria 1395
452 Ga0495654_0097301 3300046530 Bacteria 1359
453 Ga0495654_0098547 3300046530 Bacteria 1348
454 Ga0495654_0128589 3300046530 Bacteria 1139
455 Ga0495654_0179222 3300046530 Bacteria 918
456 Ga0495586_0101788 3300046535 Bacteria 1594
457 Ga0495587_0024092 3300046536 Bacteria 3734
458 Ga0495587_0092887 3300046536 Bacteria 1742
459 Ga0495609_0000066 3300046538 Bacteria 131202
460 Ga0495609_0004568 3300046538 Bacteria 7524
461 Ga0495609_0005438 3300046538 Bacteria 6691
462 Ga0495609_0006429 3300046538 Bacteria 5995
463 Ga0495609_0009498 3300046538 Bacteria 4705
464 Ga0495609_0018559 3300046538 Bacteria 3222
465 Ga0495609_0024012 3300046538 Bacteria 2798
466 Ga0495597_0000011 3300046542 Bacteria 221377
467 Ga0495597_0006542 3300046542 Bacteria 6015
468 Ga0495597_0008888 3300046542 Bacteria 5008
469 Ga0495597_0017098 3300046542 Bacteria 3417
470 Ga0495597_0018718 3300046542 Bacteria 3247
471 Ga0495597_0020226 3300046542 Bacteria 3102
472 Ga0495597_0021958 3300046542 Bacteria 2963
473 Ga0495597_0063893 3300046542 Bacteria 1599
474 Ga0495597_0083324 3300046542 Bacteria 1365
475 Ga0495622_0002561 3300046557 Bacteria 8783
476 Ga0495622_0003892 3300046557 Bacteria 6974
477 Ga0495622_0008562 3300046557 Bacteria 4741
478 Ga0495622_0028987 3300046557 Bacteria 2586
479 Ga0495622_0052332 3300046557 Bacteria 1894
480 Ga0495622_0053763 3300046557 Bacteria 1868
481 Ga0495633_0010318 3300046558 Bacteria 5107
482 Ga0495668_0002481 3300046616 Bacteria 15151
483 Ga0495668_0008255 3300046616 Bacteria 6526
484 Ga0495668_0016122 3300046616 Bacteria 4347
485 Ga0495668_0185858 3300046616 Bacteria 1138
486 Ga0495634_0020607 3300046642 Bacteria 4673
487 Ga0495611_0000416 3300046648 Bacteria 26473
488 Ga0495611_0002365 3300046648 Bacteria 8687
489 Ga0495611_0003356 3300046648 Bacteria 7067
490 Ga0495625_0000055 3300046660 Bacteria 186381
491 Ga0495625_0020483 3300046660 Bacteria 5104
492 Ga0495625_0022411 3300046660 Bacteria 4843
493 Ga0495625_0048103 3300046660 Bacteria 3072
494 Ga0495625_0084289 3300046660 Bacteria 2207
495 Ga0495635_0006025 3300046663 Bacteria 8455
496 Ga0495635_0018177 3300046663 Bacteria 4907
497 Ga0495659_0001059 3300046664 Bacteria 9611
498 Ga0495661_0000105 3300046665 Bacteria 101167
499 Ga0495661_0000139 3300046665 Bacteria 85160
500 Ga0495661_0002061 3300046665 Bacteria 15772
501 Ga0495661_0004967 3300046665 Bacteria 9503
502 Ga0495661_0025126 3300046665 Bacteria 3851
503 Ga0495661_0033064 3300046665 Bacteria 3264
504 Ga0495661_0034528 3300046665 Bacteria 3182
505 Ga0495661_0071314 3300046665 Bacteria 2030
506 Ga0495588_0020609 3300046674 Bacteria 3243
507 Ga0495588_0137198 3300046674 Bacteria 1291
508 Ga0495623_0016125 3300046679 Bacteria 4827
509 Ga0495623_0018191 3300046679 Bacteria 4538
510 Ga0495646_0024731 3300046680 Bacteria 3781
511 Ga0495646_0025218 3300046680 Bacteria 3741
512 Ga0495646_0028629 3300046680 Bacteria 3486
513 Ga0495646_0098588 3300046680 Bacteria 1678
514 Ga0495669_0001111 3300046684 Bacteria 11152
515 Ga0495613_0049064 3300046689 Bacteria 3116
516 Ga0495613_0061840 3300046689 Bacteria 2741
517 Ga0495613_0114868 3300046689 Bacteria 1937
518 Ga0495624_0007174 3300046690 Bacteria 7843
519 Ga0495670_0004140 3300046691 Bacteria 7110
520 Ga0495670_0006986 3300046691 Bacteria 5563
521 Ga0495670_0042577 3300046691 Bacteria 2265
522 Ga0495670_0122357 3300046691 Bacteria 1352
523 Ga0495670_0136191 3300046691 Bacteria 1282
524 Ga0495670_0209178 3300046691 Bacteria 1034
525 Ga0495671_0000516 3300046692 Bacteria 29556
526 Ga0495671_0001535 3300046692 Bacteria 15386
527 Ga0495671_0007630 3300046692 Bacteria 6145
528 Ga0495671_0019851 3300046692 Bacteria 3547
529 Ga0495671_0022087 3300046692 Bacteria 3336
530 Ga0495671_0033881 3300046692 Bacteria 2599
531 Ga0495671_0039276 3300046692 Bacteria 2390
532 Ga0495671_0041552 3300046692 Bacteria 2314
533 Ga0495671_0103258 3300046692 Bacteria 1392
534 Ga0495649_0002480 3300046694 Bacteria 12953
535 Ga0495649_0006308 3300046694 Bacteria 7379
536 Ga0495649_0007497 3300046694 Bacteria 6640
537 Ga0495649_0013971 3300046694 Bacteria 4618
538 Ga0495649_0026961 3300046694 Bacteria 3190
539 Ga0495649_0037742 3300046694 Bacteria 2651
540 Ga0495649_0052219 3300046694 Bacteria 2215
541 Ga0495649_0055807 3300046694 Bacteria 2133
542 Ga0495589_0000411 3300046794 Bacteria 32203
543 Ga0495589_0001524 3300046794 Bacteria 13328
544 Ga0495589_0004506 3300046794 Bacteria 7400
545 Ga0495589_0007367 3300046794 Bacteria 5760
546 Ga0495589_0026347 3300046794 Bacteria 2946
547 Ga0495589_0028987 3300046794 Bacteria 2791
548 Ga0495600_0016472 3300046809 Bacteria 4691
549 Ga0495660_0000142 3300046810 Bacteria 77290
550 Ga0495660_0001119 3300046810 Bacteria 19156
551 Ga0495660_0007548 3300046810 Bacteria 6383
552 Ga0495660_0008985 3300046810 Bacteria 5837
553 Ga0495660_0012251 3300046810 Bacteria 4974
554 Ga0495660_0012502 3300046810 Bacteria 4928
555 Ga0495660_0012787 3300046810 Bacteria 4869
556 Ga0495660_0015928 3300046810 Bacteria 4338
557 Ga0495660_0022738 3300046810 Bacteria 3578
558 Ga0495660_0030871 3300046810 Bacteria 3016
559 Ga0495660_0054092 3300046810 Bacteria 2176
560 Ga0495660_0073726 3300046810 Bacteria 1804
561 Ga0495660_0085657 3300046810 Bacteria 1646
562 Ga0495660_0093750 3300046810 Bacteria 1556
563 Ga0495660_0136063 3300046810 Bacteria 1227
564 Ga0495660_0170688 3300046810 Bacteria 1059
565 Ga0495604_0028278 3300047317 Bacteria 4459
566 Ga0495604_0054701 3300047317 Bacteria 3079
567 Ga0495604_0331762 3300047317 Bacteria 1014
568 Ga0495636_0012249 3300047318 Bacteria 3395
569 Ga0495674_0027626 3300047319 Bacteria 5183
570 Ga0495672_0003642 3300047320 Bacteria 13052
571 Ga0495672_0004056 3300047320 Bacteria 12227
572 Ga0495672_0007887 3300047320 Bacteria 7943
573 Ga0495672_0015575 3300047320 Bacteria 5157
574 Ga0495672_0022571 3300047320 Bacteria 4088
575 Ga0495672_0029531 3300047320 Bacteria 3452
576 Ga0495672_0036108 3300047320 Bacteria 3037
577 Ga0495672_0039705 3300047320 Bacteria 2860
578 Ga0495672_0059273 3300047320 Bacteria 2215
579 Ga0495672_0110292 3300047320 Bacteria 1478
580 Ga0495676_0000013 3300047321 Bacteria 213031
581 Ga0495676_0019443 3300047321 Bacteria 5973
582 Ga0495676_0079116 3300047321 Bacteria 2500
583 Ga0495680_0009030 3300047322 Bacteria 9005
584 Ga0495680_0052857 3300047322 Bacteria 3164
585 Ga0495680_0072207 3300047322 Bacteria 2625
586 Ga0495683_0005515 3300047323 Bacteria 7015
587 Ga0495683_0016832 3300047323 Bacteria 3794
588 Ga0495683_0019268 3300047323 Bacteria 3522
589 Ga0495683_0022825 3300047323 Bacteria 3217
590 Ga0495683_0039481 3300047323 Bacteria 2385
591 Ga0495683_0193713 3300047323 Bacteria 920
592 Ga0495687_004474 3300047443 Bacteria 9414
593 Ga0495687_025436 3300047443 Bacteria 2798
594 Ga0495675_0303601 3300047444 Bacteria 947
595 Ga0495677_0003504 3300047445 Bacteria 6089
596 Ga0495679_000129 3300047446 Bacteria 67544
597 Ga0495679_004672 3300047446 Bacteria 6240
598 Ga0495679_007869 3300047446 Bacteria 4391
599 Ga0495679_007997 3300047446 Bacteria 4347
600 Ga0495679_009193 3300047446 Bacteria 3972
601 Ga0495679_009679 3300047446 Bacteria 3839
602 Ga0495679_016820 3300047446 Bacteria 2635
603 Ga0495679_016840 3300047446 Bacteria 2633
604 Ga0495679_030636 3300047446 Bacteria 1743
605 Ga0495679_069681 3300047446 Bacteria 1015
606 Ga0495673_0000510 3300047469 Bacteria 41036
607 Ga0495673_0000641 3300047469 Bacteria 34387
608 Ga0495673_0001049 3300047469 Bacteria 24312
609 Ga0495673_0003806 3300047469 Bacteria 9745
610 Ga0495673_0004768 3300047469 Bacteria 8399
611 Ga0495673_0006091 3300047469 Bacteria 7162
612 Ga0495673_0008502 3300047469 Bacteria 5767
613 Ga0495673_0009496 3300047469 Bacteria 5383
614 Ga0495673_0010918 3300047469 Bacteria 4914
615 Ga0495673_0013311 3300047469 Bacteria 4325
616 Ga0495673_0013457 3300047469 Bacteria 4292
617 Ga0495673_0014564 3300047469 Bacteria 4085
618 Ga0495673_0014875 3300047469 Bacteria 4030
619 Ga0495673_0022411 3300047469 Bacteria 3096
620 Ga0495673_0025384 3300047469 Bacteria 2846
621 Ga0495673_0026170 3300047469 Bacteria 2792
622 Ga0495673_0029441 3300047469 Bacteria 2591
623 Ga0495673_0036349 3300047469 Bacteria 2260
624 Ga0495673_0039748 3300047469 Bacteria 2132
625 Ga0495673_0041298 3300047469 Bacteria 2077
626 Ga0495681_0001437 3300047470 Bacteria 17881
627 Ga0495681_0004955 3300047470 Bacteria 8985
628 Ga0495681_0005721 3300047470 Bacteria 8274
629 Ga0495681_0007131 3300047470 Bacteria 7202
630 Ga0495681_0007318 3300047470 Bacteria 7072
631 Ga0495681_0015381 3300047470 Bacteria 4331
632 Ga0495681_0018869 3300047470 Bacteria 3785
633 Ga0495681_0038148 3300047470 Bacteria 2358
634 Ga0495681_0105343 3300047470 Bacteria 1227
635 Ga0495681_0155149 3300047470 Bacteria 957
636 Ga0495684_0010506 3300047471 Bacteria 7159
637 Ga0495684_0022241 3300047471 Bacteria 4882
638 Ga0495686_0015573 3300047472 Bacteria 5186
639 Ga0495686_0017332 3300047472 Bacteria 4856
640 Ga0495686_0021878 3300047472 Bacteria 4237
641 Ga0495686_0031136 3300047472 Bacteria 3461
642 Ga0495686_0040447 3300047472 Bacteria 2973
643 Ga0495686_0179017 3300047472 Bacteria 1229
644 Ga0495686_0229606 3300047472 Bacteria 1051
645 Ga0495593_0011041 3300047673 Bacteria 5199
646 Ga0495602_0015548 3300048088 Bacteria 7673
647 Ga0495626_0000056 3300048091 Bacteria 150654
648 Ga0495626_0001149 3300048091 Bacteria 22106
649 Ga0495626_0001346 3300048091 Bacteria 19873
650 Ga0495626_0002001 3300048091 Bacteria 15031
651 Ga0495626_0003528 3300048091 Bacteria 10014
652 Ga0495626_0007781 3300048091 Bacteria 5938
653 Ga0495626_0010537 3300048091 Bacteria 4923
654 Ga0495626_0011028 3300048091 Bacteria 4794
655 Ga0495626_0022037 3300048091 Bacteria 3151
656 Ga0495626_0048137 3300048091 Bacteria 1979
657 Ga0495626_0133578 3300048091 Bacteria 1057
658 Ga0496100_0032875 3300048903 Bacteria 3240
659 Ga0496101_0012768 3300048904 Bacteria 5617
660 Ga0496102_0004463 3300048905 Bacteria 11805
661 Ga0496102_0275671 3300048905 Bacteria 1585
662 Ga0496102_0622638 3300048905 Bacteria 1002
663 Ga0496103_0013756 3300048906 Bacteria 4803
664 Ga0496103_0140729 3300048906 Bacteria 1543
665 Ga0496104_0034402 3300048907 Bacteria 4725
666 Ga0496105_0092973 3300048908 Bacteria 2490
667 Ga0496110_0322043 3300048913 Bacteria 1408
668 Ga0496111_0327545 3300048914 Bacteria 1134
669 Ga0496112_0257867 3300048915 Bacteria 1693
670 Ga0496116_0006411 3300048919 Bacteria 10676
671 Ga0496116_0014738 3300048919 Bacteria 6226
672 Ga0496116_0022706 3300048919 Bacteria 4694
673 Ga0496116_0032094 3300048919 Bacteria 3748
674 Ga0496116_0046236 3300048919 Bacteria 2939
675 Ga0496116_0088988 3300048919 Bacteria 1885
676 Ga0496117_0002789 3300048920 Bacteria 21338
677 Ga0496117_0008857 3300048920 Bacteria 9496
678 Ga0496117_0011214 3300048920 Bacteria 8046
679 Ga0496117_0017405 3300048920 Bacteria 6000
680 Ga0496117_0025548 3300048920 Bacteria 4641
681 Ga0496117_0028665 3300048920 Bacteria 4308
682 Ga0496118_0016084 3300048921 Bacteria 6883
683 Ga0496118_0018336 3300048921 Bacteria 6319
684 Ga0496118_0025463 3300048921 Bacteria 5072
685 Ga0496118_0029625 3300048921 Bacteria 4586
686 Ga0496118_0051207 3300048921 Bacteria 3160
687 Ga0496118_0123217 3300048921 Bacteria 1684
688 Ga0496118_0170014 3300048921 Bacteria 1333
689 Ga0496119_0000011 3300048922 Bacteria 438315
690 Ga0496119_0000570 3300048922 Bacteria 49795
691 Ga0496119_0030527 3300048922 Bacteria 3631
692 Ga0496119_0046829 3300048922 Bacteria 2695
693 Ga0496120_0000306 3300048923 Bacteria 81699
694 Ga0496120_0008512 3300048923 Bacteria 7437
695 Ga0496120_0020768 3300048923 Bacteria 4164
696 Ga0496120_0031599 3300048923 Bacteria 3203
697 Ga0496120_0033638 3300048923 Bacteria 3078
698 Ga0496121_0005089 3300048924 Bacteria 17144
699 Ga0496121_0008265 3300048924 Bacteria 12317
700 Ga0496121_0018914 3300048924 Bacteria 6913
701 Ga0496121_0023351 3300048924 Bacteria 5959
702 Ga0496121_0048821 3300048924 Bacteria 3596
703 Ga0496121_0071713 3300048924 Bacteria 2784
704 Ga0496121_0501650 3300048924 Bacteria 770
705 Ga0496122_0000122 3300048925 Bacteria 181491
706 Ga0496122_0037968 3300048925 Bacteria 3867
707 Ga0496122_0043373 3300048925 Bacteria 3525
708 Ga0496122_0057593 3300048925 Bacteria 2884
709 Ga0496122_0063686 3300048925 Bacteria 2688
710 Ga0496122_0092629 3300048925 Bacteria 2053
711 Ga0496122_0102264 3300048925 Bacteria 1911
712 Ga0496122_0201513 3300048925 Bacteria 1163
713 Ga0496123_0000173 3300048926 Bacteria 130586
714 Ga0496123_0009566 3300048926 Bacteria 8711
715 Ga0496123_0044650 3300048926 Bacteria 3028
716 Ga0496123_0074315 3300048926 Bacteria 2104
717 Ga0496123_0097294 3300048926 Bacteria 1725
718 Ga0496123_0192918 3300048926 Bacteria 1052
719 Ga0496124_0007784 3300048927 Bacteria 11315
720 Ga0496124_0007979 3300048927 Bacteria 11142
721 Ga0496124_0008166 3300048927 Bacteria 10983
722 Ga0496124_0010290 3300048927 Bacteria 9492
723 Ga0496124_0013760 3300048927 Bacteria 7874
724 Ga0496124_0048184 3300048927 Bacteria 3643
725 Ga0496124_0081591 3300048927 Bacteria 2657
726 Ga0496124_0136492 3300048927 Bacteria 1941
727 Ga0496124_0160948 3300048927 Bacteria 1749
728 Ga0496124_0260254 3300048927 Bacteria 1277
729 Ga0496125_0001578 3300048928 Bacteria 32443
730 Ga0496125_0008486 3300048928 Bacteria 10751
731 Ga0496125_0031155 3300048928 Bacteria 4757
732 Ga0496125_0035635 3300048928 Bacteria 4359
733 Ga0496125_0037745 3300048928 Bacteria 4196
734 Ga0496125_0046617 3300048928 Bacteria 3635
735 Ga0496125_0109197 3300048928 Bacteria 2009
736 Ga0496125_0206908 3300048928 Bacteria 1278
737 Ga0496126_0004789 3300048929 Bacteria 15903
738 Ga0496126_0011313 3300048929 Bacteria 9256
739 Ga0496126_0044097 3300048929 Bacteria 4110
740 Ga0496126_0087985 3300048929 Bacteria 2737
741 Ga0495678_000031 3300049459 Bacteria 215528
742 Ga0495678_002391 3300049459 Bacteria 12835
743 Ga0495678_016115 3300049459 Bacteria 3426
744 Ga0495678_018587 3300049459 Bacteria 3120
745 Ga0495678_019146 3300049459 Bacteria 3061
746 Ga0495678_038471 3300049459 Bacteria 1935
747 Ga0495678_054293 3300049459 Bacteria 1534
748 Ga0495678_091212 3300049459 Bacteria 1073
749 Ga0495682_0002255 3300049460 Bacteria 9263
750 Ga0495682_0007653 3300049460 Bacteria 4287
751 Ga0495682_0011864 3300049460 Bacteria 3349
752 Ga0495682_0053676 3300049460 Bacteria 1463
753 Ga0495682_0080369 3300049460 Bacteria 1172
754 Ga0495682_0130893 3300049460 Bacteria 897
755 Ga0501036_0572564 3300049572 Bacteria 938
756 Ga0501037_0118024 3300049573 Bacteria 1909
757 Ga0501038_0050334 3300049574 Bacteria 3600
758 Ga0501040_0075444 3300049576 Unclassified 2330
759 Ga0501042_0027560 3300049578 Bacteria 3996
760 Ga0501042_0131366 3300049578 Unclassified 1805
761 Ga0501048_0042347 3300049582 Bacteria 3260
762 Ga0501071_0114807 3300049587 Bacteria 1992
763 Ga0501072_0164664 3300049588 Bacteria 1769
764 Ga0501075_0010719 3300049591 Bacteria 6453
765 Ga0501076_0086422 3300049592 Unclassified 2521
766 Ga0501076_0294829 3300049592 Unclassified 1329
767 Ga0501079_0032358 3300049741 Bacteria 4020
768 Ga0501080_0149400 3300049742 Bacteria 2160
769 Ga0501081_0573881 3300049743 Unclassified 843
770 Ga0501241_002124 3300049758 Bacteria 3878
771 Ga0500643_002976 3300053087 Bacteria 8393
772 Ga0500650_0086734 3300053098 Bacteria 1465
773 Ga0500572_004600 3300053111 Bacteria 3129
774 Ga0500573_0002559 3300053140 Bacteria 9137
775 Ga0500634_0002065 3300053161 Bacteria 8271
776 Ga0501084_0072561 3300054114 Unclassified 2883
777 Ga0501082_0406445 3300060353 Bacteria 1188
778 Ga0501082_0461427 3300060353 Unclassified 1110
779 Ga0530510_0050452 3300061734 Unclassified 3006
780 2511256705 2511231004 Bacteria 6669789
781 2511291803 2511231010 Bacteria 6373152
782 2511294913 2511231011 Bacteria 6149768
783 2511302974 2511231012 Bacteria 6738011
784 2511324099 2511231016 Bacteria 6704427
785 2511330554 2511231017 Bacteria 6503007
786 2511344049 2511231019 Bacteria 6520662
787 2511365006 2511231022 Bacteria 6719296
788 2511368196 2511231023 Bacteria 6808468
789 2511414973 2511231031 Bacteria 6558529
790 2511823334 2511231156 Bacteria 6845832
791 2512326399 2512047018 Bacteria 6663241
792 2524613639 2524023250 Bacteria 5457705
793 2555257608 2554235234 Bacteria 5762085
794 2583790717 2582580891 Bacteria 6800976
795 2599396774 2599185167 Bacteria 6353609
796 2599409582 2599185169 Bacteria 5441380
797 2599448752 2599185179 Bacteria 6611171
798 2599511489 2599185190 Bacteria 6285678
799 2599517571 2599185191 Bacteria 6297582
800 2599805129 2599185257 Bacteria 6492581
801 2599879939 2599185288 Bacteria 6666191
802 2599890863 2599185290 Bacteria 6289611
803 2599946134 2599185302 Bacteria 5954930
804 2599948446 2599185303 Bacteria 6512725
805 2599957273 2599185304 Bacteria 5951361
806 2599965536 2599185306 Bacteria 6637356
807 2599973206 2599185307 Bacteria 6194719
808 2599980073 2599185308 Bacteria 6621546
809 2599986180 2599185309 Bacteria 5969593
810 2599991947 2599185310 Bacteria 6014457
811 2600003024 2599185312 Bacteria 5912071
812 2600013985 2599185314 Bacteria 6621749
813 2600050476 2599185320 Bacteria 5963263
814 2600363839 2600254931 Bacteria 6734225
815 2601521924 2600255254 Bacteria 5281859
816 2601526949 2600255255 Bacteria 5282785
817 2601613779 2600255280 Bacteria 5292309
818 2601618502 2600255281 Bacteria 5288753
819 2601625800 2600255283 Bacteria 6061572
820 2601642870 2600255287 Bacteria 5210468
821 2601647741 2600255288 Bacteria 5282738
822 2601651927 2600255289 Bacteria 5281907
823 2601657254 2600255290 Bacteria 5282218
824 2601662691 2600255291 Bacteria 5217298
825 2601695648 2600255298 Bacteria 5215185
826 2601700324 2600255299 Bacteria 5218662
827 2601705051 2600255300 Bacteria 5287774
828 2601710080 2600255301 Bacteria 5280532
829 2601715092 2600255302 Bacteria 5288235
830 2601720675 2600255303 Bacteria 5219315
831 2601725498 2600255304 Bacteria 5283973
832 2601730040 2600255305 Bacteria 5282329
833 2601735057 2600255306 Bacteria 5281613
834 2601739742 2600255307 Bacteria 5439064
835 2601750231 2600255309 Bacteria 5431045
836 2601799819 2600255318 Bacteria 6383414
837 2602017484 2600255392 Bacteria 5437392
838 2603660065 2602042052 Bacteria 5215873
839 2603665341 2602042053 Bacteria 5214361
840 2603837424 2602042103 Bacteria 5284714
841 2603842500 2602042104 Bacteria 5281639
842 2603847573 2602042105 Bacteria 5282303
843 2603852644 2602042106 Bacteria 5282744
844 2603866623 2602042109 Bacteria 5152801
845 2603870697 2602042110 Bacteria 5283285
846 2603875632 2602042111 Bacteria 5212080
847 2606047888 2603880178 Bacteria 5283018
848 2606069772 2603880184 Bacteria 5217896
849 2606074382 2603880185 Bacteria 6379190
850 2606127245 2603880199 Bacteria 6377649
851 2606145607 2603880202 Bacteria 5284684
852 2606175290 2603880211 Bacteria 5284226
853 2621301239 2619619299 Bacteria 6649820
854 2624479105 2623620443 Bacteria 6427864
855 2624493899 2623620446 Bacteria 6500345
856 2637225502 2636415599 Bacteria 5718434
857 2644184879 2643221633 Bacteria 6733554
858 2644213542 2643221638 Bacteria 6579467
859 2644283489 2643221650 Bacteria 7029547
860 2671768137 2671180172 Bacteria 6495783
861 2676406730 2675903046 Bacteria 5451247
862 2678261883 2675903515 Bacteria 6580491
863 2715758826 2713897149 Bacteria 6506249
864 2718632994 2718217725 Bacteria 5758958
865 2738673992 2738541265 Bacteria 6594665
866 2738752385 2738541282 Bacteria 6593925
867 2738809405 2738541294 Bacteria 6925949
868 2738861426 2738541303 Bacteria 6591772
869 2738896765 2738541309 Bacteria 6926455
870 2739313069 2738543025 Bacteria 6600348
871 2743735933 2740892503 Bacteria 6855563
872 2745008232 2744054620 Bacteria 6551379
873 2774121484 2773857670 Bacteria 6407454
874 2777022858 2775507074 Bacteria 5532402
875 2784260177 2784132063 Bacteria 6262788
876 2784315628 2784132072 Bacteria 6596533
877 2794594698 2791355520 Bacteria 5948615
878 2808856746 2808606361 Bacteria 6136259
879 2808907739 2808606373 Bacteria 4423627
880 2808926927 2808606376 Bacteria 6248667
881 2808929359 2808606377 Bacteria 6646337
882 2808936805 2808606378 Bacteria 6177535
883 2808942732 2808606379 Bacteria 5022697
884 2808945968 2808606380 Bacteria 6248705
885 2808951533 2808606381 Bacteria 6646461
886 2808960878 2808606382 Bacteria 6841132
887 2808965133 2808606383 Bacteria 6138645
888 2809000025 2808606389 Bacteria 6138126
889 2809216070 2808606445 Bacteria 6057339
890 2817489399 2816332298 Bacteria 6852809
891 2819654667 2818991456 Bacteria 6123676
892 2825653392 2825651385 Bacteria 6715909
893 2834029311 2834028612 Bacteria 6354979
894 2842833066 2842832357 Bacteria 5959113
895 2842856952 2842854478 Bacteria 6143501
896 2860340387 2860339153 Bacteria 6846989
897 2860869355 2860867994 Bacteria 5645326
898 2878031063 2878029506 Bacteria 6418441
899 2880231977 2880230671 Bacteria 6140320
900 2904513638 2904513164 Bacteria 5476410
901 2913038229 2913036834 Bacteria 6704877
902 2919064422 2919063839 Bacteria 6302690
903 2919108806 2919108558 Bacteria 5897419
904 2919157028 2919155634 Bacteria 4860545
905 2919386103 2919385768 Bacteria 5897293
906 2919458045 2919456309 Bacteria 6586567
907 2919506349 2919501602 Bacteria 5286340
908 2919700183 2919697872 Bacteria 6553725
909 2923154943 2923153595 Bacteria 6870622
910 2926067419 2926063275 Bacteria 5285848
911 2929145676 2929144301 Bacteria 6622272
912 2931370992 2931369376 Bacteria 6847892
913 2931392330 2931390751 Bacteria 6273349
914 2931399708 2931396565 Bacteria 7251677
915 2939609135 2939607340 Bacteria 4719256
916 2945961582 2945961074 Bacteria 7342064
917 2946011513 2946006987 Bacteria 6705746
918 2946029549 2946027586 Bacteria 6049274
919 2969082498 2969079654 Bacteria 5439582
920 2969305888 2969304461 Bacteria 6601805
921 2971823375 2971820967 Bacteria 5823634
922 2974292497 2974289157 Bacteria 6080362
923 2984291088 2984286254 Bacteria 6702062
924 2984559556 2984559226 Bacteria 5683096
925 2984597642 2984595703 Bacteria 5682994
926 2988733218 2988728565 Bacteria 6124362
927 2998141310 2998139840 Bacteria 6073514
928 3007400461 3007395558 Bacteria 6755444
929 3007512682 3007511990 Bacteria 6481491
930 3007614924 3007614139 Bacteria 6053559
931 3007622039 3007619802 Bacteria 6411688
932 3007722961 3007718800 Bacteria 5971527
933 3007855921 3007855910 Bacteria 5637581
934 3007863454 3007861166 Bacteria 6045338
935 640487214 640427133 Bacteria 4567418
936 651175091 651053060 Bacteria 4689946
937 8015689175 8015687852 Bacteria 6613826
938 8019776850 8019775933 Bacteria 6858656
939 8029999436 8029995093 Bacteria 5990776
940 8054288823 8054285046 Bacteria 6919322
941 8054504893 8054503363 Bacteria 6101651
942 8055090523 8055087960 Bacteria 4784273
943 8055096811 8055092621 Bacteria 4873875
944 8055098680 8055097453 Bacteria 4865496
945 8055819353 8055817908 Bacteria 6609162
946 8056133260 8056131705 Bacteria 6107031
947 8056147603 8056143049 Bacteria 6307666
948 8056159465 8056155041 Bacteria 6486948
949 8056169746 8056166840 Bacteria 5820959
950 8056569973 8056569372 Bacteria 5997322
951 8057309341 8057304971 Bacteria 4649742
952 Ga0495605_0005553
953 MRS2a_Contig_26459
954 SwRhRL2b_contig_2696906
955 JGI25163J39215_1000348
956 JGI25164J39214_1000492
957 JGI25165J46597_1000934
958 rootL2_10085104
959 Ga0055526_1010871
960 Ga0055536_1000043
961 Ga0055536_1001093
962 Ga0055530_10000031
963 Ga0055530_10000527
964 Ga0055540_1000161
965 Ga0055540_1000230
966 Ga0055540_1001131
967 Ga0055531_10001267
968 Ga0065714_10003926
969 Ga0065714_10007790
970 Ga0065714_10026140
971 Ga0065714_10065072
972 Ga0065714_10069444
973 Ga0065714_10070935
974 Ga0065714_10073836
975 Ga0065704_10001387
976 Ga0065704_10095259
977 Ga0065704_10142008
978 Ga0070683_100000933
979 Ga0070670_100001105
980 Ga0070670_100009361
981 Ga0070661_100000238
982 Ga0070669_100000150
983 Ga0070709_10005206
984 Ga0068853_100005654
985 Ga0070665_100251663
986 Ga0070664_100000233
987 Ga0068854_100008578
988 Ga0068851_10000019
989 Ga0075364_10294879
990 Ga0075432_10006266
991 Ga0075436_100076706
992 Ga0079104_1028293
993 Ga0105251_10000021
994 Ga0105251_10000477
995 Ga0105251_10003438
996 Ga0105251_10003475
997 Ga0105251_10009892
998 Ga0105251_10017479
999 Ga0105244_10004276
1000 Ga0105244_10004598
1001 Ga0105244_10010896
1002 Ga0105244_10021200
1003 Ga0105244_10026476
1004 Ga0105244_10041414
1005 Ga0105244_10072395
1006 Ga0105244_10093887
1007 Ga0105250_10000072
1008 Ga0105250_10000118
1009 Ga0105250_10002765
1010 Ga0105250_10003322
1011 Ga0105250_10065396
1012 Ga0105247_10051921
1013 Ga0105243_10001564
1014 Ga0105243_10239895
1015 Ga0105242_10000719
1016 Ga0105248_10438648
1017 Ga0105237_10005805
1018 Ga0105246_10001731
1019 Ga0105246_10002504
1020 Ga0105246_10027971
1021 Ga0157345_1000135
1022 Ga0157373_10001969
1023 Ga0157373_10007934
1024 Ga0157373_10008873
1025 Ga0157373_10031446
1026 Ga0157373_10031805
1027 Ga0157373_10070927
1028 Ga0157373_10178320
1029 Ga0157373_10312720
1030 Ga0157371_10000281
1031 Ga0157371_10019377
1032 Ga0157371_10501813
1033 Ga0157370_10036138
1034 Ga0157370_10137734
1035 Ga0157369_10003643
1036 Ga0157369_10010141
1037 Ga0157369_10043869
1038 Ga0163162_10000835
1039 Ga0163162_10476875
1040 Ga0157372_10004247
1041 Ga0157375_10005491
1042 Ga0157375_10039221
1043 Ga0157375_10337200
1044 Ga0182008_10007260
1045 Ga0182008_10013392
1046 Ga0182006_1000736
1047 Ga0182006_1000816
1048 Ga0182006_1008689
1049 Ga0182006_1026599
1050 Ga0182007_10000110
1051 Ga0182007_10003838
1052 Ga0182005_1000627
1053 Ga0182005_1005224
1054 Ga0182005_1009143
1055 Ga0182005_1028956
1056 Ga0163161_10002537
1057 Ga0163161_10037516
1058 Ga0163161_10052017
1059 Ga0163161_10064796
1060 Ga0163161_10113280
1061 Ga0163161_10138446
1062 Ga0163161_10422888
1063 Ga0209760_100047
1064 Ga0207427_100029
1065 Ga0209437_100009
1066 Ga0209233_1000032
1067 Ga0209675_1002348
1068 Ga0209676_1000016
1069 Ga0209676_1000033
1070 Ga0209676_1000080
1071 Ga0209676_1002060
1072 Ga0209676_1011697
1073 Ga0209564_1001361
1074 Ga0209050_1000036
1075 Ga0209050_1000117
1076 Ga0209050_1000187
1077 Ga0209050_1001134
1078 Ga0209051_1000077
1079 Ga0209051_1000094
1080 Ga0209051_1000131
1081 Ga0209051_1007856
1082 Ga0209257_1000173
1083 Ga0207656_10000026
1084 Ga0207696_1000005
1085 Ga0207696_1000083
1086 Ga0207696_1000111
1087 Ga0207696_1018769
1088 Ga0207655_1000063
1089 Ga0207655_1000435
1090 Ga0207655_1000893
1091 Ga0207655_1002166
1092 Ga0207655_1002478
1093 Ga0207655_1002832
1094 Ga0207655_1006801
1095 Ga0207655_1007688
1096 Ga0207655_1014097
1097 Ga0207655_1025566
1098 Ga0207655_1074812
1099 Ga0207713_1000002
1100 Ga0207713_1000003
1101 Ga0207713_1000104
1102 Ga0207713_1000564
1103 Ga0207713_1001593
1104 Ga0207713_1002004
1105 Ga0207713_1002990
1106 Ga0207713_1003370
1107 Ga0207713_1005039
1108 Ga0207713_1018153
1109 Ga0207713_1065880
1110 Ga0207710_10141532
1111 Ga0207699_10028489
1112 Ga0207671_10000436
1113 Ga0207649_10000002
1114 Ga0207681_10000816
1115 Ga0207650_10000559
1116 Ga0207650_10000688
1117 Ga0207706_10005582
1118 Ga0207686_10005841
1119 Ga0207709_10000036
1120 Ga0207679_10000006
1121 Ga0207639_10002172
1122 Ga0209281_1004003
1123 Ga0209281_1014772
1124 Ga0209281_1014996
1125 Ga0209981_1004989
1126 Ga0209996_1001558
1127 Ga0209968_1006918
1128 Ga0209983_1001292
1129 Ga0209974_10028508
1130 Ga0207428_10038182
1131 Ga0207428_10097691
1132 Ga0268266_10011117
1133 Ga0307511_10181496
1134 Ga0316178_1175126
1135 Ga0265340_10100814
1136 Ga0307509_10045079
1137 Ga0307408_100009275
1138 Ga0307408_100047218
1139 Ga0307408_100331416
1140 Ga0307405_10000858
1141 Ga0307405_10034002
1142 Ga0307405_10042297
1143 Ga0307405_10062191
1144 Ga0307406_10605063
1145 Ga0307412_10013149
1146 Ga0307412_10021104
1147 Ga0307412_10039547
1148 Ga0307412_10043688
1149 Ga0307412_10044907
1150 Ga0307412_10055324
1151 Ga0307412_10103333
1152 Ga0307412_10248558
1153 Ga0307416_100040799
1154 Ga0307416_100312825
1155 Ga0307416_100375485
1156 Ga0307414_10059779
1157 Ga0307411_10015552
1158 Ga0307411_10619895
1159 Ga0307510_10017421
1160 Ga0307510_10107259
1161 Ga0237819_02852
1162 Ga0439438_000786
1163 Ga0439438_002348
1164 Ga0439438_003155
1165 Ga0439438_005775
1166 Ga0439438_007754
1167 Ga0439438_008580
1168 Ga0439447_000985
1169 Ga0439447_001411
1170 Ga0439447_006363
1171 Ga0439447_017819
1172 Ga0439447_046546
1173 Ga0439466_0001571
1174 Ga0439466_0001845
1175 Ga0439466_0001878
1176 Ga0439466_0008863
1177 Ga0439466_0027775
1178 Ga0439466_0028654
1179 Ga0439466_0040503
1180 Ga0439465_0007331
1181 Ga0439431_0010252
1182 Ga0439445_0044923
1183 Ga0439432_000245
1184 Ga0439432_007140
1185 Ga0439432_058764
1186 Ga0439432_063597
1187 Ga0439432_082494
1188 Ga0439451_001190
1189 Ga0439451_003397
1190 Ga0439451_010346
1191 Ga0439451_022469
1192 Ga0439452_001036
1193 Ga0439452_002729
1194 Ga0439452_004324
1195 Ga0439452_011394
1196 Ga0439452_020900
1197 Ga0439452_030104
1198 Ga0439456_001777
1199 Ga0439456_019846
1200 Ga0439456_031682
1201 Ga0439463_035129
1202 Ga0450911_001409
1203 Ga0450911_001580
1204 Ga0450919_002784
1205 Ga0450898_019753
1206 Ga0450900_006911
1207 Ga0450902_001140
1208 Ga0450903_003033
1209 Ga0450903_005287
1210 Ga0450904_002190
1211 Ga0450906_004159
1212 Ga0450906_012772
1213 Ga0450907_000173
1214 Ga0450907_004128
1215 Ga0450907_013304
1216 Ga0450910_006877
1217 Ga0450908_013324
1218 Ga0450909_004414
1219 Ga0439434_0001671
1220 Ga0439460_0032672
1221 Ga0439440_0001312
1222 Ga0439440_0010474
1223 Ga0495617_001213
1224 Ga0495617_007892
1225 Ga0495617_017307
1226 Ga0495617_020800
1227 Ga0495617_021109
1228 Ga0495617_035676
1229 Ga0495617_056969
1230 Ga0495627_000010
1231 Ga0495627_001278
1232 Ga0495627_002406
1233 Ga0495627_005495
1234 Ga0495603_0005877
1235 Ga0495603_0013688
1236 Ga0495590_0001626
1237 Ga0495590_0004603
1238 Ga0495590_0006841
1239 Ga0495590_0021548
1240 Ga0495591_000002
1241 Ga0495591_000452
1242 Ga0495591_001442
1243 Ga0495591_001556
1244 Ga0495591_002486
1245 Ga0495591_002525
1246 Ga0495591_003543
1247 Ga0495591_004698
1248 Ga0495591_007226
1249 Ga0495591_007825
1250 Ga0495591_008402
1251 Ga0495591_013459
1252 Ga0495591_029909
1253 Ga0495638_0005689
1254 Ga0495638_0006808
1255 Ga0495638_0007812
1256 Ga0495638_0032131
1257 Ga0495638_0046056
1258 Ga0495653_0015282
1259 Ga0495650_0003766
1260 Ga0495650_0004073
1261 Ga0495650_0005829
1262 Ga0495650_0019471
1263 Ga0495650_0026336
1264 Ga0495650_0028975
1265 Ga0495650_0032847
1266 Ga0495650_0049992
1267 Ga0495650_0056126
1268 Ga0495582_0016390
1269 Ga0495605_0008470
1270 Ga0495605_0010655
1271 Ga0495605_0022243
1272 Ga0495605_0037769
1273 Ga0495605_0104320
1274 Ga0495605_0130337
1275 Ga0495639_0000994
1276 Ga0495584_0001291
1277 Ga0495584_0002832
1278 Ga0495584_0009191
1279 Ga0495584_0010632
1280 Ga0495584_0017755
1281 Ga0495584_0022206
1282 Ga0495584_0067622
1283 Ga0495585_0007924
1284 Ga0495585_0011257
1285 Ga0495585_0017386
1286 Ga0495585_0019132
1287 Ga0495585_0076259
1288 Ga0495594_0006698
1289 Ga0495594_0058585
1290 Ga0495594_0123797
1291 Ga0495596_0001019
1292 Ga0495607_0000025
1293 Ga0495607_0000723
1294 Ga0495607_0003843
1295 Ga0495607_0005334
1296 Ga0495607_0009730
1297 Ga0495607_0016411
1298 Ga0495607_0024112
1299 Ga0495607_0039658
1300 Ga0495607_0063469
1301 Ga0495607_0069373
1302 Ga0495607_0070726
1303 Ga0495607_0074243
1304 Ga0495583_0001907
1305 Ga0495583_0008510
1306 Ga0495583_0008516
1307 Ga0495583_0018824
1308 Ga0495583_0029479
1309 Ga0495583_0035446
1310 Ga0495583_0098419
1311 Ga0495606_0000055
1312 Ga0495606_0001543
1313 Ga0495606_0011362
1314 Ga0495606_0011908
1315 Ga0495606_0016397
1316 Ga0495606_0016942
1317 Ga0495606_0020935
1318 Ga0495606_0031545
1319 Ga0495606_0035464
1320 Ga0495606_0058330
1321 Ga0495606_0101267
1322 Ga0495606_0227933
1323 Ga0495610_0004508
1324 Ga0495610_0008798
1325 Ga0495610_0010140
1326 Ga0495610_0016078
1327 Ga0495610_0023992
1328 Ga0495610_0049979
1329 Ga0495610_0095346
1330 Ga0495616_0003008
1331 Ga0495616_0006069
1332 Ga0495616_0007496
1333 Ga0495616_0009252
1334 Ga0495616_0009306
1335 Ga0495616_0012317
1336 Ga0495616_0025253
1337 Ga0495616_0029012
1338 Ga0495620_0001753
1339 Ga0495620_0002591
1340 Ga0495620_0007857
1341 Ga0495620_0008194
1342 Ga0495620_0008988
1343 Ga0495620_0014699
1344 Ga0495620_0021640
1345 Ga0495620_0022198
1346 Ga0495620_0031288
1347 Ga0495620_0034269
1348 Ga0495630_0032621
1349 Ga0495630_0075306
1350 Ga0495631_0003291
1351 Ga0495631_0019988
1352 Ga0495631_0023185
1353 Ga0495631_0090514
1354 Ga0495632_0003292
1355 Ga0495632_0005336
1356 Ga0495632_0009359
1357 Ga0495632_0010459
1358 Ga0495632_0013714
1359 Ga0495632_0017467
1360 Ga0495632_0027429
1361 Ga0495637_0000414
1362 Ga0495637_0002290
1363 Ga0495637_0002474
1364 Ga0495637_0005314
1365 Ga0495637_0014643
1366 Ga0495637_0021535
1367 Ga0495637_0093929
1368 Ga0495643_0006744
1369 Ga0495643_0010283
1370 Ga0495643_0013850
1371 Ga0495643_0017952
1372 Ga0495643_0021971
1373 Ga0495643_0027922
1374 Ga0495643_0150046
1375 Ga0495643_0186716
1376 Ga0495644_0001339
1377 Ga0495644_0002235
1378 Ga0495644_0003754
1379 Ga0495644_0011222
1380 Ga0495648_0001887
1381 Ga0495648_0006635
1382 Ga0495648_0007214
1383 Ga0495648_0013042
1384 Ga0495648_0016559
1385 Ga0495648_0024568
1386 Ga0495648_0032234
1387 Ga0495648_0036612
1388 Ga0495648_0048425
1389 Ga0495648_0092173
1390 Ga0495648_0121460
1391 Ga0495666_0010775
1392 Ga0495666_0024064
1393 Ga0495666_0050239
1394 Ga0495642_0000619
1395 Ga0495642_0018089
1396 Ga0495654_0000673
1397 Ga0495654_0001952
1398 Ga0495654_0023755
1399 Ga0495654_0027139
1400 Ga0495654_0027278
1401 Ga0495654_0037975
1402 Ga0495654_0093213
1403 Ga0495654_0097301
1404 Ga0495654_0098547
1405 Ga0495654_0128589
1406 Ga0495654_0179222
1407 Ga0495586_0101788
1408 Ga0495587_0024092
1409 Ga0495587_0092887
1410 Ga0495609_0000066
1411 Ga0495609_0004568
1412 Ga0495609_0005438
1413 Ga0495609_0006429
1414 Ga0495609_0009498
1415 Ga0495609_0018559
1416 Ga0495609_0024012
1417 Ga0495597_0000011
1418 Ga0495597_0006542
1419 Ga0495597_0008888
1420 Ga0495597_0017098
1421 Ga0495597_0018718
1422 Ga0495597_0020226
1423 Ga0495597_0021958
1424 Ga0495597_0063893
1425 Ga0495597_0083324
1426 Ga0495622_0002561
1427 Ga0495622_0003892
1428 Ga0495622_0008562
1429 Ga0495622_0028987
1430 Ga0495622_0052332
1431 Ga0495622_0053763
1432 Ga0495633_0010318
1433 Ga0495668_0002481
1434 Ga0495668_0008255
1435 Ga0495668_0016122
1436 Ga0495668_0185858
1437 Ga0495634_0020607
1438 Ga0495611_0000416
1439 Ga0495611_0002365
1440 Ga0495611_0003356
1441 Ga0495625_0000055
1442 Ga0495625_0020483
1443 Ga0495625_0022411
1444 Ga0495625_0048103
1445 Ga0495625_0084289
1446 Ga0495635_0006025
1447 Ga0495635_0018177
1448 Ga0495659_0001059
1449 Ga0495661_0000105
1450 Ga0495661_0000139
1451 Ga0495661_0002061
1452 Ga0495661_0004967
1453 Ga0495661_0025126
1454 Ga0495661_0033064
1455 Ga0495661_0034528
1456 Ga0495661_0071314
1457 Ga0495588_0020609
1458 Ga0495588_0137198
1459 Ga0495623_0016125
1460 Ga0495623_0018191
1461 Ga0495646_0024731
1462 Ga0495646_0025218
1463 Ga0495646_0028629
1464 Ga0495646_0098588
1465 Ga0495669_0001111
1466 Ga0495613_0049064
1467 Ga0495613_0061840
1468 Ga0495613_0114868
1469 Ga0495624_0007174
1470 Ga0495670_0004140
1471 Ga0495670_0006986
1472 Ga0495670_0042577
1473 Ga0495670_0122357
1474 Ga0495670_0136191
1475 Ga0495670_0209178
1476 Ga0495671_0000516
1477 Ga0495671_0001535
1478 Ga0495671_0007630
1479 Ga0495671_0019851
1480 Ga0495671_0022087
1481 Ga0495671_0033881
1482 Ga0495671_0039276
1483 Ga0495671_0041552
1484 Ga0495671_0103258
1485 Ga0495649_0002480
1486 Ga0495649_0006308
1487 Ga0495649_0007497
1488 Ga0495649_0013971
1489 Ga0495649_0026961
1490 Ga0495649_0037742
1491 Ga0495649_0052219
1492 Ga0495649_0055807
1493 Ga0495589_0000411
1494 Ga0495589_0001524
1495 Ga0495589_0004506
1496 Ga0495589_0007367
1497 Ga0495589_0026347
1498 Ga0495589_0028987
1499 Ga0495600_0016472
1500 Ga0495660_0000142
1501 Ga0495660_0001119
1502 Ga0495660_0007548
1503 Ga0495660_0008985
1504 Ga0495660_0012251
1505 Ga0495660_0012502
1506 Ga0495660_0012787
1507 Ga0495660_0015928
1508 Ga0495660_0022738
1509 Ga0495660_0030871
1510 Ga0495660_0054092
1511 Ga0495660_0073726
1512 Ga0495660_0085657
1513 Ga0495660_0093750
1514 Ga0495660_0136063
1515 Ga0495660_0170688
1516 Ga0495604_0028278
1517 Ga0495604_0054701
1518 Ga0495604_0331762
1519 Ga0495636_0012249
1520 Ga0495674_0027626
1521 Ga0495672_0003642
1522 Ga0495672_0004056
1523 Ga0495672_0007887
1524 Ga0495672_0015575
1525 Ga0495672_0022571
1526 Ga0495672_0029531
1527 Ga0495672_0036108
1528 Ga0495672_0039705
1529 Ga0495672_0059273
1530 Ga0495672_0110292
1531 Ga0495676_0000013
1532 Ga0495676_0019443
1533 Ga0495676_0079116
1534 Ga0495680_0009030
1535 Ga0495680_0052857
1536 Ga0495680_0072207
1537 Ga0495683_0005515
1538 Ga0495683_0016832
1539 Ga0495683_0019268
1540 Ga0495683_0022825
1541 Ga0495683_0039481
1542 Ga0495683_0193713
1543 Ga0495687_004474
1544 Ga0495687_025436
1545 Ga0495675_0303601
1546 Ga0495677_0003504
1547 Ga0495679_000129
1548 Ga0495679_004672
1549 Ga0495679_007869
1550 Ga0495679_007997
1551 Ga0495679_009193
1552 Ga0495679_009679
1553 Ga0495679_016820
1554 Ga0495679_016840
1555 Ga0495679_030636
1556 Ga0495679_069681
1557 Ga0495673_0000510
1558 Ga0495673_0000641
1559 Ga0495673_0001049
1560 Ga0495673_0003806
1561 Ga0495673_0004768
1562 Ga0495673_0006091
1563 Ga0495673_0008502
1564 Ga0495673_0009496
1565 Ga0495673_0010918
1566 Ga0495673_0013311
1567 Ga0495673_0013457
1568 Ga0495673_0014564
1569 Ga0495673_0014875
1570 Ga0495673_0022411
1571 Ga0495673_0025384
1572 Ga0495673_0026170
1573 Ga0495673_0029441
1574 Ga0495673_0036349
1575 Ga0495673_0039748
1576 Ga0495673_0041298
1577 Ga0495681_0001437
1578 Ga0495681_0004955
1579 Ga0495681_0005721
1580 Ga0495681_0007131
1581 Ga0495681_0007318
1582 Ga0495681_0015381
1583 Ga0495681_0018869
1584 Ga0495681_0038148
1585 Ga0495681_0105343
1586 Ga0495681_0155149
1587 Ga0495684_0010506
1588 Ga0495684_0022241
1589 Ga0495686_0015573
1590 Ga0495686_0017332
1591 Ga0495686_0021878
1592 Ga0495686_0031136
1593 Ga0495686_0040447
1594 Ga0495686_0179017
1595 Ga0495686_0229606
1596 Ga0495593_0011041
1597 Ga0495602_0015548
1598 Ga0495626_0000056
1599 Ga0495626_0001149
1600 Ga0495626_0001346
1601 Ga0495626_0002001
1602 Ga0495626_0003528
1603 Ga0495626_0007781
1604 Ga0495626_0010537
1605 Ga0495626_0011028
1606 Ga0495626_0022037
1607 Ga0495626_0048137
1608 Ga0495626_0133578
1609 Ga0496100_0032875
1610 Ga0496101_0012768
1611 Ga0496102_0004463
1612 Ga0496102_0275671
1613 Ga0496102_0622638
1614 Ga0496103_0013756
1615 Ga0496103_0140729
1616 Ga0496104_0034402
1617 Ga0496105_0092973
1618 Ga0496110_0322043
1619 Ga0496111_0327545
1620 Ga0496112_0257867
1621 Ga0496116_0006411
1622 Ga0496116_0014738
1623 Ga0496116_0022706
1624 Ga0496116_0032094
1625 Ga0496116_0046236
1626 Ga0496116_0088988
1627 Ga0496117_0002789
1628 Ga0496117_0008857
1629 Ga0496117_0011214
1630 Ga0496117_0017405
1631 Ga0496117_0025548
1632 Ga0496117_0028665
1633 Ga0496118_0016084
1634 Ga0496118_0018336
1635 Ga0496118_0025463
1636 Ga0496118_0029625
1637 Ga0496118_0051207
1638 Ga0496118_0123217
1639 Ga0496118_0170014
1640 Ga0496119_0000011
1641 Ga0496119_0000570
1642 Ga0496119_0030527
1643 Ga0496119_0046829
1644 Ga0496120_0000306
1645 Ga0496120_0008512
1646 Ga0496120_0020768
1647 Ga0496120_0031599
1648 Ga0496120_0033638
1649 Ga0496121_0005089
1650 Ga0496121_0008265
1651 Ga0496121_0018914
1652 Ga0496121_0023351
1653 Ga0496121_0048821
1654 Ga0496121_0071713
1655 Ga0496121_0501650
1656 Ga0496122_0000122
1657 Ga0496122_0037968
1658 Ga0496122_0043373
1659 Ga0496122_0057593
1660 Ga0496122_0063686
1661 Ga0496122_0092629
1662 Ga0496122_0102264
1663 Ga0496122_0201513
1664 Ga0496123_0000173
1665 Ga0496123_0009566
1666 Ga0496123_0044650
1667 Ga0496123_0074315
1668 Ga0496123_0097294
1669 Ga0496123_0192918
1670 Ga0496124_0007784
1671 Ga0496124_0007979
1672 Ga0496124_0008166
1673 Ga0496124_0010290
1674 Ga0496124_0013760
1675 Ga0496124_0048184
1676 Ga0496124_0081591
1677 Ga0496124_0136492
1678 Ga0496124_0160948
1679 Ga0496124_0260254
1680 Ga0496125_0001578
1681 Ga0496125_0008486
1682 Ga0496125_0031155
1683 Ga0496125_0035635
1684 Ga0496125_0037745
1685 Ga0496125_0046617
1686 Ga0496125_0109197
1687 Ga0496125_0206908
1688 Ga0496126_0004789
1689 Ga0496126_0011313
1690 Ga0496126_0044097
1691 Ga0496126_0087985
1692 Ga0495678_000031
1693 Ga0495678_002391
1694 Ga0495678_016115
1695 Ga0495678_018587
1696 Ga0495678_019146
1697 Ga0495678_038471
1698 Ga0495678_054293
1699 Ga0495678_091212
1700 Ga0495682_0002255
1701 Ga0495682_0007653
1702 Ga0495682_0011864
1703 Ga0495682_0053676
1704 Ga0495682_0080369
1705 Ga0495682_0130893
1706 Ga0501036_0572564
1707 Ga0501037_0118024
1708 Ga0501038_0050334
1709 Ga0501040_0075444
1710 Ga0501042_0027560
1711 Ga0501042_0131366
1712 Ga0501048_0042347
1713 Ga0501071_0114807
1714 Ga0501072_0164664
1715 Ga0501075_0010719
1716 Ga0501076_0086422
1717 Ga0501076_0294829
1718 Ga0501079_0032358
1719 Ga0501080_0149400
1720 Ga0501081_0573881
1721 Ga0501241_002124
1722 Ga0500643_002976
1723 Ga0500650_0086734
1724 Ga0500572_004600
1725 Ga0500573_0002559
1726 Ga0500634_0002065
1727 Ga0501084_0072561
1728 Ga0501082_0406445
1729 Ga0501082_0461427
1730 Ga0530510_0050452
1731 2511256705
1732 2511291803
1733 2511294913
1734 2511302974
1735 2511324099
1736 2511330554
1737 2511344049
1738 2511365006
1739 2511368196
1740 2511414973
1741 2511823334
1742 2512326399
1743 2524613639
1744 2555257608
1745 2583790717
1746 2599396774
1747 2599409582
1748 2599448752
1749 2599511489
1750 2599517571
1751 2599805129
1752 2599879939
1753 2599890863
1754 2599946134
1755 2599948446
1756 2599957273
1757 2599965536
1758 2599973206
1759 2599980073
1760 2599986180
1761 2599991947
1762 2600003024
1763 2600013985
1764 2600050476
1765 2600363839
1766 2601521924
1767 2601526949
1768 2601613779
1769 2601618502
1770 2601625800
1771 2601642870
1772 2601647741
1773 2601651927
1774 2601657254
1775 2601662691
1776 2601695648
1777 2601700324
1778 2601705051
1779 2601710080
1780 2601715092
1781 2601720675
1782 2601725498
1783 2601730040
1784 2601735057
1785 2601739742
1786 2601750231
1787 2601799819
1788 2602017484
1789 2603660065
1790 2603665341
1791 2603837424
1792 2603842500
1793 2603847573
1794 2603852644
1795 2603866623
1796 2603870697
1797 2603875632
1798 2606047888
1799 2606069772
1800 2606074382
1801 2606127245
1802 2606145607
1803 2606175290
1804 2621301239
1805 2624479105
1806 2624493899
1807 2637225502
1808 2644184879
1809 2644213542
1810 2644283489
1811 2671768137
1812 2676406730
1813 2678261883
1814 2715758826
1815 2718632994
1816 2738673992
1817 2738752385
1818 2738809405
1819 2738861426
1820 2738896765
1821 2739313069
1822 2743735933
1823 2745008232
1824 2774121484
1825 2777022858
1826 2784260177
1827 2784315628
1828 2794594698
1829 2808856746
1830 2808907739
1831 2808926927
1832 2808929359
1833 2808936805
1834 2808942732
1835 2808945968
1836 2808951533
1837 2808960878
1838 2808965133
1839 2809000025
1840 2809216070
1841 2817489399
1842 2819654667
1843 2825653392
1844 2834029311
1845 2842833066
1846 2842856952
1847 2860340387
1848 2860869355
1849 2878031063
1850 2880231977
1851 2904513638
1852 2913038229
1853 2919064422
1854 2919108806
1855 2919157028
1856 2919386103
1857 2919458045
1858 2919506349
1859 2919700183
1860 2923154943
1861 2926067419
1862 2929145676
1863 2931370992
1864 2931392330
1865 2931399708
1866 2939609135
1867 2945961582
1868 2946011513
1869 2946029549
1870 2969082498
1871 2969305888
1872 2971823375
1873 2974292497
1874 2984291088
1875 2984559556
1876 2984597642
1877 2988733218
1878 2998141310
1879 3007400461
1880 3007512682
1881 3007614924
1882 3007622039
1883 3007722961
1884 3007855921
1885 3007863454
1886 640487214
1887 651175091
1888 8015689175
1889 8019776850
1890 8029999436
1891 8054288823
1892 8054504893
1893 8055090523
1894 8055096811
1895 8055098680
1896 8055819353
1897 8056133260
1898 8056147603
1899 8056159465
1900 8056169746
1901 8056569973
1902 8057309341

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

47

274

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

267

0.75

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

49

280

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.978 2 266
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9706 2 266
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9653 2 268
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9439 2 268
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9217 9 266
ID Description Score Start End Superfamily
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9704 2 266 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9675 2 268 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9629 2 266 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9457 2 268 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9214 9 266 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0T6VL91-F1-model_v4 deleted 0.9962 1 266
AF-A0A2Z4GHL9-F1-model_v4 3-oxoadipate enol-lactonase 0.9845 11 268 GO:0016020
GO:0042952
GO:0047570
AF-A0A2N5C326-F1-model_v4 AraC family transcriptional regulator 0.9817 3 267 GO:0042952
GO:0047570
GO:0051920
AF-A0A0T6VL91-F1-model_v4 deleted 0.9812 1 266
AF-A0A2V2BBY9-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.981 11 265 GO:0042952
GO:0047570
GO:0047575
GO:0051920

Map