F486629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 952 | 373 | 1904 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300042147|Ga0450910_000024|Ga0450910_000024_353_1399 |
| Length | 348 |
| Sequence | MARNGGITMKTALQHSKTGKTHRRLLGSSILALSLFGALGVAHGQSTSAAQPTANKSGVTHTTPSPFGALKHIKAGLLDVAYAETGPADGPVVILLHGWPYDIHSYDEVAPLLAAKGYRVLMPYARGYGDTHFLSEKTLRNGQPAALASDVIDFMDALKIKQAVLGGYDWGARSADIVAALWPERVKALVAVSGYLIGNQAAGQNPLPPKAELQWWYQFYFATDRGRAGYEKNTHDFAKLIWQLASPKWAFDDAEITVFNYRWRLGLVQGETRYDALEQKLATAPPISVPTITLEGDANGAPHPAPEDYAKRFTGKYEFRLISGGIGHNLPQEDPQAFAKAVIDADHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 19 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 20 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 21 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 22 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 23 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 24 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 25 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 26 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 27 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 73 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 74 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 77 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 78 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 79 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 81 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 82 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 83 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 84 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 85 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 86 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 87 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 88 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 89 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 90 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 91 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 92 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 93 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 94 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 95 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 96 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 97 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 98 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 99 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 100 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 101 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 102 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 103 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 104 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 193 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 194 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 195 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 217 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 218 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 219 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 220 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 221 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 222 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 223 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 224 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 225 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 226 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 227 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 228 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 229 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 230 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 231 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 232 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 233 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 234 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 235 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 236 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 237 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 238 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 239 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 240 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 241 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 242 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 243 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 244 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 245 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 246 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 247 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 248 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 249 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 250 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 251 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 252 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 253 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 254 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 255 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 256 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 257 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 258 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 259 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 260 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 261 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 262 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 263 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 264 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 265 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 266 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 267 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 268 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 269 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 270 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 271 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 272 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 273 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 274 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 275 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 276 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 277 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 278 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 279 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 280 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 281 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 282 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 283 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 284 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 285 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 286 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 287 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 288 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 289 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 290 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 291 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 292 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 293 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 294 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 295 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 296 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 297 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 298 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 299 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 300 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 301 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 302 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 303 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 304 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 305 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 306 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 307 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 308 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 309 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 310 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 311 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 312 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 313 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 314 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 315 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 316 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 317 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 318 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 319 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 320 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 321 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 322 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 323 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 324 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 325 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 326 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 327 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 328 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 329 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 330 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 331 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 332 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 333 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 334 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 335 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 336 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 337 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 338 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 339 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 340 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 341 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 342 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 343 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 344 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 345 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 346 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 347 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 348 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 349 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 350 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 351 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 352 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 353 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 354 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 355 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 356 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 357 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 358 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 359 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 360 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 361 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 362 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 363 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 364 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 365 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 366 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 367 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 368 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 369 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 370 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 371 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 372 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 373 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.88 |
| Metatranscriptomes | 0 |
| Isolates | 17.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.15 |
| Nodule | 2.42 |
| Rhizoplane | 5.46 |
| Rhizosphere | 75.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450910_000024 | 3300042147 | Bacteria | 22666 |
| 2 | MRS2a_Contig_1678 | 2124908027 | Bacteria | 5178 |
| 3 | SwRhRL2b_contig_2455006 | 2162886007 | Bacteria | 7159 |
| 4 | JGI25162J39368_1000013 | 3300002737 | Bacteria | 343384 |
| 5 | JGI25163J39215_1000157 | 3300002771 | Bacteria | 26769 |
| 6 | JGI25164J39214_1000005 | 3300002772 | Bacteria | 343384 |
| 7 | JGI25165J46597_1000099 | 3300003214 | Bacteria | 158550 |
| 8 | Ga0055536_1000013 | 3300003781 | Bacteria | 240693 |
| 9 | Ga0055536_1000088 | 3300003781 | Bacteria | 79565 |
| 10 | Ga0055536_1000262 | 3300003781 | Bacteria | 41063 |
| 11 | Ga0055530_10000016 | 3300003791 | Bacteria | 146874 |
| 12 | Ga0055530_10000087 | 3300003791 | Bacteria | 79565 |
| 13 | Ga0055530_10000103 | 3300003791 | Bacteria | 72498 |
| 14 | Ga0055530_10001656 | 3300003791 | Bacteria | 15860 |
| 15 | Ga0055530_10002474 | 3300003791 | Bacteria | 11850 |
| 16 | Ga0055530_10022040 | 3300003791 | Bacteria | 1863 |
| 17 | Ga0055540_1000008 | 3300003792 | Bacteria | 309635 |
| 18 | Ga0055540_1000048 | 3300003792 | Bacteria | 146874 |
| 19 | Ga0055531_10000182 | 3300003794 | Bacteria | 70786 |
| 20 | Ga0055531_10002226 | 3300003794 | Bacteria | 13163 |
| 21 | Ga0065714_10003199 | 3300005288 | Bacteria | 10790 |
| 22 | Ga0065714_10008363 | 3300005288 | Bacteria | 3198 |
| 23 | Ga0065714_10068620 | 3300005288 | Bacteria | 4627 |
| 24 | Ga0065714_10077065 | 3300005288 | Bacteria | 2717 |
| 25 | Ga0065704_10005347 | 3300005289 | Bacteria | 2923 |
| 26 | Ga0065704_10093687 | 3300005289 | Bacteria | 2583 |
| 27 | Ga0070669_100013571 | 3300005353 | Bacteria | 5792 |
| 28 | Ga0070669_100027628 | 3300005353 | Bacteria | 4084 |
| 29 | Ga0068853_100008887 | 3300005539 | Bacteria | 8084 |
| 30 | Ga0068855_100115595 | 3300005563 | Bacteria | 3075 |
| 31 | Ga0070664_100000024 | 3300005564 | Bacteria | 94521 |
| 32 | Ga0068851_10038578 | 3300005834 | Bacteria | 2397 |
| 33 | Ga0075364_10028129 | 3300006051 | Bacteria | 3597 |
| 34 | Ga0075432_10000700 | 3300006058 | Bacteria | 10339 |
| 35 | Ga0075432_10005082 | 3300006058 | Bacteria | 4481 |
| 36 | Ga0075432_10028232 | 3300006058 | Bacteria | 1935 |
| 37 | Ga0075432_10061129 | 3300006058 | Bacteria | 1341 |
| 38 | Ga0075362_10032169 | 3300006177 | Bacteria | 2274 |
| 39 | Ga0075369_10032178 | 3300006186 | Bacteria | 2218 |
| 40 | Ga0075434_100000694 | 3300006871 | Bacteria | 26302 |
| 41 | Ga0079104_1000094 | 3300006946 | Bacteria | 130202 |
| 42 | Ga0079104_1000537 | 3300006946 | Bacteria | 40039 |
| 43 | Ga0079104_1001585 | 3300006946 | Bacteria | 14849 |
| 44 | Ga0079104_1002557 | 3300006946 | Bacteria | 9593 |
| 45 | Ga0079104_1015347 | 3300006946 | Bacteria | 2272 |
| 46 | Ga0099826_10037688 | 3300006948 | Bacteria | 3406 |
| 47 | Ga0075435_100036120 | 3300007076 | Bacteria | 3925 |
| 48 | Ga0105251_10000363 | 3300009011 | Bacteria | 44493 |
| 49 | Ga0105251_10003033 | 3300009011 | Bacteria | 12511 |
| 50 | Ga0105251_10007455 | 3300009011 | Bacteria | 6739 |
| 51 | Ga0105251_10033401 | 3300009011 | Bacteria | 2555 |
| 52 | Ga0105251_10037418 | 3300009011 | Bacteria | 2382 |
| 53 | Ga0105251_10127775 | 3300009011 | Bacteria | 1153 |
| 54 | Ga0105244_10000449 | 3300009036 | Bacteria | 37516 |
| 55 | Ga0105244_10022163 | 3300009036 | Bacteria | 3498 |
| 56 | Ga0105244_10027757 | 3300009036 | Bacteria | 3047 |
| 57 | Ga0105244_10029457 | 3300009036 | Bacteria | 2933 |
| 58 | Ga0105244_10037921 | 3300009036 | Bacteria | 2516 |
| 59 | Ga0105244_10065924 | 3300009036 | Bacteria | 1813 |
| 60 | Ga0105250_10000015 | 3300009092 | Bacteria | 262683 |
| 61 | Ga0105250_10000155 | 3300009092 | Bacteria | 59663 |
| 62 | Ga0105250_10013848 | 3300009092 | Bacteria | 3321 |
| 63 | Ga0105250_10022004 | 3300009092 | Bacteria | 2572 |
| 64 | Ga0105250_10061001 | 3300009092 | Bacteria | 1516 |
| 65 | Ga0105240_10094827 | 3300009093 | Bacteria | 3639 |
| 66 | Ga0105243_10000060 | 3300009148 | Bacteria | 128124 |
| 67 | Ga0105242_10067130 | 3300009176 | Bacteria | 2964 |
| 68 | Ga0105242_10142055 | 3300009176 | Bacteria | 2084 |
| 69 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 70 | Ga0105246_10000723 | 3300011119 | Bacteria | 18714 |
| 71 | Ga0105246_10027075 | 3300011119 | Bacteria | 3753 |
| 72 | Ga0157345_1000122 | 3300012498 | Bacteria | 15294 |
| 73 | Ga0157373_10000374 | 3300013100 | Bacteria | 35786 |
| 74 | Ga0157373_10000874 | 3300013100 | Bacteria | 23320 |
| 75 | Ga0157373_10010544 | 3300013100 | Bacteria | 6801 |
| 76 | Ga0157373_10012407 | 3300013100 | Bacteria | 6266 |
| 77 | Ga0157373_10045459 | 3300013100 | Bacteria | 3134 |
| 78 | Ga0157373_10075534 | 3300013100 | Bacteria | 2377 |
| 79 | Ga0157371_10003129 | 3300013102 | Bacteria | 15287 |
| 80 | Ga0157371_10003297 | 3300013102 | Bacteria | 14774 |
| 81 | Ga0157370_10009404 | 3300013104 | Bacteria | 10449 |
| 82 | Ga0157370_10011916 | 3300013104 | Bacteria | 9066 |
| 83 | Ga0157370_10022555 | 3300013104 | Bacteria | 6264 |
| 84 | Ga0157370_10035411 | 3300013104 | Bacteria | 4852 |
| 85 | Ga0157370_10057151 | 3300013104 | Bacteria | 3711 |
| 86 | Ga0157370_10138035 | 3300013104 | Bacteria | 2272 |
| 87 | Ga0157370_10147558 | 3300013104 | Bacteria | 2190 |
| 88 | Ga0157369_10001093 | 3300013105 | Bacteria | 33888 |
| 89 | Ga0157369_10002233 | 3300013105 | Bacteria | 23310 |
| 90 | Ga0157369_10002926 | 3300013105 | Bacteria | 20415 |
| 91 | Ga0157369_10030798 | 3300013105 | Bacteria | 5914 |
| 92 | Ga0157369_10269774 | 3300013105 | Bacteria | 1773 |
| 93 | Ga0163162_10000137 | 3300013306 | Bacteria | 66670 |
| 94 | Ga0163162_10007127 | 3300013306 | Bacteria | 10850 |
| 95 | Ga0163162_10458734 | 3300013306 | Bacteria | 1406 |
| 96 | Ga0157372_10001800 | 3300013307 | Bacteria | 23279 |
| 97 | Ga0157375_10000050 | 3300013308 | Bacteria | 134913 |
| 98 | Ga0157375_10047614 | 3300013308 | Bacteria | 4189 |
| 99 | Ga0182008_10000496 | 3300014497 | Bacteria | 29685 |
| 100 | Ga0182008_10001714 | 3300014497 | Bacteria | 14388 |
| 101 | Ga0182008_10002492 | 3300014497 | Bacteria | 11504 |
| 102 | Ga0182008_10003801 | 3300014497 | Bacteria | 8973 |
| 103 | Ga0182008_10004088 | 3300014497 | Bacteria | 8606 |
| 104 | Ga0182008_10008762 | 3300014497 | Bacteria | 5498 |
| 105 | Ga0182008_10012414 | 3300014497 | Bacteria | 4496 |
| 106 | Ga0182008_10067814 | 3300014497 | Bacteria | 1755 |
| 107 | Ga0182008_10078557 | 3300014497 | Bacteria | 1623 |
| 108 | Ga0182006_1000396 | 3300015261 | Bacteria | 35562 |
| 109 | Ga0182006_1001125 | 3300015261 | Bacteria | 17007 |
| 110 | Ga0182006_1010118 | 3300015261 | Bacteria | 4200 |
| 111 | Ga0182006_1015839 | 3300015261 | Bacteria | 3225 |
| 112 | Ga0182006_1017555 | 3300015261 | Bacteria | 3038 |
| 113 | Ga0182007_10000303 | 3300015262 | Bacteria | 31833 |
| 114 | Ga0182007_10000394 | 3300015262 | Bacteria | 27020 |
| 115 | Ga0182007_10003110 | 3300015262 | Bacteria | 7987 |
| 116 | Ga0182005_1001258 | 3300015265 | Bacteria | 10431 |
| 117 | Ga0182005_1007476 | 3300015265 | Bacteria | 3275 |
| 118 | Ga0182005_1008300 | 3300015265 | Bacteria | 3066 |
| 119 | Ga0182005_1010822 | 3300015265 | Bacteria | 2616 |
| 120 | Ga0163161_10000054 | 3300017792 | Bacteria | 117153 |
| 121 | Ga0163161_10002749 | 3300017792 | Bacteria | 12506 |
| 122 | Ga0163161_10016214 | 3300017792 | Bacteria | 5200 |
| 123 | Ga0163161_10042217 | 3300017792 | Bacteria | 3280 |
| 124 | Ga0163161_10122984 | 3300017792 | Bacteria | 1951 |
| 125 | Ga0209760_100035 | 3300025207 | Bacteria | 132204 |
| 126 | Ga0209563_102378 | 3300025230 | Bacteria | 4284 |
| 127 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 128 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 129 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 130 | Ga0209675_1009989 | 3300025291 | Bacteria | 3288 |
| 131 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 132 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 133 | Ga0209676_1000050 | 3300025292 | Bacteria | 398350 |
| 134 | Ga0209676_1000113 | 3300025292 | Bacteria | 207931 |
| 135 | Ga0209676_1002427 | 3300025292 | Bacteria | 13272 |
| 136 | Ga0209676_1005636 | 3300025292 | Bacteria | 6457 |
| 137 | Ga0209676_1008145 | 3300025292 | Bacteria | 4743 |
| 138 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 139 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 140 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 141 | Ga0209050_1000126 | 3300025298 | Bacteria | 188438 |
| 142 | Ga0209050_1000321 | 3300025298 | Bacteria | 96465 |
| 143 | Ga0209050_1001041 | 3300025298 | Bacteria | 34372 |
| 144 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 145 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 146 | Ga0209051_1000052 | 3300025303 | Bacteria | 283346 |
| 147 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 148 | Ga0209257_1000155 | 3300025304 | Bacteria | 182928 |
| 149 | Ga0209257_1000256 | 3300025304 | Bacteria | 123057 |
| 150 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 151 | Ga0207696_1000223 | 3300025711 | Bacteria | 82090 |
| 152 | Ga0207696_1001477 | 3300025711 | Bacteria | 12721 |
| 153 | Ga0207696_1006322 | 3300025711 | Bacteria | 4784 |
| 154 | Ga0207696_1012781 | 3300025711 | Bacteria | 2955 |
| 155 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 156 | Ga0207655_1000076 | 3300025728 | Bacteria | 226359 |
| 157 | Ga0207655_1002401 | 3300025728 | Bacteria | 15260 |
| 158 | Ga0207655_1004390 | 3300025728 | Bacteria | 10017 |
| 159 | Ga0207655_1006108 | 3300025728 | Bacteria | 8041 |
| 160 | Ga0207655_1008249 | 3300025728 | Bacteria | 6637 |
| 161 | Ga0207655_1018119 | 3300025728 | Bacteria | 3755 |
| 162 | Ga0207655_1024886 | 3300025728 | Bacteria | 2922 |
| 163 | Ga0207713_1000073 | 3300025735 | Bacteria | 181519 |
| 164 | Ga0207713_1001910 | 3300025735 | Bacteria | 15777 |
| 165 | Ga0207713_1002185 | 3300025735 | Bacteria | 14501 |
| 166 | Ga0207713_1004432 | 3300025735 | Bacteria | 9102 |
| 167 | Ga0207713_1006184 | 3300025735 | Bacteria | 7346 |
| 168 | Ga0207713_1009642 | 3300025735 | Bacteria | 5417 |
| 169 | Ga0207713_1019313 | 3300025735 | Bacteria | 3340 |
| 170 | Ga0207713_1024366 | 3300025735 | Bacteria | 2824 |
| 171 | Ga0207713_1025331 | 3300025735 | Bacteria | 2743 |
| 172 | Ga0207695_10068337 | 3300025913 | Bacteria | 3640 |
| 173 | Ga0207671_10000474 | 3300025914 | Bacteria | 54456 |
| 174 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 175 | Ga0207681_10005164 | 3300025923 | Bacteria | 8018 |
| 176 | Ga0207681_10059355 | 3300025923 | Bacteria | 2622 |
| 177 | Ga0207706_10009243 | 3300025933 | Bacteria | 9058 |
| 178 | Ga0207686_10024380 | 3300025934 | Bacteria | 3506 |
| 179 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 180 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 181 | Ga0207639_10068990 | 3300026041 | Bacteria | 2757 |
| 182 | Ga0209281_1000046 | 3300027111 | Bacteria | 327042 |
| 183 | Ga0209281_1000143 | 3300027111 | Bacteria | 174070 |
| 184 | Ga0209281_1000212 | 3300027111 | Bacteria | 130216 |
| 185 | Ga0209281_1005093 | 3300027111 | Bacteria | 3732 |
| 186 | Ga0207428_10022576 | 3300027907 | Bacteria | 5307 |
| 187 | Ga0207428_10047480 | 3300027907 | Bacteria | 3447 |
| 188 | Ga0207428_10061117 | 3300027907 | Bacteria | 2984 |
| 189 | Ga0207428_10075095 | 3300027907 | Bacteria | 2650 |
| 190 | Ga0207428_10085594 | 3300027907 | Bacteria | 2454 |
| 191 | Ga0307511_10032874 | 3300030521 | Bacteria | 4594 |
| 192 | Ga0316178_1159482 | 3300030735 | Bacteria | 22902 |
| 193 | Ga0307408_100021029 | 3300031548 | Bacteria | 4410 |
| 194 | Ga0307408_100035970 | 3300031548 | Bacteria | 3477 |
| 195 | Ga0307412_10001360 | 3300031911 | Bacteria | 13591 |
| 196 | Ga0307412_10045661 | 3300031911 | Bacteria | 2865 |
| 197 | Ga0307416_100299513 | 3300032002 | Bacteria | 1597 |
| 198 | Ga0307414_10004343 | 3300032004 | Bacteria | 7695 |
| 199 | Ga0307414_10271898 | 3300032004 | Bacteria | 1419 |
| 200 | Ga0307411_10006051 | 3300032005 | Bacteria | 6015 |
| 201 | Ga0307411_10129347 | 3300032005 | Bacteria | 1843 |
| 202 | Ga0373941_0021623 | 3300035115 | Bacteria | 1818 |
| 203 | Ga0373942_0016077 | 3300035207 | Bacteria | 1832 |
| 204 | Ga0373931_0016616 | 3300035691 | Bacteria | 3626 |
| 205 | Ga0237819_00218 | 3300038705 | Bacteria | 20786 |
| 206 | Ga0237819_00520 | 3300038705 | Bacteria | 12904 |
| 207 | Ga0439438_000109 | 3300041405 | Bacteria | 38057 |
| 208 | Ga0439438_000129 | 3300041405 | Bacteria | 34152 |
| 209 | Ga0439438_000587 | 3300041405 | Bacteria | 16488 |
| 210 | Ga0439438_002048 | 3300041405 | Bacteria | 8783 |
| 211 | Ga0439438_002096 | 3300041405 | Bacteria | 8608 |
| 212 | Ga0439438_005891 | 3300041405 | Bacteria | 4432 |
| 213 | Ga0439447_000131 | 3300041407 | Bacteria | 25696 |
| 214 | Ga0439447_000152 | 3300041407 | Bacteria | 23926 |
| 215 | Ga0439447_001180 | 3300041407 | Bacteria | 9514 |
| 216 | Ga0439447_023297 | 3300041407 | Bacteria | 1614 |
| 217 | Ga0439466_0000118 | 3300041411 | Bacteria | 30812 |
| 218 | Ga0439466_0001046 | 3300041411 | Bacteria | 10684 |
| 219 | Ga0439466_0004195 | 3300041411 | Bacteria | 5559 |
| 220 | Ga0439466_0022937 | 3300041411 | Bacteria | 2198 |
| 221 | Ga0439466_0041876 | 3300041411 | Bacteria | 1526 |
| 222 | Ga0439431_0000018 | 3300041997 | Bacteria | 26379 |
| 223 | Ga0439445_0000461 | 3300042004 | Bacteria | 8252 |
| 224 | Ga0439432_010385 | 3300042006 | Bacteria | 3226 |
| 225 | Ga0439432_010607 | 3300042006 | Bacteria | 3185 |
| 226 | Ga0439432_011068 | 3300042006 | Bacteria | 3110 |
| 227 | Ga0439451_000604 | 3300042009 | Bacteria | 6809 |
| 228 | Ga0439452_000045 | 3300042010 | Bacteria | 131508 |
| 229 | Ga0439452_000046 | 3300042010 | Bacteria | 130842 |
| 230 | Ga0439452_001850 | 3300042010 | Bacteria | 8181 |
| 231 | Ga0439452_004581 | 3300042010 | Bacteria | 4603 |
| 232 | Ga0439452_011795 | 3300042010 | Bacteria | 2503 |
| 233 | Ga0439452_018562 | 3300042010 | Bacteria | 1850 |
| 234 | Ga0439452_031424 | 3300042010 | Bacteria | 1303 |
| 235 | Ga0439456_002046 | 3300042013 | Bacteria | 4057 |
| 236 | Ga0439456_005303 | 3300042013 | Bacteria | 2617 |
| 237 | Ga0439456_007189 | 3300042013 | Bacteria | 2283 |
| 238 | Ga0439463_006639 | 3300042016 | Bacteria | 2865 |
| 239 | Ga0450911_000095 | 3300042115 | Bacteria | 35787 |
| 240 | Ga0450911_000212 | 3300042115 | Bacteria | 22778 |
| 241 | Ga0450911_001378 | 3300042115 | Bacteria | 5682 |
| 242 | Ga0450902_001250 | 3300042137 | Bacteria | 3422 |
| 243 | Ga0450902_008530 | 3300042137 | Bacteria | 1602 |
| 244 | Ga0450902_017532 | 3300042137 | Bacteria | 1171 |
| 245 | Ga0450903_004432 | 3300042138 | Bacteria | 2392 |
| 246 | Ga0450903_014349 | 3300042138 | Bacteria | 1254 |
| 247 | Ga0450903_014665 | 3300042138 | Bacteria | 1239 |
| 248 | Ga0450904_002992 | 3300042139 | Bacteria | 1897 |
| 249 | Ga0450906_000046 | 3300042145 | Bacteria | 19736 |
| 250 | Ga0450907_000010 | 3300042146 | Bacteria | 95376 |
| 251 | Ga0450908_015220 | 3300042184 | Bacteria | 1378 |
| 252 | Ga0450909_002260 | 3300042185 | Bacteria | 2725 |
| 253 | Ga0439434_0002424 | 3300042435 | Bacteria | 5424 |
| 254 | Ga0439460_0000683 | 3300042461 | Bacteria | 7502 |
| 255 | Ga0466957_0050527 | 3300044842 | Bacteria | 2530 |
| 256 | Ga0495617_000202 | 3300046452 | Bacteria | 37705 |
| 257 | Ga0495617_010496 | 3300046452 | Bacteria | 3172 |
| 258 | Ga0495617_011719 | 3300046452 | Bacteria | 2990 |
| 259 | Ga0495617_018039 | 3300046452 | Bacteria | 2385 |
| 260 | Ga0495617_020166 | 3300046452 | Bacteria | 2252 |
| 261 | Ga0495617_043809 | 3300046452 | Bacteria | 1494 |
| 262 | Ga0495617_057074 | 3300046452 | Bacteria | 1294 |
| 263 | Ga0495627_000133 | 3300046453 | Bacteria | 89977 |
| 264 | Ga0495627_001238 | 3300046453 | Bacteria | 15892 |
| 265 | Ga0495627_001779 | 3300046453 | Bacteria | 11547 |
| 266 | Ga0495627_002212 | 3300046453 | Bacteria | 9673 |
| 267 | Ga0495627_003726 | 3300046453 | Bacteria | 6594 |
| 268 | Ga0495627_004458 | 3300046453 | Bacteria | 5853 |
| 269 | Ga0495603_0001109 | 3300046455 | Bacteria | 15640 |
| 270 | Ga0495603_0011611 | 3300046455 | Bacteria | 5329 |
| 271 | Ga0495603_0062626 | 3300046455 | Bacteria | 2196 |
| 272 | Ga0495590_0000050 | 3300046457 | Bacteria | 105727 |
| 273 | Ga0495590_0000153 | 3300046457 | Bacteria | 41540 |
| 274 | Ga0495590_0003510 | 3300046457 | Bacteria | 6402 |
| 275 | Ga0495590_0026640 | 3300046457 | Bacteria | 2029 |
| 276 | Ga0495590_0028305 | 3300046457 | Bacteria | 1965 |
| 277 | Ga0495591_000074 | 3300046458 | Bacteria | 114062 |
| 278 | Ga0495591_000143 | 3300046458 | Bacteria | 76321 |
| 279 | Ga0495591_000151 | 3300046458 | Bacteria | 73402 |
| 280 | Ga0495591_000197 | 3300046458 | Bacteria | 61590 |
| 281 | Ga0495591_000263 | 3300046458 | Bacteria | 49869 |
| 282 | Ga0495591_000427 | 3300046458 | Bacteria | 34759 |
| 283 | Ga0495591_003910 | 3300046458 | Bacteria | 7507 |
| 284 | Ga0495591_004299 | 3300046458 | Bacteria | 7025 |
| 285 | Ga0495591_006614 | 3300046458 | Bacteria | 5085 |
| 286 | Ga0495591_007409 | 3300046458 | Bacteria | 4669 |
| 287 | Ga0495591_015129 | 3300046458 | Bacteria | 2736 |
| 288 | Ga0495591_022016 | 3300046458 | Bacteria | 2067 |
| 289 | Ga0495591_045336 | 3300046458 | Bacteria | 1226 |
| 290 | Ga0495629_0155964 | 3300046459 | Bacteria | 1586 |
| 291 | Ga0495638_0001241 | 3300046460 | Bacteria | 24034 |
| 292 | Ga0495638_0002344 | 3300046460 | Bacteria | 15537 |
| 293 | Ga0495638_0002439 | 3300046460 | Bacteria | 15177 |
| 294 | Ga0495638_0004078 | 3300046460 | Bacteria | 11193 |
| 295 | Ga0495638_0004350 | 3300046460 | Bacteria | 10733 |
| 296 | Ga0495638_0005769 | 3300046460 | Bacteria | 9117 |
| 297 | Ga0495638_0018266 | 3300046460 | Bacteria | 4660 |
| 298 | Ga0495638_0072499 | 3300046460 | Bacteria | 2104 |
| 299 | Ga0495638_0076991 | 3300046460 | Bacteria | 2031 |
| 300 | Ga0495638_0084145 | 3300046460 | Bacteria | 1925 |
| 301 | Ga0495653_0010904 | 3300046463 | Bacteria | 7440 |
| 302 | Ga0495653_0059353 | 3300046463 | Bacteria | 2904 |
| 303 | Ga0495650_0000389 | 3300046471 | Bacteria | 75118 |
| 304 | Ga0495650_0001924 | 3300046471 | Bacteria | 18400 |
| 305 | Ga0495650_0003496 | 3300046471 | Bacteria | 11408 |
| 306 | Ga0495650_0003955 | 3300046471 | Bacteria | 10421 |
| 307 | Ga0495650_0018292 | 3300046471 | Bacteria | 3485 |
| 308 | Ga0495650_0020877 | 3300046471 | Bacteria | 3181 |
| 309 | Ga0495650_0047979 | 3300046471 | Bacteria | 1782 |
| 310 | Ga0495605_0000091 | 3300046474 | Bacteria | 115482 |
| 311 | Ga0495605_0000102 | 3300046474 | Bacteria | 107430 |
| 312 | Ga0495605_0000505 | 3300046474 | Bacteria | 33476 |
| 313 | Ga0495605_0000577 | 3300046474 | Bacteria | 29725 |
| 314 | Ga0495605_0000586 | 3300046474 | Bacteria | 29236 |
| 315 | Ga0495605_0000642 | 3300046474 | Bacteria | 26793 |
| 316 | Ga0495605_0021805 | 3300046474 | Bacteria | 3388 |
| 317 | Ga0495605_0028777 | 3300046474 | Bacteria | 2866 |
| 318 | Ga0495605_0029306 | 3300046474 | Bacteria | 2835 |
| 319 | Ga0495605_0029685 | 3300046474 | Bacteria | 2809 |
| 320 | Ga0495605_0084480 | 3300046474 | Bacteria | 1480 |
| 321 | Ga0495639_0000090 | 3300046475 | Bacteria | 44069 |
| 322 | Ga0495639_0008700 | 3300046475 | Bacteria | 4352 |
| 323 | Ga0495639_0042598 | 3300046475 | Bacteria | 2048 |
| 324 | Ga0495584_0000014 | 3300046491 | Bacteria | 172880 |
| 325 | Ga0495584_0000141 | 3300046491 | Bacteria | 50024 |
| 326 | Ga0495584_0001912 | 3300046491 | Bacteria | 11990 |
| 327 | Ga0495584_0007519 | 3300046491 | Bacteria | 5679 |
| 328 | Ga0495584_0012709 | 3300046491 | Bacteria | 4297 |
| 329 | Ga0495584_0014767 | 3300046491 | Bacteria | 3978 |
| 330 | Ga0495584_0097597 | 3300046491 | Bacteria | 1484 |
| 331 | Ga0495585_0000012 | 3300046492 | Bacteria | 203064 |
| 332 | Ga0495585_0000016 | 3300046492 | Bacteria | 175433 |
| 333 | Ga0495585_0005502 | 3300046492 | Bacteria | 7972 |
| 334 | Ga0495585_0011397 | 3300046492 | Bacteria | 5262 |
| 335 | Ga0495585_0018710 | 3300046492 | Bacteria | 3995 |
| 336 | Ga0495585_0020154 | 3300046492 | Bacteria | 3837 |
| 337 | Ga0495585_0059869 | 3300046492 | Bacteria | 2097 |
| 338 | Ga0495585_0061018 | 3300046492 | Bacteria | 2074 |
| 339 | Ga0495585_0064639 | 3300046492 | Bacteria | 2006 |
| 340 | Ga0495585_0080733 | 3300046492 | Bacteria | 1762 |
| 341 | Ga0495594_0002272 | 3300046499 | Bacteria | 10015 |
| 342 | Ga0495594_0024491 | 3300046499 | Bacteria | 3242 |
| 343 | Ga0495596_0000050 | 3300046500 | Bacteria | 87493 |
| 344 | Ga0495596_0004400 | 3300046500 | Bacteria | 6876 |
| 345 | Ga0495596_0012042 | 3300046500 | Bacteria | 3712 |
| 346 | Ga0495607_0000018 | 3300046501 | Bacteria | 167673 |
| 347 | Ga0495607_0000259 | 3300046501 | Bacteria | 56558 |
| 348 | Ga0495607_0000271 | 3300046501 | Bacteria | 55714 |
| 349 | Ga0495607_0002455 | 3300046501 | Bacteria | 15063 |
| 350 | Ga0495607_0006011 | 3300046501 | Bacteria | 8606 |
| 351 | Ga0495607_0010355 | 3300046501 | Bacteria | 6273 |
| 352 | Ga0495607_0013254 | 3300046501 | Bacteria | 5410 |
| 353 | Ga0495607_0017563 | 3300046501 | Bacteria | 4588 |
| 354 | Ga0495607_0020272 | 3300046501 | Bacteria | 4206 |
| 355 | Ga0495607_0025447 | 3300046501 | Bacteria | 3680 |
| 356 | Ga0495607_0052799 | 3300046501 | Bacteria | 2352 |
| 357 | Ga0495607_0054011 | 3300046501 | Bacteria | 2316 |
| 358 | Ga0495583_0000131 | 3300046506 | Bacteria | 125393 |
| 359 | Ga0495583_0000244 | 3300046506 | Bacteria | 89766 |
| 360 | Ga0495583_0001087 | 3300046506 | Bacteria | 30092 |
| 361 | Ga0495583_0001205 | 3300046506 | Bacteria | 27737 |
| 362 | Ga0495583_0001483 | 3300046506 | Bacteria | 23474 |
| 363 | Ga0495583_0002942 | 3300046506 | Bacteria | 13720 |
| 364 | Ga0495583_0013915 | 3300046506 | Bacteria | 4460 |
| 365 | Ga0495606_0000238 | 3300046507 | Bacteria | 96877 |
| 366 | Ga0495606_0000315 | 3300046507 | Bacteria | 83545 |
| 367 | Ga0495606_0000706 | 3300046507 | Bacteria | 51756 |
| 368 | Ga0495606_0000883 | 3300046507 | Bacteria | 44862 |
| 369 | Ga0495606_0001185 | 3300046507 | Bacteria | 36734 |
| 370 | Ga0495606_0001862 | 3300046507 | Bacteria | 26483 |
| 371 | Ga0495606_0002361 | 3300046507 | Bacteria | 22160 |
| 372 | Ga0495606_0007650 | 3300046507 | Bacteria | 9586 |
| 373 | Ga0495606_0013616 | 3300046507 | Bacteria | 6413 |
| 374 | Ga0495606_0045271 | 3300046507 | Bacteria | 2918 |
| 375 | Ga0495606_0060016 | 3300046507 | Bacteria | 2437 |
| 376 | Ga0495610_0000568 | 3300046512 | Bacteria | 36829 |
| 377 | Ga0495610_0004740 | 3300046512 | Bacteria | 9924 |
| 378 | Ga0495610_0006577 | 3300046512 | Bacteria | 7947 |
| 379 | Ga0495610_0010956 | 3300046512 | Bacteria | 5584 |
| 380 | Ga0495616_0000041 | 3300046513 | Bacteria | 122413 |
| 381 | Ga0495616_0000203 | 3300046513 | Bacteria | 49328 |
| 382 | Ga0495616_0000245 | 3300046513 | Bacteria | 44179 |
| 383 | Ga0495616_0000259 | 3300046513 | Bacteria | 42870 |
| 384 | Ga0495616_0000364 | 3300046513 | Bacteria | 35589 |
| 385 | Ga0495616_0026791 | 3300046513 | Bacteria | 3063 |
| 386 | Ga0495616_0030393 | 3300046513 | Bacteria | 2839 |
| 387 | Ga0495616_0032797 | 3300046513 | Bacteria | 2710 |
| 388 | Ga0495616_0041596 | 3300046513 | Bacteria | 2343 |
| 389 | Ga0495616_0043032 | 3300046513 | Bacteria | 2295 |
| 390 | Ga0495616_0048573 | 3300046513 | Bacteria | 2131 |
| 391 | Ga0495620_0000126 | 3300046515 | Bacteria | 62048 |
| 392 | Ga0495620_0000678 | 3300046515 | Bacteria | 21047 |
| 393 | Ga0495620_0001264 | 3300046515 | Bacteria | 15433 |
| 394 | Ga0495620_0002321 | 3300046515 | Bacteria | 11021 |
| 395 | Ga0495620_0014023 | 3300046515 | Bacteria | 4087 |
| 396 | Ga0495620_0014817 | 3300046515 | Bacteria | 3951 |
| 397 | Ga0495620_0021006 | 3300046515 | Bacteria | 3177 |
| 398 | Ga0495620_0074028 | 3300046515 | Bacteria | 1388 |
| 399 | Ga0495630_0018862 | 3300046517 | Bacteria | 5070 |
| 400 | Ga0495630_0042359 | 3300046517 | Bacteria | 3400 |
| 401 | Ga0495630_0068998 | 3300046517 | Bacteria | 2659 |
| 402 | Ga0495631_0000131 | 3300046518 | Bacteria | 50430 |
| 403 | Ga0495631_0000533 | 3300046518 | Bacteria | 25521 |
| 404 | Ga0495631_0000554 | 3300046518 | Bacteria | 25074 |
| 405 | Ga0495631_0000946 | 3300046518 | Bacteria | 18094 |
| 406 | Ga0495631_0015286 | 3300046518 | Bacteria | 3680 |
| 407 | Ga0495631_0029152 | 3300046518 | Bacteria | 2513 |
| 408 | Ga0495631_0040339 | 3300046518 | Bacteria | 2068 |
| 409 | Ga0495632_0000475 | 3300046519 | Bacteria | 38064 |
| 410 | Ga0495632_0000683 | 3300046519 | Bacteria | 30990 |
| 411 | Ga0495632_0002461 | 3300046519 | Bacteria | 14088 |
| 412 | Ga0495632_0003181 | 3300046519 | Bacteria | 11833 |
| 413 | Ga0495632_0003400 | 3300046519 | Bacteria | 11328 |
| 414 | Ga0495632_0007618 | 3300046519 | Bacteria | 6769 |
| 415 | Ga0495632_0047071 | 3300046519 | Bacteria | 2140 |
| 416 | Ga0495632_0059453 | 3300046519 | Bacteria | 1859 |
| 417 | Ga0495632_0063342 | 3300046519 | Bacteria | 1790 |
| 418 | Ga0495632_0083607 | 3300046519 | Bacteria | 1520 |
| 419 | Ga0495637_0000046 | 3300046520 | Bacteria | 108118 |
| 420 | Ga0495637_0000275 | 3300046520 | Bacteria | 40472 |
| 421 | Ga0495637_0002301 | 3300046520 | Bacteria | 10584 |
| 422 | Ga0495637_0005075 | 3300046520 | Bacteria | 6754 |
| 423 | Ga0495637_0007268 | 3300046520 | Bacteria | 5507 |
| 424 | Ga0495637_0008706 | 3300046520 | Bacteria | 4975 |
| 425 | Ga0495637_0023084 | 3300046520 | Bacteria | 2831 |
| 426 | Ga0495637_0029814 | 3300046520 | Bacteria | 2425 |
| 427 | Ga0495637_0031307 | 3300046520 | Bacteria | 2354 |
| 428 | Ga0495637_0086538 | 3300046520 | Bacteria | 1242 |
| 429 | Ga0495643_0000783 | 3300046522 | Bacteria | 35376 |
| 430 | Ga0495643_0000914 | 3300046522 | Bacteria | 31057 |
| 431 | Ga0495643_0009467 | 3300046522 | Bacteria | 6055 |
| 432 | Ga0495643_0099519 | 3300046522 | Bacteria | 1491 |
| 433 | Ga0495644_0000052 | 3300046523 | Bacteria | 55714 |
| 434 | Ga0495644_0000575 | 3300046523 | Bacteria | 15400 |
| 435 | Ga0495644_0007134 | 3300046523 | Bacteria | 4321 |
| 436 | Ga0495644_0020322 | 3300046523 | Bacteria | 2534 |
| 437 | Ga0495648_0002342 | 3300046524 | Bacteria | 17587 |
| 438 | Ga0495648_0002449 | 3300046524 | Bacteria | 17121 |
| 439 | Ga0495648_0005920 | 3300046524 | Bacteria | 10063 |
| 440 | Ga0495648_0008610 | 3300046524 | Bacteria | 8002 |
| 441 | Ga0495648_0017652 | 3300046524 | Bacteria | 5090 |
| 442 | Ga0495648_0018712 | 3300046524 | Bacteria | 4890 |
| 443 | Ga0495648_0035583 | 3300046524 | Bacteria | 3226 |
| 444 | Ga0495648_0037822 | 3300046524 | Bacteria | 3095 |
| 445 | Ga0495648_0060372 | 3300046524 | Bacteria | 2256 |
| 446 | Ga0495648_0062536 | 3300046524 | Bacteria | 2203 |
| 447 | Ga0495648_0071475 | 3300046524 | Bacteria | 2011 |
| 448 | Ga0495666_0000286 | 3300046526 | Bacteria | 22158 |
| 449 | Ga0495666_0015516 | 3300046526 | Bacteria | 3793 |
| 450 | Ga0495666_0019700 | 3300046526 | Bacteria | 3345 |
| 451 | Ga0495666_0036473 | 3300046526 | Bacteria | 2394 |
| 452 | Ga0495642_0000452 | 3300046528 | Bacteria | 21635 |
| 453 | Ga0495642_0000487 | 3300046528 | Bacteria | 20318 |
| 454 | Ga0495642_0006510 | 3300046528 | Bacteria | 4479 |
| 455 | Ga0495654_0000059 | 3300046530 | Bacteria | 137056 |
| 456 | Ga0495654_0000104 | 3300046530 | Bacteria | 95266 |
| 457 | Ga0495654_0000182 | 3300046530 | Bacteria | 61568 |
| 458 | Ga0495654_0000272 | 3300046530 | Bacteria | 47029 |
| 459 | Ga0495654_0000714 | 3300046530 | Bacteria | 25967 |
| 460 | Ga0495654_0003320 | 3300046530 | Bacteria | 9909 |
| 461 | Ga0495654_0009121 | 3300046530 | Bacteria | 5440 |
| 462 | Ga0495654_0010079 | 3300046530 | Bacteria | 5154 |
| 463 | Ga0495654_0010725 | 3300046530 | Bacteria | 4976 |
| 464 | Ga0495654_0013750 | 3300046530 | Bacteria | 4325 |
| 465 | Ga0495654_0013828 | 3300046530 | Bacteria | 4308 |
| 466 | Ga0495654_0013964 | 3300046530 | Bacteria | 4284 |
| 467 | Ga0495654_0020664 | 3300046530 | Bacteria | 3430 |
| 468 | Ga0495654_0029395 | 3300046530 | Bacteria | 2803 |
| 469 | Ga0495654_0033492 | 3300046530 | Bacteria | 2599 |
| 470 | Ga0495654_0047732 | 3300046530 | Bacteria | 2103 |
| 471 | Ga0495654_0076687 | 3300046530 | Bacteria | 1574 |
| 472 | Ga0495654_0093135 | 3300046530 | Bacteria | 1396 |
| 473 | Ga0495587_0001759 | 3300046536 | Bacteria | 14480 |
| 474 | Ga0495587_0029322 | 3300046536 | Bacteria | 3340 |
| 475 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 476 | Ga0495609_0000069 | 3300046538 | Bacteria | 128601 |
| 477 | Ga0495609_0001183 | 3300046538 | Bacteria | 17998 |
| 478 | Ga0495609_0003250 | 3300046538 | Bacteria | 9401 |
| 479 | Ga0495609_0011406 | 3300046538 | Bacteria | 4233 |
| 480 | Ga0495609_0041072 | 3300046538 | Bacteria | 2080 |
| 481 | Ga0495597_0000464 | 3300046542 | Bacteria | 34458 |
| 482 | Ga0495597_0008406 | 3300046542 | Bacteria | 5174 |
| 483 | Ga0495597_0009203 | 3300046542 | Bacteria | 4896 |
| 484 | Ga0495597_0010952 | 3300046542 | Bacteria | 4409 |
| 485 | Ga0495597_0013242 | 3300046542 | Bacteria | 3957 |
| 486 | Ga0495597_0034550 | 3300046542 | Bacteria | 2284 |
| 487 | Ga0495597_0038720 | 3300046542 | Bacteria | 2136 |
| 488 | Ga0495597_0044820 | 3300046542 | Bacteria | 1965 |
| 489 | Ga0495645_0262627 | 3300046543 | Bacteria | 1142 |
| 490 | Ga0495622_0000354 | 3300046557 | Bacteria | 32338 |
| 491 | Ga0495622_0000452 | 3300046557 | Bacteria | 26316 |
| 492 | Ga0495622_0006019 | 3300046557 | Bacteria | 5635 |
| 493 | Ga0495622_0011764 | 3300046557 | Bacteria | 4045 |
| 494 | Ga0495622_0014695 | 3300046557 | Bacteria | 3636 |
| 495 | Ga0495622_0051528 | 3300046557 | Bacteria | 1909 |
| 496 | Ga0495633_0000730 | 3300046558 | Bacteria | 29769 |
| 497 | Ga0495633_0010804 | 3300046558 | Bacteria | 4965 |
| 498 | Ga0495656_0011944 | 3300046615 | Bacteria | 3195 |
| 499 | Ga0495668_0001607 | 3300046616 | Bacteria | 21184 |
| 500 | Ga0495668_0014348 | 3300046616 | Bacteria | 4648 |
| 501 | Ga0495668_0060298 | 3300046616 | Bacteria | 2093 |
| 502 | Ga0495634_0000091 | 3300046642 | Bacteria | 72170 |
| 503 | Ga0495634_0103629 | 3300046642 | Bacteria | 1836 |
| 504 | Ga0495611_0000067 | 3300046648 | Bacteria | 72577 |
| 505 | Ga0495611_0000288 | 3300046648 | Bacteria | 34211 |
| 506 | Ga0495611_0001314 | 3300046648 | Bacteria | 12648 |
| 507 | Ga0495611_0057748 | 3300046648 | Bacteria | 1759 |
| 508 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 509 | Ga0495625_0000184 | 3300046660 | Bacteria | 98137 |
| 510 | Ga0495625_0000653 | 3300046660 | Bacteria | 49602 |
| 511 | Ga0495625_0001487 | 3300046660 | Bacteria | 28260 |
| 512 | Ga0495625_0002094 | 3300046660 | Bacteria | 22301 |
| 513 | Ga0495625_0008069 | 3300046660 | Bacteria | 9028 |
| 514 | Ga0495625_0022161 | 3300046660 | Bacteria | 4875 |
| 515 | Ga0495625_0076532 | 3300046660 | Bacteria | 2339 |
| 516 | Ga0495625_0084228 | 3300046660 | Bacteria | 2208 |
| 517 | Ga0495625_0171298 | 3300046660 | Bacteria | 1449 |
| 518 | Ga0495635_0000176 | 3300046663 | Bacteria | 40149 |
| 519 | Ga0495635_0000733 | 3300046663 | Bacteria | 21217 |
| 520 | Ga0495659_0000295 | 3300046664 | Bacteria | 19818 |
| 521 | Ga0495661_0000033 | 3300046665 | Bacteria | 168033 |
| 522 | Ga0495661_0000086 | 3300046665 | Bacteria | 113945 |
| 523 | Ga0495661_0003338 | 3300046665 | Bacteria | 11890 |
| 524 | Ga0495661_0014364 | 3300046665 | Bacteria | 5305 |
| 525 | Ga0495661_0035587 | 3300046665 | Bacteria | 3122 |
| 526 | Ga0495661_0049797 | 3300046665 | Bacteria | 2538 |
| 527 | Ga0495661_0070907 | 3300046665 | Bacteria | 2037 |
| 528 | Ga0495588_0011495 | 3300046674 | Bacteria | 4157 |
| 529 | Ga0495588_0027833 | 3300046674 | Bacteria | 2827 |
| 530 | Ga0495588_0033772 | 3300046674 | Bacteria | 2585 |
| 531 | Ga0495657_0191602 | 3300046675 | Bacteria | 1249 |
| 532 | Ga0495623_0071612 | 3300046679 | Bacteria | 2156 |
| 533 | Ga0495646_0006128 | 3300046680 | Bacteria | 7627 |
| 534 | Ga0495646_0029298 | 3300046680 | Bacteria | 3441 |
| 535 | Ga0495646_0044778 | 3300046680 | Bacteria | 2704 |
| 536 | Ga0495669_0000824 | 3300046684 | Bacteria | 13219 |
| 537 | Ga0495669_0001417 | 3300046684 | Bacteria | 9861 |
| 538 | Ga0495613_0010538 | 3300046689 | Bacteria | 6862 |
| 539 | Ga0495613_0050118 | 3300046689 | Bacteria | 3080 |
| 540 | Ga0495670_0000061 | 3300046691 | Bacteria | 48947 |
| 541 | Ga0495670_0000109 | 3300046691 | Bacteria | 36580 |
| 542 | Ga0495670_0000131 | 3300046691 | Bacteria | 32446 |
| 543 | Ga0495670_0002311 | 3300046691 | Bacteria | 9421 |
| 544 | Ga0495670_0024483 | 3300046691 | Bacteria | 2983 |
| 545 | Ga0495670_0054647 | 3300046691 | Bacteria | 2001 |
| 546 | Ga0495670_0089523 | 3300046691 | Bacteria | 1574 |
| 547 | Ga0495671_0000137 | 3300046692 | Bacteria | 64587 |
| 548 | Ga0495671_0001202 | 3300046692 | Bacteria | 17712 |
| 549 | Ga0495671_0002604 | 3300046692 | Bacteria | 11351 |
| 550 | Ga0495671_0003652 | 3300046692 | Bacteria | 9371 |
| 551 | Ga0495671_0025470 | 3300046692 | Bacteria | 3074 |
| 552 | Ga0495671_0027624 | 3300046692 | Bacteria | 2928 |
| 553 | Ga0495671_0035973 | 3300046692 | Bacteria | 2511 |
| 554 | Ga0495671_0036481 | 3300046692 | Bacteria | 2489 |
| 555 | Ga0495671_0081428 | 3300046692 | Bacteria | 1586 |
| 556 | Ga0495671_0121103 | 3300046692 | Bacteria | 1276 |
| 557 | Ga0495649_0000664 | 3300046694 | Bacteria | 28100 |
| 558 | Ga0495649_0001412 | 3300046694 | Bacteria | 18138 |
| 559 | Ga0495649_0002165 | 3300046694 | Bacteria | 14055 |
| 560 | Ga0495649_0002578 | 3300046694 | Bacteria | 12678 |
| 561 | Ga0495649_0002732 | 3300046694 | Bacteria | 12284 |
| 562 | Ga0495649_0008614 | 3300046694 | Bacteria | 6126 |
| 563 | Ga0495649_0014614 | 3300046694 | Bacteria | 4491 |
| 564 | Ga0495649_0044431 | 3300046694 | Bacteria | 2425 |
| 565 | Ga0495589_0000011 | 3300046794 | Bacteria | 250370 |
| 566 | Ga0495589_0000086 | 3300046794 | Bacteria | 86130 |
| 567 | Ga0495589_0000685 | 3300046794 | Bacteria | 22064 |
| 568 | Ga0495589_0000854 | 3300046794 | Bacteria | 19110 |
| 569 | Ga0495589_0001776 | 3300046794 | Bacteria | 12260 |
| 570 | Ga0495589_0001953 | 3300046794 | Bacteria | 11676 |
| 571 | Ga0495589_0003642 | 3300046794 | Bacteria | 8322 |
| 572 | Ga0495589_0004341 | 3300046794 | Bacteria | 7561 |
| 573 | Ga0495589_0025942 | 3300046794 | Bacteria | 2970 |
| 574 | Ga0495589_0029070 | 3300046794 | Bacteria | 2786 |
| 575 | Ga0495600_0041172 | 3300046809 | Bacteria | 3010 |
| 576 | Ga0495660_0000042 | 3300046810 | Bacteria | 167048 |
| 577 | Ga0495660_0002117 | 3300046810 | Bacteria | 12848 |
| 578 | Ga0495660_0003557 | 3300046810 | Bacteria | 9612 |
| 579 | Ga0495660_0004175 | 3300046810 | Bacteria | 8783 |
| 580 | Ga0495660_0005027 | 3300046810 | Bacteria | 7953 |
| 581 | Ga0495660_0006994 | 3300046810 | Bacteria | 6650 |
| 582 | Ga0495660_0009489 | 3300046810 | Bacteria | 5674 |
| 583 | Ga0495660_0009844 | 3300046810 | Bacteria | 5563 |
| 584 | Ga0495660_0010071 | 3300046810 | Bacteria | 5498 |
| 585 | Ga0495660_0013843 | 3300046810 | Bacteria | 4675 |
| 586 | Ga0495660_0014112 | 3300046810 | Bacteria | 4628 |
| 587 | Ga0495660_0037408 | 3300046810 | Bacteria | 2702 |
| 588 | Ga0495660_0046028 | 3300046810 | Bacteria | 2393 |
| 589 | Ga0495660_0055367 | 3300046810 | Bacteria | 2147 |
| 590 | Ga0495660_0055390 | 3300046810 | Bacteria | 2147 |
| 591 | Ga0495660_0081238 | 3300046810 | Bacteria | 1699 |
| 592 | Ga0495660_0145241 | 3300046810 | Bacteria | 1176 |
| 593 | Ga0495581_0018330 | 3300047315 | Bacteria | 4066 |
| 594 | Ga0495581_0050054 | 3300047315 | Bacteria | 2413 |
| 595 | Ga0495604_0001222 | 3300047317 | Bacteria | 21073 |
| 596 | Ga0495604_0062711 | 3300047317 | Bacteria | 2838 |
| 597 | Ga0495636_0011725 | 3300047318 | Bacteria | 3473 |
| 598 | Ga0495674_0000810 | 3300047319 | Bacteria | 29755 |
| 599 | Ga0495672_0000278 | 3300047320 | Bacteria | 71017 |
| 600 | Ga0495672_0000800 | 3300047320 | Bacteria | 33912 |
| 601 | Ga0495672_0001575 | 3300047320 | Bacteria | 22321 |
| 602 | Ga0495672_0001693 | 3300047320 | Bacteria | 21357 |
| 603 | Ga0495672_0016785 | 3300047320 | Bacteria | 4914 |
| 604 | Ga0495672_0019739 | 3300047320 | Bacteria | 4439 |
| 605 | Ga0495672_0041118 | 3300047320 | Bacteria | 2798 |
| 606 | Ga0495672_0043199 | 3300047320 | Bacteria | 2711 |
| 607 | Ga0495672_0081731 | 3300047320 | Bacteria | 1798 |
| 608 | Ga0495672_0091905 | 3300047320 | Bacteria | 1664 |
| 609 | Ga0495672_0149308 | 3300047320 | Bacteria | 1213 |
| 610 | Ga0495676_0000021 | 3300047321 | Bacteria | 166180 |
| 611 | Ga0495676_0000298 | 3300047321 | Bacteria | 40228 |
| 612 | Ga0495680_0014075 | 3300047322 | Bacteria | 6949 |
| 613 | Ga0495680_0016113 | 3300047322 | Bacteria | 6426 |
| 614 | Ga0495680_0034633 | 3300047322 | Bacteria | 4074 |
| 615 | Ga0495683_0000022 | 3300047323 | Bacteria | 163268 |
| 616 | Ga0495683_0000327 | 3300047323 | Bacteria | 39970 |
| 617 | Ga0495683_0006606 | 3300047323 | Bacteria | 6323 |
| 618 | Ga0495683_0006789 | 3300047323 | Bacteria | 6223 |
| 619 | Ga0495683_0007547 | 3300047323 | Bacteria | 5865 |
| 620 | Ga0495683_0034583 | 3300047323 | Bacteria | 2569 |
| 621 | Ga0495683_0051251 | 3300047323 | Bacteria | 2064 |
| 622 | Ga0495683_0053272 | 3300047323 | Bacteria | 2018 |
| 623 | Ga0495683_0054968 | 3300047323 | Bacteria | 1982 |
| 624 | Ga0495687_000081 | 3300047443 | Bacteria | 147362 |
| 625 | Ga0495687_000463 | 3300047443 | Bacteria | 49612 |
| 626 | Ga0495687_000792 | 3300047443 | Bacteria | 33996 |
| 627 | Ga0495687_001276 | 3300047443 | Bacteria | 23704 |
| 628 | Ga0495675_0007448 | 3300047444 | Bacteria | 6740 |
| 629 | Ga0495677_0000299 | 3300047445 | Bacteria | 21740 |
| 630 | Ga0495677_0020605 | 3300047445 | Bacteria | 2390 |
| 631 | Ga0495679_000106 | 3300047446 | Bacteria | 75283 |
| 632 | Ga0495679_001059 | 3300047446 | Bacteria | 16719 |
| 633 | Ga0495679_001852 | 3300047446 | Bacteria | 11430 |
| 634 | Ga0495679_002135 | 3300047446 | Bacteria | 10401 |
| 635 | Ga0495679_027583 | 3300047446 | Bacteria | 1871 |
| 636 | Ga0495685_028774 | 3300047447 | Bacteria | 1911 |
| 637 | Ga0495673_0000107 | 3300047469 | Bacteria | 168920 |
| 638 | Ga0495673_0000536 | 3300047469 | Bacteria | 39335 |
| 639 | Ga0495673_0000609 | 3300047469 | Bacteria | 35569 |
| 640 | Ga0495673_0002805 | 3300047469 | Bacteria | 11898 |
| 641 | Ga0495673_0003568 | 3300047469 | Bacteria | 10224 |
| 642 | Ga0495673_0004419 | 3300047469 | Bacteria | 8797 |
| 643 | Ga0495673_0005869 | 3300047469 | Bacteria | 7339 |
| 644 | Ga0495673_0008877 | 3300047469 | Bacteria | 5605 |
| 645 | Ga0495673_0010840 | 3300047469 | Bacteria | 4932 |
| 646 | Ga0495673_0025184 | 3300047469 | Bacteria | 2860 |
| 647 | Ga0495673_0048232 | 3300047469 | Bacteria | 1878 |
| 648 | Ga0495681_0000109 | 3300047470 | Bacteria | 71558 |
| 649 | Ga0495681_0000831 | 3300047470 | Bacteria | 23816 |
| 650 | Ga0495681_0001811 | 3300047470 | Bacteria | 15712 |
| 651 | Ga0495681_0002361 | 3300047470 | Bacteria | 13549 |
| 652 | Ga0495681_0002406 | 3300047470 | Bacteria | 13399 |
| 653 | Ga0495681_0003712 | 3300047470 | Bacteria | 10586 |
| 654 | Ga0495681_0005492 | 3300047470 | Bacteria | 8475 |
| 655 | Ga0495681_0005958 | 3300047470 | Bacteria | 8084 |
| 656 | Ga0495681_0007473 | 3300047470 | Bacteria | 6973 |
| 657 | Ga0495681_0013316 | 3300047470 | Bacteria | 4779 |
| 658 | Ga0495681_0027199 | 3300047470 | Bacteria | 2963 |
| 659 | Ga0495681_0027289 | 3300047470 | Bacteria | 2956 |
| 660 | Ga0495681_0027928 | 3300047470 | Bacteria | 2912 |
| 661 | Ga0495681_0029362 | 3300047470 | Bacteria | 2814 |
| 662 | Ga0495681_0058388 | 3300047470 | Bacteria | 1788 |
| 663 | Ga0495686_0000439 | 3300047472 | Bacteria | 63587 |
| 664 | Ga0495686_0000475 | 3300047472 | Bacteria | 59699 |
| 665 | Ga0495686_0035231 | 3300047472 | Bacteria | 3218 |
| 666 | Ga0495686_0036252 | 3300047472 | Bacteria | 3166 |
| 667 | Ga0495686_0172650 | 3300047472 | Bacteria | 1257 |
| 668 | Ga0495593_0000551 | 3300047673 | Bacteria | 21278 |
| 669 | Ga0495593_0034638 | 3300047673 | Bacteria | 2745 |
| 670 | Ga0495593_0048208 | 3300047673 | Bacteria | 2264 |
| 671 | Ga0495593_0082255 | 3300047673 | Bacteria | 1664 |
| 672 | Ga0495602_0029881 | 3300048088 | Bacteria | 5179 |
| 673 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 674 | Ga0495626_0000112 | 3300048091 | Bacteria | 105221 |
| 675 | Ga0495626_0000114 | 3300048091 | Bacteria | 105174 |
| 676 | Ga0495626_0000279 | 3300048091 | Bacteria | 56185 |
| 677 | Ga0495626_0000303 | 3300048091 | Bacteria | 52202 |
| 678 | Ga0495626_0000538 | 3300048091 | Bacteria | 37687 |
| 679 | Ga0495626_0000744 | 3300048091 | Bacteria | 30072 |
| 680 | Ga0495626_0001326 | 3300048091 | Bacteria | 20109 |
| 681 | Ga0495626_0001554 | 3300048091 | Bacteria | 18009 |
| 682 | Ga0495626_0002282 | 3300048091 | Bacteria | 13636 |
| 683 | Ga0495626_0005276 | 3300048091 | Bacteria | 7632 |
| 684 | Ga0495626_0006970 | 3300048091 | Bacteria | 6359 |
| 685 | Ga0496102_0158626 | 3300048905 | Bacteria | 2128 |
| 686 | Ga0496103_0069867 | 3300048906 | Bacteria | 2196 |
| 687 | Ga0496105_0042927 | 3300048908 | Bacteria | 3729 |
| 688 | Ga0496106_0264617 | 3300048909 | Bacteria | 1376 |
| 689 | Ga0496110_0247167 | 3300048913 | Bacteria | 1623 |
| 690 | Ga0496111_0136288 | 3300048914 | Bacteria | 1818 |
| 691 | Ga0496116_0000654 | 3300048919 | Bacteria | 45317 |
| 692 | Ga0496116_0000858 | 3300048919 | Bacteria | 38019 |
| 693 | Ga0496116_0001153 | 3300048919 | Bacteria | 31191 |
| 694 | Ga0496116_0001414 | 3300048919 | Bacteria | 26960 |
| 695 | Ga0496116_0048049 | 3300048919 | Bacteria | 2867 |
| 696 | Ga0496116_0111835 | 3300048919 | Bacteria | 1603 |
| 697 | Ga0496117_0000100 | 3300048920 | Bacteria | 194307 |
| 698 | Ga0496117_0004465 | 3300048920 | Bacteria | 15406 |
| 699 | Ga0496117_0007211 | 3300048920 | Bacteria | 10952 |
| 700 | Ga0496117_0009186 | 3300048920 | Bacteria | 9261 |
| 701 | Ga0496117_0012635 | 3300048920 | Bacteria | 7424 |
| 702 | Ga0496117_0030750 | 3300048920 | Bacteria | 4113 |
| 703 | Ga0496117_0058221 | 3300048920 | Bacteria | 2678 |
| 704 | Ga0496118_0006907 | 3300048921 | Bacteria | 12283 |
| 705 | Ga0496118_0012776 | 3300048921 | Bacteria | 8020 |
| 706 | Ga0496118_0024933 | 3300048921 | Bacteria | 5147 |
| 707 | Ga0496118_0033531 | 3300048921 | Bacteria | 4210 |
| 708 | Ga0496118_0035749 | 3300048921 | Bacteria | 4027 |
| 709 | Ga0496118_0040929 | 3300048921 | Bacteria | 3676 |
| 710 | Ga0496118_0078693 | 3300048921 | Bacteria | 2331 |
| 711 | Ga0496119_0008749 | 3300048922 | Bacteria | 8831 |
| 712 | Ga0496119_0019649 | 3300048922 | Bacteria | 4963 |
| 713 | Ga0496120_0005831 | 3300048923 | Bacteria | 9647 |
| 714 | Ga0496120_0006095 | 3300048923 | Bacteria | 9351 |
| 715 | Ga0496121_0000160 | 3300048924 | Bacteria | 146354 |
| 716 | Ga0496121_0001858 | 3300048924 | Bacteria | 33891 |
| 717 | Ga0496121_0002636 | 3300048924 | Bacteria | 27038 |
| 718 | Ga0496121_0010373 | 3300048924 | Bacteria | 10524 |
| 719 | Ga0496121_0013684 | 3300048924 | Bacteria | 8698 |
| 720 | Ga0496121_0048629 | 3300048924 | Bacteria | 3607 |
| 721 | Ga0496121_0158833 | 3300048924 | Bacteria | 1655 |
| 722 | Ga0496122_0000259 | 3300048925 | Bacteria | 119366 |
| 723 | Ga0496122_0001003 | 3300048925 | Bacteria | 50005 |
| 724 | Ga0496122_0006723 | 3300048925 | Bacteria | 13087 |
| 725 | Ga0496122_0007079 | 3300048925 | Bacteria | 12600 |
| 726 | Ga0496122_0009373 | 3300048925 | Bacteria | 10334 |
| 727 | Ga0496122_0035471 | 3300048925 | Bacteria | 4056 |
| 728 | Ga0496122_0040344 | 3300048925 | Bacteria | 3711 |
| 729 | Ga0496122_0091104 | 3300048925 | Bacteria | 2077 |
| 730 | Ga0496122_0120772 | 3300048925 | Bacteria | 1690 |
| 731 | Ga0496123_0000209 | 3300048926 | Bacteria | 119480 |
| 732 | Ga0496123_0000956 | 3300048926 | Bacteria | 44795 |
| 733 | Ga0496123_0004671 | 3300048926 | Bacteria | 14198 |
| 734 | Ga0496123_0010220 | 3300048926 | Bacteria | 8327 |
| 735 | Ga0496123_0013118 | 3300048926 | Bacteria | 6989 |
| 736 | Ga0496123_0043593 | 3300048926 | Bacteria | 3079 |
| 737 | Ga0496123_0176401 | 3300048926 | Bacteria | 1121 |
| 738 | Ga0496124_0000338 | 3300048927 | Bacteria | 85856 |
| 739 | Ga0496124_0000580 | 3300048927 | Bacteria | 61729 |
| 740 | Ga0496124_0000922 | 3300048927 | Bacteria | 47468 |
| 741 | Ga0496124_0005330 | 3300048927 | Bacteria | 14521 |
| 742 | Ga0496124_0021010 | 3300048927 | Bacteria | 6020 |
| 743 | Ga0496124_0034836 | 3300048927 | Bacteria | 4411 |
| 744 | Ga0496124_0039481 | 3300048927 | Bacteria | 4092 |
| 745 | Ga0496124_0052666 | 3300048927 | Bacteria | 3456 |
| 746 | Ga0496124_0172047 | 3300048927 | Bacteria | 1676 |
| 747 | Ga0496125_0000245 | 3300048928 | Bacteria | 111310 |
| 748 | Ga0496125_0000992 | 3300048928 | Bacteria | 44258 |
| 749 | Ga0496125_0009503 | 3300048928 | Bacteria | 9982 |
| 750 | Ga0496125_0020733 | 3300048928 | Bacteria | 6161 |
| 751 | Ga0496125_0069236 | 3300048928 | Bacteria | 2770 |
| 752 | Ga0496125_0096772 | 3300048928 | Bacteria | 2190 |
| 753 | Ga0496126_0002098 | 3300048929 | Bacteria | 27910 |
| 754 | Ga0496126_0102808 | 3300048929 | Bacteria | 2497 |
| 755 | Ga0495678_000343 | 3300049459 | Bacteria | 48316 |
| 756 | Ga0495678_000500 | 3300049459 | Bacteria | 38668 |
| 757 | Ga0495678_001452 | 3300049459 | Bacteria | 18640 |
| 758 | Ga0495678_001593 | 3300049459 | Bacteria | 17404 |
| 759 | Ga0495678_001740 | 3300049459 | Bacteria | 16194 |
| 760 | Ga0495678_008303 | 3300049459 | Bacteria | 5254 |
| 761 | Ga0495678_018542 | 3300049459 | Bacteria | 3126 |
| 762 | Ga0495678_037456 | 3300049459 | Bacteria | 1970 |
| 763 | Ga0495678_039366 | 3300049459 | Bacteria | 1907 |
| 764 | Ga0495678_045100 | 3300049459 | Bacteria | 1740 |
| 765 | Ga0495682_0000087 | 3300049460 | Bacteria | 80534 |
| 766 | Ga0495682_0001800 | 3300049460 | Bacteria | 10814 |
| 767 | Ga0495682_0010633 | 3300049460 | Bacteria | 3556 |
| 768 | Ga0495682_0025414 | 3300049460 | Bacteria | 2204 |
| 769 | Ga0501031_0171835 | 3300049568 | Bacteria | 1416 |
| 770 | Ga0501033_0001473 | 3300049570 | Bacteria | 20840 |
| 771 | Ga0501034_0203873 | 3300049571 | Bacteria | 1935 |
| 772 | Ga0501036_0047672 | 3300049572 | Bacteria | 3628 |
| 773 | Ga0501037_0022938 | 3300049573 | Bacteria | 4616 |
| 774 | Ga0501043_0008605 | 3300049579 | Bacteria | 8043 |
| 775 | Ga0501047_0002073 | 3300049581 | Bacteria | 19184 |
| 776 | Ga0501070_0098534 | 3300049586 | Bacteria | 2418 |
| 777 | Ga0501241_000412 | 3300049758 | Bacteria | 9388 |
| 778 | Ga0501035_0002146 | 3300049822 | Bacteria | 19622 |
| 779 | Ga0501035_0002317 | 3300049822 | Bacteria | 18779 |
| 780 | Ga0501044_0014437 | 3300049823 | Bacteria | 8527 |
| 781 | nmdc:mga03683_15020_c1 | 3300050489 | Bacteria | 2880 |
| 782 | nmdc:mga08y16_65337_c1 | 3300050511 | Bacteria | 3798 |
| 783 | nmdc:mga0n895_936_c1 | 3300050512 | Bacteria | 21069 |
| 784 | nmdc:mga0rr50_36921_c1 | 3300050513 | Bacteria | 3523 |
| 785 | nmdc:mga0a205_123954_c1 | 3300050515 | Bacteria | 2484 |
| 786 | nmdc:mga0sz30_1517_c1 | 3300050516 | Bacteria | 4271 |
| 787 | Ga0500569_020577 | 3300053109 | Bacteria | 1733 |
| 788 | Ga0500658_0000051 | 3300053134 | Bacteria | 62135 |
| 789 | Ga0466962_0063268 | 3300061719 | Bacteria | 1766 |
| 790 | 2511257014 | 2511231004 | Bacteria | 6669789 |
| 791 | 2511271201 | 2511231007 | Bacteria | 6306603 |
| 792 | 2511276933 | 2511231008 | Bacteria | 6624100 |
| 793 | 2511292175 | 2511231010 | Bacteria | 6373152 |
| 794 | 2511298510 | 2511231011 | Bacteria | 6149768 |
| 795 | 2511304943 | 2511231012 | Bacteria | 6738011 |
| 796 | 2511312436 | 2511231014 | Bacteria | 6462302 |
| 797 | 2511321555 | 2511231015 | Bacteria | 6598026 |
| 798 | 2511340723 | 2511231018 | Bacteria | 6436256 |
| 799 | 2511346555 | 2511231019 | Bacteria | 6520662 |
| 800 | 2511347871 | 2511231020 | Bacteria | 6115223 |
| 801 | 2511360194 | 2511231021 | Bacteria | 7302637 |
| 802 | 2511415886 | 2511231031 | Bacteria | 6558529 |
| 803 | 2511824911 | 2511231156 | Bacteria | 6845832 |
| 804 | 2512323469 | 2512047018 | Bacteria | 6663241 |
| 805 | 2583791901 | 2582580891 | Bacteria | 6800976 |
| 806 | 2597857724 | 2597489887 | Bacteria | 6666321 |
| 807 | 2599398505 | 2599185167 | Bacteria | 6353609 |
| 808 | 2599450554 | 2599185179 | Bacteria | 6611171 |
| 809 | 2599484350 | 2599185185 | Bacteria | 6652270 |
| 810 | 2599507417 | 2599185189 | Bacteria | 5862825 |
| 811 | 2599512991 | 2599185190 | Bacteria | 6285678 |
| 812 | 2599521641 | 2599185191 | Bacteria | 6297582 |
| 813 | 2599612518 | 2599185212 | Bacteria | 6765997 |
| 814 | 2599772255 | 2599185248 | Bacteria | 6696816 |
| 815 | 2599802384 | 2599185257 | Bacteria | 6492581 |
| 816 | 2599885310 | 2599185289 | Bacteria | 6778765 |
| 817 | 2599891668 | 2599185290 | Bacteria | 6289611 |
| 818 | 2599898977 | 2599185291 | Bacteria | 6775623 |
| 819 | 2599941274 | 2599185302 | Bacteria | 5954930 |
| 820 | 2599946620 | 2599185303 | Bacteria | 6512725 |
| 821 | 2599953206 | 2599185304 | Bacteria | 5951361 |
| 822 | 2599959963 | 2599185305 | Bacteria | 6748700 |
| 823 | 2599966951 | 2599185306 | Bacteria | 6637356 |
| 824 | 2599978454 | 2599185308 | Bacteria | 6621546 |
| 825 | 2599982542 | 2599185309 | Bacteria | 5969593 |
| 826 | 2599989860 | 2599185310 | Bacteria | 6014457 |
| 827 | 2599993502 | 2599185311 | Bacteria | 6354990 |
| 828 | 2599998753 | 2599185312 | Bacteria | 5912071 |
| 829 | 2600006156 | 2599185313 | Bacteria | 6658188 |
| 830 | 2600012621 | 2599185314 | Bacteria | 6621749 |
| 831 | 2600016471 | 2599185315 | Bacteria | 6771107 |
| 832 | 2600022105 | 2599185316 | Bacteria | 6320029 |
| 833 | 2600035122 | 2599185318 | Bacteria | 6961590 |
| 834 | 2600040768 | 2599185319 | Bacteria | 6637840 |
| 835 | 2600047433 | 2599185320 | Bacteria | 5963263 |
| 836 | 2600051677 | 2599185321 | Bacteria | 6764560 |
| 837 | 2600059385 | 2599185322 | Bacteria | 6763055 |
| 838 | 2600063105 | 2599185323 | Bacteria | 6688755 |
| 839 | 2600071001 | 2599185324 | Bacteria | 6590677 |
| 840 | 2600075379 | 2599185325 | Bacteria | 6324919 |
| 841 | 2600357554 | 2600254930 | Bacteria | 6431253 |
| 842 | 2600368475 | 2600254931 | Bacteria | 6734225 |
| 843 | 2601691856 | 2600255296 | Bacteria | 5784754 |
| 844 | 2601799263 | 2600255318 | Bacteria | 6383414 |
| 845 | 2601799397 | 2600255318 | Bacteria | 6383414 |
| 846 | 2606078370 | 2603880185 | Bacteria | 6379190 |
| 847 | 2606078507 | 2603880185 | Bacteria | 6379190 |
| 848 | 2606130478 | 2603880199 | Bacteria | 6377649 |
| 849 | 2606130615 | 2603880199 | Bacteria | 6377649 |
| 850 | 2624480241 | 2623620443 | Bacteria | 6427864 |
| 851 | 2624480366 | 2623620443 | Bacteria | 6427864 |
| 852 | 2624492938 | 2623620446 | Bacteria | 6500345 |
| 853 | 2643796604 | 2643221556 | Bacteria | 7251154 |
| 854 | 2643845833 | 2643221565 | Bacteria | 6216018 |
| 855 | 2643874193 | 2643221571 | Bacteria | 6228673 |
| 856 | 2643954451 | 2643221589 | Bacteria | 6250934 |
| 857 | 2644023260 | 2643221602 | Bacteria | 6249926 |
| 858 | 2644189190 | 2643221633 | Bacteria | 6733554 |
| 859 | 2644284488 | 2643221650 | Bacteria | 7029547 |
| 860 | 2644472726 | 2643221684 | Bacteria | 7145183 |
| 861 | 2652546062 | 2651869719 | Bacteria | 6047974 |
| 862 | 2671091593 | 2667528170 | Bacteria | 6786960 |
| 863 | 2671126458 | 2667528176 | Bacteria | 6724917 |
| 864 | 2671769998 | 2671180172 | Bacteria | 6495783 |
| 865 | 2677896217 | 2675903420 | Bacteria | 6247433 |
| 866 | 2678265461 | 2675903515 | Bacteria | 6580491 |
| 867 | 2715754090 | 2713897148 | Bacteria | 5883533 |
| 868 | 2715758573 | 2713897149 | Bacteria | 6506249 |
| 869 | 2715760078 | 2713897149 | Bacteria | 6506249 |
| 870 | 2718634394 | 2718217725 | Bacteria | 5758958 |
| 871 | 2739197226 | 2738543004 | Bacteria | 6381073 |
| 872 | 2739257919 | 2738543015 | Bacteria | 6750701 |
| 873 | 2739312056 | 2738543025 | Bacteria | 6600348 |
| 874 | 2743737160 | 2740892503 | Bacteria | 6855563 |
| 875 | 2745005912 | 2744054620 | Bacteria | 6551379 |
| 876 | 2774123159 | 2773857670 | Bacteria | 6407454 |
| 877 | 2774138099 | 2773857673 | Bacteria | 6513460 |
| 878 | 2784264806 | 2784132063 | Bacteria | 6262788 |
| 879 | 2784315435 | 2784132072 | Bacteria | 6596533 |
| 880 | 2794595991 | 2791355520 | Bacteria | 5948615 |
| 881 | 2808858737 | 2808606361 | Bacteria | 6136259 |
| 882 | 2808927167 | 2808606376 | Bacteria | 6248667 |
| 883 | 2808933267 | 2808606377 | Bacteria | 6646337 |
| 884 | 2808938888 | 2808606378 | Bacteria | 6177535 |
| 885 | 2808949270 | 2808606380 | Bacteria | 6248705 |
| 886 | 2808955359 | 2808606381 | Bacteria | 6646461 |
| 887 | 2808957973 | 2808606382 | Bacteria | 6841132 |
| 888 | 2808967239 | 2808606383 | Bacteria | 6138645 |
| 889 | 2809002051 | 2808606389 | Bacteria | 6138126 |
| 890 | 2809215172 | 2808606445 | Bacteria | 6057339 |
| 891 | 2819654790 | 2818991456 | Bacteria | 6123676 |
| 892 | 2825651776 | 2825651385 | Bacteria | 6715909 |
| 893 | 2834033608 | 2834028612 | Bacteria | 6354979 |
| 894 | 2842834950 | 2842832357 | Bacteria | 5959113 |
| 895 | 2842839304 | 2842837860 | Bacteria | 6066181 |
| 896 | 2842843881 | 2842843487 | Bacteria | 6004777 |
| 897 | 2842857784 | 2842854478 | Bacteria | 6143501 |
| 898 | 2852662270 | 2852657418 | Bacteria | 6472974 |
| 899 | 2860345480 | 2860339153 | Bacteria | 6846989 |
| 900 | 2860870579 | 2860867994 | Bacteria | 5645326 |
| 901 | 2878032147 | 2878029506 | Bacteria | 6418441 |
| 902 | 2878032293 | 2878029506 | Bacteria | 6418441 |
| 903 | 2904521982 | 2904518522 | Bacteria | 6068986 |
| 904 | 2904550210 | 2904550169 | Bacteria | 6221258 |
| 905 | 2908449471 | 2908446538 | Bacteria | 6829095 |
| 906 | 2913039862 | 2913036834 | Bacteria | 6704877 |
| 907 | 2917703178 | 2917699015 | Bacteria | 7043791 |
| 908 | 2919068625 | 2919063839 | Bacteria | 6302690 |
| 909 | 2919068752 | 2919063839 | Bacteria | 6302690 |
| 910 | 2919387258 | 2919385768 | Bacteria | 5897293 |
| 911 | 2919460429 | 2919456309 | Bacteria | 6586567 |
| 912 | 2919484900 | 2919481497 | Bacteria | 6907839 |
| 913 | 2919491950 | 2919487758 | Bacteria | 5929766 |
| 914 | 2919699793 | 2919697872 | Bacteria | 6553725 |
| 915 | 2923156193 | 2923153595 | Bacteria | 6870622 |
| 916 | 2923588693 | 2923586266 | Bacteria | 6565975 |
| 917 | 2931375402 | 2931369376 | Bacteria | 6847892 |
| 918 | 2931393762 | 2931390751 | Bacteria | 6273349 |
| 919 | 2931402802 | 2931396565 | Bacteria | 7251677 |
| 920 | 2939638817 | 2939636861 | Bacteria | 6297853 |
| 921 | 2945963975 | 2945961074 | Bacteria | 7342064 |
| 922 | 2946009516 | 2946006987 | Bacteria | 6705746 |
| 923 | 2947237785 | 2947233263 | Bacteria | 6439278 |
| 924 | 2969307258 | 2969304461 | Bacteria | 6601805 |
| 925 | 2974290660 | 2974289157 | Bacteria | 6080362 |
| 926 | 2984289843 | 2984286254 | Bacteria | 6702062 |
| 927 | 2988728583 | 2988728565 | Bacteria | 6124362 |
| 928 | 2998143150 | 2998139840 | Bacteria | 6073514 |
| 929 | 3005457958 | 3005452660 | Bacteria | 5889319 |
| 930 | 3007401695 | 3007395558 | Bacteria | 6755444 |
| 931 | 3007423240 | 3007419365 | Bacteria | 7026924 |
| 932 | 3007514773 | 3007511990 | Bacteria | 6481491 |
| 933 | 3007615083 | 3007614139 | Bacteria | 6053559 |
| 934 | 3007623586 | 3007619802 | Bacteria | 6411688 |
| 935 | 3007721889 | 3007718800 | Bacteria | 5971527 |
| 936 | 3007721968 | 3007718800 | Bacteria | 5971527 |
| 937 | 3007857141 | 3007855910 | Bacteria | 5637581 |
| 938 | 3007862256 | 3007861166 | Bacteria | 6045338 |
| 939 | 8015690405 | 8015687852 | Bacteria | 6613826 |
| 940 | 8019775935 | 8019775933 | Bacteria | 6858656 |
| 941 | 8029997633 | 8029995093 | Bacteria | 5990776 |
| 942 | 8047675724 | 8047673197 | Bacteria | 7395230 |
| 943 | 8054352235 | 8054347763 | Bacteria | 5901107 |
| 944 | 8055773535 | 8055770955 | Bacteria | 6827675 |
| 945 | 8056128828 | 8056125926 | Bacteria | 6228218 |
| 946 | 8056146337 | 8056143049 | Bacteria | 6307666 |
| 947 | 8056154793 | 8056148874 | Bacteria | 6479865 |
| 948 | 8056157510 | 8056155041 | Bacteria | 6486948 |
| 949 | 8056168031 | 8056166840 | Bacteria | 5820959 |
| 950 | 8056173937 | 8056172158 | Bacteria | 6133900 |
| 951 | 8056182575 | 8056177738 | Bacteria | 6748268 |
| 952 | 8056574119 | 8056569372 | Bacteria | 5997322 |
| 953 | Ga0450910_000024 | |||
| 954 | MRS2a_Contig_1678 | |||
| 955 | SwRhRL2b_contig_2455006 | |||
| 956 | JGI25162J39368_1000013 | |||
| 957 | JGI25163J39215_1000157 | |||
| 958 | JGI25164J39214_1000005 | |||
| 959 | JGI25165J46597_1000099 | |||
| 960 | Ga0055536_1000013 | |||
| 961 | Ga0055536_1000088 | |||
| 962 | Ga0055536_1000262 | |||
| 963 | Ga0055530_10000016 | |||
| 964 | Ga0055530_10000087 | |||
| 965 | Ga0055530_10000103 | |||
| 966 | Ga0055530_10001656 | |||
| 967 | Ga0055530_10002474 | |||
| 968 | Ga0055530_10022040 | |||
| 969 | Ga0055540_1000008 | |||
| 970 | Ga0055540_1000048 | |||
| 971 | Ga0055531_10000182 | |||
| 972 | Ga0055531_10002226 | |||
| 973 | Ga0065714_10003199 | |||
| 974 | Ga0065714_10008363 | |||
| 975 | Ga0065714_10068620 | |||
| 976 | Ga0065714_10077065 | |||
| 977 | Ga0065704_10005347 | |||
| 978 | Ga0065704_10093687 | |||
| 979 | Ga0070669_100013571 | |||
| 980 | Ga0070669_100027628 | |||
| 981 | Ga0068853_100008887 | |||
| 982 | Ga0068855_100115595 | |||
| 983 | Ga0070664_100000024 | |||
| 984 | Ga0068851_10038578 | |||
| 985 | Ga0075364_10028129 | |||
| 986 | Ga0075432_10000700 | |||
| 987 | Ga0075432_10005082 | |||
| 988 | Ga0075432_10028232 | |||
| 989 | Ga0075432_10061129 | |||
| 990 | Ga0075362_10032169 | |||
| 991 | Ga0075369_10032178 | |||
| 992 | Ga0075434_100000694 | |||
| 993 | Ga0079104_1000094 | |||
| 994 | Ga0079104_1000537 | |||
| 995 | Ga0079104_1001585 | |||
| 996 | Ga0079104_1002557 | |||
| 997 | Ga0079104_1015347 | |||
| 998 | Ga0099826_10037688 | |||
| 999 | Ga0075435_100036120 | |||
| 1000 | Ga0105251_10000363 | |||
| 1001 | Ga0105251_10003033 | |||
| 1002 | Ga0105251_10007455 | |||
| 1003 | Ga0105251_10033401 | |||
| 1004 | Ga0105251_10037418 | |||
| 1005 | Ga0105251_10127775 | |||
| 1006 | Ga0105244_10000449 | |||
| 1007 | Ga0105244_10022163 | |||
| 1008 | Ga0105244_10027757 | |||
| 1009 | Ga0105244_10029457 | |||
| 1010 | Ga0105244_10037921 | |||
| 1011 | Ga0105244_10065924 | |||
| 1012 | Ga0105250_10000015 | |||
| 1013 | Ga0105250_10000155 | |||
| 1014 | Ga0105250_10013848 | |||
| 1015 | Ga0105250_10022004 | |||
| 1016 | Ga0105250_10061001 | |||
| 1017 | Ga0105240_10094827 | |||
| 1018 | Ga0105243_10000060 | |||
| 1019 | Ga0105242_10067130 | |||
| 1020 | Ga0105242_10142055 | |||
| 1021 | Ga0105237_10000042 | |||
| 1022 | Ga0105246_10000723 | |||
| 1023 | Ga0105246_10027075 | |||
| 1024 | Ga0157345_1000122 | |||
| 1025 | Ga0157373_10000374 | |||
| 1026 | Ga0157373_10000874 | |||
| 1027 | Ga0157373_10010544 | |||
| 1028 | Ga0157373_10012407 | |||
| 1029 | Ga0157373_10045459 | |||
| 1030 | Ga0157373_10075534 | |||
| 1031 | Ga0157371_10003129 | |||
| 1032 | Ga0157371_10003297 | |||
| 1033 | Ga0157370_10009404 | |||
| 1034 | Ga0157370_10011916 | |||
| 1035 | Ga0157370_10022555 | |||
| 1036 | Ga0157370_10035411 | |||
| 1037 | Ga0157370_10057151 | |||
| 1038 | Ga0157370_10138035 | |||
| 1039 | Ga0157370_10147558 | |||
| 1040 | Ga0157369_10001093 | |||
| 1041 | Ga0157369_10002233 | |||
| 1042 | Ga0157369_10002926 | |||
| 1043 | Ga0157369_10030798 | |||
| 1044 | Ga0157369_10269774 | |||
| 1045 | Ga0163162_10000137 | |||
| 1046 | Ga0163162_10007127 | |||
| 1047 | Ga0163162_10458734 | |||
| 1048 | Ga0157372_10001800 | |||
| 1049 | Ga0157375_10000050 | |||
| 1050 | Ga0157375_10047614 | |||
| 1051 | Ga0182008_10000496 | |||
| 1052 | Ga0182008_10001714 | |||
| 1053 | Ga0182008_10002492 | |||
| 1054 | Ga0182008_10003801 | |||
| 1055 | Ga0182008_10004088 | |||
| 1056 | Ga0182008_10008762 | |||
| 1057 | Ga0182008_10012414 | |||
| 1058 | Ga0182008_10067814 | |||
| 1059 | Ga0182008_10078557 | |||
| 1060 | Ga0182006_1000396 | |||
| 1061 | Ga0182006_1001125 | |||
| 1062 | Ga0182006_1010118 | |||
| 1063 | Ga0182006_1015839 | |||
| 1064 | Ga0182006_1017555 | |||
| 1065 | Ga0182007_10000303 | |||
| 1066 | Ga0182007_10000394 | |||
| 1067 | Ga0182007_10003110 | |||
| 1068 | Ga0182005_1001258 | |||
| 1069 | Ga0182005_1007476 | |||
| 1070 | Ga0182005_1008300 | |||
| 1071 | Ga0182005_1010822 | |||
| 1072 | Ga0163161_10000054 | |||
| 1073 | Ga0163161_10002749 | |||
| 1074 | Ga0163161_10016214 | |||
| 1075 | Ga0163161_10042217 | |||
| 1076 | Ga0163161_10122984 | |||
| 1077 | Ga0209760_100035 | |||
| 1078 | Ga0209563_102378 | |||
| 1079 | Ga0207427_100018 | |||
| 1080 | Ga0209437_100031 | |||
| 1081 | Ga0209233_1000012 | |||
| 1082 | Ga0209675_1009989 | |||
| 1083 | Ga0209676_1000002 | |||
| 1084 | Ga0209676_1000003 | |||
| 1085 | Ga0209676_1000050 | |||
| 1086 | Ga0209676_1000113 | |||
| 1087 | Ga0209676_1002427 | |||
| 1088 | Ga0209676_1005636 | |||
| 1089 | Ga0209676_1008145 | |||
| 1090 | Ga0209050_1000004 | |||
| 1091 | Ga0209050_1000006 | |||
| 1092 | Ga0209050_1000013 | |||
| 1093 | Ga0209050_1000126 | |||
| 1094 | Ga0209050_1000321 | |||
| 1095 | Ga0209050_1001041 | |||
| 1096 | Ga0209051_1000001 | |||
| 1097 | Ga0209051_1000007 | |||
| 1098 | Ga0209051_1000052 | |||
| 1099 | Ga0209257_1000029 | |||
| 1100 | Ga0209257_1000155 | |||
| 1101 | Ga0209257_1000256 | |||
| 1102 | Ga0207696_1000017 | |||
| 1103 | Ga0207696_1000223 | |||
| 1104 | Ga0207696_1001477 | |||
| 1105 | Ga0207696_1006322 | |||
| 1106 | Ga0207696_1012781 | |||
| 1107 | Ga0207655_1000070 | |||
| 1108 | Ga0207655_1000076 | |||
| 1109 | Ga0207655_1002401 | |||
| 1110 | Ga0207655_1004390 | |||
| 1111 | Ga0207655_1006108 | |||
| 1112 | Ga0207655_1008249 | |||
| 1113 | Ga0207655_1018119 | |||
| 1114 | Ga0207655_1024886 | |||
| 1115 | Ga0207713_1000073 | |||
| 1116 | Ga0207713_1001910 | |||
| 1117 | Ga0207713_1002185 | |||
| 1118 | Ga0207713_1004432 | |||
| 1119 | Ga0207713_1006184 | |||
| 1120 | Ga0207713_1009642 | |||
| 1121 | Ga0207713_1019313 | |||
| 1122 | Ga0207713_1024366 | |||
| 1123 | Ga0207713_1025331 | |||
| 1124 | Ga0207695_10068337 | |||
| 1125 | Ga0207671_10000474 | |||
| 1126 | Ga0207649_10000010 | |||
| 1127 | Ga0207681_10005164 | |||
| 1128 | Ga0207681_10059355 | |||
| 1129 | Ga0207706_10009243 | |||
| 1130 | Ga0207686_10024380 | |||
| 1131 | Ga0207709_10000004 | |||
| 1132 | Ga0207679_10000022 | |||
| 1133 | Ga0207639_10068990 | |||
| 1134 | Ga0209281_1000046 | |||
| 1135 | Ga0209281_1000143 | |||
| 1136 | Ga0209281_1000212 | |||
| 1137 | Ga0209281_1005093 | |||
| 1138 | Ga0207428_10022576 | |||
| 1139 | Ga0207428_10047480 | |||
| 1140 | Ga0207428_10061117 | |||
| 1141 | Ga0207428_10075095 | |||
| 1142 | Ga0207428_10085594 | |||
| 1143 | Ga0307511_10032874 | |||
| 1144 | Ga0316178_1159482 | |||
| 1145 | Ga0307408_100021029 | |||
| 1146 | Ga0307408_100035970 | |||
| 1147 | Ga0307412_10001360 | |||
| 1148 | Ga0307412_10045661 | |||
| 1149 | Ga0307416_100299513 | |||
| 1150 | Ga0307414_10004343 | |||
| 1151 | Ga0307414_10271898 | |||
| 1152 | Ga0307411_10006051 | |||
| 1153 | Ga0307411_10129347 | |||
| 1154 | Ga0373941_0021623 | |||
| 1155 | Ga0373942_0016077 | |||
| 1156 | Ga0373931_0016616 | |||
| 1157 | Ga0237819_00218 | |||
| 1158 | Ga0237819_00520 | |||
| 1159 | Ga0439438_000109 | |||
| 1160 | Ga0439438_000129 | |||
| 1161 | Ga0439438_000587 | |||
| 1162 | Ga0439438_002048 | |||
| 1163 | Ga0439438_002096 | |||
| 1164 | Ga0439438_005891 | |||
| 1165 | Ga0439447_000131 | |||
| 1166 | Ga0439447_000152 | |||
| 1167 | Ga0439447_001180 | |||
| 1168 | Ga0439447_023297 | |||
| 1169 | Ga0439466_0000118 | |||
| 1170 | Ga0439466_0001046 | |||
| 1171 | Ga0439466_0004195 | |||
| 1172 | Ga0439466_0022937 | |||
| 1173 | Ga0439466_0041876 | |||
| 1174 | Ga0439431_0000018 | |||
| 1175 | Ga0439445_0000461 | |||
| 1176 | Ga0439432_010385 | |||
| 1177 | Ga0439432_010607 | |||
| 1178 | Ga0439432_011068 | |||
| 1179 | Ga0439451_000604 | |||
| 1180 | Ga0439452_000045 | |||
| 1181 | Ga0439452_000046 | |||
| 1182 | Ga0439452_001850 | |||
| 1183 | Ga0439452_004581 | |||
| 1184 | Ga0439452_011795 | |||
| 1185 | Ga0439452_018562 | |||
| 1186 | Ga0439452_031424 | |||
| 1187 | Ga0439456_002046 | |||
| 1188 | Ga0439456_005303 | |||
| 1189 | Ga0439456_007189 | |||
| 1190 | Ga0439463_006639 | |||
| 1191 | Ga0450911_000095 | |||
| 1192 | Ga0450911_000212 | |||
| 1193 | Ga0450911_001378 | |||
| 1194 | Ga0450902_001250 | |||
| 1195 | Ga0450902_008530 | |||
| 1196 | Ga0450902_017532 | |||
| 1197 | Ga0450903_004432 | |||
| 1198 | Ga0450903_014349 | |||
| 1199 | Ga0450903_014665 | |||
| 1200 | Ga0450904_002992 | |||
| 1201 | Ga0450906_000046 | |||
| 1202 | Ga0450907_000010 | |||
| 1203 | Ga0450908_015220 | |||
| 1204 | Ga0450909_002260 | |||
| 1205 | Ga0439434_0002424 | |||
| 1206 | Ga0439460_0000683 | |||
| 1207 | Ga0466957_0050527 | |||
| 1208 | Ga0495617_000202 | |||
| 1209 | Ga0495617_010496 | |||
| 1210 | Ga0495617_011719 | |||
| 1211 | Ga0495617_018039 | |||
| 1212 | Ga0495617_020166 | |||
| 1213 | Ga0495617_043809 | |||
| 1214 | Ga0495617_057074 | |||
| 1215 | Ga0495627_000133 | |||
| 1216 | Ga0495627_001238 | |||
| 1217 | Ga0495627_001779 | |||
| 1218 | Ga0495627_002212 | |||
| 1219 | Ga0495627_003726 | |||
| 1220 | Ga0495627_004458 | |||
| 1221 | Ga0495603_0001109 | |||
| 1222 | Ga0495603_0011611 | |||
| 1223 | Ga0495603_0062626 | |||
| 1224 | Ga0495590_0000050 | |||
| 1225 | Ga0495590_0000153 | |||
| 1226 | Ga0495590_0003510 | |||
| 1227 | Ga0495590_0026640 | |||
| 1228 | Ga0495590_0028305 | |||
| 1229 | Ga0495591_000074 | |||
| 1230 | Ga0495591_000143 | |||
| 1231 | Ga0495591_000151 | |||
| 1232 | Ga0495591_000197 | |||
| 1233 | Ga0495591_000263 | |||
| 1234 | Ga0495591_000427 | |||
| 1235 | Ga0495591_003910 | |||
| 1236 | Ga0495591_004299 | |||
| 1237 | Ga0495591_006614 | |||
| 1238 | Ga0495591_007409 | |||
| 1239 | Ga0495591_015129 | |||
| 1240 | Ga0495591_022016 | |||
| 1241 | Ga0495591_045336 | |||
| 1242 | Ga0495629_0155964 | |||
| 1243 | Ga0495638_0001241 | |||
| 1244 | Ga0495638_0002344 | |||
| 1245 | Ga0495638_0002439 | |||
| 1246 | Ga0495638_0004078 | |||
| 1247 | Ga0495638_0004350 | |||
| 1248 | Ga0495638_0005769 | |||
| 1249 | Ga0495638_0018266 | |||
| 1250 | Ga0495638_0072499 | |||
| 1251 | Ga0495638_0076991 | |||
| 1252 | Ga0495638_0084145 | |||
| 1253 | Ga0495653_0010904 | |||
| 1254 | Ga0495653_0059353 | |||
| 1255 | Ga0495650_0000389 | |||
| 1256 | Ga0495650_0001924 | |||
| 1257 | Ga0495650_0003496 | |||
| 1258 | Ga0495650_0003955 | |||
| 1259 | Ga0495650_0018292 | |||
| 1260 | Ga0495650_0020877 | |||
| 1261 | Ga0495650_0047979 | |||
| 1262 | Ga0495605_0000091 | |||
| 1263 | Ga0495605_0000102 | |||
| 1264 | Ga0495605_0000505 | |||
| 1265 | Ga0495605_0000577 | |||
| 1266 | Ga0495605_0000586 | |||
| 1267 | Ga0495605_0000642 | |||
| 1268 | Ga0495605_0021805 | |||
| 1269 | Ga0495605_0028777 | |||
| 1270 | Ga0495605_0029306 | |||
| 1271 | Ga0495605_0029685 | |||
| 1272 | Ga0495605_0084480 | |||
| 1273 | Ga0495639_0000090 | |||
| 1274 | Ga0495639_0008700 | |||
| 1275 | Ga0495639_0042598 | |||
| 1276 | Ga0495584_0000014 | |||
| 1277 | Ga0495584_0000141 | |||
| 1278 | Ga0495584_0001912 | |||
| 1279 | Ga0495584_0007519 | |||
| 1280 | Ga0495584_0012709 | |||
| 1281 | Ga0495584_0014767 | |||
| 1282 | Ga0495584_0097597 | |||
| 1283 | Ga0495585_0000012 | |||
| 1284 | Ga0495585_0000016 | |||
| 1285 | Ga0495585_0005502 | |||
| 1286 | Ga0495585_0011397 | |||
| 1287 | Ga0495585_0018710 | |||
| 1288 | Ga0495585_0020154 | |||
| 1289 | Ga0495585_0059869 | |||
| 1290 | Ga0495585_0061018 | |||
| 1291 | Ga0495585_0064639 | |||
| 1292 | Ga0495585_0080733 | |||
| 1293 | Ga0495594_0002272 | |||
| 1294 | Ga0495594_0024491 | |||
| 1295 | Ga0495596_0000050 | |||
| 1296 | Ga0495596_0004400 | |||
| 1297 | Ga0495596_0012042 | |||
| 1298 | Ga0495607_0000018 | |||
| 1299 | Ga0495607_0000259 | |||
| 1300 | Ga0495607_0000271 | |||
| 1301 | Ga0495607_0002455 | |||
| 1302 | Ga0495607_0006011 | |||
| 1303 | Ga0495607_0010355 | |||
| 1304 | Ga0495607_0013254 | |||
| 1305 | Ga0495607_0017563 | |||
| 1306 | Ga0495607_0020272 | |||
| 1307 | Ga0495607_0025447 | |||
| 1308 | Ga0495607_0052799 | |||
| 1309 | Ga0495607_0054011 | |||
| 1310 | Ga0495583_0000131 | |||
| 1311 | Ga0495583_0000244 | |||
| 1312 | Ga0495583_0001087 | |||
| 1313 | Ga0495583_0001205 | |||
| 1314 | Ga0495583_0001483 | |||
| 1315 | Ga0495583_0002942 | |||
| 1316 | Ga0495583_0013915 | |||
| 1317 | Ga0495606_0000238 | |||
| 1318 | Ga0495606_0000315 | |||
| 1319 | Ga0495606_0000706 | |||
| 1320 | Ga0495606_0000883 | |||
| 1321 | Ga0495606_0001185 | |||
| 1322 | Ga0495606_0001862 | |||
| 1323 | Ga0495606_0002361 | |||
| 1324 | Ga0495606_0007650 | |||
| 1325 | Ga0495606_0013616 | |||
| 1326 | Ga0495606_0045271 | |||
| 1327 | Ga0495606_0060016 | |||
| 1328 | Ga0495610_0000568 | |||
| 1329 | Ga0495610_0004740 | |||
| 1330 | Ga0495610_0006577 | |||
| 1331 | Ga0495610_0010956 | |||
| 1332 | Ga0495616_0000041 | |||
| 1333 | Ga0495616_0000203 | |||
| 1334 | Ga0495616_0000245 | |||
| 1335 | Ga0495616_0000259 | |||
| 1336 | Ga0495616_0000364 | |||
| 1337 | Ga0495616_0026791 | |||
| 1338 | Ga0495616_0030393 | |||
| 1339 | Ga0495616_0032797 | |||
| 1340 | Ga0495616_0041596 | |||
| 1341 | Ga0495616_0043032 | |||
| 1342 | Ga0495616_0048573 | |||
| 1343 | Ga0495620_0000126 | |||
| 1344 | Ga0495620_0000678 | |||
| 1345 | Ga0495620_0001264 | |||
| 1346 | Ga0495620_0002321 | |||
| 1347 | Ga0495620_0014023 | |||
| 1348 | Ga0495620_0014817 | |||
| 1349 | Ga0495620_0021006 | |||
| 1350 | Ga0495620_0074028 | |||
| 1351 | Ga0495630_0018862 | |||
| 1352 | Ga0495630_0042359 | |||
| 1353 | Ga0495630_0068998 | |||
| 1354 | Ga0495631_0000131 | |||
| 1355 | Ga0495631_0000533 | |||
| 1356 | Ga0495631_0000554 | |||
| 1357 | Ga0495631_0000946 | |||
| 1358 | Ga0495631_0015286 | |||
| 1359 | Ga0495631_0029152 | |||
| 1360 | Ga0495631_0040339 | |||
| 1361 | Ga0495632_0000475 | |||
| 1362 | Ga0495632_0000683 | |||
| 1363 | Ga0495632_0002461 | |||
| 1364 | Ga0495632_0003181 | |||
| 1365 | Ga0495632_0003400 | |||
| 1366 | Ga0495632_0007618 | |||
| 1367 | Ga0495632_0047071 | |||
| 1368 | Ga0495632_0059453 | |||
| 1369 | Ga0495632_0063342 | |||
| 1370 | Ga0495632_0083607 | |||
| 1371 | Ga0495637_0000046 | |||
| 1372 | Ga0495637_0000275 | |||
| 1373 | Ga0495637_0002301 | |||
| 1374 | Ga0495637_0005075 | |||
| 1375 | Ga0495637_0007268 | |||
| 1376 | Ga0495637_0008706 | |||
| 1377 | Ga0495637_0023084 | |||
| 1378 | Ga0495637_0029814 | |||
| 1379 | Ga0495637_0031307 | |||
| 1380 | Ga0495637_0086538 | |||
| 1381 | Ga0495643_0000783 | |||
| 1382 | Ga0495643_0000914 | |||
| 1383 | Ga0495643_0009467 | |||
| 1384 | Ga0495643_0099519 | |||
| 1385 | Ga0495644_0000052 | |||
| 1386 | Ga0495644_0000575 | |||
| 1387 | Ga0495644_0007134 | |||
| 1388 | Ga0495644_0020322 | |||
| 1389 | Ga0495648_0002342 | |||
| 1390 | Ga0495648_0002449 | |||
| 1391 | Ga0495648_0005920 | |||
| 1392 | Ga0495648_0008610 | |||
| 1393 | Ga0495648_0017652 | |||
| 1394 | Ga0495648_0018712 | |||
| 1395 | Ga0495648_0035583 | |||
| 1396 | Ga0495648_0037822 | |||
| 1397 | Ga0495648_0060372 | |||
| 1398 | Ga0495648_0062536 | |||
| 1399 | Ga0495648_0071475 | |||
| 1400 | Ga0495666_0000286 | |||
| 1401 | Ga0495666_0015516 | |||
| 1402 | Ga0495666_0019700 | |||
| 1403 | Ga0495666_0036473 | |||
| 1404 | Ga0495642_0000452 | |||
| 1405 | Ga0495642_0000487 | |||
| 1406 | Ga0495642_0006510 | |||
| 1407 | Ga0495654_0000059 | |||
| 1408 | Ga0495654_0000104 | |||
| 1409 | Ga0495654_0000182 | |||
| 1410 | Ga0495654_0000272 | |||
| 1411 | Ga0495654_0000714 | |||
| 1412 | Ga0495654_0003320 | |||
| 1413 | Ga0495654_0009121 | |||
| 1414 | Ga0495654_0010079 | |||
| 1415 | Ga0495654_0010725 | |||
| 1416 | Ga0495654_0013750 | |||
| 1417 | Ga0495654_0013828 | |||
| 1418 | Ga0495654_0013964 | |||
| 1419 | Ga0495654_0020664 | |||
| 1420 | Ga0495654_0029395 | |||
| 1421 | Ga0495654_0033492 | |||
| 1422 | Ga0495654_0047732 | |||
| 1423 | Ga0495654_0076687 | |||
| 1424 | Ga0495654_0093135 | |||
| 1425 | Ga0495587_0001759 | |||
| 1426 | Ga0495587_0029322 | |||
| 1427 | Ga0495609_0000014 | |||
| 1428 | Ga0495609_0000069 | |||
| 1429 | Ga0495609_0001183 | |||
| 1430 | Ga0495609_0003250 | |||
| 1431 | Ga0495609_0011406 | |||
| 1432 | Ga0495609_0041072 | |||
| 1433 | Ga0495597_0000464 | |||
| 1434 | Ga0495597_0008406 | |||
| 1435 | Ga0495597_0009203 | |||
| 1436 | Ga0495597_0010952 | |||
| 1437 | Ga0495597_0013242 | |||
| 1438 | Ga0495597_0034550 | |||
| 1439 | Ga0495597_0038720 | |||
| 1440 | Ga0495597_0044820 | |||
| 1441 | Ga0495645_0262627 | |||
| 1442 | Ga0495622_0000354 | |||
| 1443 | Ga0495622_0000452 | |||
| 1444 | Ga0495622_0006019 | |||
| 1445 | Ga0495622_0011764 | |||
| 1446 | Ga0495622_0014695 | |||
| 1447 | Ga0495622_0051528 | |||
| 1448 | Ga0495633_0000730 | |||
| 1449 | Ga0495633_0010804 | |||
| 1450 | Ga0495656_0011944 | |||
| 1451 | Ga0495668_0001607 | |||
| 1452 | Ga0495668_0014348 | |||
| 1453 | Ga0495668_0060298 | |||
| 1454 | Ga0495634_0000091 | |||
| 1455 | Ga0495634_0103629 | |||
| 1456 | Ga0495611_0000067 | |||
| 1457 | Ga0495611_0000288 | |||
| 1458 | Ga0495611_0001314 | |||
| 1459 | Ga0495611_0057748 | |||
| 1460 | Ga0495625_0000103 | |||
| 1461 | Ga0495625_0000184 | |||
| 1462 | Ga0495625_0000653 | |||
| 1463 | Ga0495625_0001487 | |||
| 1464 | Ga0495625_0002094 | |||
| 1465 | Ga0495625_0008069 | |||
| 1466 | Ga0495625_0022161 | |||
| 1467 | Ga0495625_0076532 | |||
| 1468 | Ga0495625_0084228 | |||
| 1469 | Ga0495625_0171298 | |||
| 1470 | Ga0495635_0000176 | |||
| 1471 | Ga0495635_0000733 | |||
| 1472 | Ga0495659_0000295 | |||
| 1473 | Ga0495661_0000033 | |||
| 1474 | Ga0495661_0000086 | |||
| 1475 | Ga0495661_0003338 | |||
| 1476 | Ga0495661_0014364 | |||
| 1477 | Ga0495661_0035587 | |||
| 1478 | Ga0495661_0049797 | |||
| 1479 | Ga0495661_0070907 | |||
| 1480 | Ga0495588_0011495 | |||
| 1481 | Ga0495588_0027833 | |||
| 1482 | Ga0495588_0033772 | |||
| 1483 | Ga0495657_0191602 | |||
| 1484 | Ga0495623_0071612 | |||
| 1485 | Ga0495646_0006128 | |||
| 1486 | Ga0495646_0029298 | |||
| 1487 | Ga0495646_0044778 | |||
| 1488 | Ga0495669_0000824 | |||
| 1489 | Ga0495669_0001417 | |||
| 1490 | Ga0495613_0010538 | |||
| 1491 | Ga0495613_0050118 | |||
| 1492 | Ga0495670_0000061 | |||
| 1493 | Ga0495670_0000109 | |||
| 1494 | Ga0495670_0000131 | |||
| 1495 | Ga0495670_0002311 | |||
| 1496 | Ga0495670_0024483 | |||
| 1497 | Ga0495670_0054647 | |||
| 1498 | Ga0495670_0089523 | |||
| 1499 | Ga0495671_0000137 | |||
| 1500 | Ga0495671_0001202 | |||
| 1501 | Ga0495671_0002604 | |||
| 1502 | Ga0495671_0003652 | |||
| 1503 | Ga0495671_0025470 | |||
| 1504 | Ga0495671_0027624 | |||
| 1505 | Ga0495671_0035973 | |||
| 1506 | Ga0495671_0036481 | |||
| 1507 | Ga0495671_0081428 | |||
| 1508 | Ga0495671_0121103 | |||
| 1509 | Ga0495649_0000664 | |||
| 1510 | Ga0495649_0001412 | |||
| 1511 | Ga0495649_0002165 | |||
| 1512 | Ga0495649_0002578 | |||
| 1513 | Ga0495649_0002732 | |||
| 1514 | Ga0495649_0008614 | |||
| 1515 | Ga0495649_0014614 | |||
| 1516 | Ga0495649_0044431 | |||
| 1517 | Ga0495589_0000011 | |||
| 1518 | Ga0495589_0000086 | |||
| 1519 | Ga0495589_0000685 | |||
| 1520 | Ga0495589_0000854 | |||
| 1521 | Ga0495589_0001776 | |||
| 1522 | Ga0495589_0001953 | |||
| 1523 | Ga0495589_0003642 | |||
| 1524 | Ga0495589_0004341 | |||
| 1525 | Ga0495589_0025942 | |||
| 1526 | Ga0495589_0029070 | |||
| 1527 | Ga0495600_0041172 | |||
| 1528 | Ga0495660_0000042 | |||
| 1529 | Ga0495660_0002117 | |||
| 1530 | Ga0495660_0003557 | |||
| 1531 | Ga0495660_0004175 | |||
| 1532 | Ga0495660_0005027 | |||
| 1533 | Ga0495660_0006994 | |||
| 1534 | Ga0495660_0009489 | |||
| 1535 | Ga0495660_0009844 | |||
| 1536 | Ga0495660_0010071 | |||
| 1537 | Ga0495660_0013843 | |||
| 1538 | Ga0495660_0014112 | |||
| 1539 | Ga0495660_0037408 | |||
| 1540 | Ga0495660_0046028 | |||
| 1541 | Ga0495660_0055367 | |||
| 1542 | Ga0495660_0055390 | |||
| 1543 | Ga0495660_0081238 | |||
| 1544 | Ga0495660_0145241 | |||
| 1545 | Ga0495581_0018330 | |||
| 1546 | Ga0495581_0050054 | |||
| 1547 | Ga0495604_0001222 | |||
| 1548 | Ga0495604_0062711 | |||
| 1549 | Ga0495636_0011725 | |||
| 1550 | Ga0495674_0000810 | |||
| 1551 | Ga0495672_0000278 | |||
| 1552 | Ga0495672_0000800 | |||
| 1553 | Ga0495672_0001575 | |||
| 1554 | Ga0495672_0001693 | |||
| 1555 | Ga0495672_0016785 | |||
| 1556 | Ga0495672_0019739 | |||
| 1557 | Ga0495672_0041118 | |||
| 1558 | Ga0495672_0043199 | |||
| 1559 | Ga0495672_0081731 | |||
| 1560 | Ga0495672_0091905 | |||
| 1561 | Ga0495672_0149308 | |||
| 1562 | Ga0495676_0000021 | |||
| 1563 | Ga0495676_0000298 | |||
| 1564 | Ga0495680_0014075 | |||
| 1565 | Ga0495680_0016113 | |||
| 1566 | Ga0495680_0034633 | |||
| 1567 | Ga0495683_0000022 | |||
| 1568 | Ga0495683_0000327 | |||
| 1569 | Ga0495683_0006606 | |||
| 1570 | Ga0495683_0006789 | |||
| 1571 | Ga0495683_0007547 | |||
| 1572 | Ga0495683_0034583 | |||
| 1573 | Ga0495683_0051251 | |||
| 1574 | Ga0495683_0053272 | |||
| 1575 | Ga0495683_0054968 | |||
| 1576 | Ga0495687_000081 | |||
| 1577 | Ga0495687_000463 | |||
| 1578 | Ga0495687_000792 | |||
| 1579 | Ga0495687_001276 | |||
| 1580 | Ga0495675_0007448 | |||
| 1581 | Ga0495677_0000299 | |||
| 1582 | Ga0495677_0020605 | |||
| 1583 | Ga0495679_000106 | |||
| 1584 | Ga0495679_001059 | |||
| 1585 | Ga0495679_001852 | |||
| 1586 | Ga0495679_002135 | |||
| 1587 | Ga0495679_027583 | |||
| 1588 | Ga0495685_028774 | |||
| 1589 | Ga0495673_0000107 | |||
| 1590 | Ga0495673_0000536 | |||
| 1591 | Ga0495673_0000609 | |||
| 1592 | Ga0495673_0002805 | |||
| 1593 | Ga0495673_0003568 | |||
| 1594 | Ga0495673_0004419 | |||
| 1595 | Ga0495673_0005869 | |||
| 1596 | Ga0495673_0008877 | |||
| 1597 | Ga0495673_0010840 | |||
| 1598 | Ga0495673_0025184 | |||
| 1599 | Ga0495673_0048232 | |||
| 1600 | Ga0495681_0000109 | |||
| 1601 | Ga0495681_0000831 | |||
| 1602 | Ga0495681_0001811 | |||
| 1603 | Ga0495681_0002361 | |||
| 1604 | Ga0495681_0002406 | |||
| 1605 | Ga0495681_0003712 | |||
| 1606 | Ga0495681_0005492 | |||
| 1607 | Ga0495681_0005958 | |||
| 1608 | Ga0495681_0007473 | |||
| 1609 | Ga0495681_0013316 | |||
| 1610 | Ga0495681_0027199 | |||
| 1611 | Ga0495681_0027289 | |||
| 1612 | Ga0495681_0027928 | |||
| 1613 | Ga0495681_0029362 | |||
| 1614 | Ga0495681_0058388 | |||
| 1615 | Ga0495686_0000439 | |||
| 1616 | Ga0495686_0000475 | |||
| 1617 | Ga0495686_0035231 | |||
| 1618 | Ga0495686_0036252 | |||
| 1619 | Ga0495686_0172650 | |||
| 1620 | Ga0495593_0000551 | |||
| 1621 | Ga0495593_0034638 | |||
| 1622 | Ga0495593_0048208 | |||
| 1623 | Ga0495593_0082255 | |||
| 1624 | Ga0495602_0029881 | |||
| 1625 | Ga0495626_0000074 | |||
| 1626 | Ga0495626_0000112 | |||
| 1627 | Ga0495626_0000114 | |||
| 1628 | Ga0495626_0000279 | |||
| 1629 | Ga0495626_0000303 | |||
| 1630 | Ga0495626_0000538 | |||
| 1631 | Ga0495626_0000744 | |||
| 1632 | Ga0495626_0001326 | |||
| 1633 | Ga0495626_0001554 | |||
| 1634 | Ga0495626_0002282 | |||
| 1635 | Ga0495626_0005276 | |||
| 1636 | Ga0495626_0006970 | |||
| 1637 | Ga0496102_0158626 | |||
| 1638 | Ga0496103_0069867 | |||
| 1639 | Ga0496105_0042927 | |||
| 1640 | Ga0496106_0264617 | |||
| 1641 | Ga0496110_0247167 | |||
| 1642 | Ga0496111_0136288 | |||
| 1643 | Ga0496116_0000654 | |||
| 1644 | Ga0496116_0000858 | |||
| 1645 | Ga0496116_0001153 | |||
| 1646 | Ga0496116_0001414 | |||
| 1647 | Ga0496116_0048049 | |||
| 1648 | Ga0496116_0111835 | |||
| 1649 | Ga0496117_0000100 | |||
| 1650 | Ga0496117_0004465 | |||
| 1651 | Ga0496117_0007211 | |||
| 1652 | Ga0496117_0009186 | |||
| 1653 | Ga0496117_0012635 | |||
| 1654 | Ga0496117_0030750 | |||
| 1655 | Ga0496117_0058221 | |||
| 1656 | Ga0496118_0006907 | |||
| 1657 | Ga0496118_0012776 | |||
| 1658 | Ga0496118_0024933 | |||
| 1659 | Ga0496118_0033531 | |||
| 1660 | Ga0496118_0035749 | |||
| 1661 | Ga0496118_0040929 | |||
| 1662 | Ga0496118_0078693 | |||
| 1663 | Ga0496119_0008749 | |||
| 1664 | Ga0496119_0019649 | |||
| 1665 | Ga0496120_0005831 | |||
| 1666 | Ga0496120_0006095 | |||
| 1667 | Ga0496121_0000160 | |||
| 1668 | Ga0496121_0001858 | |||
| 1669 | Ga0496121_0002636 | |||
| 1670 | Ga0496121_0010373 | |||
| 1671 | Ga0496121_0013684 | |||
| 1672 | Ga0496121_0048629 | |||
| 1673 | Ga0496121_0158833 | |||
| 1674 | Ga0496122_0000259 | |||
| 1675 | Ga0496122_0001003 | |||
| 1676 | Ga0496122_0006723 | |||
| 1677 | Ga0496122_0007079 | |||
| 1678 | Ga0496122_0009373 | |||
| 1679 | Ga0496122_0035471 | |||
| 1680 | Ga0496122_0040344 | |||
| 1681 | Ga0496122_0091104 | |||
| 1682 | Ga0496122_0120772 | |||
| 1683 | Ga0496123_0000209 | |||
| 1684 | Ga0496123_0000956 | |||
| 1685 | Ga0496123_0004671 | |||
| 1686 | Ga0496123_0010220 | |||
| 1687 | Ga0496123_0013118 | |||
| 1688 | Ga0496123_0043593 | |||
| 1689 | Ga0496123_0176401 | |||
| 1690 | Ga0496124_0000338 | |||
| 1691 | Ga0496124_0000580 | |||
| 1692 | Ga0496124_0000922 | |||
| 1693 | Ga0496124_0005330 | |||
| 1694 | Ga0496124_0021010 | |||
| 1695 | Ga0496124_0034836 | |||
| 1696 | Ga0496124_0039481 | |||
| 1697 | Ga0496124_0052666 | |||
| 1698 | Ga0496124_0172047 | |||
| 1699 | Ga0496125_0000245 | |||
| 1700 | Ga0496125_0000992 | |||
| 1701 | Ga0496125_0009503 | |||
| 1702 | Ga0496125_0020733 | |||
| 1703 | Ga0496125_0069236 | |||
| 1704 | Ga0496125_0096772 | |||
| 1705 | Ga0496126_0002098 | |||
| 1706 | Ga0496126_0102808 | |||
| 1707 | Ga0495678_000343 | |||
| 1708 | Ga0495678_000500 | |||
| 1709 | Ga0495678_001452 | |||
| 1710 | Ga0495678_001593 | |||
| 1711 | Ga0495678_001740 | |||
| 1712 | Ga0495678_008303 | |||
| 1713 | Ga0495678_018542 | |||
| 1714 | Ga0495678_037456 | |||
| 1715 | Ga0495678_039366 | |||
| 1716 | Ga0495678_045100 | |||
| 1717 | Ga0495682_0000087 | |||
| 1718 | Ga0495682_0001800 | |||
| 1719 | Ga0495682_0010633 | |||
| 1720 | Ga0495682_0025414 | |||
| 1721 | Ga0501031_0171835 | |||
| 1722 | Ga0501033_0001473 | |||
| 1723 | Ga0501034_0203873 | |||
| 1724 | Ga0501036_0047672 | |||
| 1725 | Ga0501037_0022938 | |||
| 1726 | Ga0501043_0008605 | |||
| 1727 | Ga0501047_0002073 | |||
| 1728 | Ga0501070_0098534 | |||
| 1729 | Ga0501241_000412 | |||
| 1730 | Ga0501035_0002146 | |||
| 1731 | Ga0501035_0002317 | |||
| 1732 | Ga0501044_0014437 | |||
| 1733 | nmdc:mga03683_15020_c1 | |||
| 1734 | nmdc:mga08y16_65337_c1 | |||
| 1735 | nmdc:mga0n895_936_c1 | |||
| 1736 | nmdc:mga0rr50_36921_c1 | |||
| 1737 | nmdc:mga0a205_123954_c1 | |||
| 1738 | nmdc:mga0sz30_1517_c1 | |||
| 1739 | Ga0500569_020577 | |||
| 1740 | Ga0500658_0000051 | |||
| 1741 | Ga0466962_0063268 | |||
| 1742 | 2511257014 | |||
| 1743 | 2511271201 | |||
| 1744 | 2511276933 | |||
| 1745 | 2511292175 | |||
| 1746 | 2511298510 | |||
| 1747 | 2511304943 | |||
| 1748 | 2511312436 | |||
| 1749 | 2511321555 | |||
| 1750 | 2511340723 | |||
| 1751 | 2511346555 | |||
| 1752 | 2511347871 | |||
| 1753 | 2511360194 | |||
| 1754 | 2511415886 | |||
| 1755 | 2511824911 | |||
| 1756 | 2512323469 | |||
| 1757 | 2583791901 | |||
| 1758 | 2597857724 | |||
| 1759 | 2599398505 | |||
| 1760 | 2599450554 | |||
| 1761 | 2599484350 | |||
| 1762 | 2599507417 | |||
| 1763 | 2599512991 | |||
| 1764 | 2599521641 | |||
| 1765 | 2599612518 | |||
| 1766 | 2599772255 | |||
| 1767 | 2599802384 | |||
| 1768 | 2599885310 | |||
| 1769 | 2599891668 | |||
| 1770 | 2599898977 | |||
| 1771 | 2599941274 | |||
| 1772 | 2599946620 | |||
| 1773 | 2599953206 | |||
| 1774 | 2599959963 | |||
| 1775 | 2599966951 | |||
| 1776 | 2599978454 | |||
| 1777 | 2599982542 | |||
| 1778 | 2599989860 | |||
| 1779 | 2599993502 | |||
| 1780 | 2599998753 | |||
| 1781 | 2600006156 | |||
| 1782 | 2600012621 | |||
| 1783 | 2600016471 | |||
| 1784 | 2600022105 | |||
| 1785 | 2600035122 | |||
| 1786 | 2600040768 | |||
| 1787 | 2600047433 | |||
| 1788 | 2600051677 | |||
| 1789 | 2600059385 | |||
| 1790 | 2600063105 | |||
| 1791 | 2600071001 | |||
| 1792 | 2600075379 | |||
| 1793 | 2600357554 | |||
| 1794 | 2600368475 | |||
| 1795 | 2601691856 | |||
| 1796 | 2601799263 | |||
| 1797 | 2601799397 | |||
| 1798 | 2606078370 | |||
| 1799 | 2606078507 | |||
| 1800 | 2606130478 | |||
| 1801 | 2606130615 | |||
| 1802 | 2624480241 | |||
| 1803 | 2624480366 | |||
| 1804 | 2624492938 | |||
| 1805 | 2643796604 | |||
| 1806 | 2643845833 | |||
| 1807 | 2643874193 | |||
| 1808 | 2643954451 | |||
| 1809 | 2644023260 | |||
| 1810 | 2644189190 | |||
| 1811 | 2644284488 | |||
| 1812 | 2644472726 | |||
| 1813 | 2652546062 | |||
| 1814 | 2671091593 | |||
| 1815 | 2671126458 | |||
| 1816 | 2671769998 | |||
| 1817 | 2677896217 | |||
| 1818 | 2678265461 | |||
| 1819 | 2715754090 | |||
| 1820 | 2715758573 | |||
| 1821 | 2715760078 | |||
| 1822 | 2718634394 | |||
| 1823 | 2739197226 | |||
| 1824 | 2739257919 | |||
| 1825 | 2739312056 | |||
| 1826 | 2743737160 | |||
| 1827 | 2745005912 | |||
| 1828 | 2774123159 | |||
| 1829 | 2774138099 | |||
| 1830 | 2784264806 | |||
| 1831 | 2784315435 | |||
| 1832 | 2794595991 | |||
| 1833 | 2808858737 | |||
| 1834 | 2808927167 | |||
| 1835 | 2808933267 | |||
| 1836 | 2808938888 | |||
| 1837 | 2808949270 | |||
| 1838 | 2808955359 | |||
| 1839 | 2808957973 | |||
| 1840 | 2808967239 | |||
| 1841 | 2809002051 | |||
| 1842 | 2809215172 | |||
| 1843 | 2819654790 | |||
| 1844 | 2825651776 | |||
| 1845 | 2834033608 | |||
| 1846 | 2842834950 | |||
| 1847 | 2842839304 | |||
| 1848 | 2842843881 | |||
| 1849 | 2842857784 | |||
| 1850 | 2852662270 | |||
| 1851 | 2860345480 | |||
| 1852 | 2860870579 | |||
| 1853 | 2878032147 | |||
| 1854 | 2878032293 | |||
| 1855 | 2904521982 | |||
| 1856 | 2904550210 | |||
| 1857 | 2908449471 | |||
| 1858 | 2913039862 | |||
| 1859 | 2917703178 | |||
| 1860 | 2919068625 | |||
| 1861 | 2919068752 | |||
| 1862 | 2919387258 | |||
| 1863 | 2919460429 | |||
| 1864 | 2919484900 | |||
| 1865 | 2919491950 | |||
| 1866 | 2919699793 | |||
| 1867 | 2923156193 | |||
| 1868 | 2923588693 | |||
| 1869 | 2931375402 | |||
| 1870 | 2931393762 | |||
| 1871 | 2931402802 | |||
| 1872 | 2939638817 | |||
| 1873 | 2945963975 | |||
| 1874 | 2946009516 | |||
| 1875 | 2947237785 | |||
| 1876 | 2969307258 | |||
| 1877 | 2974290660 | |||
| 1878 | 2984289843 | |||
| 1879 | 2988728583 | |||
| 1880 | 2998143150 | |||
| 1881 | 3005457958 | |||
| 1882 | 3007401695 | |||
| 1883 | 3007423240 | |||
| 1884 | 3007514773 | |||
| 1885 | 3007615083 | |||
| 1886 | 3007623586 | |||
| 1887 | 3007721889 | |||
| 1888 | 3007721968 | |||
| 1889 | 3007857141 | |||
| 1890 | 3007862256 | |||
| 1891 | 8015690405 | |||
| 1892 | 8019775935 | |||
| 1893 | 8029997633 | |||
| 1894 | 8047675724 | |||
| 1895 | 8054352235 | |||
| 1896 | 8055773535 | |||
| 1897 | 8056128828 | |||
| 1898 | 8056146337 | |||
| 1899 | 8056154793 | |||
| 1900 | 8056157510 | |||
| 1901 | 8056168031 | |||
| 1902 | 8056173937 | |||
| 1903 | 8056182575 | |||
| 1904 | 8056574119 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bov-assembly2.cif.gz_B | crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution | 0.9803 | 60 | 357 |
| 5bov-assembly2.cif.gz_B | crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution | 0.9644 | 60 | 357 |
| 7jqy-assembly1.cif.gz_B | crystal structure of cfl1-d123s from burkholderia cenocepacia | 0.8563 | 67 | 357 |
| 7jqx-assembly1.cif.gz_A | crystal structure of cfl1 wild-type from burkholderia cenocepacia | 0.845 | 67 | 357 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8403 | 64 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9755 | 61 | 357 | 3.40.50.1820 |
| 5bovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9659 | 61 | 357 | 3.40.50.1820 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8944 | 67 | 153 | 3.40.50.12270 |
| af_A0A0P0WIT7_2_163_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8595 | 78 | 183 | 3.40.50.1820 |
| af_P96811_2_293_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8281 | 67 | 353 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377XWR7-F1-model_v4 | Putative epoxide hydrolase protein (EC 3.8.1.3) | 0.988 | 80 | 357 |
GO:0016020
GO:0018785 GO:0046464 GO:0047372 |
| AF-A0A4V2AR43-F1-model_v4 | Alpha/beta hydrolase | 0.9861 | 68 | 273 |
GO:0016020
GO:0016787 |
| AF-A0A2X3IXZ0-F1-model_v4 | Putative epoxide hydrolase protein | 0.9856 | 142 | 357 |
GO:0016020
GO:0046464 GO:0047372 |
| AF-A0A528AUY4-F1-model_v4 | Alpha/beta hydrolase | 0.9846 | 238 | 357 |
GO:0016787
|
| AF-A0A270QK74-F1-model_v4 | deleted | 0.9843 | 163 | 357 |
|