F486636

General Info

Members Datasets Scaffolds Average Seq Length
952 539 744 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874645413|2874649707
Length 208
Sequence SPRSRLRLLARLVPVLVVGLLCLWASPASADFRLCNNTSSRVGIALGYKDAEGWTTEGWWNISSRSCETLLRGTLVARFYYIYAIDYDRGGEWSGQAFMCSRDKEFTIRGTEDCLARGYDRTGYFEVDTGEQRAWTVQLTDANEQPSKQQRVPGLPGPVGPGVPGLPNGPPGRCPPSPPSHPRPTPPPSHNNTQHRSTKADTTKPNTQ

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
42 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
43 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
44 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
56 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
57 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
58 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
59 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
60 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
61 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
65 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
66 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
71 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
72 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
73 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
74 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
75 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
76 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
77 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
78 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
79 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
80 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
81 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
82 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
83 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
84 2904699407
85 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
86 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
87 2906610324
88 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
89 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
90 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
91 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
92 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
93 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
94 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
95 2922368715
96 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
97 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
98 2922425934
99 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
100 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
101 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
102 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
103 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
104 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
105 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
106 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
107 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
108 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
109 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
110 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
111 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
112 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
113 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
114 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
115 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
116 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
117 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
118 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
119 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
120 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
121 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
122 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
123 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
124 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
125 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
126 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
127 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
128 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
129 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
130 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
131 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
132 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
133 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
134 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
135 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
136 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
137 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
138 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
139 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
140 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
141 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
142 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
143 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
144 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
145 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
146 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
147 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
148 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
149 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
150 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
151 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
152 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
153 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
154 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
155 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
156 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
157 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
158 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
159 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
160 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
161 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
162 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
163 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
164 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
165 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
166 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
167 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
168 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
169 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
170 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
171 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
172 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
173 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
174 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
175 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
176 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
177 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
178 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
179 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
182 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
183 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
184 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
185 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
186 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
187 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
195 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
196 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
197 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
198 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
199 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
200 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
201 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
202 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
203 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
207 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
208 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
209 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
210 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
211 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
212 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
213 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
214 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
215 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
216 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
217 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
218 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
219 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
220 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
221 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
222 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
223 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
224 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
225 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
226 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
227 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
228 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
229 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
230 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
231 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
232 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
233 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
234 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
235 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
236 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
237 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
238 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
239 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
240 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
241 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
242 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
243 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
244 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
245 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
246 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
247 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
248 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
249 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
250 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
251 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
252 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
253 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
254 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
255 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
256 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
257 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
258 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
259 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
260 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
263 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
264 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
265 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
266 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
267 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
268 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
269 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
320 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
321 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
322 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
323 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
325 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
326 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
327 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
328 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
331 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
332 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
333 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
334 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
335 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
336 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
337 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
338 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
339 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
340 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
341 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
342 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
343 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
344 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
345 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
346 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
347 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
349 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
350 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
351 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
352 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
353 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
354 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
355 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
356 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
359 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
360 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
361 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
362 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
363 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
364 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
365 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
366 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
367 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
371 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
372 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
373 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
374 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
379 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
382 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
383 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
384 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
398 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
399 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
402 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
403 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
483 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
484 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
485 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
486 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
487 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
488 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
489 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
490 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
493 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
498 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
499 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
500 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
501 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
502 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
503 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
504 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
505 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
506 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
507 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
508 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
509 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
510 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
511 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
512 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
513 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
514 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
515 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
516 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
517 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
518 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
519 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
520 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
521 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
522 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
523 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
524 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
525 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
526 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
527 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
528 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
529 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
530 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
531 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
532 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
533 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
534 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
535 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
536 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
537 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
538 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
539 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.35
Metatranscriptomes 0.21
Isolates 21.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 15.76
Rhizoplane 8.09
Rhizosphere 60.19
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030012 3300001989 Bacteria 1887
2 JGI24737J22298_10016683 3300001990 Bacteria 2370
3 JGI24735J21928_10022236 3300002067 Bacteria 1933
4 Ga0070683_100059816 3300005329 Bacteria 3540
5 Ga0070683_100296554 3300005329 Bacteria 1538
6 Ga0070682_100259179 3300005337 Bacteria 1258
7 Ga0068868_100104658 3300005338 Bacteria 2294
8 Ga0068868_100121743 3300005338 Bacteria 2129
9 Ga0068868_100306083 3300005338 Bacteria 1351
10 Ga0070660_100614190 3300005339 Bacteria 910
11 Ga0070689_100027697 3300005340 Bacteria 4274
12 Ga0070689_100121490 3300005340 Bacteria 2087
13 Ga0070687_100645005 3300005343 Bacteria 733
14 Ga0070692_10643300 3300005345 Bacteria 707
15 Ga0070675_100194027 3300005354 Bacteria 1761
16 Ga0070675_100444801 3300005354 Bacteria 1162
17 Ga0070675_100672486 3300005354 Bacteria 942
18 Ga0070671_100025538 3300005355 Bacteria 4848
19 Ga0070671_100168248 3300005355 Bacteria 1854
20 Ga0070671_100712762 3300005355 Bacteria 871
21 Ga0070674_100015914 3300005356 Bacteria 4706
22 Ga0070673_100014626 3300005364 Bacteria 5476
23 Ga0070673_100268802 3300005364 Bacteria 1491
24 Ga0070673_101010118 3300005364 Bacteria 775
25 Ga0070688_100198197 3300005365 Bacteria 1403
26 Ga0070659_100368143 3300005366 Bacteria 1209
27 Ga0070667_100083614 3300005367 Bacteria 2735
28 Ga0070667_100274041 3300005367 Bacteria 1513
29 Ga0070667_100413933 3300005367 Bacteria 1228
30 Ga0070667_100444040 3300005367 Bacteria 1185
31 Ga0070709_10000619 3300005434 Bacteria 20331
32 Ga0070709_10049581 3300005434 Bacteria 2626
33 Ga0070709_10174332 3300005434 Bacteria 1505
34 Ga0070714_100004377 3300005435 Bacteria 10640
35 Ga0070714_100013145 3300005435 Bacteria 6628
36 Ga0070714_100017830 3300005435 Bacteria 5758
37 Ga0070714_100123060 3300005435 Bacteria 2309
38 Ga0070714_100273924 3300005435 Bacteria 1566
39 Ga0070714_100306490 3300005435 Bacteria 1482
40 Ga0070713_100010117 3300005436 Bacteria 6803
41 Ga0070713_100018181 3300005436 Bacteria 5341
42 Ga0070713_100078356 3300005436 Bacteria 2813
43 Ga0070713_100139415 3300005436 Bacteria 2146
44 Ga0070713_100164304 3300005436 Bacteria 1984
45 Ga0070713_100267822 3300005436 Bacteria 1563
46 Ga0070710_10000409 3300005437 Bacteria 20181
47 Ga0070710_10000804 3300005437 Bacteria 15066
48 Ga0070710_10005753 3300005437 Bacteria 5904
49 Ga0070710_10187129 3300005437 Bacteria 1300
50 Ga0070711_100000650 3300005439 Bacteria 18134
51 Ga0070711_100016256 3300005439 Bacteria 4723
52 Ga0070711_100079636 3300005439 Bacteria 2330
53 Ga0070711_100223987 3300005439 Bacteria 1463
54 Ga0070694_100576064 3300005444 Bacteria 904
55 Ga0070708_100103303 3300005445 Bacteria 2612
56 Ga0070663_100076983 3300005455 Bacteria 2441
57 Ga0070678_100207701 3300005456 Bacteria 1620
58 Ga0070662_100144654 3300005457 Bacteria 1846
59 Ga0070681_10223732 3300005458 Bacteria 1797
60 Ga0070685_10092264 3300005466 Bacteria 1835
61 Ga0070706_100343528 3300005467 Bacteria 1392
62 Ga0070706_100750060 3300005467 Bacteria 904
63 Ga0070699_100003004 3300005518 Bacteria 14991
64 Ga0070679_101081044 3300005530 Bacteria 747
65 Ga0070684_100255355 3300005535 Bacteria 1602
66 Ga0070684_100482802 3300005535 Bacteria 1147
67 Ga0070697_100141633 3300005536 Bacteria 2023
68 Ga0070697_100169978 3300005536 Bacteria 1844
69 Ga0068853_100015513 3300005539 Bacteria 6257
70 Ga0070672_100345493 3300005543 Bacteria 1268
71 Ga0070686_100056769 3300005544 Bacteria 2512
72 Ga0070686_100205680 3300005544 Bacteria 1414
73 Ga0070686_100276081 3300005544 Bacteria 1237
74 Ga0070665_100114487 3300005548 Bacteria 2700
75 Ga0068855_100026247 3300005563 Bacteria 6970
76 Ga0068855_100290975 3300005563 Bacteria 1811
77 Ga0070664_100114064 3300005564 Bacteria 2361
78 Ga0068857_100129461 3300005577 Bacteria 2276
79 Ga0068854_100002118 3300005578 Bacteria 12173
80 Ga0068854_100363706 3300005578 Bacteria 1187
81 Ga0068856_100000055 3300005614 Bacteria 104152
82 Ga0068856_100207841 3300005614 Bacteria 1972
83 Ga0068856_100339241 3300005614 Bacteria 1521
84 Ga0070702_100406306 3300005615 Bacteria 975
85 Ga0070702_101052507 3300005615 Bacteria 647
86 Ga0068859_100129787 3300005617 Bacteria 2591
87 Ga0068864_100138545 3300005618 Bacteria 2193
88 Ga0068864_100249599 3300005618 Bacteria 1647
89 Ga0068851_10455847 3300005834 Bacteria 761
90 Ga0068863_100618728 3300005841 Bacteria 1073
91 Ga0068858_100121889 3300005842 Bacteria 2439
92 Ga0068858_100147937 3300005842 Bacteria 2207
93 Ga0068858_100482458 3300005842 Bacteria 1197
94 Ga0081455_10001093 3300005937 Bacteria 34045
95 Ga0081455_10009527 3300005937 Bacteria 9976
96 Ga0081455_10211820 3300005937 Bacteria 1443
97 Ga0081538_10031425 3300005981 Bacteria 3582
98 Ga0081540_1051334 3300005983 Bacteria 2040
99 Ga0070717_10002016 3300006028 Bacteria 14209
100 Ga0070717_10002999 3300006028 Bacteria 12022
101 Ga0070717_10025250 3300006028 Bacteria 4723
102 Ga0070717_10030212 3300006028 Bacteria 4353
103 Ga0070717_10085715 3300006028 Bacteria 2651
104 Ga0070717_10416191 3300006028 Bacteria 1209
105 Ga0070717_10790035 3300006028 Bacteria 863
106 Ga0075365_10046194 3300006038 Bacteria 2859
107 Ga0075365_10127495 3300006038 Bacteria 1759
108 Ga0075365_10274272 3300006038 Bacteria 1186
109 Ga0075363_100021136 3300006048 Bacteria 3273
110 Ga0075363_100183842 3300006048 Bacteria 1190
111 Ga0075363_100280686 3300006048 Bacteria 963
112 Ga0075364_10030827 3300006051 Bacteria 3443
113 Ga0075364_10128388 3300006051 Bacteria 1701
114 Ga0075364_10320977 3300006051 Bacteria 1054
115 Ga0070715_10000199 3300006163 Bacteria 14099
116 Ga0070715_10005153 3300006163 Bacteria 4341
117 Ga0070715_10011596 3300006163 Bacteria 3179
118 Ga0070715_10166818 3300006163 Bacteria 1093
119 Ga0070715_10189802 3300006163 Bacteria 1036
120 Ga0070716_100003498 3300006173 Bacteria 7401
121 Ga0070716_100007123 3300006173 Bacteria 5493
122 Ga0070712_100026783 3300006175 Bacteria 3845
123 Ga0070712_100054155 3300006175 Bacteria 2804
124 Ga0070712_100101520 3300006175 Bacteria 2128
125 Ga0075362_10041733 3300006177 Bacteria 2025
126 Ga0075367_10031601 3300006178 Bacteria 3041
127 Ga0075367_10299047 3300006178 Bacteria 1013
128 Ga0075369_10008314 3300006186 Bacteria 3991
129 Ga0075366_10022248 3300006195 Bacteria 3687
130 Ga0075370_10001319 3300006353 Bacteria 10634
131 Ga0075370_10033800 3300006353 Bacteria 2864
132 Ga0075370_10055494 3300006353 Bacteria 2251
133 Ga0075370_10238013 3300006353 Bacteria 1078
134 Ga0075370_10501083 3300006353 Bacteria 733
135 Ga0068871_100013913 3300006358 Bacteria 5983
136 Ga0075428_100035350 3300006844 Bacteria 5508
137 Ga0075428_100463566 3300006844 Bacteria 1357
138 Ga0075428_101542115 3300006844 Bacteria 695
139 Ga0075430_100234294 3300006846 Bacteria 1522
140 Ga0075431_100087680 3300006847 Bacteria 3211
141 Ga0075431_100129587 3300006847 Bacteria 2602
142 Ga0075434_100128119 3300006871 Bacteria 2556
143 Ga0075434_100146849 3300006871 Bacteria 2378
144 Ga0075434_100159706 3300006871 Bacteria 2274
145 Ga0075434_100246619 3300006871 Bacteria 1805
146 Ga0075429_100306752 3300006880 Bacteria 1390
147 Ga0075429_100406395 3300006880 Bacteria 1193
148 Ga0068865_101283628 3300006881 Bacteria 650
149 Ga0097620_100129776 3300006931 Bacteria 2591
150 Ga0075435_100244588 3300007076 Bacteria 1526
151 Ga0075435_100406799 3300007076 Bacteria 1171
152 Ga0099795_10105977 3300007788 Bacteria 1108
153 Ga0105244_10183628 3300009036 Bacteria 991
154 Ga0105240_10023270 3300009093 Bacteria 8199
155 Ga0105240_10031437 3300009093 Bacteria 6885
156 Ga0111539_10040709 3300009094 Bacteria 5591
157 Ga0105245_10002241 3300009098 Bacteria 17507
158 Ga0105245_10167287 3300009098 Bacteria 2091
159 Ga0105247_10155765 3300009101 Bacteria 1509
160 Ga0105247_10181587 3300009101 Bacteria 1405
161 Ga0114129_10212328 3300009147 Bacteria 2615
162 Ga0114129_12414671 3300009147 Bacteria 629
163 Ga0105243_10156335 3300009148 Bacteria 1961
164 Ga0105242_10137592 3300009176 Bacteria 2115
165 Ga0105242_10831890 3300009176 Bacteria 917
166 Ga0105248_10060907 3300009177 Bacteria 4237
167 Ga0105248_10169046 3300009177 Bacteria 2464
168 Ga0105237_10024587 3300009545 Bacteria 6159
169 Ga0105237_10080340 3300009545 Bacteria 3251
170 Ga0105237_10082386 3300009545 Bacteria 3208
171 Ga0105237_10092764 3300009545 Bacteria 3009
172 Ga0105237_10214790 3300009545 Bacteria 1923
173 Ga0105238_10012908 3300009551 Bacteria 8430
174 Ga0105238_10045610 3300009551 Bacteria 4428
175 Ga0105238_10063884 3300009551 Bacteria 3682
176 Ga0105238_10333592 3300009551 Bacteria 1504
177 Ga0105238_10446993 3300009551 Bacteria 1289
178 Ga0099796_10027701 3300010159 Bacteria 1812
179 Ga0099796_10059180 3300010159 Bacteria 1352
180 Ga0105239_10012010 3300010375 Bacteria 9658
181 Ga0105239_10594306 3300010375 Bacteria 1262
182 Ga0105246_10192047 3300011119 Bacteria 1581
183 Ga0105246_10258240 3300011119 Bacteria 1387
184 Ga0105246_10679104 3300011119 Bacteria 900
185 Ga0157370_10183631 3300013104 Bacteria 1943
186 Ga0157369_10048517 3300013105 Bacteria 4607
187 Ga0157369_10086990 3300013105 Bacteria 3337
188 Ga0157369_10238439 3300013105 Bacteria 1900
189 Ga0157374_10055264 3300013296 Bacteria 3704
190 Ga0163162_10165938 3300013306 Bacteria 2332
191 Ga0163162_10278726 3300013306 Bacteria 1804
192 Ga0157375_11659215 3300013308 Bacteria 756
193 Ga0163163_10093908 3300014325 Bacteria 3017
194 Ga0163163_11712358 3300014325 Bacteria 689
195 Ga0163161_10319734 3300017792 Bacteria 1227
196 Ga0213873_10002485 3300021358 Bacteria 3193
197 Ga0213872_10013615 3300021361 Bacteria 3808
198 Ga0213872_10170767 3300021361 Bacteria 943
199 Ga0213876_10030494 3300021384 Bacteria 2844
200 Ga0213876_10343434 3300021384 Bacteria 794
201 Ga0213875_10000033 3300021388 Bacteria 170944
202 Ga0213875_10106942 3300021388 Bacteria 1306
203 Ga0213871_10068876 3300021441 Bacteria 997
204 Ga0224572_1006986 3300024225 Bacteria 2057
205 Ga0209758_1001433 3300025297 Bacteria 28167
206 Ga0209758_1043052 3300025297 Bacteria 1667
207 Ga0207682_10357695 3300025893 Bacteria 688
208 Ga0207692_10000426 3300025898 Bacteria 14792
209 Ga0207692_10016808 3300025898 Bacteria 3249
210 Ga0207642_10254575 3300025899 Bacteria 998
211 Ga0207710_10079523 3300025900 Bacteria 1518
212 Ga0207710_10299952 3300025900 Bacteria 812
213 Ga0207680_10218878 3300025903 Bacteria 1304
214 Ga0207647_10002979 3300025904 Bacteria 12743
215 Ga0207685_10000676 3300025905 Bacteria 6108
216 Ga0207685_10000725 3300025905 Bacteria 5988
217 Ga0207685_10135382 3300025905 Bacteria 1098
218 Ga0207685_10228224 3300025905 Bacteria 889
219 Ga0207699_10000368 3300025906 Bacteria 23746
220 Ga0207699_10030943 3300025906 Bacteria 3001
221 Ga0207699_10038943 3300025906 Bacteria 2728
222 Ga0207699_10059050 3300025906 Bacteria 2297
223 Ga0207699_10546944 3300025906 Bacteria 839
224 Ga0207645_10190766 3300025907 Bacteria 1347
225 Ga0207684_10049404 3300025910 Bacteria 3568
226 Ga0207684_10391356 3300025910 Bacteria 1195
227 Ga0207695_10054187 3300025913 Bacteria 4190
228 Ga0207671_10064657 3300025914 Bacteria 2720
229 Ga0207671_10068296 3300025914 Bacteria 2648
230 Ga0207671_10089125 3300025914 Bacteria 2321
231 Ga0207693_10001800 3300025915 Bacteria 18793
232 Ga0207693_10026940 3300025915 Bacteria 4546
233 Ga0207693_10062230 3300025915 Bacteria 2924
234 Ga0207693_10087406 3300025915 Bacteria 2442
235 Ga0207693_10207342 3300025915 Bacteria 1541
236 Ga0207663_10000896 3300025916 Bacteria 13571
237 Ga0207663_10013127 3300025916 Bacteria 4496
238 Ga0207663_10200555 3300025916 Bacteria 1439
239 Ga0207649_10460311 3300025920 Bacteria 961
240 Ga0207652_10042639 3300025921 Bacteria 3863
241 Ga0207652_10098763 3300025921 Bacteria 2575
242 Ga0207646_10099945 3300025922 Bacteria 2600
243 Ga0207694_10042041 3300025924 Bacteria 3524
244 Ga0207694_10107825 3300025924 Bacteria 2213
245 Ga0207694_10138458 3300025924 Bacteria 1956
246 Ga0207650_10007870 3300025925 Bacteria 7257
247 Ga0207650_10279148 3300025925 Bacteria 1360
248 Ga0207659_10106041 3300025926 Bacteria 2127
249 Ga0207659_10114854 3300025926 Bacteria 2053
250 Ga0207687_10023697 3300025927 Bacteria 4094
251 Ga0207687_10669561 3300025927 Bacteria 879
252 Ga0207687_11015715 3300025927 Bacteria 711
253 Ga0207700_10003271 3300025928 Bacteria 9371
254 Ga0207700_10022300 3300025928 Bacteria 4343
255 Ga0207700_10037832 3300025928 Bacteria 3498
256 Ga0207700_10081890 3300025928 Bacteria 2522
257 Ga0207700_10096339 3300025928 Bacteria 2349
258 Ga0207700_10140024 3300025928 Bacteria 1987
259 Ga0207700_10172138 3300025928 Bacteria 1807
260 Ga0207700_10213776 3300025928 Bacteria 1632
261 Ga0207700_10282403 3300025928 Bacteria 1428
262 Ga0207700_10429775 3300025928 Bacteria 1161
263 Ga0207700_10771619 3300025928 Bacteria 859
264 Ga0207664_10021693 3300025929 Bacteria 4783
265 Ga0207664_10098511 3300025929 Bacteria 2411
266 Ga0207664_10103552 3300025929 Bacteria 2355
267 Ga0207664_10111644 3300025929 Bacteria 2274
268 Ga0207664_10440302 3300025929 Bacteria 1162
269 Ga0207664_10699201 3300025929 Bacteria 912
270 Ga0207664_10727705 3300025929 Bacteria 892
271 Ga0207644_10003286 3300025931 Bacteria 10449
272 Ga0207644_10085957 3300025931 Bacteria 2334
273 Ga0207690_10505151 3300025932 Bacteria 978
274 Ga0207706_10033595 3300025933 Bacteria 4565
275 Ga0207706_10060299 3300025933 Bacteria 3341
276 Ga0207706_10566472 3300025933 Bacteria 977
277 Ga0207686_10704747 3300025934 Bacteria 803
278 Ga0207709_10566415 3300025935 Bacteria 895
279 Ga0207670_10111986 3300025936 Bacteria 1969
280 Ga0207670_10133649 3300025936 Bacteria 1821
281 Ga0207669_10035736 3300025937 Bacteria 2831
282 Ga0207665_10000224 3300025939 Bacteria 38643
283 Ga0207665_10001873 3300025939 Bacteria 14172
284 Ga0207665_10011625 3300025939 Bacteria 5785
285 Ga0207665_10170852 3300025939 Bacteria 1570
286 Ga0207665_10456422 3300025939 Bacteria 981
287 Ga0207691_10058529 3300025940 Bacteria 3505
288 Ga0207691_10113854 3300025940 Bacteria 2404
289 Ga0207691_10249079 3300025940 Bacteria 1534
290 Ga0207711_10081931 3300025941 Bacteria 2820
291 Ga0207711_10193303 3300025941 Bacteria 1855
292 Ga0207661_10006894 3300025944 Bacteria 8052
293 Ga0207667_10070617 3300025949 Bacteria 3634
294 Ga0207667_10174669 3300025949 Bacteria 2208
295 Ga0207667_10653345 3300025949 Bacteria 1057
296 Ga0207651_10078439 3300025960 Bacteria 2369
297 Ga0207651_11453601 3300025960 Bacteria 617
298 Ga0207712_10227463 3300025961 Bacteria 1495
299 Ga0207712_10232963 3300025961 Bacteria 1479
300 Ga0207640_10001801 3300025981 Bacteria 11500
301 Ga0207640_10641338 3300025981 Bacteria 904
302 Ga0207658_10107139 3300025986 Bacteria 2202
303 Ga0207658_10123190 3300025986 Bacteria 2071
304 Ga0207677_10159967 3300026023 Bacteria 1748
305 Ga0207677_10217451 3300026023 Bacteria 1530
306 Ga0207677_10287554 3300026023 Bacteria 1352
307 Ga0207703_10130052 3300026035 Bacteria 2173
308 Ga0207703_10210994 3300026035 Bacteria 1731
309 Ga0207703_10688485 3300026035 Bacteria 972
310 Ga0207639_11000068 3300026041 Bacteria 783
311 Ga0207678_10099266 3300026067 Bacteria 2487
312 Ga0207678_10154957 3300026067 Bacteria 1956
313 Ga0207702_10000688 3300026078 Bacteria 36556
314 Ga0207702_10010531 3300026078 Bacteria 7730
315 Ga0207676_10112674 3300026095 Bacteria 2279
316 Ga0207676_10776230 3300026095 Bacteria 933
317 Ga0207674_10050892 3300026116 Bacteria 4230
318 Ga0207683_10047974 3300026121 Bacteria 3740
319 Ga0207683_10932983 3300026121 Bacteria 806
320 Ga0207698_10436902 3300026142 Bacteria 1260
321 Ga0209179_1023692 3300027512 Bacteria 1213
322 Ga0268266_10286038 3300028379 Bacteria 1534
323 Ga0265336_10029119 3300028666 Bacteria 1723
324 Ga0265338_10001933 3300028800 Bacteria 32327
325 Ga0265324_10017106 3300029957 Bacteria 2638
326 Ga0307511_10204636 3300030521 Bacteria 1018
327 Ga0265760_10033692 3300031090 Bacteria 1513
328 Ga0265760_10116647 3300031090 Bacteria 854
329 Ga0265340_10097742 3300031247 Bacteria 1367
330 Ga0307509_10074245 3300031507 Bacteria 3537
331 Ga0307509_10166946 3300031507 Bacteria 2087
332 Ga0265313_10196075 3300031595 Bacteria 842
333 Ga0307508_10001335 3300031616 Bacteria 27906
334 Ga0307508_10127981 3300031616 Bacteria 2142
335 Ga0307516_10199557 3300031730 Bacteria 1721
336 Ga0307516_10228815 3300031730 Bacteria 1564
337 Ga0307412_10626885 3300031911 Bacteria 914
338 Ga0307507_10031018 3300033179 Bacteria 5620
339 Ga0373930_0111813 3300034816 Bacteria 658
340 Ga0373948_0009793 3300034817 Bacteria 1661
341 Ga0373950_0017673 3300034818 Bacteria 1231
342 Ga0373929_0068056 3300035085 Bacteria 847
343 Ga0373940_0016218 3300035088 Bacteria 1844
344 Ga0373944_0002616 3300035089 Bacteria 4588
345 Ga0373944_0003875 3300035089 Bacteria 3877
346 Ga0373949_0018243 3300035090 Bacteria 1589
347 Ga0373949_0066951 3300035090 Bacteria 934
348 Ga0373951_0014324 3300035091 Bacteria 1783
349 Ga0373952_0031215 3300035092 Bacteria 1184
350 Ga0373945_0050351 3300035116 Bacteria 1530
351 Ga0373960_0055424 3300035121 Bacteria 1188
352 Ga0373943_0000115 3300035170 Bacteria 30041
353 Ga0373943_0029833 3300035170 Bacteria 2578
354 Ga0373943_0049619 3300035170 Bacteria 2060
355 Ga0373943_0282078 3300035170 Bacteria 939
356 Ga0373946_0003839 3300035171 Bacteria 5337
357 Ga0373946_0005231 3300035171 Bacteria 4678
358 Ga0373955_0100773 3300035172 Bacteria 1658
359 Ga0373961_0058505 3300035241 Bacteria 1163
360 Ga0373961_0292598 3300035241 Bacteria 600
361 Ga0373931_0047704 3300035691 Bacteria 2267
362 Ga0373935_0001782 3300035692 Bacteria 12112
363 Ga0373935_0009768 3300035692 Bacteria 5747
364 Ga0373935_0034061 3300035692 Bacteria 3173
365 Ga0373935_0129457 3300035692 Bacteria 1695
366 Ga0373935_0185169 3300035692 Bacteria 1431
367 Ga0373935_0193265 3300035692 Bacteria 1403
368 Ga0373935_0208474 3300035692 Bacteria 1353
369 Ga0373927_0001673 3300035695 Bacteria 16572
370 Ga0373927_0001710 3300035695 Bacteria 16395
371 Ga0373927_0032729 3300035695 Bacteria 3386
372 Ga0373927_0048532 3300035695 Bacteria 2746
373 Ga0373927_0065899 3300035695 Bacteria 2342
374 Ga0373947_0001924 3300035725 Bacteria 12701
375 Ga0373947_0016273 3300035725 Bacteria 4275
376 Ga0373947_0045489 3300035725 Bacteria 2627
377 Ga0373947_0074035 3300035725 Bacteria 2094
378 Ga0373947_0184413 3300035725 Bacteria 1360
379 Ga0373947_0247214 3300035725 Bacteria 1178
380 Ga0316584_0039488 3300036712 Bacteria 3514
381 Ga0373925_0004011 3300037068 Bacteria 11200
382 Ga0373925_0010804 3300037068 Bacteria 6620
383 Ga0373925_0034736 3300037068 Bacteria 3717
384 Ga0373925_0321233 3300037068 Bacteria 1253
385 Ga0373925_0337713 3300037068 Bacteria 1221
386 Ga0395899_0096896 3300037312 Bacteria 2133
387 Ga0395900_0099052 3300037418 Bacteria 2995
388 Ga0395898_0018364 3300037466 Bacteria 7133
389 Ga0395898_0114634 3300037466 Bacteria 2582
390 Ga0395898_0414314 3300037466 Bacteria 1284
391 Ga0395905_0485756 3300037471 Bacteria 1135
392 Ga0436364_0816729 3300037853 Bacteria 7877
393 Ga0436364_1511242 3300037853 Bacteria 912
394 Ga0395901_0227168 3300038443 Bacteria 1949
395 Ga0395901_0348947 3300038443 Bacteria 1527
396 Ga0395901_0409313 3300038443 Bacteria 1393
397 Ga0395901_0553324 3300038443 Bacteria 1166
398 Ga0436365_0027168 3300039437 Bacteria 922
399 Ga0436365_0594440 3300039437 Bacteria 12543
400 Ga0436365_0696800 3300039437 Bacteria 10837
401 Ga0436365_0772739 3300039437 Bacteria 2157
402 Ga0436365_0914429 3300039437 Bacteria 2302
403 Ga0436365_0982478 3300039437 Bacteria 4414
404 Ga0436365_1860016 3300039437 Bacteria 982
405 Ga0436365_1876119 3300039437 Bacteria 2318
406 Ga0436360_0460383 3300039438 Bacteria 954
407 Ga0436361_0298469 3300039447 Bacteria 1326
408 Ga0436361_0531880 3300039447 Bacteria 1169
409 Ga0436361_0679525 3300039447 Bacteria 1469
410 Ga0436363_0424805 3300039450 Bacteria 1699
411 Ga0436363_0644197 3300039450 Bacteria 1170
412 Ga0436363_0904821 3300039450 Bacteria 1666
413 Ga0436363_1026561 3300039450 Bacteria 796
414 Ga0436363_1145542 3300039450 Bacteria 630
415 Ga0436362_0715867 3300039453 Bacteria 6311
416 Ga0451797_0977362 3300041453 Bacteria 740
417 Ga0451833_0759778 3300041491 Bacteria 822
418 Ga0495603_0064045 3300046455 Bacteria 2168
419 Ga0495641_0088345 3300046461 Bacteria 1386
420 Ga0495653_0169862 3300046463 Bacteria 1506
421 Ga0495580_0042943 3300046472 Bacteria 3218
422 Ga0495580_0625075 3300046472 Bacteria 710
423 Ga0495582_0063217 3300046473 Bacteria 2045
424 Ga0495639_0018784 3300046475 Bacteria 3012
425 Ga0495662_0013154 3300046476 Bacteria 4030
426 Ga0495664_0002145 3300046477 Bacteria 10553
427 Ga0495584_0003705 3300046491 Bacteria 8330
428 Ga0495618_0004115 3300046514 Bacteria 8979
429 Ga0495630_0009728 3300046517 Bacteria 6915
430 Ga0495630_0026168 3300046517 Bacteria 4319
431 Ga0495630_0138601 3300046517 Bacteria 1849
432 Ga0495630_0361455 3300046517 Bacteria 1111
433 Ga0495648_0186998 3300046524 Bacteria 1048
434 Ga0495652_0018206 3300046529 Bacteria 6268
435 Ga0495665_0042714 3300046531 Bacteria 2412
436 Ga0495665_0048332 3300046531 Bacteria 2255
437 Ga0495665_0175146 3300046531 Bacteria 1116
438 Ga0495640_0009233 3300046533 Bacteria 7692
439 Ga0495640_0009535 3300046533 Bacteria 7553
440 Ga0495640_0113326 3300046533 Bacteria 1769
441 Ga0495587_0338766 3300046536 Bacteria 839
442 Ga0495598_0002854 3300046537 Bacteria 3609
443 Ga0495621_0049786 3300046539 Bacteria 1496
444 Ga0495645_0026515 3300046543 Bacteria 4207
445 Ga0495622_0048886 3300046557 Bacteria 1964
446 Ga0495667_0263520 3300046559 Bacteria 1096
447 Ga0495667_0288295 3300046559 Bacteria 1041
448 Ga0495634_0054995 3300046642 Bacteria 2663
449 Ga0495634_0141094 3300046642 Bacteria 1529
450 Ga0495611_0115465 3300046648 Bacteria 1251
451 Ga0495635_0005989 3300046663 Bacteria 8486
452 Ga0495635_0286183 3300046663 Bacteria 1107
453 Ga0495659_0028611 3300046664 Bacteria 1930
454 Ga0495588_0125571 3300046674 Bacteria 1353
455 Ga0495646_0293685 3300046680 Bacteria 861
456 Ga0495647_0055162 3300046681 Bacteria 1555
457 Ga0495658_0055046 3300046683 Bacteria 2265
458 Ga0495613_0048311 3300046689 Bacteria 3142
459 Ga0495613_0222566 3300046689 Bacteria 1324
460 Ga0495624_0006806 3300046690 Bacteria 8073
461 Ga0495624_0162822 3300046690 Bacteria 1362
462 Ga0495624_0496525 3300046690 Bacteria 730
463 Ga0495670_0081220 3300046691 Bacteria 1652
464 Ga0495649_0197035 3300046694 Bacteria 1047
465 Ga0495600_0294090 3300046809 Bacteria 1026
466 Ga0495581_0008563 3300047315 Bacteria 5928
467 Ga0495674_0008704 3300047319 Bacteria 9653
468 Ga0495674_0106665 3300047319 Bacteria 2379
469 Ga0495674_0475495 3300047319 Bacteria 1002
470 Ga0495672_0015931 3300047320 Bacteria 5089
471 Ga0495672_0109725 3300047320 Bacteria 1482
472 Ga0495672_0146177 3300047320 Bacteria 1230
473 Ga0495676_0008456 3300047321 Bacteria 9434
474 Ga0495676_0026806 3300047321 Bacteria 4953
475 Ga0495676_0384791 3300047321 Bacteria 933
476 Ga0495680_0134987 3300047322 Bacteria 1810
477 Ga0495684_0003419 3300047471 Bacteria 12438
478 Ga0495684_0065664 3300047471 Bacteria 2758
479 Ga0495684_0131771 3300047471 Bacteria 1877
480 Ga0495684_0176020 3300047471 Bacteria 1588
481 Ga0495686_0090578 3300047472 Bacteria 1857
482 Ga0495593_0007704 3300047673 Bacteria 6285
483 Ga0496100_0033132 3300048903 Bacteria 3230
484 Ga0496100_0040098 3300048903 Bacteria 2977
485 Ga0496100_0098942 3300048903 Bacteria 2006
486 Ga0496100_0138594 3300048903 Bacteria 1721
487 Ga0496100_0304567 3300048903 Bacteria 1193
488 Ga0496100_0370246 3300048903 Bacteria 1086
489 Ga0496100_0542315 3300048903 Bacteria 899
490 Ga0496101_0010525 3300048904 Bacteria 6109
491 Ga0496101_0180781 3300048904 Bacteria 1624
492 Ga0496101_0208189 3300048904 Bacteria 1514
493 Ga0496102_0018849 3300048905 Bacteria 6070
494 Ga0496102_0061781 3300048905 Bacteria 3430
495 Ga0496102_0191676 3300048905 Bacteria 1926
496 Ga0496102_0244218 3300048905 Bacteria 1693
497 Ga0496102_0265675 3300048905 Bacteria 1618
498 Ga0496102_0868192 3300048905 Bacteria 824
499 Ga0496103_0106278 3300048906 Bacteria 1780
500 Ga0496104_0003071 3300048907 Bacteria 14389
501 Ga0496104_0026450 3300048907 Bacteria 5358
502 Ga0496104_0031830 3300048907 Bacteria 4907
503 Ga0496104_0161471 3300048907 Bacteria 2149
504 Ga0496104_0194047 3300048907 Bacteria 1943
505 Ga0496104_0896025 3300048907 Bacteria 792
506 Ga0496105_0028455 3300048908 Bacteria 4569
507 Ga0496105_0046077 3300048908 Bacteria 3599
508 Ga0496105_0066846 3300048908 Bacteria 2968
509 Ga0496105_0586989 3300048908 Bacteria 866
510 Ga0496105_0873061 3300048908 Bacteria 680
511 Ga0496106_0000935 3300048909 Bacteria 21280
512 Ga0496106_0002126 3300048909 Bacteria 14825
513 Ga0496106_0004268 3300048909 Bacteria 10632
514 Ga0496106_0209769 3300048909 Bacteria 1551
515 Ga0496106_0332443 3300048909 Bacteria 1220
516 Ga0496106_1062148 3300048909 Bacteria 635
517 Ga0496107_0018102 3300048910 Bacteria 4956
518 Ga0496107_0026410 3300048910 Bacteria 4116
519 Ga0496107_0037970 3300048910 Bacteria 3457
520 Ga0496107_0044911 3300048910 Bacteria 3177
521 Ga0496107_0084638 3300048910 Bacteria 2314
522 Ga0496108_0000681 3300048911 Bacteria 26279
523 Ga0496108_0007740 3300048911 Bacteria 8703
524 Ga0496108_0046112 3300048911 Bacteria 3641
525 Ga0496108_1025496 3300048911 Bacteria 704
526 Ga0496109_0000450 3300048912 Bacteria 35265
527 Ga0496109_0013868 3300048912 Bacteria 7005
528 Ga0496109_0028896 3300048912 Bacteria 4963
529 Ga0496109_0162976 3300048912 Bacteria 2089
530 Ga0496109_0417611 3300048912 Bacteria 1267
531 Ga0496109_0529755 3300048912 Bacteria 1112
532 Ga0496110_0013531 3300048913 Bacteria 6750
533 Ga0496110_0016966 3300048913 Bacteria 6086
534 Ga0496110_0022412 3300048913 Bacteria 5362
535 Ga0496110_0028657 3300048913 Bacteria 4785
536 Ga0496110_0176995 3300048913 Bacteria 1936
537 Ga0496110_0188172 3300048913 Bacteria 1875
538 Ga0496111_0028463 3300048914 Bacteria 3960
539 Ga0496111_0039557 3300048914 Bacteria 3381
540 Ga0496111_0058601 3300048914 Bacteria 2788
541 Ga0496111_0073344 3300048914 Bacteria 2492
542 Ga0496111_0185253 3300048914 Bacteria 1548
543 Ga0496112_0005385 3300048915 Bacteria 11059
544 Ga0496112_0033161 3300048915 Bacteria 5018
545 Ga0496112_0042495 3300048915 Bacteria 4446
546 Ga0496112_0114900 3300048915 Bacteria 2662
547 Ga0496112_0374829 3300048915 Bacteria 1364
548 Ga0496113_0018469 3300048916 Bacteria 4857
549 Ga0496113_0019604 3300048916 Bacteria 4734
550 Ga0496113_0076366 3300048916 Bacteria 2559
551 Ga0496113_0111502 3300048916 Bacteria 2130
552 Ga0496114_0021891 3300048917 Bacteria 5203
553 Ga0496114_0684857 3300048917 Bacteria 900
554 Ga0496115_0096460 3300048918 Bacteria 2421
555 Ga0496115_0097432 3300048918 Bacteria 2408
556 Ga0496115_0245481 3300048918 Bacteria 1475
557 Ga0496115_0398057 3300048918 Bacteria 1118
558 Ga0496117_0033294 3300048920 Bacteria 3899
559 Ga0496118_0008592 3300048921 Bacteria 10513
560 Ga0496121_0000555 3300048924 Bacteria 70509
561 Ga0496124_0001875 3300048927 Bacteria 28930
562 Ga0496124_0198601 3300048927 Bacteria 1527
563 Ga0496125_0022852 3300048928 Bacteria 5794
564 Ga0496125_0100666 3300048928 Bacteria 2129
565 Ga0496126_0006420 3300048929 Bacteria 13106
566 Ga0496126_0019705 3300048929 Bacteria 6638
567 Ga0496126_0128673 3300048929 Bacteria 2190
568 Ga0496126_0218350 3300048929 Bacteria 1603
569 Ga0496126_0630246 3300048929 Bacteria 841
570 Ga0501031_0044694 3300049568 Bacteria 2890
571 Ga0501032_0008306 3300049569 Bacteria 7566
572 Ga0501033_0275614 3300049570 Bacteria 1188
573 Ga0501034_0000438 3300049571 Bacteria 68973
574 Ga0501034_0003844 3300049571 Bacteria 16924
575 Ga0501034_0022890 3300049571 Bacteria 6365
576 Ga0501034_0066082 3300049571 Bacteria 3630
577 Ga0501034_0174825 3300049571 Bacteria 2114
578 Ga0501034_0265743 3300049571 Bacteria 1657
579 Ga0501036_0000416 3300049572 Bacteria 30060
580 Ga0501036_0004125 3300049572 Bacteria 11687
581 Ga0501036_0315240 3300049572 Bacteria 1307
582 Ga0501037_0014592 3300049573 Bacteria 5780
583 Ga0501037_0033411 3300049573 Bacteria 3799
584 Ga0501037_0232951 3300049573 Bacteria 1292
585 Ga0501038_0000737 3300049574 Bacteria 29223
586 Ga0501038_0039621 3300049574 Bacteria 4121
587 Ga0501038_0072428 3300049574 Bacteria 2920
588 Ga0501038_0107812 3300049574 Bacteria 2310
589 Ga0501038_0386224 3300049574 Bacteria 1085
590 Ga0501039_0067421 3300049575 Bacteria 2779
591 Ga0501040_0038181 3300049576 Bacteria 3264
592 Ga0501040_0119416 3300049576 Bacteria 1849
593 Ga0501041_0057186 3300049577 Bacteria 2385
594 Ga0501042_0001313 3300049578 Bacteria 14489
595 Ga0501042_0099622 3300049578 Bacteria 2089
596 Ga0501042_0107759 3300049578 Bacteria 2006
597 Ga0501043_0001832 3300049579 Bacteria 18242
598 Ga0501043_0034171 3300049579 Bacteria 3999
599 Ga0501043_0111878 3300049579 Bacteria 2144
600 Ga0501046_0027370 3300049580 Bacteria 4651
601 Ga0501046_0052580 3300049580 Bacteria 3210
602 Ga0501046_0267760 3300049580 Bacteria 1254
603 Ga0501047_0001390 3300049581 Bacteria 23708
604 Ga0501047_0005901 3300049581 Bacteria 11519
605 Ga0501047_0023188 3300049581 Bacteria 5959
606 Ga0501047_0577809 3300049581 Bacteria 947
607 Ga0501048_0001180 3300049582 Bacteria 19749
608 Ga0501048_0158106 3300049582 Bacteria 1603
609 Ga0501048_0220774 3300049582 Bacteria 1344
610 Ga0501048_0295798 3300049582 Bacteria 1152
611 Ga0501067_0003891 3300049583 Bacteria 8243
612 Ga0501067_0093336 3300049583 Bacteria 1671
613 Ga0501067_0198240 3300049583 Bacteria 1118
614 Ga0501067_0209696 3300049583 Bacteria 1085
615 Ga0501068_0040235 3300049584 Bacteria 2805
616 Ga0501068_0580874 3300049584 Bacteria 729
617 Ga0501069_0036772 3300049585 Bacteria 2701
618 Ga0501070_0010757 3300049586 Bacteria 7732
619 Ga0501070_0016280 3300049586 Bacteria 6247
620 Ga0501070_0016565 3300049586 Bacteria 6190
621 Ga0501070_0054916 3300049586 Bacteria 3302
622 Ga0501070_0142345 3300049586 Bacteria 1980
623 Ga0501070_0180044 3300049586 Bacteria 1740
624 Ga0501070_0430060 3300049586 Bacteria 1065
625 Ga0501071_0054913 3300049587 Bacteria 2875
626 Ga0501071_0064338 3300049587 Bacteria 2661
627 Ga0501072_0007723 3300049588 Bacteria 8164
628 Ga0501072_0092515 3300049588 Bacteria 2402
629 Ga0501072_0102119 3300049588 Bacteria 2279
630 Ga0501072_0102120 3300049588 Bacteria 2279
631 Ga0501073_0016336 3300049589 Bacteria 5380
632 Ga0501073_0058535 3300049589 Bacteria 2692
633 Ga0501073_0075852 3300049589 Bacteria 2340
634 Ga0501073_0135304 3300049589 Bacteria 1708
635 Ga0501074_0006323 3300049590 Bacteria 8552
636 Ga0501074_0015919 3300049590 Bacteria 5470
637 Ga0501074_0179441 3300049590 Bacteria 1511
638 Ga0501075_0914071 3300049591 Bacteria 667
639 Ga0501076_0113475 3300049592 Bacteria 2192
640 Ga0501076_0124967 3300049592 Bacteria 2084
641 Ga0501076_0541136 3300049592 Bacteria 960
642 Ga0501077_0179875 3300049593 Bacteria 1344
643 Ga0501077_0262503 3300049593 Bacteria 1098
644 Ga0501077_0280670 3300049593 Bacteria 1060
645 Ga0501079_0052957 3300049741 Bacteria 3131
646 Ga0501079_0061415 3300049741 Bacteria 2899
647 Ga0501079_0063678 3300049741 Bacteria 2845
648 Ga0501079_0073351 3300049741 Bacteria 2645
649 Ga0501079_0087569 3300049741 Bacteria 2411
650 Ga0501079_0649568 3300049741 Bacteria 830
651 Ga0501080_0002488 3300049742 Bacteria 16133
652 Ga0501080_0046502 3300049742 Bacteria 4040
653 Ga0501080_0097557 3300049742 Bacteria 2729
654 Ga0501080_0229303 3300049742 Bacteria 1698
655 Ga0501081_0145626 3300049743 Bacteria 1700
656 Ga0501081_0534934 3300049743 Bacteria 875
657 Ga0501083_0001790 3300049744 Bacteria 14696
658 Ga0501083_0145200 3300049744 Bacteria 1553
659 Ga0501083_0181304 3300049744 Bacteria 1375
660 Ga0501083_0274597 3300049744 Bacteria 1096
661 Ga0501035_0002696 3300049822 Bacteria 17272
662 Ga0501035_0401386 3300049822 Bacteria 1140
663 Ga0501035_0534851 3300049822 Bacteria 961
664 Ga0501044_0027460 3300049823 Bacteria 6015
665 Ga0501044_0038096 3300049823 Bacteria 5021
666 Ga0501044_0044741 3300049823 Bacteria 4591
667 Ga0501044_0112058 3300049823 Bacteria 2735
668 Ga0501044_0131574 3300049823 Bacteria 2496
669 Ga0501045_0025935 3300049824 Bacteria 4213
670 nmdc:mga03683_153110_c1 3300050489 Bacteria 1041
671 nmdc:mga03683_2726_c1 3300050489 Bacteria 5544
672 nmdc:mga03n38_6933_c1 3300050490 Bacteria 3977
673 nmdc:mga00v17_272781_c1 3300050491 Bacteria 1098
674 nmdc:mga00v17_29550_c1 3300050491 Bacteria 2048
675 nmdc:mga00v17_411310_c1 3300050491 Bacteria 879
676 nmdc:mga0yw44_175002_c1 3300050492 Bacteria 1411
677 nmdc:mga0yw44_21452_c1 3300050492 Bacteria 3603
678 nmdc:mga0yw44_355062_c1 3300050492 Bacteria 987
679 nmdc:mga0yw44_75449_c1 3300050492 Bacteria 2102
680 nmdc:mga0k408_12293_c1 3300050493 Bacteria 4678
681 nmdc:mga0k408_247709_c1 3300050493 Bacteria 1064
682 nmdc:mga0k408_460264_c1 3300050493 Bacteria 755
683 nmdc:mga06z11_156954_c1 3300050494 Bacteria 1298
684 nmdc:mga06z11_20718_c1 3300050494 Bacteria 3043
685 nmdc:mga06z11_253959_c1 3300050494 Bacteria 1036
686 nmdc:mga04h51_6058_c1 3300050495 Bacteria 3115
687 nmdc:mga07m45_14615_c1 3300050496 Bacteria 4185
688 nmdc:mga07m45_55257_c1 3300050496 Bacteria 2244
689 nmdc:mga07m45_727304_c1 3300050496 Bacteria 570
690 nmdc:mga07m45_87138_c1 3300050496 Bacteria 1786
691 nmdc:mga05p37_1778888_c1 3300050507 Bacteria 596
692 nmdc:mga05p37_7061_c1 3300050507 Bacteria 13239
693 nmdc:mga05p37_89575_c1 3300050507 Bacteria 3792
694 nmdc:mga09592_198436_c1 3300050508 Bacteria 1737
695 nmdc:mga09592_80417_c1 3300050508 Bacteria 2775
696 nmdc:mga0qj67_215164_c1 3300050509 Bacteria 1560
697 nmdc:mga0qj67_237381_c1 3300050509 Bacteria 1479
698 nmdc:mga06r32_367562_c1 3300050510 Bacteria 1422
699 nmdc:mga06r32_51010_c1 3300050510 Bacteria 3959
700 nmdc:mga08y16_114066_c1 3300050511 Bacteria 2813
701 nmdc:mga0n895_1087569_c1 3300050512 Bacteria 777
702 nmdc:mga0n895_157102_c1 3300050512 Bacteria 2305
703 nmdc:mga0n895_228952_c1 3300050512 Bacteria 1887
704 nmdc:mga0n895_620305_c1 3300050512 Bacteria 1082
705 nmdc:mga0rr50_696127_c1 3300050513 Bacteria 867
706 nmdc:mga08x19_1183709_c1 3300050514 Bacteria 542
707 nmdc:mga0a205_159325_c1 3300050515 Bacteria 2154
708 nmdc:mga0a205_487499_c1 3300050515 Bacteria 1090
709 nmdc:mga0sz30_280630_c1 3300050516 Bacteria 742
710 Ga0495601_0025509 3300053077 Bacteria 3645
711 Ga0495601_0238094 3300053077 Bacteria 1188
712 Ga0495601_0362319 3300053077 Bacteria 942
713 Ga0495612_0006854 3300053078 Bacteria 4663
714 Ga0495612_0110216 3300053078 Bacteria 1177
715 Ga0495595_0031207 3300053084 Bacteria 2394
716 Ga0495595_0075934 3300053084 Bacteria 1594
717 Ga0495619_0003833 3300053085 Bacteria 9683
718 Ga0495619_0026656 3300053085 Bacteria 3719
719 Ga0500578_0328900 3300053086 Bacteria 899
720 Ga0500651_0038350 3300053093 Bacteria 3018
721 Ga0500566_0028972 3300053094 Bacteria 3235
722 Ga0500595_010000 3300053119 Bacteria 3793
723 Ga0500595_013874 3300053119 Bacteria 3074
724 Ga0500577_0150212 3300053142 Bacteria 988
725 Ga0500616_0000001 3300053153 Bacteria 1986011
726 Ga0500616_0154030 3300053153 Bacteria 1061
727 Ga0500622_0177696 3300053156 Bacteria 986
728 Ga0500636_0143335 3300053177 Bacteria 1320
729 Ga0500637_0087617 3300053178 Bacteria 1800
730 Ga0500657_132335 3300053728 Bacteria 964
731 Ga0500645_000144 3300053730 Bacteria 55783
732 Ga0501084_0142632 3300054114 Bacteria 2017
733 Ga0501084_0176000 3300054114 Bacteria 1806
734 Ga0501084_0199467 3300054114 Bacteria 1688
735 Ga0501084_0375871 3300054114 Bacteria 1201
736 Ga0501082_0061018 3300060353 Bacteria 3246
737 Ga0501082_0103022 3300060353 Bacteria 2469
738 Ga0501082_0144333 3300060353 Bacteria 2066
739 Ga0501082_0355369 3300060353 Bacteria 1278
740 Ga0501082_0819275 3300060353 Bacteria 814
741 Ga0530510_0036040 3300061734 Bacteria 3566
742 Ga0530510_0058110 3300061734 Bacteria 2796
743 Ga0530510_0259121 3300061734 Bacteria 1296
744 Ga0530510_0489640 3300061734 Bacteria 932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10023270 Ga0105240_100232703 150
2 3300025916 Ga0207663_10200555 Ga0207663_102005553 150
3 3300031247 Ga0265340_10097742 Ga0265340_100977422 151
4 3300031595 Ga0265313_10196075 Ga0265313_101960752 151
5 3300053153 Ga0500616_0154030 Ga0500616_0154030_375_905 152
6 3300005338 Ga0068868_100104658 Ga0068868_1001046582 153
7 3300005354 Ga0070675_100194027 Ga0070675_1001940272 153
8 3300005356 Ga0070674_100015914 Ga0070674_1000159145 153
9 3300005367 Ga0070667_100444040 Ga0070667_1004440402 153
10 3300005543 Ga0070672_100345493 Ga0070672_1003454931 153
11 3300005578 Ga0068854_100363706 Ga0068854_1003637062 153
12 3300005615 Ga0070702_100406306 Ga0070702_1004063062 153
13 3300013306 Ga0163162_10278726 Ga0163162_102787262 153
14 3300025926 Ga0207659_10114854 Ga0207659_101148542 153
15 3300025937 Ga0207669_10035736 Ga0207669_100357362 153
16 3300025940 Ga0207691_10249079 Ga0207691_102490792 153
17 3300025986 Ga0207658_10123190 Ga0207658_101231902 153
18 3300048917 Ga0496114_0684857 Ga0496114_0684857_361_864 153
19 3300005518 Ga0070699_100003004 Ga0070699_1000030046 154
20 3300009551 Ga0105238_10446993 Ga0105238_104469932 154
21 3300035241 Ga0373961_0292598 Ga0373961_0292598_38_544 154
22 3300047320 Ga0495672_0109725 Ga0495672_0109725_334_858 154
23 3300048903 Ga0496100_0542315 Ga0496100_0542315_308_814 154
24 3300048907 Ga0496104_0003071 Ga0496104_0003071_12471_12977 154
25 3300048908 Ga0496105_0873061 Ga0496105_0873061_88_594 154
26 3300048913 Ga0496110_0188172 Ga0496110_0188172_606_1112 154
27 3300048918 Ga0496115_0245481 Ga0496115_0245481_877_1383 154
28 3300006051 Ga0075364_10030827 Ga0075364_100308274 155
29 3300034818 Ga0373950_0017673 Ga0373950_0017673_157_714 155
30 3300049574 Ga0501038_0386224 Ga0501038_0386224_504_1010 155
31 3300049576 Ga0501040_0119416 Ga0501040_0119416_608_1114 155
32 3300049577 Ga0501041_0057186 Ga0501041_0057186_1052_1558 155
33 3300049578 Ga0501042_0107759 Ga0501042_0107759_498_1004 155
34 3300049580 Ga0501046_0267760 Ga0501046_0267760_113_619 155
35 3300049582 Ga0501048_0158106 Ga0501048_0158106_339_845 155
36 3300049587 Ga0501071_0054913 Ga0501071_0054913_1798_2304 155
37 3300049588 Ga0501072_0102119 Ga0501072_0102119_642_1148 155
38 3300049592 Ga0501076_0113475 Ga0501076_0113475_997_1503 155
39 3300049593 Ga0501077_0179875 Ga0501077_0179875_243_749 155
40 3300049741 Ga0501079_0061415 Ga0501079_0061415_539_1045 155
41 3300050496 nmdc:mga07m45_727304_c1 nmdc:mga07m45_727304_c1_15_545 155
42 3300054114 Ga0501084_0176000 Ga0501084_0176000_985_1491 155
43 3300054114 Ga0501084_0375871 Ga0501084_0375871_141_776 155
44 3300060353 Ga0501082_0103022 Ga0501082_0103022_1920_2426 155
45 3300061734 Ga0530510_0058110 Ga0530510_0058110_1635_2141 155
46 3300005536 Ga0070697_100141633 Ga0070697_1001416332 156
47 3300006028 Ga0070717_10025250 Ga0070717_100252505 156
48 3300006038 Ga0075365_10127495 Ga0075365_101274952 156
49 3300006163 Ga0070715_10005153 Ga0070715_100051535 156
50 3300006844 Ga0075428_100035350 Ga0075428_1000353503 156
51 3300006844 Ga0075428_101542115 Ga0075428_1015421151 156
52 3300006846 Ga0075430_100234294 Ga0075430_1002342942 156
53 3300006847 Ga0075431_100129587 Ga0075431_1001295872 156
54 3300007076 Ga0075435_100406799 Ga0075435_1004067992 156
55 3300009147 Ga0114129_10212328 Ga0114129_102123282 156
56 3300025905 Ga0207685_10000676 Ga0207685_100006767 156
57 3300025906 Ga0207699_10038943 Ga0207699_100389433 156
58 3300025928 Ga0207700_10096339 Ga0207700_100963392 156
59 3300025929 Ga0207664_10440302 Ga0207664_104403022 156
60 3300031090 Ga0265760_10033692 Ga0265760_100336922 156
61 3300035170 Ga0373943_0282078 Ga0373943_0282078_307_894 156
62 3300035695 Ga0373927_0065899 Ga0373927_0065899_649_1236 156
63 3300037418 Ga0395900_0099052 Ga0395900_0099052_20_529 156
64 3300037466 Ga0395898_0414314 Ga0395898_0414314_147_656 156
65 3300038443 Ga0395901_0348947 Ga0395901_0348947_289_798 156
66 3300039437 Ga0436365_1860016 Ga0436365_1860016_81_608 156
67 3300048905 Ga0496102_0265675 Ga0496102_0265675_937_1446 156
68 3300048910 Ga0496107_0084638 Ga0496107_0084638_240_749 156
69 3300049741 Ga0501079_0649568 Ga0501079_0649568_145_654 156
70 3300050492 nmdc:mga0yw44_75449_c1 nmdc:mga0yw44_75449_c1_505_1014 156
71 3300050507 nmdc:mga05p37_89575_c1 nmdc:mga05p37_89575_c1_303_812 156
72 3300050509 nmdc:mga0qj67_215164_c1 nmdc:mga0qj67_215164_c1_897_1406 156
73 3300050510 nmdc:mga06r32_51010_c1 nmdc:mga06r32_51010_c1_2812_3321 156
74 3300050514 nmdc:mga08x19_1183709_c1 nmdc:mga08x19_1183709_c1_23_532 156
75 3300005354 Ga0070675_100444801 Ga0070675_1004448012 157
76 3300005364 Ga0070673_101010118 Ga0070673_1010101181 157
77 3300006844 Ga0075428_100463566 Ga0075428_1004635662 157
78 3300006880 Ga0075429_100406395 Ga0075429_1004063952 157
79 3300017792 Ga0163161_10319734 Ga0163161_103197342 157
80 3300025907 Ga0207645_10190766 Ga0207645_101907662 157
81 3300025926 Ga0207659_10106041 Ga0207659_101060412 157
82 3300025940 Ga0207691_10113854 Ga0207691_101138542 157
83 3300025960 Ga0207651_11453601 Ga0207651_114536011 157
84 3300031090 Ga0265760_10116647 Ga0265760_101166472 157
85 3300037466 Ga0395898_0114634 Ga0395898_0114634_1051_1623 157
86 3300038443 Ga0395901_0227168 Ga0395901_0227168_1209_1781 157
87 3300048907 Ga0496104_0896025 Ga0496104_0896025_34_594 157
88 3300049569 Ga0501032_0008306 Ga0501032_0008306_3265_3774 157
89 3300049570 Ga0501033_0275614 Ga0501033_0275614_413_985 157
90 3300049571 Ga0501034_0003844 Ga0501034_0003844_10506_11015 157
91 3300049571 Ga0501034_0022890 Ga0501034_0022890_2967_3476 157
92 3300049572 Ga0501036_0000416 Ga0501036_0000416_13134_13643 157
93 3300049573 Ga0501037_0014592 Ga0501037_0014592_3377_3886 157
94 3300049574 Ga0501038_0072428 Ga0501038_0072428_1283_1792 157
95 3300049579 Ga0501043_0001832 Ga0501043_0001832_7330_7839 157
96 3300049580 Ga0501046_0027370 Ga0501046_0027370_83_592 157
97 3300049581 Ga0501047_0001390 Ga0501047_0001390_15842_16351 157
98 3300049582 Ga0501048_0001180 Ga0501048_0001180_4736_5245 157
99 3300049583 Ga0501067_0093336 Ga0501067_0093336_241_786 157
100 3300049586 Ga0501070_0016280 Ga0501070_0016280_3776_4285 157
101 3300049589 Ga0501073_0016336 Ga0501073_0016336_3946_4455 157
102 3300049590 Ga0501074_0006323 Ga0501074_0006323_2739_3248 157
103 3300049742 Ga0501080_0002488 Ga0501080_0002488_2494_3003 157
104 3300049744 Ga0501083_0001790 Ga0501083_0001790_2327_2836 157
105 3300049822 Ga0501035_0534851 Ga0501035_0534851_168_677 157
106 3300049823 Ga0501044_0027460 Ga0501044_0027460_1785_2294 157
107 3300049823 Ga0501044_0038096 Ga0501044_0038096_2641_3150 157
108 3300060353 Ga0501082_0061018 Ga0501082_0061018_150_659 157
109 3300005337 Ga0070682_100259179 Ga0070682_1002591792 158
110 3300005338 Ga0068868_100306083 Ga0068868_1003060832 158
111 3300005340 Ga0070689_100027697 Ga0070689_1000276975 158
112 3300005345 Ga0070692_10643300 Ga0070692_106433001 158
113 3300005355 Ga0070671_100025538 Ga0070671_1000255384 158
114 3300005364 Ga0070673_100268802 Ga0070673_1002688021 158
115 3300005466 Ga0070685_10092264 Ga0070685_100922642 158
116 3300005467 Ga0070706_100343528 Ga0070706_1003435282 158
117 3300005530 Ga0070679_101081044 Ga0070679_1010810441 158
118 3300005544 Ga0070686_100276081 Ga0070686_1002760812 158
119 3300005617 Ga0068859_100129787 Ga0068859_1001297872 158
120 3300005618 Ga0068864_100138545 Ga0068864_1001385452 158
121 3300005841 Ga0068863_100618728 Ga0068863_1006187281 158
122 3300005842 Ga0068858_100482458 Ga0068858_1004824582 158
123 3300006881 Ga0068865_101283628 Ga0068865_1012836281 158
124 3300006931 Ga0097620_100129776 Ga0097620_1001297762 158
125 3300009147 Ga0114129_12414671 Ga0114129_124146711 158
126 3300009176 Ga0105242_10831890 Ga0105242_108318902 158
127 3300009177 Ga0105248_10169046 Ga0105248_101690461 158
128 3300011119 Ga0105246_10192047 Ga0105246_101920472 158
129 3300013308 Ga0157375_11659215 Ga0157375_116592152 158
130 3300025893 Ga0207682_10357695 Ga0207682_103576951 158
131 3300025899 Ga0207642_10254575 Ga0207642_102545752 158
132 3300025910 Ga0207684_10391356 Ga0207684_103913562 158
133 3300025927 Ga0207687_10669561 Ga0207687_106695612 158
134 3300025927 Ga0207687_11015715 Ga0207687_110157152 158
135 3300025931 Ga0207644_10085957 Ga0207644_100859572 158
136 3300025933 Ga0207706_10566472 Ga0207706_105664722 158
137 3300025939 Ga0207665_10170852 Ga0207665_101708522 158
138 3300025941 Ga0207711_10081931 Ga0207711_100819313 158
139 3300025960 Ga0207651_10078439 Ga0207651_100784394 158
140 3300025961 Ga0207712_10232963 Ga0207712_102329632 158
141 3300026023 Ga0207677_10159967 Ga0207677_101599672 158
142 3300026023 Ga0207677_10287554 Ga0207677_102875542 158
143 3300026035 Ga0207703_10688485 Ga0207703_106884852 158
144 3300026041 Ga0207639_11000068 Ga0207639_110000681 158
145 3300026067 Ga0207678_10154957 Ga0207678_101549571 158
146 3300026095 Ga0207676_10112674 Ga0207676_101126742 158
147 3300026121 Ga0207683_10047974 Ga0207683_100479744 158
148 3300034816 Ga0373930_0111813 Ga0373930_0111813_59_580 158
149 3300034817 Ga0373948_0009793 Ga0373948_0009793_411_932 158
150 3300035085 Ga0373929_0068056 Ga0373929_0068056_59_580 158
151 3300035088 Ga0373940_0016218 Ga0373940_0016218_545_1066 158
152 3300035090 Ga0373949_0066951 Ga0373949_0066951_227_748 158
153 3300035091 Ga0373951_0014324 Ga0373951_0014324_289_810 158
154 3300035121 Ga0373960_0055424 Ga0373960_0055424_123_644 158
155 3300035241 Ga0373961_0058505 Ga0373961_0058505_423_944 158
156 3300035691 Ga0373931_0047704 Ga0373931_0047704_1637_2158 158
157 3300035692 Ga0373935_0193265 Ga0373935_0193265_257_778 158
158 3300046690 Ga0495624_0496525 Ga0495624_0496525_180_701 158
159 3300048903 Ga0496100_0040098 Ga0496100_0040098_769_1290 158
160 3300048904 Ga0496101_0010525 Ga0496101_0010525_2019_2540 158
161 3300048905 Ga0496102_0191676 Ga0496102_0191676_1243_1764 158
162 3300048906 Ga0496103_0106278 Ga0496103_0106278_472_993 158
163 3300048907 Ga0496104_0161471 Ga0496104_0161471_1188_1709 158
164 3300048908 Ga0496105_0046077 Ga0496105_0046077_1794_2315 158
165 3300048909 Ga0496106_0209769 Ga0496106_0209769_42_563 158
166 3300048910 Ga0496107_0026410 Ga0496107_0026410_1466_1987 158
167 3300048912 Ga0496109_0013868 Ga0496109_0013868_682_1203 158
168 3300048913 Ga0496110_0013531 Ga0496110_0013531_2597_3118 158
169 3300048914 Ga0496111_0058601 Ga0496111_0058601_1690_2211 158
170 3300048916 Ga0496113_0111502 Ga0496113_0111502_59_580 158
171 3300048917 Ga0496114_0021891 Ga0496114_0021891_3506_4027 158
172 3300048918 Ga0496115_0097432 Ga0496115_0097432_312_833 158
173 3300049589 Ga0501073_0058535 Ga0501073_0058535_1014_1532 158
174 3300049742 Ga0501080_0229303 Ga0501080_0229303_585_1103 158
175 3300049822 Ga0501035_0002696 Ga0501035_0002696_4159_4680 158
176 3300050494 nmdc:mga06z11_253959_c1 nmdc:mga06z11_253959_c1_346_864 158
177 3300050507 nmdc:mga05p37_1778888_c1 nmdc:mga05p37_1778888_c1_38_553 158
178 3300025925 Ga0207650_10279148 Ga0207650_102791482 159
179 3300025961 Ga0207712_10227463 Ga0207712_102274632 159
180 3300026035 Ga0207703_10210994 Ga0207703_102109942 159
181 3300035092 Ga0373952_0031215 Ga0373952_0031215_152_724 159
182 3300035170 Ga0373943_0049619 Ga0373943_0049619_30_641 159
183 3300035692 Ga0373935_0185169 Ga0373935_0185169_210_821 159
184 3300035725 Ga0373947_0247214 Ga0373947_0247214_361_972 159
185 3300037068 Ga0373925_0321233 Ga0373925_0321233_132_704 159
186 3300037068 Ga0373925_0337713 Ga0373925_0337713_200_811 159
187 3300046476 Ga0495662_0013154 Ga0495662_0013154_782_1393 159
188 3300046477 Ga0495664_0002145 Ga0495664_0002145_6571_7182 159
189 3300046491 Ga0495584_0003705 Ga0495584_0003705_2426_2947 159
190 3300046514 Ga0495618_0004115 Ga0495618_0004115_6144_6755 159
191 3300046517 Ga0495630_0026168 Ga0495630_0026168_3294_3905 159
192 3300046529 Ga0495652_0018206 Ga0495652_0018206_3257_3868 159
193 3300046533 Ga0495640_0009535 Ga0495640_0009535_4615_5226 159
194 3300046543 Ga0495645_0026515 Ga0495645_0026515_2229_2840 159
195 3300046559 Ga0495667_0263520 Ga0495667_0263520_369_941 159
196 3300046642 Ga0495634_0141094 Ga0495634_0141094_112_723 159
197 3300046663 Ga0495635_0005989 Ga0495635_0005989_5996_6607 159
198 3300046663 Ga0495635_0286183 Ga0495635_0286183_142_714 159
199 3300046680 Ga0495646_0293685 Ga0495646_0293685_53_664 159
200 3300046689 Ga0495613_0048311 Ga0495613_0048311_279_851 159
201 3300046809 Ga0495600_0294090 Ga0495600_0294090_228_800 159
202 3300047319 Ga0495674_0008704 Ga0495674_0008704_3376_3987 159
203 3300047321 Ga0495676_0384791 Ga0495676_0384791_152_724 159
204 3300047471 Ga0495684_0065664 Ga0495684_0065664_1948_2559 159
205 3300048904 Ga0496101_0208189 Ga0496101_0208189_717_1289 159
206 3300048907 Ga0496104_0031830 Ga0496104_0031830_1230_1802 159
207 3300048908 Ga0496105_0028455 Ga0496105_0028455_1735_2307 159
208 3300048910 Ga0496107_0044911 Ga0496107_0044911_1948_2520 159
209 3300048911 Ga0496108_0007740 Ga0496108_0007740_2301_2873 159
210 3300048912 Ga0496109_0028896 Ga0496109_0028896_3451_4023 159
211 3300048913 Ga0496110_0022412 Ga0496110_0022412_871_1443 159
212 3300048914 Ga0496111_0073344 Ga0496111_0073344_1379_1951 159
213 3300048915 Ga0496112_0042495 Ga0496112_0042495_2172_2744 159
214 3300048916 Ga0496113_0019604 Ga0496113_0019604_1862_2434 159
215 3300049571 Ga0501034_0000438 Ga0501034_0000438_17355_17870 159
216 3300049572 Ga0501036_0315240 Ga0501036_0315240_275_853 159
217 3300049578 Ga0501042_0099622 Ga0501042_0099622_1028_1606 159
218 3300049585 Ga0501069_0036772 Ga0501069_0036772_762_1280 159
219 3300049586 Ga0501070_0142345 Ga0501070_0142345_521_1036 159
220 3300049588 Ga0501072_0102120 Ga0501072_0102120_289_867 159
221 3300049592 Ga0501076_0124967 Ga0501076_0124967_1453_2031 159
222 3300049741 Ga0501079_0073351 Ga0501079_0073351_1448_2026 159
223 3300049742 Ga0501080_0097557 Ga0501080_0097557_1682_2260 159
224 3300049744 Ga0501083_0181304 Ga0501083_0181304_177_692 159
225 3300049823 Ga0501044_0131574 Ga0501044_0131574_1302_1826 159
226 3300050507 nmdc:mga05p37_7061_c1 nmdc:mga05p37_7061_c1_8038_8610 159
227 3300050508 nmdc:mga09592_80417_c1 nmdc:mga09592_80417_c1_826_1398 159
228 3300050509 nmdc:mga0qj67_237381_c1 nmdc:mga0qj67_237381_c1_327_851 159
229 3300050510 nmdc:mga06r32_367562_c1 nmdc:mga06r32_367562_c1_186_758 159
230 3300050511 nmdc:mga08y16_114066_c1 nmdc:mga08y16_114066_c1_1381_1953 159
231 3300050512 nmdc:mga0n895_228952_c1 nmdc:mga0n895_228952_c1_408_980 159
232 3300050515 nmdc:mga0a205_487499_c1 nmdc:mga0a205_487499_c1_27_599 159
233 3300053077 Ga0495601_0025509 Ga0495601_0025509_32_643 159
234 3300053078 Ga0495612_0006854 Ga0495612_0006854_2455_3066 159
235 3300053084 Ga0495595_0031207 Ga0495595_0031207_1771_2382 159
236 3300053085 Ga0495619_0003833 Ga0495619_0003833_2031_2642 159
237 3300061734 Ga0530510_0036040 Ga0530510_0036040_1523_2101 159
238 iso_pu_bacteria 2841941048 2841947010 159
239 iso_pu_bacteria 2841949485 2841955060 159
240 iso_pu_bacteria 2841966195 2841970017 159
241 iso_pu_bacteria 2841974524 2841977341 159
242 iso_pu_bacteria 8006926726 8006929046 159
243 3300005563 Ga0068855_100290975 Ga0068855_1002909752 160
244 3300021441 Ga0213871_10068876 Ga0213871_100688762 160
245 3300025921 Ga0207652_10098763 Ga0207652_100987632 160
246 3300025928 Ga0207700_10140024 Ga0207700_101400241 160
247 3300025949 Ga0207667_10653345 Ga0207667_106533452 160
248 3300037853 Ga0436364_1511242 Ga0436364_1511242_211_735 160
249 3300038443 Ga0395901_0553324 Ga0395901_0553324_70_594 160
250 3300039437 Ga0436365_0696800 Ga0436365_0696800_8696_9220 160
251 3300039438 Ga0436360_0460383 Ga0436360_0460383_254_778 160
252 3300039447 Ga0436361_0298469 Ga0436361_0298469_412_936 160
253 3300046463 Ga0495653_0169862 Ga0495653_0169862_926_1450 160
254 3300046533 Ga0495640_0009233 Ga0495640_0009233_473_997 160
255 3300046536 Ga0495587_0338766 Ga0495587_0338766_126_650 160
256 3300046559 Ga0495667_0288295 Ga0495667_0288295_438_962 160
257 3300047322 Ga0495680_0134987 Ga0495680_0134987_196_720 160
258 3300047471 Ga0495684_0176020 Ga0495684_0176020_837_1361 160
259 3300048903 Ga0496100_0304567 Ga0496100_0304567_100_624 160
260 3300048905 Ga0496102_0244218 Ga0496102_0244218_1093_1617 160
261 3300048909 Ga0496106_1062148 Ga0496106_1062148_56_580 160
262 3300048912 Ga0496109_0162976 Ga0496109_0162976_836_1360 160
263 3300048914 Ga0496111_0185253 Ga0496111_0185253_478_1002 160
264 3300048918 Ga0496115_0398057 Ga0496115_0398057_382_906 160
265 3300049571 Ga0501034_0265743 Ga0501034_0265743_773_1309 160
266 3300049572 Ga0501036_0004125 Ga0501036_0004125_8962_9498 160
267 3300049573 Ga0501037_0033411 Ga0501037_0033411_2009_2545 160
268 3300049574 Ga0501038_0039621 Ga0501038_0039621_1536_2072 160
269 3300049575 Ga0501039_0067421 Ga0501039_0067421_1076_1612 160
270 3300049579 Ga0501043_0034171 Ga0501043_0034171_963_1499 160
271 3300049579 Ga0501043_0111878 Ga0501043_0111878_574_1116 160
272 3300049580 Ga0501046_0052580 Ga0501046_0052580_965_1501 160
273 3300049581 Ga0501047_0005901 Ga0501047_0005901_5761_6297 160
274 3300049582 Ga0501048_0220774 Ga0501048_0220774_210_746 160
275 3300049584 Ga0501068_0580874 Ga0501068_0580874_147_683 160
276 3300049586 Ga0501070_0010757 Ga0501070_0010757_4878_5414 160
277 3300049586 Ga0501070_0430060 Ga0501070_0430060_305_847 160
278 3300049589 Ga0501073_0075852 Ga0501073_0075852_1049_1585 160
279 3300049742 Ga0501080_0046502 Ga0501080_0046502_2319_2855 160
280 3300049743 Ga0501081_0145626 Ga0501081_0145626_857_1393 160
281 3300049744 Ga0501083_0145200 Ga0501083_0145200_990_1526 160
282 3300049822 Ga0501035_0401386 Ga0501035_0401386_539_1075 160
283 3300049823 Ga0501044_0112058 Ga0501044_0112058_1186_1722 160
284 3300053077 Ga0495601_0238094 Ga0495601_0238094_35_559 160
285 3300053078 Ga0495612_0110216 Ga0495612_0110216_406_930 160
286 3300053084 Ga0495595_0075934 Ga0495595_0075934_311_835 160
287 3300053085 Ga0495619_0026656 Ga0495619_0026656_1472_1996 160
288 3300053093 Ga0500651_0038350 Ga0500651_0038350_1439_1996 160
289 3300053142 Ga0500577_0150212 Ga0500577_0150212_205_762 160
290 3300053153 Ga0500616_0000001 Ga0500616_0000001_293124_293681 160
291 3300053730 Ga0500645_000144 Ga0500645_000144_17981_18538 160
292 3300060353 Ga0501082_0144333 Ga0501082_0144333_204_740 160
293 3300060353 Ga0501082_0355369 Ga0501082_0355369_702_1268 160
294 3300061734 Ga0530510_0489640 Ga0530510_0489640_264_794 160
295 3300005435 Ga0070714_100123060 Ga0070714_1001230602 161
296 3300006028 Ga0070717_10085715 Ga0070717_100857152 161
297 3300006163 Ga0070715_10189802 Ga0070715_101898021 161
298 3300024225 Ga0224572_1006986 Ga0224572_10069862 161
299 3300025906 Ga0207699_10030943 Ga0207699_100309433 161
300 3300025928 Ga0207700_10213776 Ga0207700_102137762 161
301 3300025929 Ga0207664_10111644 Ga0207664_101116442 161
302 3300025929 Ga0207664_10699201 Ga0207664_106992011 161
303 3300026121 Ga0207683_10932983 Ga0207683_109329832 161
304 3300035090 Ga0373949_0018243 Ga0373949_0018243_869_1447 161
305 3300035172 Ga0373955_0100773 Ga0373955_0100773_514_1092 161
306 3300035692 Ga0373935_0129457 Ga0373935_0129457_690_1268 161
307 3300035725 Ga0373947_0184413 Ga0373947_0184413_533_1111 161
308 3300039437 Ga0436365_0772739 Ga0436365_0772739_1413_1949 161
309 3300046461 Ga0495641_0088345 Ga0495641_0088345_573_1151 161
310 3300046517 Ga0495630_0361455 Ga0495630_0361455_342_920 161
311 3300046533 Ga0495640_0113326 Ga0495640_0113326_372_950 161
312 3300047319 Ga0495674_0106665 Ga0495674_0106665_437_1015 161
313 3300047471 Ga0495684_0131771 Ga0495684_0131771_284_862 161
314 3300048903 Ga0496100_0138594 Ga0496100_0138594_225_803 161
315 3300048905 Ga0496102_0061781 Ga0496102_0061781_1347_1925 161
316 3300049571 Ga0501034_0174825 Ga0501034_0174825_969_1508 161
317 3300049588 Ga0501072_0007723 Ga0501072_0007723_5766_6311 161
318 3300049588 Ga0501072_0092515 Ga0501072_0092515_498_1067 161
319 3300050512 nmdc:mga0n895_620305_c1 nmdc:mga0n895_620305_c1_356_889 161
320 3300060353 Ga0501082_0819275 Ga0501082_0819275_88_690 161
321 iso_pu_bacteria 2824773399 2824781391 161
322 3300005338 Ga0068868_100121743 Ga0068868_1001217432 162
323 3300005436 Ga0070713_100139415 Ga0070713_1001394152 162
324 3300005456 Ga0070678_100207701 Ga0070678_1002077012 162
325 3300005544 Ga0070686_100205680 Ga0070686_1002056802 162
326 3300005615 Ga0070702_101052507 Ga0070702_1010525071 162
327 3300005618 Ga0068864_100249599 Ga0068864_1002495992 162
328 3300005842 Ga0068858_100121889 Ga0068858_1001218892 162
329 3300006358 Ga0068871_100013913 Ga0068871_1000139137 162
330 3300009098 Ga0105245_10002241 Ga0105245_1000224112 162
331 3300009148 Ga0105243_10156335 Ga0105243_101563352 162
332 3300009176 Ga0105242_10137592 Ga0105242_101375922 162
333 3300009177 Ga0105248_10060907 Ga0105248_100609076 162
334 3300010159 Ga0099796_10059180 Ga0099796_100591802 162
335 3300014325 Ga0163163_11712358 Ga0163163_117123581 162
336 3300021388 Ga0213875_10000033 Ga0213875_10000033162 162
337 3300025927 Ga0207687_10023697 Ga0207687_100236974 162
338 3300025928 Ga0207700_10771619 Ga0207700_107716192 162
339 3300025934 Ga0207686_10704747 Ga0207686_107047472 162
340 3300025935 Ga0207709_10566415 Ga0207709_105664152 162
341 3300025939 Ga0207665_10456422 Ga0207665_104564222 162
342 3300025981 Ga0207640_10641338 Ga0207640_106413381 162
343 3300026023 Ga0207677_10217451 Ga0207677_102174512 162
344 3300026095 Ga0207676_10776230 Ga0207676_107762302 162
345 3300037853 Ga0436364_0816729 Ga0436364_0816729_394_930 162
346 3300046531 Ga0495665_0048332 Ga0495665_0048332_1260_1868 162
347 3300050494 nmdc:mga06z11_20718_c1 nmdc:mga06z11_20718_c1_2314_2886 162
348 3300050512 nmdc:mga0n895_1087569_c1 nmdc:mga0n895_1087569_c1_62_607 162
349 iso_pu_bacteria 2879127579 2879130224 162
350 3300005435 Ga0070714_100273924 Ga0070714_1002739242 163
351 3300005436 Ga0070713_100078356 Ga0070713_1000783564 163
352 3300005436 Ga0070713_100267822 Ga0070713_1002678222 163
353 3300005445 Ga0070708_100103303 Ga0070708_1001033033 163
354 3300005467 Ga0070706_100750060 Ga0070706_1007500602 163
355 3300005536 Ga0070697_100169978 Ga0070697_1001699782 163
356 3300006871 Ga0075434_100128119 Ga0075434_1001281192 163
357 3300007076 Ga0075435_100244588 Ga0075435_1002445882 163
358 3300025905 Ga0207685_10135382 Ga0207685_101353822 163
359 3300025928 Ga0207700_10172138 Ga0207700_101721382 163
360 3300039437 Ga0436365_1876119 Ga0436365_1876119_81_665 163
361 3300049568 Ga0501031_0044694 Ga0501031_0044694_197_721 163
362 3300049573 Ga0501037_0232951 Ga0501037_0232951_572_1096 163
363 3300049574 Ga0501038_0107812 Ga0501038_0107812_354_878 163
364 3300049576 Ga0501040_0038181 Ga0501040_0038181_2169_2693 163
365 3300049578 Ga0501042_0001313 Ga0501042_0001313_12040_12564 163
366 3300049583 Ga0501067_0003891 Ga0501067_0003891_3648_4172 163
367 3300049584 Ga0501068_0040235 Ga0501068_0040235_233_757 163
368 3300049586 Ga0501070_0054916 Ga0501070_0054916_2582_3106 163
369 3300049587 Ga0501071_0064338 Ga0501071_0064338_1694_2218 163
370 3300049590 Ga0501074_0015919 Ga0501074_0015919_1871_2395 163
371 3300049590 Ga0501074_0179441 Ga0501074_0179441_272_814 163
372 3300049591 Ga0501075_0914071 Ga0501075_0914071_70_594 163
373 3300049593 Ga0501077_0262503 Ga0501077_0262503_360_884 163
374 3300049593 Ga0501077_0280670 Ga0501077_0280670_312_854 163
375 3300049741 Ga0501079_0052957 Ga0501079_0052957_1460_1984 163
376 3300049743 Ga0501081_0534934 Ga0501081_0534934_270_794 163
377 3300049744 Ga0501083_0274597 Ga0501083_0274597_361_885 163
378 3300049824 Ga0501045_0025935 Ga0501045_0025935_859_1383 163
379 3300054114 Ga0501084_0142632 Ga0501084_0142632_1290_1814 163
380 3300005435 Ga0070714_100013145 Ga0070714_1000131454 164
381 3300005436 Ga0070713_100018181 Ga0070713_1000181814 164
382 3300005437 Ga0070710_10000804 Ga0070710_100008042 164
383 3300005439 Ga0070711_100016256 Ga0070711_1000162565 164
384 3300005937 Ga0081455_10211820 Ga0081455_102118202 164
385 3300006048 Ga0075363_100021136 Ga0075363_1000211362 164
386 3300006177 Ga0075362_10041733 Ga0075362_100417332 164
387 3300006178 Ga0075367_10299047 Ga0075367_102990472 164
388 3300006195 Ga0075366_10022248 Ga0075366_100222483 164
389 3300006353 Ga0075370_10238013 Ga0075370_102380132 164
390 3300021361 Ga0213872_10013615 Ga0213872_100136152 164
391 3300025910 Ga0207684_10049404 Ga0207684_100494042 164
392 3300025928 Ga0207700_10429775 Ga0207700_104297752 164
393 3300025929 Ga0207664_10727705 Ga0207664_107277052 164
394 3300036712 Ga0316584_0039488 Ga0316584_0039488_602_1111 164
395 3300039437 Ga0436365_0027168 Ga0436365_0027168_31_576 164
396 3300039450 Ga0436363_1026561 Ga0436363_1026561_96_677 164
397 3300039450 Ga0436363_1145542 Ga0436363_1145542_33_578 164
398 3300050489 nmdc:mga03683_2726_c1 nmdc:mga03683_2726_c1_3512_4063 164
399 3300050490 nmdc:mga03n38_6933_c1 nmdc:mga03n38_6933_c1_3218_3769 164
400 3300050491 nmdc:mga00v17_272781_c1 nmdc:mga00v17_272781_c1_364_915 164
401 3300050492 nmdc:mga0yw44_355062_c1 nmdc:mga0yw44_355062_c1_308_859 164
402 3300050493 nmdc:mga0k408_12293_c1 nmdc:mga0k408_12293_c1_1973_2524 164
403 3300050494 nmdc:mga06z11_156954_c1 nmdc:mga06z11_156954_c1_402_953 164
404 3300050512 nmdc:mga0n895_157102_c1 nmdc:mga0n895_157102_c1_1097_1672 164
405 3300050516 nmdc:mga0sz30_280630_c1 nmdc:mga0sz30_280630_c1_118_669 164
406 iso_pu_bacteria 2841957949 2841961618 164
407 iso_pu_bacteria 8016630954 8016637582 164
408 3300005834 Ga0068851_10455847 Ga0068851_104558471 165
409 3300006028 Ga0070717_10002016 Ga0070717_100020166 165
410 3300006871 Ga0075434_100159706 Ga0075434_1001597062 165
411 3300007788 Ga0099795_10105977 Ga0099795_101059772 165
412 3300009101 Ga0105247_10181587 Ga0105247_101815872 165
413 3300011119 Ga0105246_10258240 Ga0105246_102582401 165
414 3300035692 Ga0373935_0009768 Ga0373935_0009768_14_568 165
415 3300037068 Ga0373925_0010804 Ga0373925_0010804_1773_2327 165
416 3300039450 Ga0436363_0644197 Ga0436363_0644197_117_716 165
417 3300046455 Ga0495603_0064045 Ga0495603_0064045_792_1346 165
418 3300046475 Ga0495639_0018784 Ga0495639_0018784_1959_2513 165
419 3300046531 Ga0495665_0175146 Ga0495665_0175146_357_911 165
420 3300048903 Ga0496100_0033132 Ga0496100_0033132_844_1389 165
421 3300048905 Ga0496102_0018849 Ga0496102_0018849_3907_4452 165
422 3300048907 Ga0496104_0026450 Ga0496104_0026450_3763_4308 165
423 3300048908 Ga0496105_0066846 Ga0496105_0066846_1199_1744 165
424 3300048909 Ga0496106_0004268 Ga0496106_0004268_5212_5757 165
425 3300048910 Ga0496107_0018102 Ga0496107_0018102_3605_4150 165
426 3300048911 Ga0496108_0046112 Ga0496108_0046112_1558_2103 165
427 3300048913 Ga0496110_0016966 Ga0496110_0016966_4441_4986 165
428 3300048913 Ga0496110_0176995 Ga0496110_0176995_280_825 165
429 3300048914 Ga0496111_0028463 Ga0496111_0028463_2060_2605 165
430 3300048914 Ga0496111_0039557 Ga0496111_0039557_1743_2288 165
431 3300048915 Ga0496112_0033161 Ga0496112_0033161_3265_3810 165
432 3300048915 Ga0496112_0114900 Ga0496112_0114900_1302_1847 165
433 3300048916 Ga0496113_0018469 Ga0496113_0018469_2652_3197 165
434 3300048918 Ga0496115_0096460 Ga0496115_0096460_358_903 165
435 3300048929 Ga0496126_0630246 Ga0496126_0630246_34_597 165
436 3300049571 Ga0501034_0066082 Ga0501034_0066082_950_1546 165
437 3300049583 Ga0501067_0198240 Ga0501067_0198240_415_1011 165
438 3300049583 Ga0501067_0209696 Ga0501067_0209696_314_889 165
439 3300049586 Ga0501070_0180044 Ga0501070_0180044_462_1037 165
440 3300050493 nmdc:mga0k408_247709_c1 nmdc:mga0k408_247709_c1_10_564 165
441 3300005340 Ga0070689_100121490 Ga0070689_1001214902 166
442 3300005355 Ga0070671_100712762 Ga0070671_1007127622 166
443 3300005365 Ga0070688_100198197 Ga0070688_1001981972 166
444 3300005436 Ga0070713_100164304 Ga0070713_1001643042 166
445 3300006051 Ga0075364_10128388 Ga0075364_101283882 166
446 3300006178 Ga0075367_10031601 Ga0075367_100316014 166
447 3300006186 Ga0075369_10008314 Ga0075369_100083142 166
448 3300006353 Ga0075370_10001319 Ga0075370_100013194 166
449 3300010159 Ga0099796_10027701 Ga0099796_100277012 166
450 3300010375 Ga0105239_10594306 Ga0105239_105943062 166
451 3300025928 Ga0207700_10081890 Ga0207700_100818902 166
452 3300025936 Ga0207670_10111986 Ga0207670_101119862 166
453 3300027512 Ga0209179_1023692 Ga0209179_10236922 166
454 3300039447 Ga0436361_0679525 Ga0436361_0679525_767_1384 166
455 3300039450 Ga0436363_0904821 Ga0436363_0904821_196_762 166
456 3300048903 Ga0496100_0370246 Ga0496100_0370246_295_879 166
457 3300048907 Ga0496104_0194047 Ga0496104_0194047_237_830 166
458 3300048909 Ga0496106_0332443 Ga0496106_0332443_29_622 166
459 3300048912 Ga0496109_0529755 Ga0496109_0529755_452_1036 166
460 3300050489 nmdc:mga03683_153110_c1 nmdc:mga03683_153110_c1_144_740 166
461 3300050491 nmdc:mga00v17_29550_c1 nmdc:mga00v17_29550_c1_469_1065 166
462 3300050493 nmdc:mga0k408_460264_c1 nmdc:mga0k408_460264_c1_79_660 166
463 3300050495 nmdc:mga04h51_6058_c1 nmdc:mga04h51_6058_c1_2490_3086 166
464 3300050496 nmdc:mga07m45_14615_c1 nmdc:mga07m45_14615_c1_16_591 166
465 iso_pu_bacteria 2824653114 2824661163 166
466 iso_pu_bacteria 8016622563 8016624191 166
467 iso_pu_bacteria 8019678201 8019681063 166
468 3300005577 Ga0068857_100129461 Ga0068857_1001294612 167
469 3300009545 Ga0105237_10092764 Ga0105237_100927643 167
470 3300009551 Ga0105238_10045610 Ga0105238_100456105 167
471 3300025914 Ga0207671_10089125 Ga0207671_100891253 167
472 3300025924 Ga0207694_10107825 Ga0207694_101078252 167
473 3300026116 Ga0207674_10050892 Ga0207674_100508924 167
474 3300035089 Ga0373944_0003875 Ga0373944_0003875_1532_2164 167
475 3300035116 Ga0373945_0050351 Ga0373945_0050351_338_970 167
476 3300035170 Ga0373943_0000115 Ga0373943_0000115_14895_15527 167
477 3300035171 Ga0373946_0003839 Ga0373946_0003839_3231_3863 167
478 3300035692 Ga0373935_0001782 Ga0373935_0001782_1503_2135 167
479 3300035695 Ga0373927_0001710 Ga0373927_0001710_11349_11981 167
480 3300035725 Ga0373947_0001924 Ga0373947_0001924_9886_10518 167
481 3300037068 Ga0373925_0004011 Ga0373925_0004011_758_1390 167
482 3300046472 Ga0495580_0042943 Ga0495580_0042943_2047_2679 167
483 3300046517 Ga0495630_0009728 Ga0495630_0009728_3985_4617 167
484 3300046531 Ga0495665_0042714 Ga0495665_0042714_789_1421 167
485 3300046642 Ga0495634_0054995 Ga0495634_0054995_1225_1857 167
486 3300046683 Ga0495658_0055046 Ga0495658_0055046_1118_1750 167
487 3300046689 Ga0495613_0222566 Ga0495613_0222566_260_892 167
488 3300046690 Ga0495624_0006806 Ga0495624_0006806_7037_7669 167
489 3300047315 Ga0495581_0008563 Ga0495581_0008563_157_789 167
490 3300047321 Ga0495676_0026806 Ga0495676_0026806_2886_3518 167
491 3300047471 Ga0495684_0003419 Ga0495684_0003419_11000_11632 167
492 3300047673 Ga0495593_0007704 Ga0495593_0007704_1490_2122 167
493 iso_pu_bacteria 2824696289 2824704292 167
494 3300005339 Ga0070660_100614190 Ga0070660_1006141902 168
495 3300005343 Ga0070687_100645005 Ga0070687_1006450051 168
496 3300005355 Ga0070671_100168248 Ga0070671_1001682482 168
497 3300005364 Ga0070673_100014626 Ga0070673_1000146261 168
498 3300005366 Ga0070659_100368143 Ga0070659_1003681432 168
499 3300005367 Ga0070667_100083614 Ga0070667_1000836142 168
500 3300005437 Ga0070710_10187129 Ga0070710_101871291 168
501 3300005439 Ga0070711_100079636 Ga0070711_1000796362 168
502 3300005457 Ga0070662_100144654 Ga0070662_1001446542 168
503 3300005544 Ga0070686_100056769 Ga0070686_1000567692 168
504 3300005548 Ga0070665_100114487 Ga0070665_1001144872 168
505 3300005564 Ga0070664_100114064 Ga0070664_1001140642 168
506 3300005614 Ga0068856_100339241 Ga0068856_1003392412 168
507 3300005842 Ga0068858_100147937 Ga0068858_1001479373 168
508 3300006028 Ga0070717_10790035 Ga0070717_107900352 168
509 3300006163 Ga0070715_10166818 Ga0070715_101668182 168
510 3300006175 Ga0070712_100054155 Ga0070712_1000541552 168
511 3300006353 Ga0075370_10501083 Ga0075370_105010832 168
512 3300006871 Ga0075434_100246619 Ga0075434_1002466192 168
513 3300009098 Ga0105245_10167287 Ga0105245_101672872 168
514 3300009101 Ga0105247_10155765 Ga0105247_101557652 168
515 3300009545 Ga0105237_10080340 Ga0105237_100803405 168
516 3300009551 Ga0105238_10063884 Ga0105238_100638845 168
517 3300009551 Ga0105238_10333592 Ga0105238_103335922 168
518 3300011119 Ga0105246_10679104 Ga0105246_106791042 168
519 3300013296 Ga0157374_10055264 Ga0157374_100552646 168
520 3300014325 Ga0163163_10093908 Ga0163163_100939082 168
521 3300025900 Ga0207710_10299952 Ga0207710_102999522 168
522 3300025914 Ga0207671_10064657 Ga0207671_100646572 168
523 3300025915 Ga0207693_10026940 Ga0207693_100269403 168
524 3300025920 Ga0207649_10460311 Ga0207649_104603112 168
525 3300025924 Ga0207694_10042041 Ga0207694_100420412 168
526 3300025925 Ga0207650_10007870 Ga0207650_100078704 168
527 3300025928 Ga0207700_10282403 Ga0207700_102824032 168
528 3300025931 Ga0207644_10003286 Ga0207644_1000328610 168
529 3300025932 Ga0207690_10505151 Ga0207690_105051512 168
530 3300025933 Ga0207706_10033595 Ga0207706_100335953 168
531 3300025936 Ga0207670_10133649 Ga0207670_101336492 168
532 3300025940 Ga0207691_10058529 Ga0207691_100585292 168
533 3300025941 Ga0207711_10193303 Ga0207711_101933032 168
534 3300025986 Ga0207658_10107139 Ga0207658_101071392 168
535 3300026035 Ga0207703_10130052 Ga0207703_101300522 168
536 3300028379 Ga0268266_10286038 Ga0268266_102860382 168
537 3300031911 Ga0307412_10626885 Ga0307412_106268852 168
538 3300039447 Ga0436361_0531880 Ga0436361_0531880_51_644 168
539 3300047472 Ga0495686_0090578 Ga0495686_0090578_22_603 168
540 3300048903 Ga0496100_0098942 Ga0496100_0098942_156_731 168
541 3300048904 Ga0496101_0180781 Ga0496101_0180781_729_1304 168
542 3300048911 Ga0496108_1025496 Ga0496108_1025496_118_693 168
543 3300048912 Ga0496109_0417611 Ga0496109_0417611_346_921 168
544 3300048927 Ga0496124_0198601 Ga0496124_0198601_44_640 168
545 3300048928 Ga0496125_0100666 Ga0496125_0100666_1443_2039 168
546 3300050513 nmdc:mga0rr50_696127_c1 nmdc:mga0rr50_696127_c1_23_598 168
547 iso_pu_bacteria 2874628541 2874633626 168
548 3300005354 Ga0070675_100672486 Ga0070675_1006724861 169
549 3300009545 Ga0105237_10082386 Ga0105237_100823864 169
550 3300013104 Ga0157370_10183631 Ga0157370_101836312 169
551 3300013105 Ga0157369_10048517 Ga0157369_100485173 169
552 3300035695 Ga0373927_0001673 Ga0373927_0001673_12744_13331 169
553 3300035725 Ga0373947_0016273 Ga0373947_0016273_3475_4062 169
554 3300037312 Ga0395899_0096896 Ga0395899_0096896_1383_1991 169
555 3300037466 Ga0395898_0018364 Ga0395898_0018364_5273_5881 169
556 iso_pu_bacteria 2857509624 2857513555 169
557 iso_pu_bacteria 2888419890 2888421382 169
558 3300005981 Ga0081538_10031425 Ga0081538_100314253 170
559 3300006048 Ga0075363_100183842 Ga0075363_1001838422 170
560 3300025922 Ga0207646_10099945 Ga0207646_100999452 170
561 3300035089 Ga0373944_0002616 Ga0373944_0002616_1703_2272 170
562 3300035170 Ga0373943_0029833 Ga0373943_0029833_892_1461 170
563 3300035171 Ga0373946_0005231 Ga0373946_0005231_2001_2570 170
564 3300035692 Ga0373935_0208474 Ga0373935_0208474_666_1235 170
565 3300035695 Ga0373927_0032729 Ga0373927_0032729_1789_2358 170
566 3300035725 Ga0373947_0074035 Ga0373947_0074035_1045_1614 170
567 3300046472 Ga0495580_0625075 Ga0495580_0625075_46_615 170
568 3300046473 Ga0495582_0063217 Ga0495582_0063217_937_1506 170
569 3300046517 Ga0495630_0138601 Ga0495630_0138601_954_1523 170
570 3300046524 Ga0495648_0186998 Ga0495648_0186998_287_883 170
571 3300046681 Ga0495647_0055162 Ga0495647_0055162_46_615 170
572 3300046690 Ga0495624_0162822 Ga0495624_0162822_85_654 170
573 3300047321 Ga0495676_0008456 Ga0495676_0008456_1357_1926 170
574 3300053086 Ga0500578_0328900 Ga0500578_0328900_273_869 170
575 3300053156 Ga0500622_0177696 Ga0500622_0177696_29_625 170
576 iso_pu_bacteria 2879074833 2879074879 170
577 3300005434 Ga0070709_10174332 Ga0070709_101743322 171
578 3300005435 Ga0070714_100004377 Ga0070714_1000043777 171
579 3300005436 Ga0070713_100010117 Ga0070713_1000101172 171
580 3300005437 Ga0070710_10005753 Ga0070710_100057532 171
581 3300005439 Ga0070711_100223987 Ga0070711_1002239872 171
582 3300005444 Ga0070694_100576064 Ga0070694_1005760642 171
583 3300005937 Ga0081455_10009527 Ga0081455_100095273 171
584 3300005983 Ga0081540_1051334 Ga0081540_10513342 171
585 3300006028 Ga0070717_10030212 Ga0070717_100302126 171
586 3300006038 Ga0075365_10046194 Ga0075365_100461944 171
587 3300006051 Ga0075364_10320977 Ga0075364_103209772 171
588 3300006847 Ga0075431_100087680 Ga0075431_1000876804 171
589 3300006871 Ga0075434_100146849 Ga0075434_1001468492 171
590 3300006880 Ga0075429_100306752 Ga0075429_1003067522 171
591 3300009545 Ga0105237_10214790 Ga0105237_102147902 171
592 3300021361 Ga0213872_10170767 Ga0213872_101707672 171
593 3300025297 Ga0209758_1043052 Ga0209758_10430522 171
594 3300025900 Ga0207710_10079523 Ga0207710_100795232 171
595 3300025939 Ga0207665_10001873 Ga0207665_100018738 171
596 3300030521 Ga0307511_10204636 Ga0307511_102046362 171
597 3300031507 Ga0307509_10074245 Ga0307509_100742454 171
598 3300031507 Ga0307509_10166946 Ga0307509_101669463 171
599 3300031616 Ga0307508_10127981 Ga0307508_101279812 171
600 3300031730 Ga0307516_10199557 Ga0307516_101995573 171
601 3300033179 Ga0307507_10031018 Ga0307507_100310186 171
602 3300035692 Ga0373935_0034061 Ga0373935_0034061_491_1066 171
603 3300035695 Ga0373927_0048532 Ga0373927_0048532_484_1059 171
604 3300035725 Ga0373947_0045489 Ga0373947_0045489_178_753 171
605 3300037068 Ga0373925_0034736 Ga0373925_0034736_1516_2091 171
606 3300039437 Ga0436365_0914429 Ga0436365_0914429_541_1149 171
607 3300039437 Ga0436365_0982478 Ga0436365_0982478_1167_1754 171
608 3300046557 Ga0495622_0048886 Ga0495622_0048886_1083_1658 171
609 3300047320 Ga0495672_0146177 Ga0495672_0146177_648_1217 171
610 3300048909 Ga0496106_0000935 Ga0496106_0000935_9177_9752 171
611 3300048920 Ga0496117_0033294 Ga0496117_0033294_2946_3521 171
612 3300048921 Ga0496118_0008592 Ga0496118_0008592_7444_8019 171
613 3300048924 Ga0496121_0000555 Ga0496121_0000555_971_1546 171
614 3300048927 Ga0496124_0001875 Ga0496124_0001875_24072_24647 171
615 3300048928 Ga0496125_0022852 Ga0496125_0022852_4849_5424 171
616 3300048929 Ga0496126_0006420 Ga0496126_0006420_7706_8281 171
617 3300048929 Ga0496126_0128673 Ga0496126_0128673_757_1356 171
618 3300050491 nmdc:mga00v17_411310_c1 nmdc:mga00v17_411310_c1_126_707 171
619 3300050492 nmdc:mga0yw44_21452_c1 nmdc:mga0yw44_21452_c1_892_1473 171
620 3300050508 nmdc:mga09592_198436_c1 nmdc:mga09592_198436_c1_766_1347 171
621 3300053094 Ga0500566_0028972 Ga0500566_0028972_2303_2878 171
622 3300053119 Ga0500595_013874 Ga0500595_013874_1862_2437 171
623 3300053177 Ga0500636_0143335 Ga0500636_0143335_646_1254 171
624 3300053178 Ga0500637_0087617 Ga0500637_0087617_982_1557 171
625 3300053728 Ga0500657_132335 Ga0500657_132335_52_627 171
626 iso_pu_bacteria 2847930680 2847939230 171
627 iso_pu_bacteria 2879083081 2879090370 171
628 iso_pu_bacteria 2906643746 2906652243 171
629 3300005329 Ga0070683_100059816 Ga0070683_1000598162 172
630 3300005367 Ga0070667_100413933 Ga0070667_1004139331 172
631 3300005434 Ga0070709_10000619 Ga0070709_100006197 172
632 3300005435 Ga0070714_100306490 Ga0070714_1003064902 172
633 3300005437 Ga0070710_10000409 Ga0070710_1000040911 172
634 3300005439 Ga0070711_100000650 Ga0070711_1000006509 172
635 3300005458 Ga0070681_10223732 Ga0070681_102237322 172
636 3300005535 Ga0070684_100255355 Ga0070684_1002553552 172
637 3300005937 Ga0081455_10001093 Ga0081455_1000109329 172
638 3300006173 Ga0070716_100003498 Ga0070716_1000034982 172
639 3300006353 Ga0075370_10055494 Ga0075370_100554943 172
640 3300009036 Ga0105244_10183628 Ga0105244_101836282 172
641 3300013105 Ga0157369_10086990 Ga0157369_100869904 172
642 3300021358 Ga0213873_10002485 Ga0213873_100024852 172
643 3300021384 Ga0213876_10030494 Ga0213876_100304941 172
644 3300025898 Ga0207692_10000426 Ga0207692_100004264 172
645 3300025906 Ga0207699_10000368 Ga0207699_100003689 172
646 3300025915 Ga0207693_10062230 Ga0207693_100622302 172
647 3300025921 Ga0207652_10042639 Ga0207652_100426392 172
648 3300025928 Ga0207700_10003271 Ga0207700_100032715 172
649 3300025939 Ga0207665_10011625 Ga0207665_100116252 172
650 3300025944 Ga0207661_10006894 Ga0207661_100068946 172
651 3300041491 Ga0451833_0759778 Ga0451833_0759778_224_802 172
652 3300046537 Ga0495598_0002854 Ga0495598_0002854_1327_1902 172
653 3300046539 Ga0495621_0049786 Ga0495621_0049786_187_762 172
654 3300046648 Ga0495611_0115465 Ga0495611_0115465_647_1222 172
655 3300046664 Ga0495659_0028611 Ga0495659_0028611_859_1434 172
656 3300047319 Ga0495674_0475495 Ga0495674_0475495_251_826 172
657 3300048929 Ga0496126_0218350 Ga0496126_0218350_807_1436 172
658 3300049582 Ga0501048_0295798 Ga0501048_0295798_126_695 172
659 3300049592 Ga0501076_0541136 Ga0501076_0541136_270_839 172
660 3300049741 Ga0501079_0087569 Ga0501079_0087569_217_786 172
661 3300050496 nmdc:mga07m45_87138_c1 nmdc:mga07m45_87138_c1_958_1536 172
662 3300054114 Ga0501084_0199467 Ga0501084_0199467_1035_1604 172
663 3300061734 Ga0530510_0259121 Ga0530510_0259121_641_1210 172
664 iso_pu_bacteria 2838122688 2838129970 172
665 iso_pu_bacteria 2841983080 2841990245 172
666 iso_pu_bacteria 2847939898 2847943802 172
667 iso_pu_bacteria 8056689827 8056696104 172
668 3300005435 Ga0070714_100017830 Ga0070714_1000178303 173
669 3300006028 Ga0070717_10416191 Ga0070717_104161912 173
670 3300006163 Ga0070715_10011596 Ga0070715_100115962 173
671 3300006175 Ga0070712_100026783 Ga0070712_1000267833 173
672 3300009094 Ga0111539_10040709 Ga0111539_100407095 173
673 3300021384 Ga0213876_10343434 Ga0213876_103434342 173
674 3300021388 Ga0213875_10106942 Ga0213875_101069422 173
675 3300025905 Ga0207685_10228224 Ga0207685_102282242 173
676 3300025915 Ga0207693_10087406 Ga0207693_100874063 173
677 3300025915 Ga0207693_10207342 Ga0207693_102073422 173
678 3300025916 Ga0207663_10000896 Ga0207663_100008967 173
679 3300025928 Ga0207700_10037832 Ga0207700_100378322 173
680 3300025929 Ga0207664_10021693 Ga0207664_100216933 173
681 3300025929 Ga0207664_10098511 Ga0207664_100985112 173
682 3300038443 Ga0395901_0409313 Ga0395901_0409313_383_1015 173
683 3300039437 Ga0436365_0594440 Ga0436365_0594440_6961_7554 173
684 3300039453 Ga0436362_0715867 Ga0436362_0715867_4916_5509 173
685 3300049581 Ga0501047_0023188 Ga0501047_0023188_1575_2204 173
686 3300049586 Ga0501070_0016565 Ga0501070_0016565_2722_3351 173
687 3300049589 Ga0501073_0135304 Ga0501073_0135304_773_1402 173
688 3300049741 Ga0501079_0063678 Ga0501079_0063678_569_1198 173
689 3300050515 nmdc:mga0a205_159325_c1 nmdc:mga0a205_159325_c1_779_1390 173
690 iso_pu_bacteria 8019608314 8019613919 173
691 3300031616 Ga0307508_10001335 Ga0307508_1000133510 174
692 3300037471 Ga0395905_0485756 Ga0395905_0485756_380_994 174
693 3300039450 Ga0436363_0424805 Ga0436363_0424805_1035_1628 174
694 3300046694 Ga0495649_0197035 Ga0495649_0197035_52_621 174
695 3300049574 Ga0501038_0000737 Ga0501038_0000737_7247_7831 174
696 3300049823 Ga0501044_0044741 Ga0501044_0044741_801_1385 174
697 3300025297 Ga0209758_1001433 Ga0209758_100143330 175
698 3300025906 Ga0207699_10546944 Ga0207699_105469442 175
699 3300046691 Ga0495670_0081220 Ga0495670_0081220_132_689 175
700 3300048905 Ga0496102_0868192 Ga0496102_0868192_236_802 175
701 3300048908 Ga0496105_0586989 Ga0496105_0586989_134_736 175
702 3300048909 Ga0496106_0002126 Ga0496106_0002126_9806_10372 175
703 3300048910 Ga0496107_0037970 Ga0496107_0037970_1870_2436 175
704 3300048911 Ga0496108_0000681 Ga0496108_0000681_376_942 175
705 3300048912 Ga0496109_0000450 Ga0496109_0000450_9322_9888 175
706 3300048913 Ga0496110_0028657 Ga0496110_0028657_3819_4385 175
707 3300048915 Ga0496112_0005385 Ga0496112_0005385_6972_7574 175
708 3300048915 Ga0496112_0374829 Ga0496112_0374829_690_1256 175
709 3300048916 Ga0496113_0076366 Ga0496113_0076366_547_1113 175
710 iso_pu_bacteria 2508501128 2509147859 175
711 iso_pu_bacteria 2874604998 2874606070 175
712 3300005614 Ga0068856_100000055 Ga0068856_10000005565 176
713 3300026078 Ga0207702_10000688 Ga0207702_1000068817 176
714 3300028666 Ga0265336_10029119 Ga0265336_100291192 176
715 3300028800 Ga0265338_10001933 Ga0265338_1000193322 176
716 3300029957 Ga0265324_10017106 Ga0265324_100171062 176
717 3300046674 Ga0495588_0125571 Ga0495588_0125571_103_759 176
718 3300048929 Ga0496126_0019705 Ga0496126_0019705_4565_5194 176
719 iso_pu_bacteria 2906610324 2906612617 176
720 3300005434 Ga0070709_10049581 Ga0070709_100495812 177
721 3300006028 Ga0070717_10002999 Ga0070717_100029997 177
722 3300006163 Ga0070715_10000199 Ga0070715_100001998 177
723 3300006173 Ga0070716_100007123 Ga0070716_1000071234 177
724 3300006175 Ga0070712_100101520 Ga0070712_1001015202 177
725 3300025898 Ga0207692_10016808 Ga0207692_100168084 177
726 3300025905 Ga0207685_10000725 Ga0207685_100007254 177
727 3300025906 Ga0207699_10059050 Ga0207699_100590503 177
728 3300025915 Ga0207693_10001800 Ga0207693_100018005 177
729 3300025916 Ga0207663_10013127 Ga0207663_100131272 177
730 3300025928 Ga0207700_10022300 Ga0207700_100223002 177
731 3300025929 Ga0207664_10103552 Ga0207664_101035522 177
732 3300025939 Ga0207665_10000224 Ga0207665_1000022415 177
733 iso_pu_bacteria 2922361189 2922363453 177
734 3300013306 Ga0163162_10165938 Ga0163162_101659382 178
735 3300049581 Ga0501047_0577809 Ga0501047_0577809_78_704 178
736 3300053077 Ga0495601_0362319 Ga0495601_0362319_259_861 178
737 3300053119 Ga0500595_010000 Ga0500595_010000_2449_3045 178
738 3300005367 Ga0070667_100274041 Ga0070667_1002740412 179
739 3300005329 Ga0070683_100296554 Ga0070683_1002965542 180
740 3300005535 Ga0070684_100482802 Ga0070684_1004828022 180
741 3300006038 Ga0075365_10274272 Ga0075365_102742722 180
742 3300006048 Ga0075363_100280686 Ga0075363_1002806861 180
743 3300006353 Ga0075370_10033800 Ga0075370_100338004 180
744 3300013105 Ga0157369_10238439 Ga0157369_102384392 180
745 3300025903 Ga0207680_10218878 Ga0207680_102188782 180
746 3300025949 Ga0207667_10174669 Ga0207667_101746692 180
747 3300031730 Ga0307516_10228815 Ga0307516_102288153 180
748 3300041453 Ga0451797_0977362 Ga0451797_0977362_38_604 180
749 3300050492 nmdc:mga0yw44_175002_c1 nmdc:mga0yw44_175002_c1_595_1161 180
750 3300050496 nmdc:mga07m45_55257_c1 nmdc:mga07m45_55257_c1_1529_2095 180
751 iso_pu_bacteria 2517093001 2517101204 180
752 iso_pu_bacteria 2617270741 2617374936 180
753 iso_pu_bacteria 2824679649 2824687498 180
754 iso_pu_bacteria 2824732956 2824740402 180
755 iso_pu_bacteria 2824746037 2824753711 180
756 iso_pu_bacteria 2842045827 2842050289 180
757 iso_pu_bacteria 2885366525 2885373681 180
758 iso_pu_bacteria 2908775508 2908777418 180
759 iso_pu_bacteria 2922393267 2922398299 180
760 iso_pu_bacteria 3005483717 3005487738 180
761 iso_pu_bacteria 3005587118 3005591958 180
762 iso_pu_bacteria 2888388044 2888389708 181
763 iso_pu_bacteria 2904690495 2904691705 181
764 iso_pu_bacteria 2908756301 2908763779 181
765 iso_pu_bacteria 8006984368 8006986267 181
766 iso_pu_bacteria 8006994254 8006998942 181
767 3300047320 Ga0495672_0015931 Ga0495672_0015931_737_1315 182
768 iso_pu_bacteria 2508501009 2508545253 182
769 iso_pu_bacteria 2508501042 2508694085 182
770 iso_pu_bacteria 2513237098 2513673272 182
771 iso_pu_bacteria 2515154112 2515624979 182
772 iso_pu_bacteria 2524023210 2524465842 182
773 iso_pu_bacteria 2791355199 2793078812 182
774 iso_pu_bacteria 2824609381 2824617621 182
775 iso_pu_bacteria 2874590934 2874594662 182
776 iso_pu_bacteria 2874645413 2874649707 182
777 iso_pu_bacteria 2876771140 2876773794 182
778 iso_pu_bacteria 2879110137 2879116768 182
779 iso_pu_bacteria 2885383462 2885386762 182
780 iso_pu_bacteria 2903768456 2903775847 182
781 iso_pu_bacteria 2922386360 2922389569 182
782 iso_pu_bacteria 2935608549 2935616364 182
783 iso_pu_bacteria 2935648319 2935650758 182
784 iso_pu_bacteria 2935656913 2935662138 182
785 iso_pu_bacteria 2935769743 2935770417 182
786 iso_pu_bacteria 2935777560 2935782555 182
787 iso_pu_bacteria 2935785616 2935786530 182
788 iso_pu_bacteria 2935793552 2935794585 182
789 iso_pu_bacteria 2935819856 2935827161 182
790 iso_pu_bacteria 2935847175 2935854342 182
791 iso_pu_bacteria 2935908558 2935913563 182
792 iso_pu_bacteria 2935916978 2935923461 182
793 iso_pu_bacteria 2935926038 2935931120 182
794 iso_pu_bacteria 2935934488 2935935402 182
795 iso_pu_bacteria 2935942939 2935946968 182
796 iso_pu_bacteria 2935951376 2935953937 182
797 iso_pu_bacteria 2935967501 2935968963 182
798 iso_pu_bacteria 2935975950 2935982386 182
799 iso_pu_bacteria 2935984226 2935985844 182
800 iso_pu_bacteria 2936011229 2936016280 182
801 iso_pu_bacteria 2936019824 2936025072 182
802 iso_pu_bacteria 2936028420 2936033585 182
803 iso_pu_bacteria 2936046547 2936050983 182
804 iso_pu_bacteria 2936055302 2936057733 182
805 iso_pu_bacteria 8016522445 8016524574 182
806 iso_pu_bacteria 8016530956 8016538135 182
807 iso_pu_bacteria 8016539877 8016542413 182
808 iso_pu_bacteria 8016548790 8016550860 182
809 iso_pu_bacteria 8016557553 8016559273 182
810 iso_pu_bacteria 8016566248 8016567802 182
811 iso_pu_bacteria 8016575299 8016580492 182
812 iso_pu_bacteria 8016595262 8016597222 182
813 iso_pu_bacteria 8016603502 8016605044 182
814 iso_pu_bacteria 8016613128 8016619973 182
815 iso_pu_bacteria 8019530166 8019537807 182
816 iso_pu_bacteria 8019538911 8019539430 182
817 iso_pu_bacteria 8019547302 8019551210 182
818 iso_pu_bacteria 8019619141 8019624485 182
819 iso_pu_bacteria 8019629233 8019637559 182
820 iso_pu_bacteria 8019638758 8019642057 182
821 iso_pu_bacteria 8019659431 8019665487 182
822 iso_pu_bacteria 8019668869 8019675031 182
823 iso_pu_bacteria 8019687851 8019694653 182
824 iso_pu_bacteria 8056673599 8056675404 182
825 iso_pu_bacteria 2513237102 2513704266 183
826 iso_pu_bacteria 2513237139 2513875046 183
827 iso_pu_bacteria 2513237161 2514013883 183
828 iso_pu_bacteria 2524023205 2524439863 183
829 iso_pu_bacteria 2617270735 2617348388 183
830 iso_pu_bacteria 2744054633 2745075855 183
831 iso_pu_bacteria 2802429603 2805916364 183
832 iso_pu_bacteria 2824617872 2824626369 183
833 iso_pu_bacteria 2824626560 2824635098 183
834 iso_pu_bacteria 2824635225 2824643678 183
835 iso_pu_bacteria 2824644064 2824652258 183
836 iso_pu_bacteria 2824671348 2824679377 183
837 iso_pu_bacteria 2824687955 2824694515 183
838 iso_pu_bacteria 2824704595 2824713925 183
839 iso_pu_bacteria 2824714736 2824722816 183
840 iso_pu_bacteria 2824723954 2824732329 183
841 iso_pu_bacteria 2824753945 2824762927 183
842 iso_pu_bacteria 2824763712 2824772925 183
843 iso_pu_bacteria 2874612657 2874615279 183
844 iso_pu_bacteria 2881665667 2881668244 183
845 iso_pu_bacteria 2904666416 2904667032 183
846 iso_pu_bacteria 2904711408 2904719605 183
847 iso_pu_bacteria 3005506211 3005511108 183
848 iso_pu_bacteria 3005710791 3005712040 183
849 iso_pu_bacteria 8006964411 8006970054 183
850 iso_pu_bacteria 8016583857 8016588540 183
851 iso_pu_bacteria 2511231028 2511397227 184
852 iso_pu_bacteria 2513237094 2513641034 184
853 iso_pu_bacteria 2513237095 2513648443 184
854 iso_pu_bacteria 2513237104 2513716396 184
855 iso_pu_bacteria 2816332527 2818240025 184
856 iso_pu_bacteria 2824661429 2824671163 184
857 iso_pu_bacteria 2844315083 2844316465 184
858 iso_pu_bacteria 2857524615 2857525496 184
859 iso_pu_bacteria 2879099564 2879103028 184
860 iso_pu_bacteria 2888378607 2888387023 184
861 iso_pu_bacteria 2903727486 2903732346 184
862 iso_pu_bacteria 2906602504 2906606341 184
863 iso_pu_bacteria 2919073203 2919074694 184
864 iso_pu_bacteria 2922368715 2922377151 184
865 iso_pu_bacteria 2929615660 2929623555 184
866 iso_pu_bacteria 2929624759 2929632743 184
867 iso_pu_bacteria 2932784394 2932791404 184
868 iso_pu_bacteria 2932794094 2932795812 184
869 iso_pu_bacteria 2932801729 2932802050 184
870 iso_pu_bacteria 2932809354 2932814736 184
871 iso_pu_bacteria 2932818245 2932823594 184
872 iso_pu_bacteria 2932828146 2932833028 184
873 iso_pu_bacteria 2933577622 2933585458 184
874 iso_pu_bacteria 2935616580 2935623758 184
875 iso_pu_bacteria 2935638405 2935639530 184
876 iso_pu_bacteria 2935665750 2935670475 184
877 iso_pu_bacteria 2935675223 2935679904 184
878 iso_pu_bacteria 2935684952 2935687474 184
879 iso_pu_bacteria 2935694250 2935696556 184
880 iso_pu_bacteria 2935703347 2935705371 184
881 iso_pu_bacteria 2935713505 2935718933 184
882 iso_pu_bacteria 2935722832 2935728585 184
883 iso_pu_bacteria 2935732158 2935736818 184
884 iso_pu_bacteria 2935741537 2935746179 184
885 iso_pu_bacteria 2935750917 2935753440 184
886 iso_pu_bacteria 2935760218 2935767632 184
887 iso_pu_bacteria 2935801545 2935807114 184
888 iso_pu_bacteria 2935810662 2935813970 184
889 iso_pu_bacteria 2935827899 2935829013 184
890 iso_pu_bacteria 2935837841 2935844185 184
891 iso_pu_bacteria 2935855204 2935862017 184
892 iso_pu_bacteria 2935864058 2935871581 184
893 iso_pu_bacteria 2935873716 2935880308 184
894 iso_pu_bacteria 2935883170 2935886238 184
895 iso_pu_bacteria 2935959822 2935961431 184
896 iso_pu_bacteria 2935992306 2935996974 184
897 iso_pu_bacteria 2936002035 2936006010 184
898 iso_pu_bacteria 2936037263 2936039526 184
899 iso_pu_bacteria 2940556831 2940559353 184
900 iso_pu_bacteria 2941531003 2941536941 184
901 iso_pu_bacteria 2941538514 2941542048 184
902 iso_pu_bacteria 3005718088 3005719277 184
903 iso_pu_bacteria 8016511872 8016517021 184
904 iso_pu_bacteria 8017057580 8017059559 184
905 iso_pu_bacteria 8019576017 8019579028 184
906 iso_pu_bacteria 8019586578 8019597073 184
907 iso_pu_bacteria 8019597564 8019604610 184
908 iso_pu_bacteria 8019648815 8019650476 184
909 iso_pu_bacteria 8055742211 8055749715 184
910 iso_pu_bacteria 8056967851 8056973927 184
911 iso_pu_bacteria 2885374607 2885382918 186
912 iso_pu_bacteria 2513237137 2513859148 187
913 iso_pu_bacteria 2513237145 2513920543 187
914 iso_pu_bacteria 2517572143 2517887411 187
915 iso_pu_bacteria 2524023228 2524539247 187
916 iso_pu_bacteria 2667528175 2671120850 187
917 iso_pu_bacteria 2728368998 2728750789 187
918 iso_pu_bacteria 2791355197 2793072840 187
919 iso_pu_bacteria 2903748898 2903754089 187
920 iso_pu_bacteria 2904699407 2904707214 187
921 iso_pu_bacteria 2906635258 2906637132 187
922 iso_pu_bacteria 2906660503 2906663660 187
923 iso_pu_bacteria 2922425934 2922433114 187
924 iso_pu_bacteria 2941507105 2941507304 187
925 iso_pu_bacteria 2941515067 2941515731 187
926 iso_pu_bacteria 2941523033 2941523561 187
927 iso_pu_bacteria 8006933436 8006935002 187
928 iso_pu_bacteria 8006973647 8006974970 187
929 iso_pu_bacteria 8019555841 8019563655 187
930 iso_pu_bacteria 8019565922 8019573725 187
931 3300001989 JGI24739J22299_10030012 JGI24739J22299_100300122 196
932 3300001990 JGI24737J22298_10016683 JGI24737J22298_100166832 196
933 3300002067 JGI24735J21928_10022236 JGI24735J21928_100222362 196
934 3300005455 Ga0070663_100076983 Ga0070663_1000769834 196
935 3300005539 Ga0068853_100015513 Ga0068853_1000155135 196
936 3300005563 Ga0068855_100026247 Ga0068855_1000262472 196
937 3300005578 Ga0068854_100002118 Ga0068854_1000021185 196
938 3300005614 Ga0068856_100207841 Ga0068856_1002078412 196
939 3300009093 Ga0105240_10031437 Ga0105240_100314374 196
940 3300009545 Ga0105237_10024587 Ga0105237_100245875 196
941 3300009551 Ga0105238_10012908 Ga0105238_100129085 196
942 3300010375 Ga0105239_10012010 Ga0105239_100120105 196
943 3300025904 Ga0207647_10002979 Ga0207647_100029795 196
944 3300025913 Ga0207695_10054187 Ga0207695_100541872 196
945 3300025914 Ga0207671_10068296 Ga0207671_100682962 196
946 3300025924 Ga0207694_10138458 Ga0207694_101384582 196
947 3300025933 Ga0207706_10060299 Ga0207706_100602992 196
948 3300025949 Ga0207667_10070617 Ga0207667_100706173 196
949 3300025981 Ga0207640_10001801 Ga0207640_100018015 196
950 3300026067 Ga0207678_10099266 Ga0207678_100992664 196
951 3300026078 Ga0207702_10010531 Ga0207702_100105315 196
952 3300026142 Ga0207698_10436902 Ga0207698_104369022 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06282

DUF1036

Protein of unknown function (DUF1036)

28

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ii8-assembly1.cif.gz_B anabaena sensory rhodopsin transducer 0.7745 42 77
2ii8-assembly2.cif.gz_D anabaena sensory rhodopsin transducer 0.7738 42 77
2ii8-assembly2.cif.gz_C anabaena sensory rhodopsin transducer 0.7734 42 77
2ii9-assembly1.cif.gz_D anabaena sensory rhodopsin transducer 0.7693 42 77
2ii9-assembly1.cif.gz_C anabaena sensory rhodopsin transducer 0.769 42 77
ID Description Score Start End Superfamily
2huhA01 Mainly Beta;Sandwich;Immunoglobulin-like;Smr-associated-like 0.8589 42 94 2.60.40.1600
af_Q0J2V2_44_153_2.60.40.3820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7977 39 94 2.60.40.3820
2ii7C00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.7639 34 77 2.60.290.11
2qpfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.7282 37 89 2.60.40.180
af_A4HYX0_89_181_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7111 31 93 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A7V3WEC5-F1-model_v4 Uncharacterized protein 0.8853 36 93
AF-A0A7Y2RHL9-F1-model_v4 J domain-containing protein 0.8797 36 97 GO:0016020
AF-A0A521SXB0-F1-model_v4 Uncharacterized protein 0.8495 36 95
AF-A0A7V6DD21-F1-model_v4 Uncharacterized protein 0.8495 33 93 GO:0016020
AF-A0A2H5X6N7-F1-model_v4 Uncharacterized protein 0.844 33 93 GO:0016020

Feature Viewer

pLDDT pTM Quality
64.92 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map