F486636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 952 | 539 | 744 | 182 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2874645413|2874649707 |
| Length | 208 |
| Sequence | SPRSRLRLLARLVPVLVVGLLCLWASPASADFRLCNNTSSRVGIALGYKDAEGWTTEGWWNISSRSCETLLRGTLVARFYYIYAIDYDRGGEWSGQAFMCSRDKEFTIRGTEDCLARGYDRTGYFEVDTGEQRAWTVQLTDANEQPSKQQRVPGLPGPVGPGVPGLPNGPPGRCPPSPPSHPRPTPPPSHNNTQHRSTKADTTKPNTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 26 | 2791355199 | |||
| 27 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 28 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 39 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 42 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 43 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 44 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 56 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 57 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 58 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 59 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 60 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 61 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 62 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 63 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 64 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 65 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 66 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 71 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 72 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 73 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 74 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 75 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 76 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 77 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 78 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 79 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 80 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 81 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 82 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 83 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 84 | 2904699407 | |||
| 85 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 86 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 87 | 2906610324 | |||
| 88 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 89 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 90 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 91 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 92 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 93 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 94 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 95 | 2922368715 | |||
| 96 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 97 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 98 | 2922425934 | |||
| 99 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 100 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 101 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 102 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 103 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 104 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 105 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 106 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 107 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 108 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 109 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 110 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 111 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 112 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 113 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 114 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 115 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 116 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 117 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 118 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 119 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 120 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 121 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 122 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 123 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 124 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 125 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 126 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 127 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 128 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 129 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 130 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 131 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 132 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 133 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 134 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 135 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 136 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 137 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 138 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 139 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 140 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 141 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 142 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 143 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 144 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 145 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 146 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 147 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 148 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 149 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 150 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 151 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 152 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 153 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 154 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 155 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 156 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 157 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 158 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 159 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 160 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 161 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 162 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 163 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 164 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 165 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 166 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 167 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 168 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 169 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 170 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 173 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 175 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 182 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 195 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 196 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 197 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 199 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 202 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 204 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 206 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 208 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 209 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 210 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 212 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 213 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 214 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 215 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 216 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 217 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 218 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 219 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 221 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 222 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 223 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 227 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 228 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 229 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 230 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 231 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 232 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 233 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 234 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 235 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 236 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 237 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 238 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 240 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 241 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 253 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 263 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 264 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 265 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 266 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 267 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 268 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 320 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 321 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 323 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 325 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 326 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 327 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 328 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 329 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 330 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 331 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 332 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 333 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 334 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 335 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 337 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 340 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 342 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 343 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 345 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 346 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 347 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 348 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 349 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 350 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 351 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 352 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 353 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 354 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 355 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 356 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 357 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 358 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 359 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 360 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 361 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 362 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 363 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 364 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 365 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 410 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 413 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 414 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 415 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 418 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 421 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 424 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 425 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 488 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 493 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 498 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 499 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 500 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 501 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 502 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 503 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 504 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 505 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 506 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 507 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 508 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 509 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 510 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 511 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 512 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 513 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 514 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 515 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 516 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 517 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 518 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 519 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 520 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 521 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 522 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 523 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 524 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 525 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 526 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 527 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 528 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 529 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 530 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 531 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 532 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 533 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 534 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 535 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 536 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 537 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 538 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 539 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.35 |
| Metatranscriptomes | 0.21 |
| Isolates | 21.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.88 |
| Nodule | 15.76 |
| Rhizoplane | 8.09 |
| Rhizosphere | 60.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10030012 | 3300001989 | Bacteria | 1887 |
| 2 | JGI24737J22298_10016683 | 3300001990 | Bacteria | 2370 |
| 3 | JGI24735J21928_10022236 | 3300002067 | Bacteria | 1933 |
| 4 | Ga0070683_100059816 | 3300005329 | Bacteria | 3540 |
| 5 | Ga0070683_100296554 | 3300005329 | Bacteria | 1538 |
| 6 | Ga0070682_100259179 | 3300005337 | Bacteria | 1258 |
| 7 | Ga0068868_100104658 | 3300005338 | Bacteria | 2294 |
| 8 | Ga0068868_100121743 | 3300005338 | Bacteria | 2129 |
| 9 | Ga0068868_100306083 | 3300005338 | Bacteria | 1351 |
| 10 | Ga0070660_100614190 | 3300005339 | Bacteria | 910 |
| 11 | Ga0070689_100027697 | 3300005340 | Bacteria | 4274 |
| 12 | Ga0070689_100121490 | 3300005340 | Bacteria | 2087 |
| 13 | Ga0070687_100645005 | 3300005343 | Bacteria | 733 |
| 14 | Ga0070692_10643300 | 3300005345 | Bacteria | 707 |
| 15 | Ga0070675_100194027 | 3300005354 | Bacteria | 1761 |
| 16 | Ga0070675_100444801 | 3300005354 | Bacteria | 1162 |
| 17 | Ga0070675_100672486 | 3300005354 | Bacteria | 942 |
| 18 | Ga0070671_100025538 | 3300005355 | Bacteria | 4848 |
| 19 | Ga0070671_100168248 | 3300005355 | Bacteria | 1854 |
| 20 | Ga0070671_100712762 | 3300005355 | Bacteria | 871 |
| 21 | Ga0070674_100015914 | 3300005356 | Bacteria | 4706 |
| 22 | Ga0070673_100014626 | 3300005364 | Bacteria | 5476 |
| 23 | Ga0070673_100268802 | 3300005364 | Bacteria | 1491 |
| 24 | Ga0070673_101010118 | 3300005364 | Bacteria | 775 |
| 25 | Ga0070688_100198197 | 3300005365 | Bacteria | 1403 |
| 26 | Ga0070659_100368143 | 3300005366 | Bacteria | 1209 |
| 27 | Ga0070667_100083614 | 3300005367 | Bacteria | 2735 |
| 28 | Ga0070667_100274041 | 3300005367 | Bacteria | 1513 |
| 29 | Ga0070667_100413933 | 3300005367 | Bacteria | 1228 |
| 30 | Ga0070667_100444040 | 3300005367 | Bacteria | 1185 |
| 31 | Ga0070709_10000619 | 3300005434 | Bacteria | 20331 |
| 32 | Ga0070709_10049581 | 3300005434 | Bacteria | 2626 |
| 33 | Ga0070709_10174332 | 3300005434 | Bacteria | 1505 |
| 34 | Ga0070714_100004377 | 3300005435 | Bacteria | 10640 |
| 35 | Ga0070714_100013145 | 3300005435 | Bacteria | 6628 |
| 36 | Ga0070714_100017830 | 3300005435 | Bacteria | 5758 |
| 37 | Ga0070714_100123060 | 3300005435 | Bacteria | 2309 |
| 38 | Ga0070714_100273924 | 3300005435 | Bacteria | 1566 |
| 39 | Ga0070714_100306490 | 3300005435 | Bacteria | 1482 |
| 40 | Ga0070713_100010117 | 3300005436 | Bacteria | 6803 |
| 41 | Ga0070713_100018181 | 3300005436 | Bacteria | 5341 |
| 42 | Ga0070713_100078356 | 3300005436 | Bacteria | 2813 |
| 43 | Ga0070713_100139415 | 3300005436 | Bacteria | 2146 |
| 44 | Ga0070713_100164304 | 3300005436 | Bacteria | 1984 |
| 45 | Ga0070713_100267822 | 3300005436 | Bacteria | 1563 |
| 46 | Ga0070710_10000409 | 3300005437 | Bacteria | 20181 |
| 47 | Ga0070710_10000804 | 3300005437 | Bacteria | 15066 |
| 48 | Ga0070710_10005753 | 3300005437 | Bacteria | 5904 |
| 49 | Ga0070710_10187129 | 3300005437 | Bacteria | 1300 |
| 50 | Ga0070711_100000650 | 3300005439 | Bacteria | 18134 |
| 51 | Ga0070711_100016256 | 3300005439 | Bacteria | 4723 |
| 52 | Ga0070711_100079636 | 3300005439 | Bacteria | 2330 |
| 53 | Ga0070711_100223987 | 3300005439 | Bacteria | 1463 |
| 54 | Ga0070694_100576064 | 3300005444 | Bacteria | 904 |
| 55 | Ga0070708_100103303 | 3300005445 | Bacteria | 2612 |
| 56 | Ga0070663_100076983 | 3300005455 | Bacteria | 2441 |
| 57 | Ga0070678_100207701 | 3300005456 | Bacteria | 1620 |
| 58 | Ga0070662_100144654 | 3300005457 | Bacteria | 1846 |
| 59 | Ga0070681_10223732 | 3300005458 | Bacteria | 1797 |
| 60 | Ga0070685_10092264 | 3300005466 | Bacteria | 1835 |
| 61 | Ga0070706_100343528 | 3300005467 | Bacteria | 1392 |
| 62 | Ga0070706_100750060 | 3300005467 | Bacteria | 904 |
| 63 | Ga0070699_100003004 | 3300005518 | Bacteria | 14991 |
| 64 | Ga0070679_101081044 | 3300005530 | Bacteria | 747 |
| 65 | Ga0070684_100255355 | 3300005535 | Bacteria | 1602 |
| 66 | Ga0070684_100482802 | 3300005535 | Bacteria | 1147 |
| 67 | Ga0070697_100141633 | 3300005536 | Bacteria | 2023 |
| 68 | Ga0070697_100169978 | 3300005536 | Bacteria | 1844 |
| 69 | Ga0068853_100015513 | 3300005539 | Bacteria | 6257 |
| 70 | Ga0070672_100345493 | 3300005543 | Bacteria | 1268 |
| 71 | Ga0070686_100056769 | 3300005544 | Bacteria | 2512 |
| 72 | Ga0070686_100205680 | 3300005544 | Bacteria | 1414 |
| 73 | Ga0070686_100276081 | 3300005544 | Bacteria | 1237 |
| 74 | Ga0070665_100114487 | 3300005548 | Bacteria | 2700 |
| 75 | Ga0068855_100026247 | 3300005563 | Bacteria | 6970 |
| 76 | Ga0068855_100290975 | 3300005563 | Bacteria | 1811 |
| 77 | Ga0070664_100114064 | 3300005564 | Bacteria | 2361 |
| 78 | Ga0068857_100129461 | 3300005577 | Bacteria | 2276 |
| 79 | Ga0068854_100002118 | 3300005578 | Bacteria | 12173 |
| 80 | Ga0068854_100363706 | 3300005578 | Bacteria | 1187 |
| 81 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 82 | Ga0068856_100207841 | 3300005614 | Bacteria | 1972 |
| 83 | Ga0068856_100339241 | 3300005614 | Bacteria | 1521 |
| 84 | Ga0070702_100406306 | 3300005615 | Bacteria | 975 |
| 85 | Ga0070702_101052507 | 3300005615 | Bacteria | 647 |
| 86 | Ga0068859_100129787 | 3300005617 | Bacteria | 2591 |
| 87 | Ga0068864_100138545 | 3300005618 | Bacteria | 2193 |
| 88 | Ga0068864_100249599 | 3300005618 | Bacteria | 1647 |
| 89 | Ga0068851_10455847 | 3300005834 | Bacteria | 761 |
| 90 | Ga0068863_100618728 | 3300005841 | Bacteria | 1073 |
| 91 | Ga0068858_100121889 | 3300005842 | Bacteria | 2439 |
| 92 | Ga0068858_100147937 | 3300005842 | Bacteria | 2207 |
| 93 | Ga0068858_100482458 | 3300005842 | Bacteria | 1197 |
| 94 | Ga0081455_10001093 | 3300005937 | Bacteria | 34045 |
| 95 | Ga0081455_10009527 | 3300005937 | Bacteria | 9976 |
| 96 | Ga0081455_10211820 | 3300005937 | Bacteria | 1443 |
| 97 | Ga0081538_10031425 | 3300005981 | Bacteria | 3582 |
| 98 | Ga0081540_1051334 | 3300005983 | Bacteria | 2040 |
| 99 | Ga0070717_10002016 | 3300006028 | Bacteria | 14209 |
| 100 | Ga0070717_10002999 | 3300006028 | Bacteria | 12022 |
| 101 | Ga0070717_10025250 | 3300006028 | Bacteria | 4723 |
| 102 | Ga0070717_10030212 | 3300006028 | Bacteria | 4353 |
| 103 | Ga0070717_10085715 | 3300006028 | Bacteria | 2651 |
| 104 | Ga0070717_10416191 | 3300006028 | Bacteria | 1209 |
| 105 | Ga0070717_10790035 | 3300006028 | Bacteria | 863 |
| 106 | Ga0075365_10046194 | 3300006038 | Bacteria | 2859 |
| 107 | Ga0075365_10127495 | 3300006038 | Bacteria | 1759 |
| 108 | Ga0075365_10274272 | 3300006038 | Bacteria | 1186 |
| 109 | Ga0075363_100021136 | 3300006048 | Bacteria | 3273 |
| 110 | Ga0075363_100183842 | 3300006048 | Bacteria | 1190 |
| 111 | Ga0075363_100280686 | 3300006048 | Bacteria | 963 |
| 112 | Ga0075364_10030827 | 3300006051 | Bacteria | 3443 |
| 113 | Ga0075364_10128388 | 3300006051 | Bacteria | 1701 |
| 114 | Ga0075364_10320977 | 3300006051 | Bacteria | 1054 |
| 115 | Ga0070715_10000199 | 3300006163 | Bacteria | 14099 |
| 116 | Ga0070715_10005153 | 3300006163 | Bacteria | 4341 |
| 117 | Ga0070715_10011596 | 3300006163 | Bacteria | 3179 |
| 118 | Ga0070715_10166818 | 3300006163 | Bacteria | 1093 |
| 119 | Ga0070715_10189802 | 3300006163 | Bacteria | 1036 |
| 120 | Ga0070716_100003498 | 3300006173 | Bacteria | 7401 |
| 121 | Ga0070716_100007123 | 3300006173 | Bacteria | 5493 |
| 122 | Ga0070712_100026783 | 3300006175 | Bacteria | 3845 |
| 123 | Ga0070712_100054155 | 3300006175 | Bacteria | 2804 |
| 124 | Ga0070712_100101520 | 3300006175 | Bacteria | 2128 |
| 125 | Ga0075362_10041733 | 3300006177 | Bacteria | 2025 |
| 126 | Ga0075367_10031601 | 3300006178 | Bacteria | 3041 |
| 127 | Ga0075367_10299047 | 3300006178 | Bacteria | 1013 |
| 128 | Ga0075369_10008314 | 3300006186 | Bacteria | 3991 |
| 129 | Ga0075366_10022248 | 3300006195 | Bacteria | 3687 |
| 130 | Ga0075370_10001319 | 3300006353 | Bacteria | 10634 |
| 131 | Ga0075370_10033800 | 3300006353 | Bacteria | 2864 |
| 132 | Ga0075370_10055494 | 3300006353 | Bacteria | 2251 |
| 133 | Ga0075370_10238013 | 3300006353 | Bacteria | 1078 |
| 134 | Ga0075370_10501083 | 3300006353 | Bacteria | 733 |
| 135 | Ga0068871_100013913 | 3300006358 | Bacteria | 5983 |
| 136 | Ga0075428_100035350 | 3300006844 | Bacteria | 5508 |
| 137 | Ga0075428_100463566 | 3300006844 | Bacteria | 1357 |
| 138 | Ga0075428_101542115 | 3300006844 | Bacteria | 695 |
| 139 | Ga0075430_100234294 | 3300006846 | Bacteria | 1522 |
| 140 | Ga0075431_100087680 | 3300006847 | Bacteria | 3211 |
| 141 | Ga0075431_100129587 | 3300006847 | Bacteria | 2602 |
| 142 | Ga0075434_100128119 | 3300006871 | Bacteria | 2556 |
| 143 | Ga0075434_100146849 | 3300006871 | Bacteria | 2378 |
| 144 | Ga0075434_100159706 | 3300006871 | Bacteria | 2274 |
| 145 | Ga0075434_100246619 | 3300006871 | Bacteria | 1805 |
| 146 | Ga0075429_100306752 | 3300006880 | Bacteria | 1390 |
| 147 | Ga0075429_100406395 | 3300006880 | Bacteria | 1193 |
| 148 | Ga0068865_101283628 | 3300006881 | Bacteria | 650 |
| 149 | Ga0097620_100129776 | 3300006931 | Bacteria | 2591 |
| 150 | Ga0075435_100244588 | 3300007076 | Bacteria | 1526 |
| 151 | Ga0075435_100406799 | 3300007076 | Bacteria | 1171 |
| 152 | Ga0099795_10105977 | 3300007788 | Bacteria | 1108 |
| 153 | Ga0105244_10183628 | 3300009036 | Bacteria | 991 |
| 154 | Ga0105240_10023270 | 3300009093 | Bacteria | 8199 |
| 155 | Ga0105240_10031437 | 3300009093 | Bacteria | 6885 |
| 156 | Ga0111539_10040709 | 3300009094 | Bacteria | 5591 |
| 157 | Ga0105245_10002241 | 3300009098 | Bacteria | 17507 |
| 158 | Ga0105245_10167287 | 3300009098 | Bacteria | 2091 |
| 159 | Ga0105247_10155765 | 3300009101 | Bacteria | 1509 |
| 160 | Ga0105247_10181587 | 3300009101 | Bacteria | 1405 |
| 161 | Ga0114129_10212328 | 3300009147 | Bacteria | 2615 |
| 162 | Ga0114129_12414671 | 3300009147 | Bacteria | 629 |
| 163 | Ga0105243_10156335 | 3300009148 | Bacteria | 1961 |
| 164 | Ga0105242_10137592 | 3300009176 | Bacteria | 2115 |
| 165 | Ga0105242_10831890 | 3300009176 | Bacteria | 917 |
| 166 | Ga0105248_10060907 | 3300009177 | Bacteria | 4237 |
| 167 | Ga0105248_10169046 | 3300009177 | Bacteria | 2464 |
| 168 | Ga0105237_10024587 | 3300009545 | Bacteria | 6159 |
| 169 | Ga0105237_10080340 | 3300009545 | Bacteria | 3251 |
| 170 | Ga0105237_10082386 | 3300009545 | Bacteria | 3208 |
| 171 | Ga0105237_10092764 | 3300009545 | Bacteria | 3009 |
| 172 | Ga0105237_10214790 | 3300009545 | Bacteria | 1923 |
| 173 | Ga0105238_10012908 | 3300009551 | Bacteria | 8430 |
| 174 | Ga0105238_10045610 | 3300009551 | Bacteria | 4428 |
| 175 | Ga0105238_10063884 | 3300009551 | Bacteria | 3682 |
| 176 | Ga0105238_10333592 | 3300009551 | Bacteria | 1504 |
| 177 | Ga0105238_10446993 | 3300009551 | Bacteria | 1289 |
| 178 | Ga0099796_10027701 | 3300010159 | Bacteria | 1812 |
| 179 | Ga0099796_10059180 | 3300010159 | Bacteria | 1352 |
| 180 | Ga0105239_10012010 | 3300010375 | Bacteria | 9658 |
| 181 | Ga0105239_10594306 | 3300010375 | Bacteria | 1262 |
| 182 | Ga0105246_10192047 | 3300011119 | Bacteria | 1581 |
| 183 | Ga0105246_10258240 | 3300011119 | Bacteria | 1387 |
| 184 | Ga0105246_10679104 | 3300011119 | Bacteria | 900 |
| 185 | Ga0157370_10183631 | 3300013104 | Bacteria | 1943 |
| 186 | Ga0157369_10048517 | 3300013105 | Bacteria | 4607 |
| 187 | Ga0157369_10086990 | 3300013105 | Bacteria | 3337 |
| 188 | Ga0157369_10238439 | 3300013105 | Bacteria | 1900 |
| 189 | Ga0157374_10055264 | 3300013296 | Bacteria | 3704 |
| 190 | Ga0163162_10165938 | 3300013306 | Bacteria | 2332 |
| 191 | Ga0163162_10278726 | 3300013306 | Bacteria | 1804 |
| 192 | Ga0157375_11659215 | 3300013308 | Bacteria | 756 |
| 193 | Ga0163163_10093908 | 3300014325 | Bacteria | 3017 |
| 194 | Ga0163163_11712358 | 3300014325 | Bacteria | 689 |
| 195 | Ga0163161_10319734 | 3300017792 | Bacteria | 1227 |
| 196 | Ga0213873_10002485 | 3300021358 | Bacteria | 3193 |
| 197 | Ga0213872_10013615 | 3300021361 | Bacteria | 3808 |
| 198 | Ga0213872_10170767 | 3300021361 | Bacteria | 943 |
| 199 | Ga0213876_10030494 | 3300021384 | Bacteria | 2844 |
| 200 | Ga0213876_10343434 | 3300021384 | Bacteria | 794 |
| 201 | Ga0213875_10000033 | 3300021388 | Bacteria | 170944 |
| 202 | Ga0213875_10106942 | 3300021388 | Bacteria | 1306 |
| 203 | Ga0213871_10068876 | 3300021441 | Bacteria | 997 |
| 204 | Ga0224572_1006986 | 3300024225 | Bacteria | 2057 |
| 205 | Ga0209758_1001433 | 3300025297 | Bacteria | 28167 |
| 206 | Ga0209758_1043052 | 3300025297 | Bacteria | 1667 |
| 207 | Ga0207682_10357695 | 3300025893 | Bacteria | 688 |
| 208 | Ga0207692_10000426 | 3300025898 | Bacteria | 14792 |
| 209 | Ga0207692_10016808 | 3300025898 | Bacteria | 3249 |
| 210 | Ga0207642_10254575 | 3300025899 | Bacteria | 998 |
| 211 | Ga0207710_10079523 | 3300025900 | Bacteria | 1518 |
| 212 | Ga0207710_10299952 | 3300025900 | Bacteria | 812 |
| 213 | Ga0207680_10218878 | 3300025903 | Bacteria | 1304 |
| 214 | Ga0207647_10002979 | 3300025904 | Bacteria | 12743 |
| 215 | Ga0207685_10000676 | 3300025905 | Bacteria | 6108 |
| 216 | Ga0207685_10000725 | 3300025905 | Bacteria | 5988 |
| 217 | Ga0207685_10135382 | 3300025905 | Bacteria | 1098 |
| 218 | Ga0207685_10228224 | 3300025905 | Bacteria | 889 |
| 219 | Ga0207699_10000368 | 3300025906 | Bacteria | 23746 |
| 220 | Ga0207699_10030943 | 3300025906 | Bacteria | 3001 |
| 221 | Ga0207699_10038943 | 3300025906 | Bacteria | 2728 |
| 222 | Ga0207699_10059050 | 3300025906 | Bacteria | 2297 |
| 223 | Ga0207699_10546944 | 3300025906 | Bacteria | 839 |
| 224 | Ga0207645_10190766 | 3300025907 | Bacteria | 1347 |
| 225 | Ga0207684_10049404 | 3300025910 | Bacteria | 3568 |
| 226 | Ga0207684_10391356 | 3300025910 | Bacteria | 1195 |
| 227 | Ga0207695_10054187 | 3300025913 | Bacteria | 4190 |
| 228 | Ga0207671_10064657 | 3300025914 | Bacteria | 2720 |
| 229 | Ga0207671_10068296 | 3300025914 | Bacteria | 2648 |
| 230 | Ga0207671_10089125 | 3300025914 | Bacteria | 2321 |
| 231 | Ga0207693_10001800 | 3300025915 | Bacteria | 18793 |
| 232 | Ga0207693_10026940 | 3300025915 | Bacteria | 4546 |
| 233 | Ga0207693_10062230 | 3300025915 | Bacteria | 2924 |
| 234 | Ga0207693_10087406 | 3300025915 | Bacteria | 2442 |
| 235 | Ga0207693_10207342 | 3300025915 | Bacteria | 1541 |
| 236 | Ga0207663_10000896 | 3300025916 | Bacteria | 13571 |
| 237 | Ga0207663_10013127 | 3300025916 | Bacteria | 4496 |
| 238 | Ga0207663_10200555 | 3300025916 | Bacteria | 1439 |
| 239 | Ga0207649_10460311 | 3300025920 | Bacteria | 961 |
| 240 | Ga0207652_10042639 | 3300025921 | Bacteria | 3863 |
| 241 | Ga0207652_10098763 | 3300025921 | Bacteria | 2575 |
| 242 | Ga0207646_10099945 | 3300025922 | Bacteria | 2600 |
| 243 | Ga0207694_10042041 | 3300025924 | Bacteria | 3524 |
| 244 | Ga0207694_10107825 | 3300025924 | Bacteria | 2213 |
| 245 | Ga0207694_10138458 | 3300025924 | Bacteria | 1956 |
| 246 | Ga0207650_10007870 | 3300025925 | Bacteria | 7257 |
| 247 | Ga0207650_10279148 | 3300025925 | Bacteria | 1360 |
| 248 | Ga0207659_10106041 | 3300025926 | Bacteria | 2127 |
| 249 | Ga0207659_10114854 | 3300025926 | Bacteria | 2053 |
| 250 | Ga0207687_10023697 | 3300025927 | Bacteria | 4094 |
| 251 | Ga0207687_10669561 | 3300025927 | Bacteria | 879 |
| 252 | Ga0207687_11015715 | 3300025927 | Bacteria | 711 |
| 253 | Ga0207700_10003271 | 3300025928 | Bacteria | 9371 |
| 254 | Ga0207700_10022300 | 3300025928 | Bacteria | 4343 |
| 255 | Ga0207700_10037832 | 3300025928 | Bacteria | 3498 |
| 256 | Ga0207700_10081890 | 3300025928 | Bacteria | 2522 |
| 257 | Ga0207700_10096339 | 3300025928 | Bacteria | 2349 |
| 258 | Ga0207700_10140024 | 3300025928 | Bacteria | 1987 |
| 259 | Ga0207700_10172138 | 3300025928 | Bacteria | 1807 |
| 260 | Ga0207700_10213776 | 3300025928 | Bacteria | 1632 |
| 261 | Ga0207700_10282403 | 3300025928 | Bacteria | 1428 |
| 262 | Ga0207700_10429775 | 3300025928 | Bacteria | 1161 |
| 263 | Ga0207700_10771619 | 3300025928 | Bacteria | 859 |
| 264 | Ga0207664_10021693 | 3300025929 | Bacteria | 4783 |
| 265 | Ga0207664_10098511 | 3300025929 | Bacteria | 2411 |
| 266 | Ga0207664_10103552 | 3300025929 | Bacteria | 2355 |
| 267 | Ga0207664_10111644 | 3300025929 | Bacteria | 2274 |
| 268 | Ga0207664_10440302 | 3300025929 | Bacteria | 1162 |
| 269 | Ga0207664_10699201 | 3300025929 | Bacteria | 912 |
| 270 | Ga0207664_10727705 | 3300025929 | Bacteria | 892 |
| 271 | Ga0207644_10003286 | 3300025931 | Bacteria | 10449 |
| 272 | Ga0207644_10085957 | 3300025931 | Bacteria | 2334 |
| 273 | Ga0207690_10505151 | 3300025932 | Bacteria | 978 |
| 274 | Ga0207706_10033595 | 3300025933 | Bacteria | 4565 |
| 275 | Ga0207706_10060299 | 3300025933 | Bacteria | 3341 |
| 276 | Ga0207706_10566472 | 3300025933 | Bacteria | 977 |
| 277 | Ga0207686_10704747 | 3300025934 | Bacteria | 803 |
| 278 | Ga0207709_10566415 | 3300025935 | Bacteria | 895 |
| 279 | Ga0207670_10111986 | 3300025936 | Bacteria | 1969 |
| 280 | Ga0207670_10133649 | 3300025936 | Bacteria | 1821 |
| 281 | Ga0207669_10035736 | 3300025937 | Bacteria | 2831 |
| 282 | Ga0207665_10000224 | 3300025939 | Bacteria | 38643 |
| 283 | Ga0207665_10001873 | 3300025939 | Bacteria | 14172 |
| 284 | Ga0207665_10011625 | 3300025939 | Bacteria | 5785 |
| 285 | Ga0207665_10170852 | 3300025939 | Bacteria | 1570 |
| 286 | Ga0207665_10456422 | 3300025939 | Bacteria | 981 |
| 287 | Ga0207691_10058529 | 3300025940 | Bacteria | 3505 |
| 288 | Ga0207691_10113854 | 3300025940 | Bacteria | 2404 |
| 289 | Ga0207691_10249079 | 3300025940 | Bacteria | 1534 |
| 290 | Ga0207711_10081931 | 3300025941 | Bacteria | 2820 |
| 291 | Ga0207711_10193303 | 3300025941 | Bacteria | 1855 |
| 292 | Ga0207661_10006894 | 3300025944 | Bacteria | 8052 |
| 293 | Ga0207667_10070617 | 3300025949 | Bacteria | 3634 |
| 294 | Ga0207667_10174669 | 3300025949 | Bacteria | 2208 |
| 295 | Ga0207667_10653345 | 3300025949 | Bacteria | 1057 |
| 296 | Ga0207651_10078439 | 3300025960 | Bacteria | 2369 |
| 297 | Ga0207651_11453601 | 3300025960 | Bacteria | 617 |
| 298 | Ga0207712_10227463 | 3300025961 | Bacteria | 1495 |
| 299 | Ga0207712_10232963 | 3300025961 | Bacteria | 1479 |
| 300 | Ga0207640_10001801 | 3300025981 | Bacteria | 11500 |
| 301 | Ga0207640_10641338 | 3300025981 | Bacteria | 904 |
| 302 | Ga0207658_10107139 | 3300025986 | Bacteria | 2202 |
| 303 | Ga0207658_10123190 | 3300025986 | Bacteria | 2071 |
| 304 | Ga0207677_10159967 | 3300026023 | Bacteria | 1748 |
| 305 | Ga0207677_10217451 | 3300026023 | Bacteria | 1530 |
| 306 | Ga0207677_10287554 | 3300026023 | Bacteria | 1352 |
| 307 | Ga0207703_10130052 | 3300026035 | Bacteria | 2173 |
| 308 | Ga0207703_10210994 | 3300026035 | Bacteria | 1731 |
| 309 | Ga0207703_10688485 | 3300026035 | Bacteria | 972 |
| 310 | Ga0207639_11000068 | 3300026041 | Bacteria | 783 |
| 311 | Ga0207678_10099266 | 3300026067 | Bacteria | 2487 |
| 312 | Ga0207678_10154957 | 3300026067 | Bacteria | 1956 |
| 313 | Ga0207702_10000688 | 3300026078 | Bacteria | 36556 |
| 314 | Ga0207702_10010531 | 3300026078 | Bacteria | 7730 |
| 315 | Ga0207676_10112674 | 3300026095 | Bacteria | 2279 |
| 316 | Ga0207676_10776230 | 3300026095 | Bacteria | 933 |
| 317 | Ga0207674_10050892 | 3300026116 | Bacteria | 4230 |
| 318 | Ga0207683_10047974 | 3300026121 | Bacteria | 3740 |
| 319 | Ga0207683_10932983 | 3300026121 | Bacteria | 806 |
| 320 | Ga0207698_10436902 | 3300026142 | Bacteria | 1260 |
| 321 | Ga0209179_1023692 | 3300027512 | Bacteria | 1213 |
| 322 | Ga0268266_10286038 | 3300028379 | Bacteria | 1534 |
| 323 | Ga0265336_10029119 | 3300028666 | Bacteria | 1723 |
| 324 | Ga0265338_10001933 | 3300028800 | Bacteria | 32327 |
| 325 | Ga0265324_10017106 | 3300029957 | Bacteria | 2638 |
| 326 | Ga0307511_10204636 | 3300030521 | Bacteria | 1018 |
| 327 | Ga0265760_10033692 | 3300031090 | Bacteria | 1513 |
| 328 | Ga0265760_10116647 | 3300031090 | Bacteria | 854 |
| 329 | Ga0265340_10097742 | 3300031247 | Bacteria | 1367 |
| 330 | Ga0307509_10074245 | 3300031507 | Bacteria | 3537 |
| 331 | Ga0307509_10166946 | 3300031507 | Bacteria | 2087 |
| 332 | Ga0265313_10196075 | 3300031595 | Bacteria | 842 |
| 333 | Ga0307508_10001335 | 3300031616 | Bacteria | 27906 |
| 334 | Ga0307508_10127981 | 3300031616 | Bacteria | 2142 |
| 335 | Ga0307516_10199557 | 3300031730 | Bacteria | 1721 |
| 336 | Ga0307516_10228815 | 3300031730 | Bacteria | 1564 |
| 337 | Ga0307412_10626885 | 3300031911 | Bacteria | 914 |
| 338 | Ga0307507_10031018 | 3300033179 | Bacteria | 5620 |
| 339 | Ga0373930_0111813 | 3300034816 | Bacteria | 658 |
| 340 | Ga0373948_0009793 | 3300034817 | Bacteria | 1661 |
| 341 | Ga0373950_0017673 | 3300034818 | Bacteria | 1231 |
| 342 | Ga0373929_0068056 | 3300035085 | Bacteria | 847 |
| 343 | Ga0373940_0016218 | 3300035088 | Bacteria | 1844 |
| 344 | Ga0373944_0002616 | 3300035089 | Bacteria | 4588 |
| 345 | Ga0373944_0003875 | 3300035089 | Bacteria | 3877 |
| 346 | Ga0373949_0018243 | 3300035090 | Bacteria | 1589 |
| 347 | Ga0373949_0066951 | 3300035090 | Bacteria | 934 |
| 348 | Ga0373951_0014324 | 3300035091 | Bacteria | 1783 |
| 349 | Ga0373952_0031215 | 3300035092 | Bacteria | 1184 |
| 350 | Ga0373945_0050351 | 3300035116 | Bacteria | 1530 |
| 351 | Ga0373960_0055424 | 3300035121 | Bacteria | 1188 |
| 352 | Ga0373943_0000115 | 3300035170 | Bacteria | 30041 |
| 353 | Ga0373943_0029833 | 3300035170 | Bacteria | 2578 |
| 354 | Ga0373943_0049619 | 3300035170 | Bacteria | 2060 |
| 355 | Ga0373943_0282078 | 3300035170 | Bacteria | 939 |
| 356 | Ga0373946_0003839 | 3300035171 | Bacteria | 5337 |
| 357 | Ga0373946_0005231 | 3300035171 | Bacteria | 4678 |
| 358 | Ga0373955_0100773 | 3300035172 | Bacteria | 1658 |
| 359 | Ga0373961_0058505 | 3300035241 | Bacteria | 1163 |
| 360 | Ga0373961_0292598 | 3300035241 | Bacteria | 600 |
| 361 | Ga0373931_0047704 | 3300035691 | Bacteria | 2267 |
| 362 | Ga0373935_0001782 | 3300035692 | Bacteria | 12112 |
| 363 | Ga0373935_0009768 | 3300035692 | Bacteria | 5747 |
| 364 | Ga0373935_0034061 | 3300035692 | Bacteria | 3173 |
| 365 | Ga0373935_0129457 | 3300035692 | Bacteria | 1695 |
| 366 | Ga0373935_0185169 | 3300035692 | Bacteria | 1431 |
| 367 | Ga0373935_0193265 | 3300035692 | Bacteria | 1403 |
| 368 | Ga0373935_0208474 | 3300035692 | Bacteria | 1353 |
| 369 | Ga0373927_0001673 | 3300035695 | Bacteria | 16572 |
| 370 | Ga0373927_0001710 | 3300035695 | Bacteria | 16395 |
| 371 | Ga0373927_0032729 | 3300035695 | Bacteria | 3386 |
| 372 | Ga0373927_0048532 | 3300035695 | Bacteria | 2746 |
| 373 | Ga0373927_0065899 | 3300035695 | Bacteria | 2342 |
| 374 | Ga0373947_0001924 | 3300035725 | Bacteria | 12701 |
| 375 | Ga0373947_0016273 | 3300035725 | Bacteria | 4275 |
| 376 | Ga0373947_0045489 | 3300035725 | Bacteria | 2627 |
| 377 | Ga0373947_0074035 | 3300035725 | Bacteria | 2094 |
| 378 | Ga0373947_0184413 | 3300035725 | Bacteria | 1360 |
| 379 | Ga0373947_0247214 | 3300035725 | Bacteria | 1178 |
| 380 | Ga0316584_0039488 | 3300036712 | Bacteria | 3514 |
| 381 | Ga0373925_0004011 | 3300037068 | Bacteria | 11200 |
| 382 | Ga0373925_0010804 | 3300037068 | Bacteria | 6620 |
| 383 | Ga0373925_0034736 | 3300037068 | Bacteria | 3717 |
| 384 | Ga0373925_0321233 | 3300037068 | Bacteria | 1253 |
| 385 | Ga0373925_0337713 | 3300037068 | Bacteria | 1221 |
| 386 | Ga0395899_0096896 | 3300037312 | Bacteria | 2133 |
| 387 | Ga0395900_0099052 | 3300037418 | Bacteria | 2995 |
| 388 | Ga0395898_0018364 | 3300037466 | Bacteria | 7133 |
| 389 | Ga0395898_0114634 | 3300037466 | Bacteria | 2582 |
| 390 | Ga0395898_0414314 | 3300037466 | Bacteria | 1284 |
| 391 | Ga0395905_0485756 | 3300037471 | Bacteria | 1135 |
| 392 | Ga0436364_0816729 | 3300037853 | Bacteria | 7877 |
| 393 | Ga0436364_1511242 | 3300037853 | Bacteria | 912 |
| 394 | Ga0395901_0227168 | 3300038443 | Bacteria | 1949 |
| 395 | Ga0395901_0348947 | 3300038443 | Bacteria | 1527 |
| 396 | Ga0395901_0409313 | 3300038443 | Bacteria | 1393 |
| 397 | Ga0395901_0553324 | 3300038443 | Bacteria | 1166 |
| 398 | Ga0436365_0027168 | 3300039437 | Bacteria | 922 |
| 399 | Ga0436365_0594440 | 3300039437 | Bacteria | 12543 |
| 400 | Ga0436365_0696800 | 3300039437 | Bacteria | 10837 |
| 401 | Ga0436365_0772739 | 3300039437 | Bacteria | 2157 |
| 402 | Ga0436365_0914429 | 3300039437 | Bacteria | 2302 |
| 403 | Ga0436365_0982478 | 3300039437 | Bacteria | 4414 |
| 404 | Ga0436365_1860016 | 3300039437 | Bacteria | 982 |
| 405 | Ga0436365_1876119 | 3300039437 | Bacteria | 2318 |
| 406 | Ga0436360_0460383 | 3300039438 | Bacteria | 954 |
| 407 | Ga0436361_0298469 | 3300039447 | Bacteria | 1326 |
| 408 | Ga0436361_0531880 | 3300039447 | Bacteria | 1169 |
| 409 | Ga0436361_0679525 | 3300039447 | Bacteria | 1469 |
| 410 | Ga0436363_0424805 | 3300039450 | Bacteria | 1699 |
| 411 | Ga0436363_0644197 | 3300039450 | Bacteria | 1170 |
| 412 | Ga0436363_0904821 | 3300039450 | Bacteria | 1666 |
| 413 | Ga0436363_1026561 | 3300039450 | Bacteria | 796 |
| 414 | Ga0436363_1145542 | 3300039450 | Bacteria | 630 |
| 415 | Ga0436362_0715867 | 3300039453 | Bacteria | 6311 |
| 416 | Ga0451797_0977362 | 3300041453 | Bacteria | 740 |
| 417 | Ga0451833_0759778 | 3300041491 | Bacteria | 822 |
| 418 | Ga0495603_0064045 | 3300046455 | Bacteria | 2168 |
| 419 | Ga0495641_0088345 | 3300046461 | Bacteria | 1386 |
| 420 | Ga0495653_0169862 | 3300046463 | Bacteria | 1506 |
| 421 | Ga0495580_0042943 | 3300046472 | Bacteria | 3218 |
| 422 | Ga0495580_0625075 | 3300046472 | Bacteria | 710 |
| 423 | Ga0495582_0063217 | 3300046473 | Bacteria | 2045 |
| 424 | Ga0495639_0018784 | 3300046475 | Bacteria | 3012 |
| 425 | Ga0495662_0013154 | 3300046476 | Bacteria | 4030 |
| 426 | Ga0495664_0002145 | 3300046477 | Bacteria | 10553 |
| 427 | Ga0495584_0003705 | 3300046491 | Bacteria | 8330 |
| 428 | Ga0495618_0004115 | 3300046514 | Bacteria | 8979 |
| 429 | Ga0495630_0009728 | 3300046517 | Bacteria | 6915 |
| 430 | Ga0495630_0026168 | 3300046517 | Bacteria | 4319 |
| 431 | Ga0495630_0138601 | 3300046517 | Bacteria | 1849 |
| 432 | Ga0495630_0361455 | 3300046517 | Bacteria | 1111 |
| 433 | Ga0495648_0186998 | 3300046524 | Bacteria | 1048 |
| 434 | Ga0495652_0018206 | 3300046529 | Bacteria | 6268 |
| 435 | Ga0495665_0042714 | 3300046531 | Bacteria | 2412 |
| 436 | Ga0495665_0048332 | 3300046531 | Bacteria | 2255 |
| 437 | Ga0495665_0175146 | 3300046531 | Bacteria | 1116 |
| 438 | Ga0495640_0009233 | 3300046533 | Bacteria | 7692 |
| 439 | Ga0495640_0009535 | 3300046533 | Bacteria | 7553 |
| 440 | Ga0495640_0113326 | 3300046533 | Bacteria | 1769 |
| 441 | Ga0495587_0338766 | 3300046536 | Bacteria | 839 |
| 442 | Ga0495598_0002854 | 3300046537 | Bacteria | 3609 |
| 443 | Ga0495621_0049786 | 3300046539 | Bacteria | 1496 |
| 444 | Ga0495645_0026515 | 3300046543 | Bacteria | 4207 |
| 445 | Ga0495622_0048886 | 3300046557 | Bacteria | 1964 |
| 446 | Ga0495667_0263520 | 3300046559 | Bacteria | 1096 |
| 447 | Ga0495667_0288295 | 3300046559 | Bacteria | 1041 |
| 448 | Ga0495634_0054995 | 3300046642 | Bacteria | 2663 |
| 449 | Ga0495634_0141094 | 3300046642 | Bacteria | 1529 |
| 450 | Ga0495611_0115465 | 3300046648 | Bacteria | 1251 |
| 451 | Ga0495635_0005989 | 3300046663 | Bacteria | 8486 |
| 452 | Ga0495635_0286183 | 3300046663 | Bacteria | 1107 |
| 453 | Ga0495659_0028611 | 3300046664 | Bacteria | 1930 |
| 454 | Ga0495588_0125571 | 3300046674 | Bacteria | 1353 |
| 455 | Ga0495646_0293685 | 3300046680 | Bacteria | 861 |
| 456 | Ga0495647_0055162 | 3300046681 | Bacteria | 1555 |
| 457 | Ga0495658_0055046 | 3300046683 | Bacteria | 2265 |
| 458 | Ga0495613_0048311 | 3300046689 | Bacteria | 3142 |
| 459 | Ga0495613_0222566 | 3300046689 | Bacteria | 1324 |
| 460 | Ga0495624_0006806 | 3300046690 | Bacteria | 8073 |
| 461 | Ga0495624_0162822 | 3300046690 | Bacteria | 1362 |
| 462 | Ga0495624_0496525 | 3300046690 | Bacteria | 730 |
| 463 | Ga0495670_0081220 | 3300046691 | Bacteria | 1652 |
| 464 | Ga0495649_0197035 | 3300046694 | Bacteria | 1047 |
| 465 | Ga0495600_0294090 | 3300046809 | Bacteria | 1026 |
| 466 | Ga0495581_0008563 | 3300047315 | Bacteria | 5928 |
| 467 | Ga0495674_0008704 | 3300047319 | Bacteria | 9653 |
| 468 | Ga0495674_0106665 | 3300047319 | Bacteria | 2379 |
| 469 | Ga0495674_0475495 | 3300047319 | Bacteria | 1002 |
| 470 | Ga0495672_0015931 | 3300047320 | Bacteria | 5089 |
| 471 | Ga0495672_0109725 | 3300047320 | Bacteria | 1482 |
| 472 | Ga0495672_0146177 | 3300047320 | Bacteria | 1230 |
| 473 | Ga0495676_0008456 | 3300047321 | Bacteria | 9434 |
| 474 | Ga0495676_0026806 | 3300047321 | Bacteria | 4953 |
| 475 | Ga0495676_0384791 | 3300047321 | Bacteria | 933 |
| 476 | Ga0495680_0134987 | 3300047322 | Bacteria | 1810 |
| 477 | Ga0495684_0003419 | 3300047471 | Bacteria | 12438 |
| 478 | Ga0495684_0065664 | 3300047471 | Bacteria | 2758 |
| 479 | Ga0495684_0131771 | 3300047471 | Bacteria | 1877 |
| 480 | Ga0495684_0176020 | 3300047471 | Bacteria | 1588 |
| 481 | Ga0495686_0090578 | 3300047472 | Bacteria | 1857 |
| 482 | Ga0495593_0007704 | 3300047673 | Bacteria | 6285 |
| 483 | Ga0496100_0033132 | 3300048903 | Bacteria | 3230 |
| 484 | Ga0496100_0040098 | 3300048903 | Bacteria | 2977 |
| 485 | Ga0496100_0098942 | 3300048903 | Bacteria | 2006 |
| 486 | Ga0496100_0138594 | 3300048903 | Bacteria | 1721 |
| 487 | Ga0496100_0304567 | 3300048903 | Bacteria | 1193 |
| 488 | Ga0496100_0370246 | 3300048903 | Bacteria | 1086 |
| 489 | Ga0496100_0542315 | 3300048903 | Bacteria | 899 |
| 490 | Ga0496101_0010525 | 3300048904 | Bacteria | 6109 |
| 491 | Ga0496101_0180781 | 3300048904 | Bacteria | 1624 |
| 492 | Ga0496101_0208189 | 3300048904 | Bacteria | 1514 |
| 493 | Ga0496102_0018849 | 3300048905 | Bacteria | 6070 |
| 494 | Ga0496102_0061781 | 3300048905 | Bacteria | 3430 |
| 495 | Ga0496102_0191676 | 3300048905 | Bacteria | 1926 |
| 496 | Ga0496102_0244218 | 3300048905 | Bacteria | 1693 |
| 497 | Ga0496102_0265675 | 3300048905 | Bacteria | 1618 |
| 498 | Ga0496102_0868192 | 3300048905 | Bacteria | 824 |
| 499 | Ga0496103_0106278 | 3300048906 | Bacteria | 1780 |
| 500 | Ga0496104_0003071 | 3300048907 | Bacteria | 14389 |
| 501 | Ga0496104_0026450 | 3300048907 | Bacteria | 5358 |
| 502 | Ga0496104_0031830 | 3300048907 | Bacteria | 4907 |
| 503 | Ga0496104_0161471 | 3300048907 | Bacteria | 2149 |
| 504 | Ga0496104_0194047 | 3300048907 | Bacteria | 1943 |
| 505 | Ga0496104_0896025 | 3300048907 | Bacteria | 792 |
| 506 | Ga0496105_0028455 | 3300048908 | Bacteria | 4569 |
| 507 | Ga0496105_0046077 | 3300048908 | Bacteria | 3599 |
| 508 | Ga0496105_0066846 | 3300048908 | Bacteria | 2968 |
| 509 | Ga0496105_0586989 | 3300048908 | Bacteria | 866 |
| 510 | Ga0496105_0873061 | 3300048908 | Bacteria | 680 |
| 511 | Ga0496106_0000935 | 3300048909 | Bacteria | 21280 |
| 512 | Ga0496106_0002126 | 3300048909 | Bacteria | 14825 |
| 513 | Ga0496106_0004268 | 3300048909 | Bacteria | 10632 |
| 514 | Ga0496106_0209769 | 3300048909 | Bacteria | 1551 |
| 515 | Ga0496106_0332443 | 3300048909 | Bacteria | 1220 |
| 516 | Ga0496106_1062148 | 3300048909 | Bacteria | 635 |
| 517 | Ga0496107_0018102 | 3300048910 | Bacteria | 4956 |
| 518 | Ga0496107_0026410 | 3300048910 | Bacteria | 4116 |
| 519 | Ga0496107_0037970 | 3300048910 | Bacteria | 3457 |
| 520 | Ga0496107_0044911 | 3300048910 | Bacteria | 3177 |
| 521 | Ga0496107_0084638 | 3300048910 | Bacteria | 2314 |
| 522 | Ga0496108_0000681 | 3300048911 | Bacteria | 26279 |
| 523 | Ga0496108_0007740 | 3300048911 | Bacteria | 8703 |
| 524 | Ga0496108_0046112 | 3300048911 | Bacteria | 3641 |
| 525 | Ga0496108_1025496 | 3300048911 | Bacteria | 704 |
| 526 | Ga0496109_0000450 | 3300048912 | Bacteria | 35265 |
| 527 | Ga0496109_0013868 | 3300048912 | Bacteria | 7005 |
| 528 | Ga0496109_0028896 | 3300048912 | Bacteria | 4963 |
| 529 | Ga0496109_0162976 | 3300048912 | Bacteria | 2089 |
| 530 | Ga0496109_0417611 | 3300048912 | Bacteria | 1267 |
| 531 | Ga0496109_0529755 | 3300048912 | Bacteria | 1112 |
| 532 | Ga0496110_0013531 | 3300048913 | Bacteria | 6750 |
| 533 | Ga0496110_0016966 | 3300048913 | Bacteria | 6086 |
| 534 | Ga0496110_0022412 | 3300048913 | Bacteria | 5362 |
| 535 | Ga0496110_0028657 | 3300048913 | Bacteria | 4785 |
| 536 | Ga0496110_0176995 | 3300048913 | Bacteria | 1936 |
| 537 | Ga0496110_0188172 | 3300048913 | Bacteria | 1875 |
| 538 | Ga0496111_0028463 | 3300048914 | Bacteria | 3960 |
| 539 | Ga0496111_0039557 | 3300048914 | Bacteria | 3381 |
| 540 | Ga0496111_0058601 | 3300048914 | Bacteria | 2788 |
| 541 | Ga0496111_0073344 | 3300048914 | Bacteria | 2492 |
| 542 | Ga0496111_0185253 | 3300048914 | Bacteria | 1548 |
| 543 | Ga0496112_0005385 | 3300048915 | Bacteria | 11059 |
| 544 | Ga0496112_0033161 | 3300048915 | Bacteria | 5018 |
| 545 | Ga0496112_0042495 | 3300048915 | Bacteria | 4446 |
| 546 | Ga0496112_0114900 | 3300048915 | Bacteria | 2662 |
| 547 | Ga0496112_0374829 | 3300048915 | Bacteria | 1364 |
| 548 | Ga0496113_0018469 | 3300048916 | Bacteria | 4857 |
| 549 | Ga0496113_0019604 | 3300048916 | Bacteria | 4734 |
| 550 | Ga0496113_0076366 | 3300048916 | Bacteria | 2559 |
| 551 | Ga0496113_0111502 | 3300048916 | Bacteria | 2130 |
| 552 | Ga0496114_0021891 | 3300048917 | Bacteria | 5203 |
| 553 | Ga0496114_0684857 | 3300048917 | Bacteria | 900 |
| 554 | Ga0496115_0096460 | 3300048918 | Bacteria | 2421 |
| 555 | Ga0496115_0097432 | 3300048918 | Bacteria | 2408 |
| 556 | Ga0496115_0245481 | 3300048918 | Bacteria | 1475 |
| 557 | Ga0496115_0398057 | 3300048918 | Bacteria | 1118 |
| 558 | Ga0496117_0033294 | 3300048920 | Bacteria | 3899 |
| 559 | Ga0496118_0008592 | 3300048921 | Bacteria | 10513 |
| 560 | Ga0496121_0000555 | 3300048924 | Bacteria | 70509 |
| 561 | Ga0496124_0001875 | 3300048927 | Bacteria | 28930 |
| 562 | Ga0496124_0198601 | 3300048927 | Bacteria | 1527 |
| 563 | Ga0496125_0022852 | 3300048928 | Bacteria | 5794 |
| 564 | Ga0496125_0100666 | 3300048928 | Bacteria | 2129 |
| 565 | Ga0496126_0006420 | 3300048929 | Bacteria | 13106 |
| 566 | Ga0496126_0019705 | 3300048929 | Bacteria | 6638 |
| 567 | Ga0496126_0128673 | 3300048929 | Bacteria | 2190 |
| 568 | Ga0496126_0218350 | 3300048929 | Bacteria | 1603 |
| 569 | Ga0496126_0630246 | 3300048929 | Bacteria | 841 |
| 570 | Ga0501031_0044694 | 3300049568 | Bacteria | 2890 |
| 571 | Ga0501032_0008306 | 3300049569 | Bacteria | 7566 |
| 572 | Ga0501033_0275614 | 3300049570 | Bacteria | 1188 |
| 573 | Ga0501034_0000438 | 3300049571 | Bacteria | 68973 |
| 574 | Ga0501034_0003844 | 3300049571 | Bacteria | 16924 |
| 575 | Ga0501034_0022890 | 3300049571 | Bacteria | 6365 |
| 576 | Ga0501034_0066082 | 3300049571 | Bacteria | 3630 |
| 577 | Ga0501034_0174825 | 3300049571 | Bacteria | 2114 |
| 578 | Ga0501034_0265743 | 3300049571 | Bacteria | 1657 |
| 579 | Ga0501036_0000416 | 3300049572 | Bacteria | 30060 |
| 580 | Ga0501036_0004125 | 3300049572 | Bacteria | 11687 |
| 581 | Ga0501036_0315240 | 3300049572 | Bacteria | 1307 |
| 582 | Ga0501037_0014592 | 3300049573 | Bacteria | 5780 |
| 583 | Ga0501037_0033411 | 3300049573 | Bacteria | 3799 |
| 584 | Ga0501037_0232951 | 3300049573 | Bacteria | 1292 |
| 585 | Ga0501038_0000737 | 3300049574 | Bacteria | 29223 |
| 586 | Ga0501038_0039621 | 3300049574 | Bacteria | 4121 |
| 587 | Ga0501038_0072428 | 3300049574 | Bacteria | 2920 |
| 588 | Ga0501038_0107812 | 3300049574 | Bacteria | 2310 |
| 589 | Ga0501038_0386224 | 3300049574 | Bacteria | 1085 |
| 590 | Ga0501039_0067421 | 3300049575 | Bacteria | 2779 |
| 591 | Ga0501040_0038181 | 3300049576 | Bacteria | 3264 |
| 592 | Ga0501040_0119416 | 3300049576 | Bacteria | 1849 |
| 593 | Ga0501041_0057186 | 3300049577 | Bacteria | 2385 |
| 594 | Ga0501042_0001313 | 3300049578 | Bacteria | 14489 |
| 595 | Ga0501042_0099622 | 3300049578 | Bacteria | 2089 |
| 596 | Ga0501042_0107759 | 3300049578 | Bacteria | 2006 |
| 597 | Ga0501043_0001832 | 3300049579 | Bacteria | 18242 |
| 598 | Ga0501043_0034171 | 3300049579 | Bacteria | 3999 |
| 599 | Ga0501043_0111878 | 3300049579 | Bacteria | 2144 |
| 600 | Ga0501046_0027370 | 3300049580 | Bacteria | 4651 |
| 601 | Ga0501046_0052580 | 3300049580 | Bacteria | 3210 |
| 602 | Ga0501046_0267760 | 3300049580 | Bacteria | 1254 |
| 603 | Ga0501047_0001390 | 3300049581 | Bacteria | 23708 |
| 604 | Ga0501047_0005901 | 3300049581 | Bacteria | 11519 |
| 605 | Ga0501047_0023188 | 3300049581 | Bacteria | 5959 |
| 606 | Ga0501047_0577809 | 3300049581 | Bacteria | 947 |
| 607 | Ga0501048_0001180 | 3300049582 | Bacteria | 19749 |
| 608 | Ga0501048_0158106 | 3300049582 | Bacteria | 1603 |
| 609 | Ga0501048_0220774 | 3300049582 | Bacteria | 1344 |
| 610 | Ga0501048_0295798 | 3300049582 | Bacteria | 1152 |
| 611 | Ga0501067_0003891 | 3300049583 | Bacteria | 8243 |
| 612 | Ga0501067_0093336 | 3300049583 | Bacteria | 1671 |
| 613 | Ga0501067_0198240 | 3300049583 | Bacteria | 1118 |
| 614 | Ga0501067_0209696 | 3300049583 | Bacteria | 1085 |
| 615 | Ga0501068_0040235 | 3300049584 | Bacteria | 2805 |
| 616 | Ga0501068_0580874 | 3300049584 | Bacteria | 729 |
| 617 | Ga0501069_0036772 | 3300049585 | Bacteria | 2701 |
| 618 | Ga0501070_0010757 | 3300049586 | Bacteria | 7732 |
| 619 | Ga0501070_0016280 | 3300049586 | Bacteria | 6247 |
| 620 | Ga0501070_0016565 | 3300049586 | Bacteria | 6190 |
| 621 | Ga0501070_0054916 | 3300049586 | Bacteria | 3302 |
| 622 | Ga0501070_0142345 | 3300049586 | Bacteria | 1980 |
| 623 | Ga0501070_0180044 | 3300049586 | Bacteria | 1740 |
| 624 | Ga0501070_0430060 | 3300049586 | Bacteria | 1065 |
| 625 | Ga0501071_0054913 | 3300049587 | Bacteria | 2875 |
| 626 | Ga0501071_0064338 | 3300049587 | Bacteria | 2661 |
| 627 | Ga0501072_0007723 | 3300049588 | Bacteria | 8164 |
| 628 | Ga0501072_0092515 | 3300049588 | Bacteria | 2402 |
| 629 | Ga0501072_0102119 | 3300049588 | Bacteria | 2279 |
| 630 | Ga0501072_0102120 | 3300049588 | Bacteria | 2279 |
| 631 | Ga0501073_0016336 | 3300049589 | Bacteria | 5380 |
| 632 | Ga0501073_0058535 | 3300049589 | Bacteria | 2692 |
| 633 | Ga0501073_0075852 | 3300049589 | Bacteria | 2340 |
| 634 | Ga0501073_0135304 | 3300049589 | Bacteria | 1708 |
| 635 | Ga0501074_0006323 | 3300049590 | Bacteria | 8552 |
| 636 | Ga0501074_0015919 | 3300049590 | Bacteria | 5470 |
| 637 | Ga0501074_0179441 | 3300049590 | Bacteria | 1511 |
| 638 | Ga0501075_0914071 | 3300049591 | Bacteria | 667 |
| 639 | Ga0501076_0113475 | 3300049592 | Bacteria | 2192 |
| 640 | Ga0501076_0124967 | 3300049592 | Bacteria | 2084 |
| 641 | Ga0501076_0541136 | 3300049592 | Bacteria | 960 |
| 642 | Ga0501077_0179875 | 3300049593 | Bacteria | 1344 |
| 643 | Ga0501077_0262503 | 3300049593 | Bacteria | 1098 |
| 644 | Ga0501077_0280670 | 3300049593 | Bacteria | 1060 |
| 645 | Ga0501079_0052957 | 3300049741 | Bacteria | 3131 |
| 646 | Ga0501079_0061415 | 3300049741 | Bacteria | 2899 |
| 647 | Ga0501079_0063678 | 3300049741 | Bacteria | 2845 |
| 648 | Ga0501079_0073351 | 3300049741 | Bacteria | 2645 |
| 649 | Ga0501079_0087569 | 3300049741 | Bacteria | 2411 |
| 650 | Ga0501079_0649568 | 3300049741 | Bacteria | 830 |
| 651 | Ga0501080_0002488 | 3300049742 | Bacteria | 16133 |
| 652 | Ga0501080_0046502 | 3300049742 | Bacteria | 4040 |
| 653 | Ga0501080_0097557 | 3300049742 | Bacteria | 2729 |
| 654 | Ga0501080_0229303 | 3300049742 | Bacteria | 1698 |
| 655 | Ga0501081_0145626 | 3300049743 | Bacteria | 1700 |
| 656 | Ga0501081_0534934 | 3300049743 | Bacteria | 875 |
| 657 | Ga0501083_0001790 | 3300049744 | Bacteria | 14696 |
| 658 | Ga0501083_0145200 | 3300049744 | Bacteria | 1553 |
| 659 | Ga0501083_0181304 | 3300049744 | Bacteria | 1375 |
| 660 | Ga0501083_0274597 | 3300049744 | Bacteria | 1096 |
| 661 | Ga0501035_0002696 | 3300049822 | Bacteria | 17272 |
| 662 | Ga0501035_0401386 | 3300049822 | Bacteria | 1140 |
| 663 | Ga0501035_0534851 | 3300049822 | Bacteria | 961 |
| 664 | Ga0501044_0027460 | 3300049823 | Bacteria | 6015 |
| 665 | Ga0501044_0038096 | 3300049823 | Bacteria | 5021 |
| 666 | Ga0501044_0044741 | 3300049823 | Bacteria | 4591 |
| 667 | Ga0501044_0112058 | 3300049823 | Bacteria | 2735 |
| 668 | Ga0501044_0131574 | 3300049823 | Bacteria | 2496 |
| 669 | Ga0501045_0025935 | 3300049824 | Bacteria | 4213 |
| 670 | nmdc:mga03683_153110_c1 | 3300050489 | Bacteria | 1041 |
| 671 | nmdc:mga03683_2726_c1 | 3300050489 | Bacteria | 5544 |
| 672 | nmdc:mga03n38_6933_c1 | 3300050490 | Bacteria | 3977 |
| 673 | nmdc:mga00v17_272781_c1 | 3300050491 | Bacteria | 1098 |
| 674 | nmdc:mga00v17_29550_c1 | 3300050491 | Bacteria | 2048 |
| 675 | nmdc:mga00v17_411310_c1 | 3300050491 | Bacteria | 879 |
| 676 | nmdc:mga0yw44_175002_c1 | 3300050492 | Bacteria | 1411 |
| 677 | nmdc:mga0yw44_21452_c1 | 3300050492 | Bacteria | 3603 |
| 678 | nmdc:mga0yw44_355062_c1 | 3300050492 | Bacteria | 987 |
| 679 | nmdc:mga0yw44_75449_c1 | 3300050492 | Bacteria | 2102 |
| 680 | nmdc:mga0k408_12293_c1 | 3300050493 | Bacteria | 4678 |
| 681 | nmdc:mga0k408_247709_c1 | 3300050493 | Bacteria | 1064 |
| 682 | nmdc:mga0k408_460264_c1 | 3300050493 | Bacteria | 755 |
| 683 | nmdc:mga06z11_156954_c1 | 3300050494 | Bacteria | 1298 |
| 684 | nmdc:mga06z11_20718_c1 | 3300050494 | Bacteria | 3043 |
| 685 | nmdc:mga06z11_253959_c1 | 3300050494 | Bacteria | 1036 |
| 686 | nmdc:mga04h51_6058_c1 | 3300050495 | Bacteria | 3115 |
| 687 | nmdc:mga07m45_14615_c1 | 3300050496 | Bacteria | 4185 |
| 688 | nmdc:mga07m45_55257_c1 | 3300050496 | Bacteria | 2244 |
| 689 | nmdc:mga07m45_727304_c1 | 3300050496 | Bacteria | 570 |
| 690 | nmdc:mga07m45_87138_c1 | 3300050496 | Bacteria | 1786 |
| 691 | nmdc:mga05p37_1778888_c1 | 3300050507 | Bacteria | 596 |
| 692 | nmdc:mga05p37_7061_c1 | 3300050507 | Bacteria | 13239 |
| 693 | nmdc:mga05p37_89575_c1 | 3300050507 | Bacteria | 3792 |
| 694 | nmdc:mga09592_198436_c1 | 3300050508 | Bacteria | 1737 |
| 695 | nmdc:mga09592_80417_c1 | 3300050508 | Bacteria | 2775 |
| 696 | nmdc:mga0qj67_215164_c1 | 3300050509 | Bacteria | 1560 |
| 697 | nmdc:mga0qj67_237381_c1 | 3300050509 | Bacteria | 1479 |
| 698 | nmdc:mga06r32_367562_c1 | 3300050510 | Bacteria | 1422 |
| 699 | nmdc:mga06r32_51010_c1 | 3300050510 | Bacteria | 3959 |
| 700 | nmdc:mga08y16_114066_c1 | 3300050511 | Bacteria | 2813 |
| 701 | nmdc:mga0n895_1087569_c1 | 3300050512 | Bacteria | 777 |
| 702 | nmdc:mga0n895_157102_c1 | 3300050512 | Bacteria | 2305 |
| 703 | nmdc:mga0n895_228952_c1 | 3300050512 | Bacteria | 1887 |
| 704 | nmdc:mga0n895_620305_c1 | 3300050512 | Bacteria | 1082 |
| 705 | nmdc:mga0rr50_696127_c1 | 3300050513 | Bacteria | 867 |
| 706 | nmdc:mga08x19_1183709_c1 | 3300050514 | Bacteria | 542 |
| 707 | nmdc:mga0a205_159325_c1 | 3300050515 | Bacteria | 2154 |
| 708 | nmdc:mga0a205_487499_c1 | 3300050515 | Bacteria | 1090 |
| 709 | nmdc:mga0sz30_280630_c1 | 3300050516 | Bacteria | 742 |
| 710 | Ga0495601_0025509 | 3300053077 | Bacteria | 3645 |
| 711 | Ga0495601_0238094 | 3300053077 | Bacteria | 1188 |
| 712 | Ga0495601_0362319 | 3300053077 | Bacteria | 942 |
| 713 | Ga0495612_0006854 | 3300053078 | Bacteria | 4663 |
| 714 | Ga0495612_0110216 | 3300053078 | Bacteria | 1177 |
| 715 | Ga0495595_0031207 | 3300053084 | Bacteria | 2394 |
| 716 | Ga0495595_0075934 | 3300053084 | Bacteria | 1594 |
| 717 | Ga0495619_0003833 | 3300053085 | Bacteria | 9683 |
| 718 | Ga0495619_0026656 | 3300053085 | Bacteria | 3719 |
| 719 | Ga0500578_0328900 | 3300053086 | Bacteria | 899 |
| 720 | Ga0500651_0038350 | 3300053093 | Bacteria | 3018 |
| 721 | Ga0500566_0028972 | 3300053094 | Bacteria | 3235 |
| 722 | Ga0500595_010000 | 3300053119 | Bacteria | 3793 |
| 723 | Ga0500595_013874 | 3300053119 | Bacteria | 3074 |
| 724 | Ga0500577_0150212 | 3300053142 | Bacteria | 988 |
| 725 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 726 | Ga0500616_0154030 | 3300053153 | Bacteria | 1061 |
| 727 | Ga0500622_0177696 | 3300053156 | Bacteria | 986 |
| 728 | Ga0500636_0143335 | 3300053177 | Bacteria | 1320 |
| 729 | Ga0500637_0087617 | 3300053178 | Bacteria | 1800 |
| 730 | Ga0500657_132335 | 3300053728 | Bacteria | 964 |
| 731 | Ga0500645_000144 | 3300053730 | Bacteria | 55783 |
| 732 | Ga0501084_0142632 | 3300054114 | Bacteria | 2017 |
| 733 | Ga0501084_0176000 | 3300054114 | Bacteria | 1806 |
| 734 | Ga0501084_0199467 | 3300054114 | Bacteria | 1688 |
| 735 | Ga0501084_0375871 | 3300054114 | Bacteria | 1201 |
| 736 | Ga0501082_0061018 | 3300060353 | Bacteria | 3246 |
| 737 | Ga0501082_0103022 | 3300060353 | Bacteria | 2469 |
| 738 | Ga0501082_0144333 | 3300060353 | Bacteria | 2066 |
| 739 | Ga0501082_0355369 | 3300060353 | Bacteria | 1278 |
| 740 | Ga0501082_0819275 | 3300060353 | Bacteria | 814 |
| 741 | Ga0530510_0036040 | 3300061734 | Bacteria | 3566 |
| 742 | Ga0530510_0058110 | 3300061734 | Bacteria | 2796 |
| 743 | Ga0530510_0259121 | 3300061734 | Bacteria | 1296 |
| 744 | Ga0530510_0489640 | 3300061734 | Bacteria | 932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10023270 | Ga0105240_100232703 | 150 |
| 2 | 3300025916 | Ga0207663_10200555 | Ga0207663_102005553 | 150 |
| 3 | 3300031247 | Ga0265340_10097742 | Ga0265340_100977422 | 151 |
| 4 | 3300031595 | Ga0265313_10196075 | Ga0265313_101960752 | 151 |
| 5 | 3300053153 | Ga0500616_0154030 | Ga0500616_0154030_375_905 | 152 |
| 6 | 3300005338 | Ga0068868_100104658 | Ga0068868_1001046582 | 153 |
| 7 | 3300005354 | Ga0070675_100194027 | Ga0070675_1001940272 | 153 |
| 8 | 3300005356 | Ga0070674_100015914 | Ga0070674_1000159145 | 153 |
| 9 | 3300005367 | Ga0070667_100444040 | Ga0070667_1004440402 | 153 |
| 10 | 3300005543 | Ga0070672_100345493 | Ga0070672_1003454931 | 153 |
| 11 | 3300005578 | Ga0068854_100363706 | Ga0068854_1003637062 | 153 |
| 12 | 3300005615 | Ga0070702_100406306 | Ga0070702_1004063062 | 153 |
| 13 | 3300013306 | Ga0163162_10278726 | Ga0163162_102787262 | 153 |
| 14 | 3300025926 | Ga0207659_10114854 | Ga0207659_101148542 | 153 |
| 15 | 3300025937 | Ga0207669_10035736 | Ga0207669_100357362 | 153 |
| 16 | 3300025940 | Ga0207691_10249079 | Ga0207691_102490792 | 153 |
| 17 | 3300025986 | Ga0207658_10123190 | Ga0207658_101231902 | 153 |
| 18 | 3300048917 | Ga0496114_0684857 | Ga0496114_0684857_361_864 | 153 |
| 19 | 3300005518 | Ga0070699_100003004 | Ga0070699_1000030046 | 154 |
| 20 | 3300009551 | Ga0105238_10446993 | Ga0105238_104469932 | 154 |
| 21 | 3300035241 | Ga0373961_0292598 | Ga0373961_0292598_38_544 | 154 |
| 22 | 3300047320 | Ga0495672_0109725 | Ga0495672_0109725_334_858 | 154 |
| 23 | 3300048903 | Ga0496100_0542315 | Ga0496100_0542315_308_814 | 154 |
| 24 | 3300048907 | Ga0496104_0003071 | Ga0496104_0003071_12471_12977 | 154 |
| 25 | 3300048908 | Ga0496105_0873061 | Ga0496105_0873061_88_594 | 154 |
| 26 | 3300048913 | Ga0496110_0188172 | Ga0496110_0188172_606_1112 | 154 |
| 27 | 3300048918 | Ga0496115_0245481 | Ga0496115_0245481_877_1383 | 154 |
| 28 | 3300006051 | Ga0075364_10030827 | Ga0075364_100308274 | 155 |
| 29 | 3300034818 | Ga0373950_0017673 | Ga0373950_0017673_157_714 | 155 |
| 30 | 3300049574 | Ga0501038_0386224 | Ga0501038_0386224_504_1010 | 155 |
| 31 | 3300049576 | Ga0501040_0119416 | Ga0501040_0119416_608_1114 | 155 |
| 32 | 3300049577 | Ga0501041_0057186 | Ga0501041_0057186_1052_1558 | 155 |
| 33 | 3300049578 | Ga0501042_0107759 | Ga0501042_0107759_498_1004 | 155 |
| 34 | 3300049580 | Ga0501046_0267760 | Ga0501046_0267760_113_619 | 155 |
| 35 | 3300049582 | Ga0501048_0158106 | Ga0501048_0158106_339_845 | 155 |
| 36 | 3300049587 | Ga0501071_0054913 | Ga0501071_0054913_1798_2304 | 155 |
| 37 | 3300049588 | Ga0501072_0102119 | Ga0501072_0102119_642_1148 | 155 |
| 38 | 3300049592 | Ga0501076_0113475 | Ga0501076_0113475_997_1503 | 155 |
| 39 | 3300049593 | Ga0501077_0179875 | Ga0501077_0179875_243_749 | 155 |
| 40 | 3300049741 | Ga0501079_0061415 | Ga0501079_0061415_539_1045 | 155 |
| 41 | 3300050496 | nmdc:mga07m45_727304_c1 | nmdc:mga07m45_727304_c1_15_545 | 155 |
| 42 | 3300054114 | Ga0501084_0176000 | Ga0501084_0176000_985_1491 | 155 |
| 43 | 3300054114 | Ga0501084_0375871 | Ga0501084_0375871_141_776 | 155 |
| 44 | 3300060353 | Ga0501082_0103022 | Ga0501082_0103022_1920_2426 | 155 |
| 45 | 3300061734 | Ga0530510_0058110 | Ga0530510_0058110_1635_2141 | 155 |
| 46 | 3300005536 | Ga0070697_100141633 | Ga0070697_1001416332 | 156 |
| 47 | 3300006028 | Ga0070717_10025250 | Ga0070717_100252505 | 156 |
| 48 | 3300006038 | Ga0075365_10127495 | Ga0075365_101274952 | 156 |
| 49 | 3300006163 | Ga0070715_10005153 | Ga0070715_100051535 | 156 |
| 50 | 3300006844 | Ga0075428_100035350 | Ga0075428_1000353503 | 156 |
| 51 | 3300006844 | Ga0075428_101542115 | Ga0075428_1015421151 | 156 |
| 52 | 3300006846 | Ga0075430_100234294 | Ga0075430_1002342942 | 156 |
| 53 | 3300006847 | Ga0075431_100129587 | Ga0075431_1001295872 | 156 |
| 54 | 3300007076 | Ga0075435_100406799 | Ga0075435_1004067992 | 156 |
| 55 | 3300009147 | Ga0114129_10212328 | Ga0114129_102123282 | 156 |
| 56 | 3300025905 | Ga0207685_10000676 | Ga0207685_100006767 | 156 |
| 57 | 3300025906 | Ga0207699_10038943 | Ga0207699_100389433 | 156 |
| 58 | 3300025928 | Ga0207700_10096339 | Ga0207700_100963392 | 156 |
| 59 | 3300025929 | Ga0207664_10440302 | Ga0207664_104403022 | 156 |
| 60 | 3300031090 | Ga0265760_10033692 | Ga0265760_100336922 | 156 |
| 61 | 3300035170 | Ga0373943_0282078 | Ga0373943_0282078_307_894 | 156 |
| 62 | 3300035695 | Ga0373927_0065899 | Ga0373927_0065899_649_1236 | 156 |
| 63 | 3300037418 | Ga0395900_0099052 | Ga0395900_0099052_20_529 | 156 |
| 64 | 3300037466 | Ga0395898_0414314 | Ga0395898_0414314_147_656 | 156 |
| 65 | 3300038443 | Ga0395901_0348947 | Ga0395901_0348947_289_798 | 156 |
| 66 | 3300039437 | Ga0436365_1860016 | Ga0436365_1860016_81_608 | 156 |
| 67 | 3300048905 | Ga0496102_0265675 | Ga0496102_0265675_937_1446 | 156 |
| 68 | 3300048910 | Ga0496107_0084638 | Ga0496107_0084638_240_749 | 156 |
| 69 | 3300049741 | Ga0501079_0649568 | Ga0501079_0649568_145_654 | 156 |
| 70 | 3300050492 | nmdc:mga0yw44_75449_c1 | nmdc:mga0yw44_75449_c1_505_1014 | 156 |
| 71 | 3300050507 | nmdc:mga05p37_89575_c1 | nmdc:mga05p37_89575_c1_303_812 | 156 |
| 72 | 3300050509 | nmdc:mga0qj67_215164_c1 | nmdc:mga0qj67_215164_c1_897_1406 | 156 |
| 73 | 3300050510 | nmdc:mga06r32_51010_c1 | nmdc:mga06r32_51010_c1_2812_3321 | 156 |
| 74 | 3300050514 | nmdc:mga08x19_1183709_c1 | nmdc:mga08x19_1183709_c1_23_532 | 156 |
| 75 | 3300005354 | Ga0070675_100444801 | Ga0070675_1004448012 | 157 |
| 76 | 3300005364 | Ga0070673_101010118 | Ga0070673_1010101181 | 157 |
| 77 | 3300006844 | Ga0075428_100463566 | Ga0075428_1004635662 | 157 |
| 78 | 3300006880 | Ga0075429_100406395 | Ga0075429_1004063952 | 157 |
| 79 | 3300017792 | Ga0163161_10319734 | Ga0163161_103197342 | 157 |
| 80 | 3300025907 | Ga0207645_10190766 | Ga0207645_101907662 | 157 |
| 81 | 3300025926 | Ga0207659_10106041 | Ga0207659_101060412 | 157 |
| 82 | 3300025940 | Ga0207691_10113854 | Ga0207691_101138542 | 157 |
| 83 | 3300025960 | Ga0207651_11453601 | Ga0207651_114536011 | 157 |
| 84 | 3300031090 | Ga0265760_10116647 | Ga0265760_101166472 | 157 |
| 85 | 3300037466 | Ga0395898_0114634 | Ga0395898_0114634_1051_1623 | 157 |
| 86 | 3300038443 | Ga0395901_0227168 | Ga0395901_0227168_1209_1781 | 157 |
| 87 | 3300048907 | Ga0496104_0896025 | Ga0496104_0896025_34_594 | 157 |
| 88 | 3300049569 | Ga0501032_0008306 | Ga0501032_0008306_3265_3774 | 157 |
| 89 | 3300049570 | Ga0501033_0275614 | Ga0501033_0275614_413_985 | 157 |
| 90 | 3300049571 | Ga0501034_0003844 | Ga0501034_0003844_10506_11015 | 157 |
| 91 | 3300049571 | Ga0501034_0022890 | Ga0501034_0022890_2967_3476 | 157 |
| 92 | 3300049572 | Ga0501036_0000416 | Ga0501036_0000416_13134_13643 | 157 |
| 93 | 3300049573 | Ga0501037_0014592 | Ga0501037_0014592_3377_3886 | 157 |
| 94 | 3300049574 | Ga0501038_0072428 | Ga0501038_0072428_1283_1792 | 157 |
| 95 | 3300049579 | Ga0501043_0001832 | Ga0501043_0001832_7330_7839 | 157 |
| 96 | 3300049580 | Ga0501046_0027370 | Ga0501046_0027370_83_592 | 157 |
| 97 | 3300049581 | Ga0501047_0001390 | Ga0501047_0001390_15842_16351 | 157 |
| 98 | 3300049582 | Ga0501048_0001180 | Ga0501048_0001180_4736_5245 | 157 |
| 99 | 3300049583 | Ga0501067_0093336 | Ga0501067_0093336_241_786 | 157 |
| 100 | 3300049586 | Ga0501070_0016280 | Ga0501070_0016280_3776_4285 | 157 |
| 101 | 3300049589 | Ga0501073_0016336 | Ga0501073_0016336_3946_4455 | 157 |
| 102 | 3300049590 | Ga0501074_0006323 | Ga0501074_0006323_2739_3248 | 157 |
| 103 | 3300049742 | Ga0501080_0002488 | Ga0501080_0002488_2494_3003 | 157 |
| 104 | 3300049744 | Ga0501083_0001790 | Ga0501083_0001790_2327_2836 | 157 |
| 105 | 3300049822 | Ga0501035_0534851 | Ga0501035_0534851_168_677 | 157 |
| 106 | 3300049823 | Ga0501044_0027460 | Ga0501044_0027460_1785_2294 | 157 |
| 107 | 3300049823 | Ga0501044_0038096 | Ga0501044_0038096_2641_3150 | 157 |
| 108 | 3300060353 | Ga0501082_0061018 | Ga0501082_0061018_150_659 | 157 |
| 109 | 3300005337 | Ga0070682_100259179 | Ga0070682_1002591792 | 158 |
| 110 | 3300005338 | Ga0068868_100306083 | Ga0068868_1003060832 | 158 |
| 111 | 3300005340 | Ga0070689_100027697 | Ga0070689_1000276975 | 158 |
| 112 | 3300005345 | Ga0070692_10643300 | Ga0070692_106433001 | 158 |
| 113 | 3300005355 | Ga0070671_100025538 | Ga0070671_1000255384 | 158 |
| 114 | 3300005364 | Ga0070673_100268802 | Ga0070673_1002688021 | 158 |
| 115 | 3300005466 | Ga0070685_10092264 | Ga0070685_100922642 | 158 |
| 116 | 3300005467 | Ga0070706_100343528 | Ga0070706_1003435282 | 158 |
| 117 | 3300005530 | Ga0070679_101081044 | Ga0070679_1010810441 | 158 |
| 118 | 3300005544 | Ga0070686_100276081 | Ga0070686_1002760812 | 158 |
| 119 | 3300005617 | Ga0068859_100129787 | Ga0068859_1001297872 | 158 |
| 120 | 3300005618 | Ga0068864_100138545 | Ga0068864_1001385452 | 158 |
| 121 | 3300005841 | Ga0068863_100618728 | Ga0068863_1006187281 | 158 |
| 122 | 3300005842 | Ga0068858_100482458 | Ga0068858_1004824582 | 158 |
| 123 | 3300006881 | Ga0068865_101283628 | Ga0068865_1012836281 | 158 |
| 124 | 3300006931 | Ga0097620_100129776 | Ga0097620_1001297762 | 158 |
| 125 | 3300009147 | Ga0114129_12414671 | Ga0114129_124146711 | 158 |
| 126 | 3300009176 | Ga0105242_10831890 | Ga0105242_108318902 | 158 |
| 127 | 3300009177 | Ga0105248_10169046 | Ga0105248_101690461 | 158 |
| 128 | 3300011119 | Ga0105246_10192047 | Ga0105246_101920472 | 158 |
| 129 | 3300013308 | Ga0157375_11659215 | Ga0157375_116592152 | 158 |
| 130 | 3300025893 | Ga0207682_10357695 | Ga0207682_103576951 | 158 |
| 131 | 3300025899 | Ga0207642_10254575 | Ga0207642_102545752 | 158 |
| 132 | 3300025910 | Ga0207684_10391356 | Ga0207684_103913562 | 158 |
| 133 | 3300025927 | Ga0207687_10669561 | Ga0207687_106695612 | 158 |
| 134 | 3300025927 | Ga0207687_11015715 | Ga0207687_110157152 | 158 |
| 135 | 3300025931 | Ga0207644_10085957 | Ga0207644_100859572 | 158 |
| 136 | 3300025933 | Ga0207706_10566472 | Ga0207706_105664722 | 158 |
| 137 | 3300025939 | Ga0207665_10170852 | Ga0207665_101708522 | 158 |
| 138 | 3300025941 | Ga0207711_10081931 | Ga0207711_100819313 | 158 |
| 139 | 3300025960 | Ga0207651_10078439 | Ga0207651_100784394 | 158 |
| 140 | 3300025961 | Ga0207712_10232963 | Ga0207712_102329632 | 158 |
| 141 | 3300026023 | Ga0207677_10159967 | Ga0207677_101599672 | 158 |
| 142 | 3300026023 | Ga0207677_10287554 | Ga0207677_102875542 | 158 |
| 143 | 3300026035 | Ga0207703_10688485 | Ga0207703_106884852 | 158 |
| 144 | 3300026041 | Ga0207639_11000068 | Ga0207639_110000681 | 158 |
| 145 | 3300026067 | Ga0207678_10154957 | Ga0207678_101549571 | 158 |
| 146 | 3300026095 | Ga0207676_10112674 | Ga0207676_101126742 | 158 |
| 147 | 3300026121 | Ga0207683_10047974 | Ga0207683_100479744 | 158 |
| 148 | 3300034816 | Ga0373930_0111813 | Ga0373930_0111813_59_580 | 158 |
| 149 | 3300034817 | Ga0373948_0009793 | Ga0373948_0009793_411_932 | 158 |
| 150 | 3300035085 | Ga0373929_0068056 | Ga0373929_0068056_59_580 | 158 |
| 151 | 3300035088 | Ga0373940_0016218 | Ga0373940_0016218_545_1066 | 158 |
| 152 | 3300035090 | Ga0373949_0066951 | Ga0373949_0066951_227_748 | 158 |
| 153 | 3300035091 | Ga0373951_0014324 | Ga0373951_0014324_289_810 | 158 |
| 154 | 3300035121 | Ga0373960_0055424 | Ga0373960_0055424_123_644 | 158 |
| 155 | 3300035241 | Ga0373961_0058505 | Ga0373961_0058505_423_944 | 158 |
| 156 | 3300035691 | Ga0373931_0047704 | Ga0373931_0047704_1637_2158 | 158 |
| 157 | 3300035692 | Ga0373935_0193265 | Ga0373935_0193265_257_778 | 158 |
| 158 | 3300046690 | Ga0495624_0496525 | Ga0495624_0496525_180_701 | 158 |
| 159 | 3300048903 | Ga0496100_0040098 | Ga0496100_0040098_769_1290 | 158 |
| 160 | 3300048904 | Ga0496101_0010525 | Ga0496101_0010525_2019_2540 | 158 |
| 161 | 3300048905 | Ga0496102_0191676 | Ga0496102_0191676_1243_1764 | 158 |
| 162 | 3300048906 | Ga0496103_0106278 | Ga0496103_0106278_472_993 | 158 |
| 163 | 3300048907 | Ga0496104_0161471 | Ga0496104_0161471_1188_1709 | 158 |
| 164 | 3300048908 | Ga0496105_0046077 | Ga0496105_0046077_1794_2315 | 158 |
| 165 | 3300048909 | Ga0496106_0209769 | Ga0496106_0209769_42_563 | 158 |
| 166 | 3300048910 | Ga0496107_0026410 | Ga0496107_0026410_1466_1987 | 158 |
| 167 | 3300048912 | Ga0496109_0013868 | Ga0496109_0013868_682_1203 | 158 |
| 168 | 3300048913 | Ga0496110_0013531 | Ga0496110_0013531_2597_3118 | 158 |
| 169 | 3300048914 | Ga0496111_0058601 | Ga0496111_0058601_1690_2211 | 158 |
| 170 | 3300048916 | Ga0496113_0111502 | Ga0496113_0111502_59_580 | 158 |
| 171 | 3300048917 | Ga0496114_0021891 | Ga0496114_0021891_3506_4027 | 158 |
| 172 | 3300048918 | Ga0496115_0097432 | Ga0496115_0097432_312_833 | 158 |
| 173 | 3300049589 | Ga0501073_0058535 | Ga0501073_0058535_1014_1532 | 158 |
| 174 | 3300049742 | Ga0501080_0229303 | Ga0501080_0229303_585_1103 | 158 |
| 175 | 3300049822 | Ga0501035_0002696 | Ga0501035_0002696_4159_4680 | 158 |
| 176 | 3300050494 | nmdc:mga06z11_253959_c1 | nmdc:mga06z11_253959_c1_346_864 | 158 |
| 177 | 3300050507 | nmdc:mga05p37_1778888_c1 | nmdc:mga05p37_1778888_c1_38_553 | 158 |
| 178 | 3300025925 | Ga0207650_10279148 | Ga0207650_102791482 | 159 |
| 179 | 3300025961 | Ga0207712_10227463 | Ga0207712_102274632 | 159 |
| 180 | 3300026035 | Ga0207703_10210994 | Ga0207703_102109942 | 159 |
| 181 | 3300035092 | Ga0373952_0031215 | Ga0373952_0031215_152_724 | 159 |
| 182 | 3300035170 | Ga0373943_0049619 | Ga0373943_0049619_30_641 | 159 |
| 183 | 3300035692 | Ga0373935_0185169 | Ga0373935_0185169_210_821 | 159 |
| 184 | 3300035725 | Ga0373947_0247214 | Ga0373947_0247214_361_972 | 159 |
| 185 | 3300037068 | Ga0373925_0321233 | Ga0373925_0321233_132_704 | 159 |
| 186 | 3300037068 | Ga0373925_0337713 | Ga0373925_0337713_200_811 | 159 |
| 187 | 3300046476 | Ga0495662_0013154 | Ga0495662_0013154_782_1393 | 159 |
| 188 | 3300046477 | Ga0495664_0002145 | Ga0495664_0002145_6571_7182 | 159 |
| 189 | 3300046491 | Ga0495584_0003705 | Ga0495584_0003705_2426_2947 | 159 |
| 190 | 3300046514 | Ga0495618_0004115 | Ga0495618_0004115_6144_6755 | 159 |
| 191 | 3300046517 | Ga0495630_0026168 | Ga0495630_0026168_3294_3905 | 159 |
| 192 | 3300046529 | Ga0495652_0018206 | Ga0495652_0018206_3257_3868 | 159 |
| 193 | 3300046533 | Ga0495640_0009535 | Ga0495640_0009535_4615_5226 | 159 |
| 194 | 3300046543 | Ga0495645_0026515 | Ga0495645_0026515_2229_2840 | 159 |
| 195 | 3300046559 | Ga0495667_0263520 | Ga0495667_0263520_369_941 | 159 |
| 196 | 3300046642 | Ga0495634_0141094 | Ga0495634_0141094_112_723 | 159 |
| 197 | 3300046663 | Ga0495635_0005989 | Ga0495635_0005989_5996_6607 | 159 |
| 198 | 3300046663 | Ga0495635_0286183 | Ga0495635_0286183_142_714 | 159 |
| 199 | 3300046680 | Ga0495646_0293685 | Ga0495646_0293685_53_664 | 159 |
| 200 | 3300046689 | Ga0495613_0048311 | Ga0495613_0048311_279_851 | 159 |
| 201 | 3300046809 | Ga0495600_0294090 | Ga0495600_0294090_228_800 | 159 |
| 202 | 3300047319 | Ga0495674_0008704 | Ga0495674_0008704_3376_3987 | 159 |
| 203 | 3300047321 | Ga0495676_0384791 | Ga0495676_0384791_152_724 | 159 |
| 204 | 3300047471 | Ga0495684_0065664 | Ga0495684_0065664_1948_2559 | 159 |
| 205 | 3300048904 | Ga0496101_0208189 | Ga0496101_0208189_717_1289 | 159 |
| 206 | 3300048907 | Ga0496104_0031830 | Ga0496104_0031830_1230_1802 | 159 |
| 207 | 3300048908 | Ga0496105_0028455 | Ga0496105_0028455_1735_2307 | 159 |
| 208 | 3300048910 | Ga0496107_0044911 | Ga0496107_0044911_1948_2520 | 159 |
| 209 | 3300048911 | Ga0496108_0007740 | Ga0496108_0007740_2301_2873 | 159 |
| 210 | 3300048912 | Ga0496109_0028896 | Ga0496109_0028896_3451_4023 | 159 |
| 211 | 3300048913 | Ga0496110_0022412 | Ga0496110_0022412_871_1443 | 159 |
| 212 | 3300048914 | Ga0496111_0073344 | Ga0496111_0073344_1379_1951 | 159 |
| 213 | 3300048915 | Ga0496112_0042495 | Ga0496112_0042495_2172_2744 | 159 |
| 214 | 3300048916 | Ga0496113_0019604 | Ga0496113_0019604_1862_2434 | 159 |
| 215 | 3300049571 | Ga0501034_0000438 | Ga0501034_0000438_17355_17870 | 159 |
| 216 | 3300049572 | Ga0501036_0315240 | Ga0501036_0315240_275_853 | 159 |
| 217 | 3300049578 | Ga0501042_0099622 | Ga0501042_0099622_1028_1606 | 159 |
| 218 | 3300049585 | Ga0501069_0036772 | Ga0501069_0036772_762_1280 | 159 |
| 219 | 3300049586 | Ga0501070_0142345 | Ga0501070_0142345_521_1036 | 159 |
| 220 | 3300049588 | Ga0501072_0102120 | Ga0501072_0102120_289_867 | 159 |
| 221 | 3300049592 | Ga0501076_0124967 | Ga0501076_0124967_1453_2031 | 159 |
| 222 | 3300049741 | Ga0501079_0073351 | Ga0501079_0073351_1448_2026 | 159 |
| 223 | 3300049742 | Ga0501080_0097557 | Ga0501080_0097557_1682_2260 | 159 |
| 224 | 3300049744 | Ga0501083_0181304 | Ga0501083_0181304_177_692 | 159 |
| 225 | 3300049823 | Ga0501044_0131574 | Ga0501044_0131574_1302_1826 | 159 |
| 226 | 3300050507 | nmdc:mga05p37_7061_c1 | nmdc:mga05p37_7061_c1_8038_8610 | 159 |
| 227 | 3300050508 | nmdc:mga09592_80417_c1 | nmdc:mga09592_80417_c1_826_1398 | 159 |
| 228 | 3300050509 | nmdc:mga0qj67_237381_c1 | nmdc:mga0qj67_237381_c1_327_851 | 159 |
| 229 | 3300050510 | nmdc:mga06r32_367562_c1 | nmdc:mga06r32_367562_c1_186_758 | 159 |
| 230 | 3300050511 | nmdc:mga08y16_114066_c1 | nmdc:mga08y16_114066_c1_1381_1953 | 159 |
| 231 | 3300050512 | nmdc:mga0n895_228952_c1 | nmdc:mga0n895_228952_c1_408_980 | 159 |
| 232 | 3300050515 | nmdc:mga0a205_487499_c1 | nmdc:mga0a205_487499_c1_27_599 | 159 |
| 233 | 3300053077 | Ga0495601_0025509 | Ga0495601_0025509_32_643 | 159 |
| 234 | 3300053078 | Ga0495612_0006854 | Ga0495612_0006854_2455_3066 | 159 |
| 235 | 3300053084 | Ga0495595_0031207 | Ga0495595_0031207_1771_2382 | 159 |
| 236 | 3300053085 | Ga0495619_0003833 | Ga0495619_0003833_2031_2642 | 159 |
| 237 | 3300061734 | Ga0530510_0036040 | Ga0530510_0036040_1523_2101 | 159 |
| 238 | iso_pu_bacteria | 2841941048 | 2841947010 | 159 |
| 239 | iso_pu_bacteria | 2841949485 | 2841955060 | 159 |
| 240 | iso_pu_bacteria | 2841966195 | 2841970017 | 159 |
| 241 | iso_pu_bacteria | 2841974524 | 2841977341 | 159 |
| 242 | iso_pu_bacteria | 8006926726 | 8006929046 | 159 |
| 243 | 3300005563 | Ga0068855_100290975 | Ga0068855_1002909752 | 160 |
| 244 | 3300021441 | Ga0213871_10068876 | Ga0213871_100688762 | 160 |
| 245 | 3300025921 | Ga0207652_10098763 | Ga0207652_100987632 | 160 |
| 246 | 3300025928 | Ga0207700_10140024 | Ga0207700_101400241 | 160 |
| 247 | 3300025949 | Ga0207667_10653345 | Ga0207667_106533452 | 160 |
| 248 | 3300037853 | Ga0436364_1511242 | Ga0436364_1511242_211_735 | 160 |
| 249 | 3300038443 | Ga0395901_0553324 | Ga0395901_0553324_70_594 | 160 |
| 250 | 3300039437 | Ga0436365_0696800 | Ga0436365_0696800_8696_9220 | 160 |
| 251 | 3300039438 | Ga0436360_0460383 | Ga0436360_0460383_254_778 | 160 |
| 252 | 3300039447 | Ga0436361_0298469 | Ga0436361_0298469_412_936 | 160 |
| 253 | 3300046463 | Ga0495653_0169862 | Ga0495653_0169862_926_1450 | 160 |
| 254 | 3300046533 | Ga0495640_0009233 | Ga0495640_0009233_473_997 | 160 |
| 255 | 3300046536 | Ga0495587_0338766 | Ga0495587_0338766_126_650 | 160 |
| 256 | 3300046559 | Ga0495667_0288295 | Ga0495667_0288295_438_962 | 160 |
| 257 | 3300047322 | Ga0495680_0134987 | Ga0495680_0134987_196_720 | 160 |
| 258 | 3300047471 | Ga0495684_0176020 | Ga0495684_0176020_837_1361 | 160 |
| 259 | 3300048903 | Ga0496100_0304567 | Ga0496100_0304567_100_624 | 160 |
| 260 | 3300048905 | Ga0496102_0244218 | Ga0496102_0244218_1093_1617 | 160 |
| 261 | 3300048909 | Ga0496106_1062148 | Ga0496106_1062148_56_580 | 160 |
| 262 | 3300048912 | Ga0496109_0162976 | Ga0496109_0162976_836_1360 | 160 |
| 263 | 3300048914 | Ga0496111_0185253 | Ga0496111_0185253_478_1002 | 160 |
| 264 | 3300048918 | Ga0496115_0398057 | Ga0496115_0398057_382_906 | 160 |
| 265 | 3300049571 | Ga0501034_0265743 | Ga0501034_0265743_773_1309 | 160 |
| 266 | 3300049572 | Ga0501036_0004125 | Ga0501036_0004125_8962_9498 | 160 |
| 267 | 3300049573 | Ga0501037_0033411 | Ga0501037_0033411_2009_2545 | 160 |
| 268 | 3300049574 | Ga0501038_0039621 | Ga0501038_0039621_1536_2072 | 160 |
| 269 | 3300049575 | Ga0501039_0067421 | Ga0501039_0067421_1076_1612 | 160 |
| 270 | 3300049579 | Ga0501043_0034171 | Ga0501043_0034171_963_1499 | 160 |
| 271 | 3300049579 | Ga0501043_0111878 | Ga0501043_0111878_574_1116 | 160 |
| 272 | 3300049580 | Ga0501046_0052580 | Ga0501046_0052580_965_1501 | 160 |
| 273 | 3300049581 | Ga0501047_0005901 | Ga0501047_0005901_5761_6297 | 160 |
| 274 | 3300049582 | Ga0501048_0220774 | Ga0501048_0220774_210_746 | 160 |
| 275 | 3300049584 | Ga0501068_0580874 | Ga0501068_0580874_147_683 | 160 |
| 276 | 3300049586 | Ga0501070_0010757 | Ga0501070_0010757_4878_5414 | 160 |
| 277 | 3300049586 | Ga0501070_0430060 | Ga0501070_0430060_305_847 | 160 |
| 278 | 3300049589 | Ga0501073_0075852 | Ga0501073_0075852_1049_1585 | 160 |
| 279 | 3300049742 | Ga0501080_0046502 | Ga0501080_0046502_2319_2855 | 160 |
| 280 | 3300049743 | Ga0501081_0145626 | Ga0501081_0145626_857_1393 | 160 |
| 281 | 3300049744 | Ga0501083_0145200 | Ga0501083_0145200_990_1526 | 160 |
| 282 | 3300049822 | Ga0501035_0401386 | Ga0501035_0401386_539_1075 | 160 |
| 283 | 3300049823 | Ga0501044_0112058 | Ga0501044_0112058_1186_1722 | 160 |
| 284 | 3300053077 | Ga0495601_0238094 | Ga0495601_0238094_35_559 | 160 |
| 285 | 3300053078 | Ga0495612_0110216 | Ga0495612_0110216_406_930 | 160 |
| 286 | 3300053084 | Ga0495595_0075934 | Ga0495595_0075934_311_835 | 160 |
| 287 | 3300053085 | Ga0495619_0026656 | Ga0495619_0026656_1472_1996 | 160 |
| 288 | 3300053093 | Ga0500651_0038350 | Ga0500651_0038350_1439_1996 | 160 |
| 289 | 3300053142 | Ga0500577_0150212 | Ga0500577_0150212_205_762 | 160 |
| 290 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_293124_293681 | 160 |
| 291 | 3300053730 | Ga0500645_000144 | Ga0500645_000144_17981_18538 | 160 |
| 292 | 3300060353 | Ga0501082_0144333 | Ga0501082_0144333_204_740 | 160 |
| 293 | 3300060353 | Ga0501082_0355369 | Ga0501082_0355369_702_1268 | 160 |
| 294 | 3300061734 | Ga0530510_0489640 | Ga0530510_0489640_264_794 | 160 |
| 295 | 3300005435 | Ga0070714_100123060 | Ga0070714_1001230602 | 161 |
| 296 | 3300006028 | Ga0070717_10085715 | Ga0070717_100857152 | 161 |
| 297 | 3300006163 | Ga0070715_10189802 | Ga0070715_101898021 | 161 |
| 298 | 3300024225 | Ga0224572_1006986 | Ga0224572_10069862 | 161 |
| 299 | 3300025906 | Ga0207699_10030943 | Ga0207699_100309433 | 161 |
| 300 | 3300025928 | Ga0207700_10213776 | Ga0207700_102137762 | 161 |
| 301 | 3300025929 | Ga0207664_10111644 | Ga0207664_101116442 | 161 |
| 302 | 3300025929 | Ga0207664_10699201 | Ga0207664_106992011 | 161 |
| 303 | 3300026121 | Ga0207683_10932983 | Ga0207683_109329832 | 161 |
| 304 | 3300035090 | Ga0373949_0018243 | Ga0373949_0018243_869_1447 | 161 |
| 305 | 3300035172 | Ga0373955_0100773 | Ga0373955_0100773_514_1092 | 161 |
| 306 | 3300035692 | Ga0373935_0129457 | Ga0373935_0129457_690_1268 | 161 |
| 307 | 3300035725 | Ga0373947_0184413 | Ga0373947_0184413_533_1111 | 161 |
| 308 | 3300039437 | Ga0436365_0772739 | Ga0436365_0772739_1413_1949 | 161 |
| 309 | 3300046461 | Ga0495641_0088345 | Ga0495641_0088345_573_1151 | 161 |
| 310 | 3300046517 | Ga0495630_0361455 | Ga0495630_0361455_342_920 | 161 |
| 311 | 3300046533 | Ga0495640_0113326 | Ga0495640_0113326_372_950 | 161 |
| 312 | 3300047319 | Ga0495674_0106665 | Ga0495674_0106665_437_1015 | 161 |
| 313 | 3300047471 | Ga0495684_0131771 | Ga0495684_0131771_284_862 | 161 |
| 314 | 3300048903 | Ga0496100_0138594 | Ga0496100_0138594_225_803 | 161 |
| 315 | 3300048905 | Ga0496102_0061781 | Ga0496102_0061781_1347_1925 | 161 |
| 316 | 3300049571 | Ga0501034_0174825 | Ga0501034_0174825_969_1508 | 161 |
| 317 | 3300049588 | Ga0501072_0007723 | Ga0501072_0007723_5766_6311 | 161 |
| 318 | 3300049588 | Ga0501072_0092515 | Ga0501072_0092515_498_1067 | 161 |
| 319 | 3300050512 | nmdc:mga0n895_620305_c1 | nmdc:mga0n895_620305_c1_356_889 | 161 |
| 320 | 3300060353 | Ga0501082_0819275 | Ga0501082_0819275_88_690 | 161 |
| 321 | iso_pu_bacteria | 2824773399 | 2824781391 | 161 |
| 322 | 3300005338 | Ga0068868_100121743 | Ga0068868_1001217432 | 162 |
| 323 | 3300005436 | Ga0070713_100139415 | Ga0070713_1001394152 | 162 |
| 324 | 3300005456 | Ga0070678_100207701 | Ga0070678_1002077012 | 162 |
| 325 | 3300005544 | Ga0070686_100205680 | Ga0070686_1002056802 | 162 |
| 326 | 3300005615 | Ga0070702_101052507 | Ga0070702_1010525071 | 162 |
| 327 | 3300005618 | Ga0068864_100249599 | Ga0068864_1002495992 | 162 |
| 328 | 3300005842 | Ga0068858_100121889 | Ga0068858_1001218892 | 162 |
| 329 | 3300006358 | Ga0068871_100013913 | Ga0068871_1000139137 | 162 |
| 330 | 3300009098 | Ga0105245_10002241 | Ga0105245_1000224112 | 162 |
| 331 | 3300009148 | Ga0105243_10156335 | Ga0105243_101563352 | 162 |
| 332 | 3300009176 | Ga0105242_10137592 | Ga0105242_101375922 | 162 |
| 333 | 3300009177 | Ga0105248_10060907 | Ga0105248_100609076 | 162 |
| 334 | 3300010159 | Ga0099796_10059180 | Ga0099796_100591802 | 162 |
| 335 | 3300014325 | Ga0163163_11712358 | Ga0163163_117123581 | 162 |
| 336 | 3300021388 | Ga0213875_10000033 | Ga0213875_10000033162 | 162 |
| 337 | 3300025927 | Ga0207687_10023697 | Ga0207687_100236974 | 162 |
| 338 | 3300025928 | Ga0207700_10771619 | Ga0207700_107716192 | 162 |
| 339 | 3300025934 | Ga0207686_10704747 | Ga0207686_107047472 | 162 |
| 340 | 3300025935 | Ga0207709_10566415 | Ga0207709_105664152 | 162 |
| 341 | 3300025939 | Ga0207665_10456422 | Ga0207665_104564222 | 162 |
| 342 | 3300025981 | Ga0207640_10641338 | Ga0207640_106413381 | 162 |
| 343 | 3300026023 | Ga0207677_10217451 | Ga0207677_102174512 | 162 |
| 344 | 3300026095 | Ga0207676_10776230 | Ga0207676_107762302 | 162 |
| 345 | 3300037853 | Ga0436364_0816729 | Ga0436364_0816729_394_930 | 162 |
| 346 | 3300046531 | Ga0495665_0048332 | Ga0495665_0048332_1260_1868 | 162 |
| 347 | 3300050494 | nmdc:mga06z11_20718_c1 | nmdc:mga06z11_20718_c1_2314_2886 | 162 |
| 348 | 3300050512 | nmdc:mga0n895_1087569_c1 | nmdc:mga0n895_1087569_c1_62_607 | 162 |
| 349 | iso_pu_bacteria | 2879127579 | 2879130224 | 162 |
| 350 | 3300005435 | Ga0070714_100273924 | Ga0070714_1002739242 | 163 |
| 351 | 3300005436 | Ga0070713_100078356 | Ga0070713_1000783564 | 163 |
| 352 | 3300005436 | Ga0070713_100267822 | Ga0070713_1002678222 | 163 |
| 353 | 3300005445 | Ga0070708_100103303 | Ga0070708_1001033033 | 163 |
| 354 | 3300005467 | Ga0070706_100750060 | Ga0070706_1007500602 | 163 |
| 355 | 3300005536 | Ga0070697_100169978 | Ga0070697_1001699782 | 163 |
| 356 | 3300006871 | Ga0075434_100128119 | Ga0075434_1001281192 | 163 |
| 357 | 3300007076 | Ga0075435_100244588 | Ga0075435_1002445882 | 163 |
| 358 | 3300025905 | Ga0207685_10135382 | Ga0207685_101353822 | 163 |
| 359 | 3300025928 | Ga0207700_10172138 | Ga0207700_101721382 | 163 |
| 360 | 3300039437 | Ga0436365_1876119 | Ga0436365_1876119_81_665 | 163 |
| 361 | 3300049568 | Ga0501031_0044694 | Ga0501031_0044694_197_721 | 163 |
| 362 | 3300049573 | Ga0501037_0232951 | Ga0501037_0232951_572_1096 | 163 |
| 363 | 3300049574 | Ga0501038_0107812 | Ga0501038_0107812_354_878 | 163 |
| 364 | 3300049576 | Ga0501040_0038181 | Ga0501040_0038181_2169_2693 | 163 |
| 365 | 3300049578 | Ga0501042_0001313 | Ga0501042_0001313_12040_12564 | 163 |
| 366 | 3300049583 | Ga0501067_0003891 | Ga0501067_0003891_3648_4172 | 163 |
| 367 | 3300049584 | Ga0501068_0040235 | Ga0501068_0040235_233_757 | 163 |
| 368 | 3300049586 | Ga0501070_0054916 | Ga0501070_0054916_2582_3106 | 163 |
| 369 | 3300049587 | Ga0501071_0064338 | Ga0501071_0064338_1694_2218 | 163 |
| 370 | 3300049590 | Ga0501074_0015919 | Ga0501074_0015919_1871_2395 | 163 |
| 371 | 3300049590 | Ga0501074_0179441 | Ga0501074_0179441_272_814 | 163 |
| 372 | 3300049591 | Ga0501075_0914071 | Ga0501075_0914071_70_594 | 163 |
| 373 | 3300049593 | Ga0501077_0262503 | Ga0501077_0262503_360_884 | 163 |
| 374 | 3300049593 | Ga0501077_0280670 | Ga0501077_0280670_312_854 | 163 |
| 375 | 3300049741 | Ga0501079_0052957 | Ga0501079_0052957_1460_1984 | 163 |
| 376 | 3300049743 | Ga0501081_0534934 | Ga0501081_0534934_270_794 | 163 |
| 377 | 3300049744 | Ga0501083_0274597 | Ga0501083_0274597_361_885 | 163 |
| 378 | 3300049824 | Ga0501045_0025935 | Ga0501045_0025935_859_1383 | 163 |
| 379 | 3300054114 | Ga0501084_0142632 | Ga0501084_0142632_1290_1814 | 163 |
| 380 | 3300005435 | Ga0070714_100013145 | Ga0070714_1000131454 | 164 |
| 381 | 3300005436 | Ga0070713_100018181 | Ga0070713_1000181814 | 164 |
| 382 | 3300005437 | Ga0070710_10000804 | Ga0070710_100008042 | 164 |
| 383 | 3300005439 | Ga0070711_100016256 | Ga0070711_1000162565 | 164 |
| 384 | 3300005937 | Ga0081455_10211820 | Ga0081455_102118202 | 164 |
| 385 | 3300006048 | Ga0075363_100021136 | Ga0075363_1000211362 | 164 |
| 386 | 3300006177 | Ga0075362_10041733 | Ga0075362_100417332 | 164 |
| 387 | 3300006178 | Ga0075367_10299047 | Ga0075367_102990472 | 164 |
| 388 | 3300006195 | Ga0075366_10022248 | Ga0075366_100222483 | 164 |
| 389 | 3300006353 | Ga0075370_10238013 | Ga0075370_102380132 | 164 |
| 390 | 3300021361 | Ga0213872_10013615 | Ga0213872_100136152 | 164 |
| 391 | 3300025910 | Ga0207684_10049404 | Ga0207684_100494042 | 164 |
| 392 | 3300025928 | Ga0207700_10429775 | Ga0207700_104297752 | 164 |
| 393 | 3300025929 | Ga0207664_10727705 | Ga0207664_107277052 | 164 |
| 394 | 3300036712 | Ga0316584_0039488 | Ga0316584_0039488_602_1111 | 164 |
| 395 | 3300039437 | Ga0436365_0027168 | Ga0436365_0027168_31_576 | 164 |
| 396 | 3300039450 | Ga0436363_1026561 | Ga0436363_1026561_96_677 | 164 |
| 397 | 3300039450 | Ga0436363_1145542 | Ga0436363_1145542_33_578 | 164 |
| 398 | 3300050489 | nmdc:mga03683_2726_c1 | nmdc:mga03683_2726_c1_3512_4063 | 164 |
| 399 | 3300050490 | nmdc:mga03n38_6933_c1 | nmdc:mga03n38_6933_c1_3218_3769 | 164 |
| 400 | 3300050491 | nmdc:mga00v17_272781_c1 | nmdc:mga00v17_272781_c1_364_915 | 164 |
| 401 | 3300050492 | nmdc:mga0yw44_355062_c1 | nmdc:mga0yw44_355062_c1_308_859 | 164 |
| 402 | 3300050493 | nmdc:mga0k408_12293_c1 | nmdc:mga0k408_12293_c1_1973_2524 | 164 |
| 403 | 3300050494 | nmdc:mga06z11_156954_c1 | nmdc:mga06z11_156954_c1_402_953 | 164 |
| 404 | 3300050512 | nmdc:mga0n895_157102_c1 | nmdc:mga0n895_157102_c1_1097_1672 | 164 |
| 405 | 3300050516 | nmdc:mga0sz30_280630_c1 | nmdc:mga0sz30_280630_c1_118_669 | 164 |
| 406 | iso_pu_bacteria | 2841957949 | 2841961618 | 164 |
| 407 | iso_pu_bacteria | 8016630954 | 8016637582 | 164 |
| 408 | 3300005834 | Ga0068851_10455847 | Ga0068851_104558471 | 165 |
| 409 | 3300006028 | Ga0070717_10002016 | Ga0070717_100020166 | 165 |
| 410 | 3300006871 | Ga0075434_100159706 | Ga0075434_1001597062 | 165 |
| 411 | 3300007788 | Ga0099795_10105977 | Ga0099795_101059772 | 165 |
| 412 | 3300009101 | Ga0105247_10181587 | Ga0105247_101815872 | 165 |
| 413 | 3300011119 | Ga0105246_10258240 | Ga0105246_102582401 | 165 |
| 414 | 3300035692 | Ga0373935_0009768 | Ga0373935_0009768_14_568 | 165 |
| 415 | 3300037068 | Ga0373925_0010804 | Ga0373925_0010804_1773_2327 | 165 |
| 416 | 3300039450 | Ga0436363_0644197 | Ga0436363_0644197_117_716 | 165 |
| 417 | 3300046455 | Ga0495603_0064045 | Ga0495603_0064045_792_1346 | 165 |
| 418 | 3300046475 | Ga0495639_0018784 | Ga0495639_0018784_1959_2513 | 165 |
| 419 | 3300046531 | Ga0495665_0175146 | Ga0495665_0175146_357_911 | 165 |
| 420 | 3300048903 | Ga0496100_0033132 | Ga0496100_0033132_844_1389 | 165 |
| 421 | 3300048905 | Ga0496102_0018849 | Ga0496102_0018849_3907_4452 | 165 |
| 422 | 3300048907 | Ga0496104_0026450 | Ga0496104_0026450_3763_4308 | 165 |
| 423 | 3300048908 | Ga0496105_0066846 | Ga0496105_0066846_1199_1744 | 165 |
| 424 | 3300048909 | Ga0496106_0004268 | Ga0496106_0004268_5212_5757 | 165 |
| 425 | 3300048910 | Ga0496107_0018102 | Ga0496107_0018102_3605_4150 | 165 |
| 426 | 3300048911 | Ga0496108_0046112 | Ga0496108_0046112_1558_2103 | 165 |
| 427 | 3300048913 | Ga0496110_0016966 | Ga0496110_0016966_4441_4986 | 165 |
| 428 | 3300048913 | Ga0496110_0176995 | Ga0496110_0176995_280_825 | 165 |
| 429 | 3300048914 | Ga0496111_0028463 | Ga0496111_0028463_2060_2605 | 165 |
| 430 | 3300048914 | Ga0496111_0039557 | Ga0496111_0039557_1743_2288 | 165 |
| 431 | 3300048915 | Ga0496112_0033161 | Ga0496112_0033161_3265_3810 | 165 |
| 432 | 3300048915 | Ga0496112_0114900 | Ga0496112_0114900_1302_1847 | 165 |
| 433 | 3300048916 | Ga0496113_0018469 | Ga0496113_0018469_2652_3197 | 165 |
| 434 | 3300048918 | Ga0496115_0096460 | Ga0496115_0096460_358_903 | 165 |
| 435 | 3300048929 | Ga0496126_0630246 | Ga0496126_0630246_34_597 | 165 |
| 436 | 3300049571 | Ga0501034_0066082 | Ga0501034_0066082_950_1546 | 165 |
| 437 | 3300049583 | Ga0501067_0198240 | Ga0501067_0198240_415_1011 | 165 |
| 438 | 3300049583 | Ga0501067_0209696 | Ga0501067_0209696_314_889 | 165 |
| 439 | 3300049586 | Ga0501070_0180044 | Ga0501070_0180044_462_1037 | 165 |
| 440 | 3300050493 | nmdc:mga0k408_247709_c1 | nmdc:mga0k408_247709_c1_10_564 | 165 |
| 441 | 3300005340 | Ga0070689_100121490 | Ga0070689_1001214902 | 166 |
| 442 | 3300005355 | Ga0070671_100712762 | Ga0070671_1007127622 | 166 |
| 443 | 3300005365 | Ga0070688_100198197 | Ga0070688_1001981972 | 166 |
| 444 | 3300005436 | Ga0070713_100164304 | Ga0070713_1001643042 | 166 |
| 445 | 3300006051 | Ga0075364_10128388 | Ga0075364_101283882 | 166 |
| 446 | 3300006178 | Ga0075367_10031601 | Ga0075367_100316014 | 166 |
| 447 | 3300006186 | Ga0075369_10008314 | Ga0075369_100083142 | 166 |
| 448 | 3300006353 | Ga0075370_10001319 | Ga0075370_100013194 | 166 |
| 449 | 3300010159 | Ga0099796_10027701 | Ga0099796_100277012 | 166 |
| 450 | 3300010375 | Ga0105239_10594306 | Ga0105239_105943062 | 166 |
| 451 | 3300025928 | Ga0207700_10081890 | Ga0207700_100818902 | 166 |
| 452 | 3300025936 | Ga0207670_10111986 | Ga0207670_101119862 | 166 |
| 453 | 3300027512 | Ga0209179_1023692 | Ga0209179_10236922 | 166 |
| 454 | 3300039447 | Ga0436361_0679525 | Ga0436361_0679525_767_1384 | 166 |
| 455 | 3300039450 | Ga0436363_0904821 | Ga0436363_0904821_196_762 | 166 |
| 456 | 3300048903 | Ga0496100_0370246 | Ga0496100_0370246_295_879 | 166 |
| 457 | 3300048907 | Ga0496104_0194047 | Ga0496104_0194047_237_830 | 166 |
| 458 | 3300048909 | Ga0496106_0332443 | Ga0496106_0332443_29_622 | 166 |
| 459 | 3300048912 | Ga0496109_0529755 | Ga0496109_0529755_452_1036 | 166 |
| 460 | 3300050489 | nmdc:mga03683_153110_c1 | nmdc:mga03683_153110_c1_144_740 | 166 |
| 461 | 3300050491 | nmdc:mga00v17_29550_c1 | nmdc:mga00v17_29550_c1_469_1065 | 166 |
| 462 | 3300050493 | nmdc:mga0k408_460264_c1 | nmdc:mga0k408_460264_c1_79_660 | 166 |
| 463 | 3300050495 | nmdc:mga04h51_6058_c1 | nmdc:mga04h51_6058_c1_2490_3086 | 166 |
| 464 | 3300050496 | nmdc:mga07m45_14615_c1 | nmdc:mga07m45_14615_c1_16_591 | 166 |
| 465 | iso_pu_bacteria | 2824653114 | 2824661163 | 166 |
| 466 | iso_pu_bacteria | 8016622563 | 8016624191 | 166 |
| 467 | iso_pu_bacteria | 8019678201 | 8019681063 | 166 |
| 468 | 3300005577 | Ga0068857_100129461 | Ga0068857_1001294612 | 167 |
| 469 | 3300009545 | Ga0105237_10092764 | Ga0105237_100927643 | 167 |
| 470 | 3300009551 | Ga0105238_10045610 | Ga0105238_100456105 | 167 |
| 471 | 3300025914 | Ga0207671_10089125 | Ga0207671_100891253 | 167 |
| 472 | 3300025924 | Ga0207694_10107825 | Ga0207694_101078252 | 167 |
| 473 | 3300026116 | Ga0207674_10050892 | Ga0207674_100508924 | 167 |
| 474 | 3300035089 | Ga0373944_0003875 | Ga0373944_0003875_1532_2164 | 167 |
| 475 | 3300035116 | Ga0373945_0050351 | Ga0373945_0050351_338_970 | 167 |
| 476 | 3300035170 | Ga0373943_0000115 | Ga0373943_0000115_14895_15527 | 167 |
| 477 | 3300035171 | Ga0373946_0003839 | Ga0373946_0003839_3231_3863 | 167 |
| 478 | 3300035692 | Ga0373935_0001782 | Ga0373935_0001782_1503_2135 | 167 |
| 479 | 3300035695 | Ga0373927_0001710 | Ga0373927_0001710_11349_11981 | 167 |
| 480 | 3300035725 | Ga0373947_0001924 | Ga0373947_0001924_9886_10518 | 167 |
| 481 | 3300037068 | Ga0373925_0004011 | Ga0373925_0004011_758_1390 | 167 |
| 482 | 3300046472 | Ga0495580_0042943 | Ga0495580_0042943_2047_2679 | 167 |
| 483 | 3300046517 | Ga0495630_0009728 | Ga0495630_0009728_3985_4617 | 167 |
| 484 | 3300046531 | Ga0495665_0042714 | Ga0495665_0042714_789_1421 | 167 |
| 485 | 3300046642 | Ga0495634_0054995 | Ga0495634_0054995_1225_1857 | 167 |
| 486 | 3300046683 | Ga0495658_0055046 | Ga0495658_0055046_1118_1750 | 167 |
| 487 | 3300046689 | Ga0495613_0222566 | Ga0495613_0222566_260_892 | 167 |
| 488 | 3300046690 | Ga0495624_0006806 | Ga0495624_0006806_7037_7669 | 167 |
| 489 | 3300047315 | Ga0495581_0008563 | Ga0495581_0008563_157_789 | 167 |
| 490 | 3300047321 | Ga0495676_0026806 | Ga0495676_0026806_2886_3518 | 167 |
| 491 | 3300047471 | Ga0495684_0003419 | Ga0495684_0003419_11000_11632 | 167 |
| 492 | 3300047673 | Ga0495593_0007704 | Ga0495593_0007704_1490_2122 | 167 |
| 493 | iso_pu_bacteria | 2824696289 | 2824704292 | 167 |
| 494 | 3300005339 | Ga0070660_100614190 | Ga0070660_1006141902 | 168 |
| 495 | 3300005343 | Ga0070687_100645005 | Ga0070687_1006450051 | 168 |
| 496 | 3300005355 | Ga0070671_100168248 | Ga0070671_1001682482 | 168 |
| 497 | 3300005364 | Ga0070673_100014626 | Ga0070673_1000146261 | 168 |
| 498 | 3300005366 | Ga0070659_100368143 | Ga0070659_1003681432 | 168 |
| 499 | 3300005367 | Ga0070667_100083614 | Ga0070667_1000836142 | 168 |
| 500 | 3300005437 | Ga0070710_10187129 | Ga0070710_101871291 | 168 |
| 501 | 3300005439 | Ga0070711_100079636 | Ga0070711_1000796362 | 168 |
| 502 | 3300005457 | Ga0070662_100144654 | Ga0070662_1001446542 | 168 |
| 503 | 3300005544 | Ga0070686_100056769 | Ga0070686_1000567692 | 168 |
| 504 | 3300005548 | Ga0070665_100114487 | Ga0070665_1001144872 | 168 |
| 505 | 3300005564 | Ga0070664_100114064 | Ga0070664_1001140642 | 168 |
| 506 | 3300005614 | Ga0068856_100339241 | Ga0068856_1003392412 | 168 |
| 507 | 3300005842 | Ga0068858_100147937 | Ga0068858_1001479373 | 168 |
| 508 | 3300006028 | Ga0070717_10790035 | Ga0070717_107900352 | 168 |
| 509 | 3300006163 | Ga0070715_10166818 | Ga0070715_101668182 | 168 |
| 510 | 3300006175 | Ga0070712_100054155 | Ga0070712_1000541552 | 168 |
| 511 | 3300006353 | Ga0075370_10501083 | Ga0075370_105010832 | 168 |
| 512 | 3300006871 | Ga0075434_100246619 | Ga0075434_1002466192 | 168 |
| 513 | 3300009098 | Ga0105245_10167287 | Ga0105245_101672872 | 168 |
| 514 | 3300009101 | Ga0105247_10155765 | Ga0105247_101557652 | 168 |
| 515 | 3300009545 | Ga0105237_10080340 | Ga0105237_100803405 | 168 |
| 516 | 3300009551 | Ga0105238_10063884 | Ga0105238_100638845 | 168 |
| 517 | 3300009551 | Ga0105238_10333592 | Ga0105238_103335922 | 168 |
| 518 | 3300011119 | Ga0105246_10679104 | Ga0105246_106791042 | 168 |
| 519 | 3300013296 | Ga0157374_10055264 | Ga0157374_100552646 | 168 |
| 520 | 3300014325 | Ga0163163_10093908 | Ga0163163_100939082 | 168 |
| 521 | 3300025900 | Ga0207710_10299952 | Ga0207710_102999522 | 168 |
| 522 | 3300025914 | Ga0207671_10064657 | Ga0207671_100646572 | 168 |
| 523 | 3300025915 | Ga0207693_10026940 | Ga0207693_100269403 | 168 |
| 524 | 3300025920 | Ga0207649_10460311 | Ga0207649_104603112 | 168 |
| 525 | 3300025924 | Ga0207694_10042041 | Ga0207694_100420412 | 168 |
| 526 | 3300025925 | Ga0207650_10007870 | Ga0207650_100078704 | 168 |
| 527 | 3300025928 | Ga0207700_10282403 | Ga0207700_102824032 | 168 |
| 528 | 3300025931 | Ga0207644_10003286 | Ga0207644_1000328610 | 168 |
| 529 | 3300025932 | Ga0207690_10505151 | Ga0207690_105051512 | 168 |
| 530 | 3300025933 | Ga0207706_10033595 | Ga0207706_100335953 | 168 |
| 531 | 3300025936 | Ga0207670_10133649 | Ga0207670_101336492 | 168 |
| 532 | 3300025940 | Ga0207691_10058529 | Ga0207691_100585292 | 168 |
| 533 | 3300025941 | Ga0207711_10193303 | Ga0207711_101933032 | 168 |
| 534 | 3300025986 | Ga0207658_10107139 | Ga0207658_101071392 | 168 |
| 535 | 3300026035 | Ga0207703_10130052 | Ga0207703_101300522 | 168 |
| 536 | 3300028379 | Ga0268266_10286038 | Ga0268266_102860382 | 168 |
| 537 | 3300031911 | Ga0307412_10626885 | Ga0307412_106268852 | 168 |
| 538 | 3300039447 | Ga0436361_0531880 | Ga0436361_0531880_51_644 | 168 |
| 539 | 3300047472 | Ga0495686_0090578 | Ga0495686_0090578_22_603 | 168 |
| 540 | 3300048903 | Ga0496100_0098942 | Ga0496100_0098942_156_731 | 168 |
| 541 | 3300048904 | Ga0496101_0180781 | Ga0496101_0180781_729_1304 | 168 |
| 542 | 3300048911 | Ga0496108_1025496 | Ga0496108_1025496_118_693 | 168 |
| 543 | 3300048912 | Ga0496109_0417611 | Ga0496109_0417611_346_921 | 168 |
| 544 | 3300048927 | Ga0496124_0198601 | Ga0496124_0198601_44_640 | 168 |
| 545 | 3300048928 | Ga0496125_0100666 | Ga0496125_0100666_1443_2039 | 168 |
| 546 | 3300050513 | nmdc:mga0rr50_696127_c1 | nmdc:mga0rr50_696127_c1_23_598 | 168 |
| 547 | iso_pu_bacteria | 2874628541 | 2874633626 | 168 |
| 548 | 3300005354 | Ga0070675_100672486 | Ga0070675_1006724861 | 169 |
| 549 | 3300009545 | Ga0105237_10082386 | Ga0105237_100823864 | 169 |
| 550 | 3300013104 | Ga0157370_10183631 | Ga0157370_101836312 | 169 |
| 551 | 3300013105 | Ga0157369_10048517 | Ga0157369_100485173 | 169 |
| 552 | 3300035695 | Ga0373927_0001673 | Ga0373927_0001673_12744_13331 | 169 |
| 553 | 3300035725 | Ga0373947_0016273 | Ga0373947_0016273_3475_4062 | 169 |
| 554 | 3300037312 | Ga0395899_0096896 | Ga0395899_0096896_1383_1991 | 169 |
| 555 | 3300037466 | Ga0395898_0018364 | Ga0395898_0018364_5273_5881 | 169 |
| 556 | iso_pu_bacteria | 2857509624 | 2857513555 | 169 |
| 557 | iso_pu_bacteria | 2888419890 | 2888421382 | 169 |
| 558 | 3300005981 | Ga0081538_10031425 | Ga0081538_100314253 | 170 |
| 559 | 3300006048 | Ga0075363_100183842 | Ga0075363_1001838422 | 170 |
| 560 | 3300025922 | Ga0207646_10099945 | Ga0207646_100999452 | 170 |
| 561 | 3300035089 | Ga0373944_0002616 | Ga0373944_0002616_1703_2272 | 170 |
| 562 | 3300035170 | Ga0373943_0029833 | Ga0373943_0029833_892_1461 | 170 |
| 563 | 3300035171 | Ga0373946_0005231 | Ga0373946_0005231_2001_2570 | 170 |
| 564 | 3300035692 | Ga0373935_0208474 | Ga0373935_0208474_666_1235 | 170 |
| 565 | 3300035695 | Ga0373927_0032729 | Ga0373927_0032729_1789_2358 | 170 |
| 566 | 3300035725 | Ga0373947_0074035 | Ga0373947_0074035_1045_1614 | 170 |
| 567 | 3300046472 | Ga0495580_0625075 | Ga0495580_0625075_46_615 | 170 |
| 568 | 3300046473 | Ga0495582_0063217 | Ga0495582_0063217_937_1506 | 170 |
| 569 | 3300046517 | Ga0495630_0138601 | Ga0495630_0138601_954_1523 | 170 |
| 570 | 3300046524 | Ga0495648_0186998 | Ga0495648_0186998_287_883 | 170 |
| 571 | 3300046681 | Ga0495647_0055162 | Ga0495647_0055162_46_615 | 170 |
| 572 | 3300046690 | Ga0495624_0162822 | Ga0495624_0162822_85_654 | 170 |
| 573 | 3300047321 | Ga0495676_0008456 | Ga0495676_0008456_1357_1926 | 170 |
| 574 | 3300053086 | Ga0500578_0328900 | Ga0500578_0328900_273_869 | 170 |
| 575 | 3300053156 | Ga0500622_0177696 | Ga0500622_0177696_29_625 | 170 |
| 576 | iso_pu_bacteria | 2879074833 | 2879074879 | 170 |
| 577 | 3300005434 | Ga0070709_10174332 | Ga0070709_101743322 | 171 |
| 578 | 3300005435 | Ga0070714_100004377 | Ga0070714_1000043777 | 171 |
| 579 | 3300005436 | Ga0070713_100010117 | Ga0070713_1000101172 | 171 |
| 580 | 3300005437 | Ga0070710_10005753 | Ga0070710_100057532 | 171 |
| 581 | 3300005439 | Ga0070711_100223987 | Ga0070711_1002239872 | 171 |
| 582 | 3300005444 | Ga0070694_100576064 | Ga0070694_1005760642 | 171 |
| 583 | 3300005937 | Ga0081455_10009527 | Ga0081455_100095273 | 171 |
| 584 | 3300005983 | Ga0081540_1051334 | Ga0081540_10513342 | 171 |
| 585 | 3300006028 | Ga0070717_10030212 | Ga0070717_100302126 | 171 |
| 586 | 3300006038 | Ga0075365_10046194 | Ga0075365_100461944 | 171 |
| 587 | 3300006051 | Ga0075364_10320977 | Ga0075364_103209772 | 171 |
| 588 | 3300006847 | Ga0075431_100087680 | Ga0075431_1000876804 | 171 |
| 589 | 3300006871 | Ga0075434_100146849 | Ga0075434_1001468492 | 171 |
| 590 | 3300006880 | Ga0075429_100306752 | Ga0075429_1003067522 | 171 |
| 591 | 3300009545 | Ga0105237_10214790 | Ga0105237_102147902 | 171 |
| 592 | 3300021361 | Ga0213872_10170767 | Ga0213872_101707672 | 171 |
| 593 | 3300025297 | Ga0209758_1043052 | Ga0209758_10430522 | 171 |
| 594 | 3300025900 | Ga0207710_10079523 | Ga0207710_100795232 | 171 |
| 595 | 3300025939 | Ga0207665_10001873 | Ga0207665_100018738 | 171 |
| 596 | 3300030521 | Ga0307511_10204636 | Ga0307511_102046362 | 171 |
| 597 | 3300031507 | Ga0307509_10074245 | Ga0307509_100742454 | 171 |
| 598 | 3300031507 | Ga0307509_10166946 | Ga0307509_101669463 | 171 |
| 599 | 3300031616 | Ga0307508_10127981 | Ga0307508_101279812 | 171 |
| 600 | 3300031730 | Ga0307516_10199557 | Ga0307516_101995573 | 171 |
| 601 | 3300033179 | Ga0307507_10031018 | Ga0307507_100310186 | 171 |
| 602 | 3300035692 | Ga0373935_0034061 | Ga0373935_0034061_491_1066 | 171 |
| 603 | 3300035695 | Ga0373927_0048532 | Ga0373927_0048532_484_1059 | 171 |
| 604 | 3300035725 | Ga0373947_0045489 | Ga0373947_0045489_178_753 | 171 |
| 605 | 3300037068 | Ga0373925_0034736 | Ga0373925_0034736_1516_2091 | 171 |
| 606 | 3300039437 | Ga0436365_0914429 | Ga0436365_0914429_541_1149 | 171 |
| 607 | 3300039437 | Ga0436365_0982478 | Ga0436365_0982478_1167_1754 | 171 |
| 608 | 3300046557 | Ga0495622_0048886 | Ga0495622_0048886_1083_1658 | 171 |
| 609 | 3300047320 | Ga0495672_0146177 | Ga0495672_0146177_648_1217 | 171 |
| 610 | 3300048909 | Ga0496106_0000935 | Ga0496106_0000935_9177_9752 | 171 |
| 611 | 3300048920 | Ga0496117_0033294 | Ga0496117_0033294_2946_3521 | 171 |
| 612 | 3300048921 | Ga0496118_0008592 | Ga0496118_0008592_7444_8019 | 171 |
| 613 | 3300048924 | Ga0496121_0000555 | Ga0496121_0000555_971_1546 | 171 |
| 614 | 3300048927 | Ga0496124_0001875 | Ga0496124_0001875_24072_24647 | 171 |
| 615 | 3300048928 | Ga0496125_0022852 | Ga0496125_0022852_4849_5424 | 171 |
| 616 | 3300048929 | Ga0496126_0006420 | Ga0496126_0006420_7706_8281 | 171 |
| 617 | 3300048929 | Ga0496126_0128673 | Ga0496126_0128673_757_1356 | 171 |
| 618 | 3300050491 | nmdc:mga00v17_411310_c1 | nmdc:mga00v17_411310_c1_126_707 | 171 |
| 619 | 3300050492 | nmdc:mga0yw44_21452_c1 | nmdc:mga0yw44_21452_c1_892_1473 | 171 |
| 620 | 3300050508 | nmdc:mga09592_198436_c1 | nmdc:mga09592_198436_c1_766_1347 | 171 |
| 621 | 3300053094 | Ga0500566_0028972 | Ga0500566_0028972_2303_2878 | 171 |
| 622 | 3300053119 | Ga0500595_013874 | Ga0500595_013874_1862_2437 | 171 |
| 623 | 3300053177 | Ga0500636_0143335 | Ga0500636_0143335_646_1254 | 171 |
| 624 | 3300053178 | Ga0500637_0087617 | Ga0500637_0087617_982_1557 | 171 |
| 625 | 3300053728 | Ga0500657_132335 | Ga0500657_132335_52_627 | 171 |
| 626 | iso_pu_bacteria | 2847930680 | 2847939230 | 171 |
| 627 | iso_pu_bacteria | 2879083081 | 2879090370 | 171 |
| 628 | iso_pu_bacteria | 2906643746 | 2906652243 | 171 |
| 629 | 3300005329 | Ga0070683_100059816 | Ga0070683_1000598162 | 172 |
| 630 | 3300005367 | Ga0070667_100413933 | Ga0070667_1004139331 | 172 |
| 631 | 3300005434 | Ga0070709_10000619 | Ga0070709_100006197 | 172 |
| 632 | 3300005435 | Ga0070714_100306490 | Ga0070714_1003064902 | 172 |
| 633 | 3300005437 | Ga0070710_10000409 | Ga0070710_1000040911 | 172 |
| 634 | 3300005439 | Ga0070711_100000650 | Ga0070711_1000006509 | 172 |
| 635 | 3300005458 | Ga0070681_10223732 | Ga0070681_102237322 | 172 |
| 636 | 3300005535 | Ga0070684_100255355 | Ga0070684_1002553552 | 172 |
| 637 | 3300005937 | Ga0081455_10001093 | Ga0081455_1000109329 | 172 |
| 638 | 3300006173 | Ga0070716_100003498 | Ga0070716_1000034982 | 172 |
| 639 | 3300006353 | Ga0075370_10055494 | Ga0075370_100554943 | 172 |
| 640 | 3300009036 | Ga0105244_10183628 | Ga0105244_101836282 | 172 |
| 641 | 3300013105 | Ga0157369_10086990 | Ga0157369_100869904 | 172 |
| 642 | 3300021358 | Ga0213873_10002485 | Ga0213873_100024852 | 172 |
| 643 | 3300021384 | Ga0213876_10030494 | Ga0213876_100304941 | 172 |
| 644 | 3300025898 | Ga0207692_10000426 | Ga0207692_100004264 | 172 |
| 645 | 3300025906 | Ga0207699_10000368 | Ga0207699_100003689 | 172 |
| 646 | 3300025915 | Ga0207693_10062230 | Ga0207693_100622302 | 172 |
| 647 | 3300025921 | Ga0207652_10042639 | Ga0207652_100426392 | 172 |
| 648 | 3300025928 | Ga0207700_10003271 | Ga0207700_100032715 | 172 |
| 649 | 3300025939 | Ga0207665_10011625 | Ga0207665_100116252 | 172 |
| 650 | 3300025944 | Ga0207661_10006894 | Ga0207661_100068946 | 172 |
| 651 | 3300041491 | Ga0451833_0759778 | Ga0451833_0759778_224_802 | 172 |
| 652 | 3300046537 | Ga0495598_0002854 | Ga0495598_0002854_1327_1902 | 172 |
| 653 | 3300046539 | Ga0495621_0049786 | Ga0495621_0049786_187_762 | 172 |
| 654 | 3300046648 | Ga0495611_0115465 | Ga0495611_0115465_647_1222 | 172 |
| 655 | 3300046664 | Ga0495659_0028611 | Ga0495659_0028611_859_1434 | 172 |
| 656 | 3300047319 | Ga0495674_0475495 | Ga0495674_0475495_251_826 | 172 |
| 657 | 3300048929 | Ga0496126_0218350 | Ga0496126_0218350_807_1436 | 172 |
| 658 | 3300049582 | Ga0501048_0295798 | Ga0501048_0295798_126_695 | 172 |
| 659 | 3300049592 | Ga0501076_0541136 | Ga0501076_0541136_270_839 | 172 |
| 660 | 3300049741 | Ga0501079_0087569 | Ga0501079_0087569_217_786 | 172 |
| 661 | 3300050496 | nmdc:mga07m45_87138_c1 | nmdc:mga07m45_87138_c1_958_1536 | 172 |
| 662 | 3300054114 | Ga0501084_0199467 | Ga0501084_0199467_1035_1604 | 172 |
| 663 | 3300061734 | Ga0530510_0259121 | Ga0530510_0259121_641_1210 | 172 |
| 664 | iso_pu_bacteria | 2838122688 | 2838129970 | 172 |
| 665 | iso_pu_bacteria | 2841983080 | 2841990245 | 172 |
| 666 | iso_pu_bacteria | 2847939898 | 2847943802 | 172 |
| 667 | iso_pu_bacteria | 8056689827 | 8056696104 | 172 |
| 668 | 3300005435 | Ga0070714_100017830 | Ga0070714_1000178303 | 173 |
| 669 | 3300006028 | Ga0070717_10416191 | Ga0070717_104161912 | 173 |
| 670 | 3300006163 | Ga0070715_10011596 | Ga0070715_100115962 | 173 |
| 671 | 3300006175 | Ga0070712_100026783 | Ga0070712_1000267833 | 173 |
| 672 | 3300009094 | Ga0111539_10040709 | Ga0111539_100407095 | 173 |
| 673 | 3300021384 | Ga0213876_10343434 | Ga0213876_103434342 | 173 |
| 674 | 3300021388 | Ga0213875_10106942 | Ga0213875_101069422 | 173 |
| 675 | 3300025905 | Ga0207685_10228224 | Ga0207685_102282242 | 173 |
| 676 | 3300025915 | Ga0207693_10087406 | Ga0207693_100874063 | 173 |
| 677 | 3300025915 | Ga0207693_10207342 | Ga0207693_102073422 | 173 |
| 678 | 3300025916 | Ga0207663_10000896 | Ga0207663_100008967 | 173 |
| 679 | 3300025928 | Ga0207700_10037832 | Ga0207700_100378322 | 173 |
| 680 | 3300025929 | Ga0207664_10021693 | Ga0207664_100216933 | 173 |
| 681 | 3300025929 | Ga0207664_10098511 | Ga0207664_100985112 | 173 |
| 682 | 3300038443 | Ga0395901_0409313 | Ga0395901_0409313_383_1015 | 173 |
| 683 | 3300039437 | Ga0436365_0594440 | Ga0436365_0594440_6961_7554 | 173 |
| 684 | 3300039453 | Ga0436362_0715867 | Ga0436362_0715867_4916_5509 | 173 |
| 685 | 3300049581 | Ga0501047_0023188 | Ga0501047_0023188_1575_2204 | 173 |
| 686 | 3300049586 | Ga0501070_0016565 | Ga0501070_0016565_2722_3351 | 173 |
| 687 | 3300049589 | Ga0501073_0135304 | Ga0501073_0135304_773_1402 | 173 |
| 688 | 3300049741 | Ga0501079_0063678 | Ga0501079_0063678_569_1198 | 173 |
| 689 | 3300050515 | nmdc:mga0a205_159325_c1 | nmdc:mga0a205_159325_c1_779_1390 | 173 |
| 690 | iso_pu_bacteria | 8019608314 | 8019613919 | 173 |
| 691 | 3300031616 | Ga0307508_10001335 | Ga0307508_1000133510 | 174 |
| 692 | 3300037471 | Ga0395905_0485756 | Ga0395905_0485756_380_994 | 174 |
| 693 | 3300039450 | Ga0436363_0424805 | Ga0436363_0424805_1035_1628 | 174 |
| 694 | 3300046694 | Ga0495649_0197035 | Ga0495649_0197035_52_621 | 174 |
| 695 | 3300049574 | Ga0501038_0000737 | Ga0501038_0000737_7247_7831 | 174 |
| 696 | 3300049823 | Ga0501044_0044741 | Ga0501044_0044741_801_1385 | 174 |
| 697 | 3300025297 | Ga0209758_1001433 | Ga0209758_100143330 | 175 |
| 698 | 3300025906 | Ga0207699_10546944 | Ga0207699_105469442 | 175 |
| 699 | 3300046691 | Ga0495670_0081220 | Ga0495670_0081220_132_689 | 175 |
| 700 | 3300048905 | Ga0496102_0868192 | Ga0496102_0868192_236_802 | 175 |
| 701 | 3300048908 | Ga0496105_0586989 | Ga0496105_0586989_134_736 | 175 |
| 702 | 3300048909 | Ga0496106_0002126 | Ga0496106_0002126_9806_10372 | 175 |
| 703 | 3300048910 | Ga0496107_0037970 | Ga0496107_0037970_1870_2436 | 175 |
| 704 | 3300048911 | Ga0496108_0000681 | Ga0496108_0000681_376_942 | 175 |
| 705 | 3300048912 | Ga0496109_0000450 | Ga0496109_0000450_9322_9888 | 175 |
| 706 | 3300048913 | Ga0496110_0028657 | Ga0496110_0028657_3819_4385 | 175 |
| 707 | 3300048915 | Ga0496112_0005385 | Ga0496112_0005385_6972_7574 | 175 |
| 708 | 3300048915 | Ga0496112_0374829 | Ga0496112_0374829_690_1256 | 175 |
| 709 | 3300048916 | Ga0496113_0076366 | Ga0496113_0076366_547_1113 | 175 |
| 710 | iso_pu_bacteria | 2508501128 | 2509147859 | 175 |
| 711 | iso_pu_bacteria | 2874604998 | 2874606070 | 175 |
| 712 | 3300005614 | Ga0068856_100000055 | Ga0068856_10000005565 | 176 |
| 713 | 3300026078 | Ga0207702_10000688 | Ga0207702_1000068817 | 176 |
| 714 | 3300028666 | Ga0265336_10029119 | Ga0265336_100291192 | 176 |
| 715 | 3300028800 | Ga0265338_10001933 | Ga0265338_1000193322 | 176 |
| 716 | 3300029957 | Ga0265324_10017106 | Ga0265324_100171062 | 176 |
| 717 | 3300046674 | Ga0495588_0125571 | Ga0495588_0125571_103_759 | 176 |
| 718 | 3300048929 | Ga0496126_0019705 | Ga0496126_0019705_4565_5194 | 176 |
| 719 | iso_pu_bacteria | 2906610324 | 2906612617 | 176 |
| 720 | 3300005434 | Ga0070709_10049581 | Ga0070709_100495812 | 177 |
| 721 | 3300006028 | Ga0070717_10002999 | Ga0070717_100029997 | 177 |
| 722 | 3300006163 | Ga0070715_10000199 | Ga0070715_100001998 | 177 |
| 723 | 3300006173 | Ga0070716_100007123 | Ga0070716_1000071234 | 177 |
| 724 | 3300006175 | Ga0070712_100101520 | Ga0070712_1001015202 | 177 |
| 725 | 3300025898 | Ga0207692_10016808 | Ga0207692_100168084 | 177 |
| 726 | 3300025905 | Ga0207685_10000725 | Ga0207685_100007254 | 177 |
| 727 | 3300025906 | Ga0207699_10059050 | Ga0207699_100590503 | 177 |
| 728 | 3300025915 | Ga0207693_10001800 | Ga0207693_100018005 | 177 |
| 729 | 3300025916 | Ga0207663_10013127 | Ga0207663_100131272 | 177 |
| 730 | 3300025928 | Ga0207700_10022300 | Ga0207700_100223002 | 177 |
| 731 | 3300025929 | Ga0207664_10103552 | Ga0207664_101035522 | 177 |
| 732 | 3300025939 | Ga0207665_10000224 | Ga0207665_1000022415 | 177 |
| 733 | iso_pu_bacteria | 2922361189 | 2922363453 | 177 |
| 734 | 3300013306 | Ga0163162_10165938 | Ga0163162_101659382 | 178 |
| 735 | 3300049581 | Ga0501047_0577809 | Ga0501047_0577809_78_704 | 178 |
| 736 | 3300053077 | Ga0495601_0362319 | Ga0495601_0362319_259_861 | 178 |
| 737 | 3300053119 | Ga0500595_010000 | Ga0500595_010000_2449_3045 | 178 |
| 738 | 3300005367 | Ga0070667_100274041 | Ga0070667_1002740412 | 179 |
| 739 | 3300005329 | Ga0070683_100296554 | Ga0070683_1002965542 | 180 |
| 740 | 3300005535 | Ga0070684_100482802 | Ga0070684_1004828022 | 180 |
| 741 | 3300006038 | Ga0075365_10274272 | Ga0075365_102742722 | 180 |
| 742 | 3300006048 | Ga0075363_100280686 | Ga0075363_1002806861 | 180 |
| 743 | 3300006353 | Ga0075370_10033800 | Ga0075370_100338004 | 180 |
| 744 | 3300013105 | Ga0157369_10238439 | Ga0157369_102384392 | 180 |
| 745 | 3300025903 | Ga0207680_10218878 | Ga0207680_102188782 | 180 |
| 746 | 3300025949 | Ga0207667_10174669 | Ga0207667_101746692 | 180 |
| 747 | 3300031730 | Ga0307516_10228815 | Ga0307516_102288153 | 180 |
| 748 | 3300041453 | Ga0451797_0977362 | Ga0451797_0977362_38_604 | 180 |
| 749 | 3300050492 | nmdc:mga0yw44_175002_c1 | nmdc:mga0yw44_175002_c1_595_1161 | 180 |
| 750 | 3300050496 | nmdc:mga07m45_55257_c1 | nmdc:mga07m45_55257_c1_1529_2095 | 180 |
| 751 | iso_pu_bacteria | 2517093001 | 2517101204 | 180 |
| 752 | iso_pu_bacteria | 2617270741 | 2617374936 | 180 |
| 753 | iso_pu_bacteria | 2824679649 | 2824687498 | 180 |
| 754 | iso_pu_bacteria | 2824732956 | 2824740402 | 180 |
| 755 | iso_pu_bacteria | 2824746037 | 2824753711 | 180 |
| 756 | iso_pu_bacteria | 2842045827 | 2842050289 | 180 |
| 757 | iso_pu_bacteria | 2885366525 | 2885373681 | 180 |
| 758 | iso_pu_bacteria | 2908775508 | 2908777418 | 180 |
| 759 | iso_pu_bacteria | 2922393267 | 2922398299 | 180 |
| 760 | iso_pu_bacteria | 3005483717 | 3005487738 | 180 |
| 761 | iso_pu_bacteria | 3005587118 | 3005591958 | 180 |
| 762 | iso_pu_bacteria | 2888388044 | 2888389708 | 181 |
| 763 | iso_pu_bacteria | 2904690495 | 2904691705 | 181 |
| 764 | iso_pu_bacteria | 2908756301 | 2908763779 | 181 |
| 765 | iso_pu_bacteria | 8006984368 | 8006986267 | 181 |
| 766 | iso_pu_bacteria | 8006994254 | 8006998942 | 181 |
| 767 | 3300047320 | Ga0495672_0015931 | Ga0495672_0015931_737_1315 | 182 |
| 768 | iso_pu_bacteria | 2508501009 | 2508545253 | 182 |
| 769 | iso_pu_bacteria | 2508501042 | 2508694085 | 182 |
| 770 | iso_pu_bacteria | 2513237098 | 2513673272 | 182 |
| 771 | iso_pu_bacteria | 2515154112 | 2515624979 | 182 |
| 772 | iso_pu_bacteria | 2524023210 | 2524465842 | 182 |
| 773 | iso_pu_bacteria | 2791355199 | 2793078812 | 182 |
| 774 | iso_pu_bacteria | 2824609381 | 2824617621 | 182 |
| 775 | iso_pu_bacteria | 2874590934 | 2874594662 | 182 |
| 776 | iso_pu_bacteria | 2874645413 | 2874649707 | 182 |
| 777 | iso_pu_bacteria | 2876771140 | 2876773794 | 182 |
| 778 | iso_pu_bacteria | 2879110137 | 2879116768 | 182 |
| 779 | iso_pu_bacteria | 2885383462 | 2885386762 | 182 |
| 780 | iso_pu_bacteria | 2903768456 | 2903775847 | 182 |
| 781 | iso_pu_bacteria | 2922386360 | 2922389569 | 182 |
| 782 | iso_pu_bacteria | 2935608549 | 2935616364 | 182 |
| 783 | iso_pu_bacteria | 2935648319 | 2935650758 | 182 |
| 784 | iso_pu_bacteria | 2935656913 | 2935662138 | 182 |
| 785 | iso_pu_bacteria | 2935769743 | 2935770417 | 182 |
| 786 | iso_pu_bacteria | 2935777560 | 2935782555 | 182 |
| 787 | iso_pu_bacteria | 2935785616 | 2935786530 | 182 |
| 788 | iso_pu_bacteria | 2935793552 | 2935794585 | 182 |
| 789 | iso_pu_bacteria | 2935819856 | 2935827161 | 182 |
| 790 | iso_pu_bacteria | 2935847175 | 2935854342 | 182 |
| 791 | iso_pu_bacteria | 2935908558 | 2935913563 | 182 |
| 792 | iso_pu_bacteria | 2935916978 | 2935923461 | 182 |
| 793 | iso_pu_bacteria | 2935926038 | 2935931120 | 182 |
| 794 | iso_pu_bacteria | 2935934488 | 2935935402 | 182 |
| 795 | iso_pu_bacteria | 2935942939 | 2935946968 | 182 |
| 796 | iso_pu_bacteria | 2935951376 | 2935953937 | 182 |
| 797 | iso_pu_bacteria | 2935967501 | 2935968963 | 182 |
| 798 | iso_pu_bacteria | 2935975950 | 2935982386 | 182 |
| 799 | iso_pu_bacteria | 2935984226 | 2935985844 | 182 |
| 800 | iso_pu_bacteria | 2936011229 | 2936016280 | 182 |
| 801 | iso_pu_bacteria | 2936019824 | 2936025072 | 182 |
| 802 | iso_pu_bacteria | 2936028420 | 2936033585 | 182 |
| 803 | iso_pu_bacteria | 2936046547 | 2936050983 | 182 |
| 804 | iso_pu_bacteria | 2936055302 | 2936057733 | 182 |
| 805 | iso_pu_bacteria | 8016522445 | 8016524574 | 182 |
| 806 | iso_pu_bacteria | 8016530956 | 8016538135 | 182 |
| 807 | iso_pu_bacteria | 8016539877 | 8016542413 | 182 |
| 808 | iso_pu_bacteria | 8016548790 | 8016550860 | 182 |
| 809 | iso_pu_bacteria | 8016557553 | 8016559273 | 182 |
| 810 | iso_pu_bacteria | 8016566248 | 8016567802 | 182 |
| 811 | iso_pu_bacteria | 8016575299 | 8016580492 | 182 |
| 812 | iso_pu_bacteria | 8016595262 | 8016597222 | 182 |
| 813 | iso_pu_bacteria | 8016603502 | 8016605044 | 182 |
| 814 | iso_pu_bacteria | 8016613128 | 8016619973 | 182 |
| 815 | iso_pu_bacteria | 8019530166 | 8019537807 | 182 |
| 816 | iso_pu_bacteria | 8019538911 | 8019539430 | 182 |
| 817 | iso_pu_bacteria | 8019547302 | 8019551210 | 182 |
| 818 | iso_pu_bacteria | 8019619141 | 8019624485 | 182 |
| 819 | iso_pu_bacteria | 8019629233 | 8019637559 | 182 |
| 820 | iso_pu_bacteria | 8019638758 | 8019642057 | 182 |
| 821 | iso_pu_bacteria | 8019659431 | 8019665487 | 182 |
| 822 | iso_pu_bacteria | 8019668869 | 8019675031 | 182 |
| 823 | iso_pu_bacteria | 8019687851 | 8019694653 | 182 |
| 824 | iso_pu_bacteria | 8056673599 | 8056675404 | 182 |
| 825 | iso_pu_bacteria | 2513237102 | 2513704266 | 183 |
| 826 | iso_pu_bacteria | 2513237139 | 2513875046 | 183 |
| 827 | iso_pu_bacteria | 2513237161 | 2514013883 | 183 |
| 828 | iso_pu_bacteria | 2524023205 | 2524439863 | 183 |
| 829 | iso_pu_bacteria | 2617270735 | 2617348388 | 183 |
| 830 | iso_pu_bacteria | 2744054633 | 2745075855 | 183 |
| 831 | iso_pu_bacteria | 2802429603 | 2805916364 | 183 |
| 832 | iso_pu_bacteria | 2824617872 | 2824626369 | 183 |
| 833 | iso_pu_bacteria | 2824626560 | 2824635098 | 183 |
| 834 | iso_pu_bacteria | 2824635225 | 2824643678 | 183 |
| 835 | iso_pu_bacteria | 2824644064 | 2824652258 | 183 |
| 836 | iso_pu_bacteria | 2824671348 | 2824679377 | 183 |
| 837 | iso_pu_bacteria | 2824687955 | 2824694515 | 183 |
| 838 | iso_pu_bacteria | 2824704595 | 2824713925 | 183 |
| 839 | iso_pu_bacteria | 2824714736 | 2824722816 | 183 |
| 840 | iso_pu_bacteria | 2824723954 | 2824732329 | 183 |
| 841 | iso_pu_bacteria | 2824753945 | 2824762927 | 183 |
| 842 | iso_pu_bacteria | 2824763712 | 2824772925 | 183 |
| 843 | iso_pu_bacteria | 2874612657 | 2874615279 | 183 |
| 844 | iso_pu_bacteria | 2881665667 | 2881668244 | 183 |
| 845 | iso_pu_bacteria | 2904666416 | 2904667032 | 183 |
| 846 | iso_pu_bacteria | 2904711408 | 2904719605 | 183 |
| 847 | iso_pu_bacteria | 3005506211 | 3005511108 | 183 |
| 848 | iso_pu_bacteria | 3005710791 | 3005712040 | 183 |
| 849 | iso_pu_bacteria | 8006964411 | 8006970054 | 183 |
| 850 | iso_pu_bacteria | 8016583857 | 8016588540 | 183 |
| 851 | iso_pu_bacteria | 2511231028 | 2511397227 | 184 |
| 852 | iso_pu_bacteria | 2513237094 | 2513641034 | 184 |
| 853 | iso_pu_bacteria | 2513237095 | 2513648443 | 184 |
| 854 | iso_pu_bacteria | 2513237104 | 2513716396 | 184 |
| 855 | iso_pu_bacteria | 2816332527 | 2818240025 | 184 |
| 856 | iso_pu_bacteria | 2824661429 | 2824671163 | 184 |
| 857 | iso_pu_bacteria | 2844315083 | 2844316465 | 184 |
| 858 | iso_pu_bacteria | 2857524615 | 2857525496 | 184 |
| 859 | iso_pu_bacteria | 2879099564 | 2879103028 | 184 |
| 860 | iso_pu_bacteria | 2888378607 | 2888387023 | 184 |
| 861 | iso_pu_bacteria | 2903727486 | 2903732346 | 184 |
| 862 | iso_pu_bacteria | 2906602504 | 2906606341 | 184 |
| 863 | iso_pu_bacteria | 2919073203 | 2919074694 | 184 |
| 864 | iso_pu_bacteria | 2922368715 | 2922377151 | 184 |
| 865 | iso_pu_bacteria | 2929615660 | 2929623555 | 184 |
| 866 | iso_pu_bacteria | 2929624759 | 2929632743 | 184 |
| 867 | iso_pu_bacteria | 2932784394 | 2932791404 | 184 |
| 868 | iso_pu_bacteria | 2932794094 | 2932795812 | 184 |
| 869 | iso_pu_bacteria | 2932801729 | 2932802050 | 184 |
| 870 | iso_pu_bacteria | 2932809354 | 2932814736 | 184 |
| 871 | iso_pu_bacteria | 2932818245 | 2932823594 | 184 |
| 872 | iso_pu_bacteria | 2932828146 | 2932833028 | 184 |
| 873 | iso_pu_bacteria | 2933577622 | 2933585458 | 184 |
| 874 | iso_pu_bacteria | 2935616580 | 2935623758 | 184 |
| 875 | iso_pu_bacteria | 2935638405 | 2935639530 | 184 |
| 876 | iso_pu_bacteria | 2935665750 | 2935670475 | 184 |
| 877 | iso_pu_bacteria | 2935675223 | 2935679904 | 184 |
| 878 | iso_pu_bacteria | 2935684952 | 2935687474 | 184 |
| 879 | iso_pu_bacteria | 2935694250 | 2935696556 | 184 |
| 880 | iso_pu_bacteria | 2935703347 | 2935705371 | 184 |
| 881 | iso_pu_bacteria | 2935713505 | 2935718933 | 184 |
| 882 | iso_pu_bacteria | 2935722832 | 2935728585 | 184 |
| 883 | iso_pu_bacteria | 2935732158 | 2935736818 | 184 |
| 884 | iso_pu_bacteria | 2935741537 | 2935746179 | 184 |
| 885 | iso_pu_bacteria | 2935750917 | 2935753440 | 184 |
| 886 | iso_pu_bacteria | 2935760218 | 2935767632 | 184 |
| 887 | iso_pu_bacteria | 2935801545 | 2935807114 | 184 |
| 888 | iso_pu_bacteria | 2935810662 | 2935813970 | 184 |
| 889 | iso_pu_bacteria | 2935827899 | 2935829013 | 184 |
| 890 | iso_pu_bacteria | 2935837841 | 2935844185 | 184 |
| 891 | iso_pu_bacteria | 2935855204 | 2935862017 | 184 |
| 892 | iso_pu_bacteria | 2935864058 | 2935871581 | 184 |
| 893 | iso_pu_bacteria | 2935873716 | 2935880308 | 184 |
| 894 | iso_pu_bacteria | 2935883170 | 2935886238 | 184 |
| 895 | iso_pu_bacteria | 2935959822 | 2935961431 | 184 |
| 896 | iso_pu_bacteria | 2935992306 | 2935996974 | 184 |
| 897 | iso_pu_bacteria | 2936002035 | 2936006010 | 184 |
| 898 | iso_pu_bacteria | 2936037263 | 2936039526 | 184 |
| 899 | iso_pu_bacteria | 2940556831 | 2940559353 | 184 |
| 900 | iso_pu_bacteria | 2941531003 | 2941536941 | 184 |
| 901 | iso_pu_bacteria | 2941538514 | 2941542048 | 184 |
| 902 | iso_pu_bacteria | 3005718088 | 3005719277 | 184 |
| 903 | iso_pu_bacteria | 8016511872 | 8016517021 | 184 |
| 904 | iso_pu_bacteria | 8017057580 | 8017059559 | 184 |
| 905 | iso_pu_bacteria | 8019576017 | 8019579028 | 184 |
| 906 | iso_pu_bacteria | 8019586578 | 8019597073 | 184 |
| 907 | iso_pu_bacteria | 8019597564 | 8019604610 | 184 |
| 908 | iso_pu_bacteria | 8019648815 | 8019650476 | 184 |
| 909 | iso_pu_bacteria | 8055742211 | 8055749715 | 184 |
| 910 | iso_pu_bacteria | 8056967851 | 8056973927 | 184 |
| 911 | iso_pu_bacteria | 2885374607 | 2885382918 | 186 |
| 912 | iso_pu_bacteria | 2513237137 | 2513859148 | 187 |
| 913 | iso_pu_bacteria | 2513237145 | 2513920543 | 187 |
| 914 | iso_pu_bacteria | 2517572143 | 2517887411 | 187 |
| 915 | iso_pu_bacteria | 2524023228 | 2524539247 | 187 |
| 916 | iso_pu_bacteria | 2667528175 | 2671120850 | 187 |
| 917 | iso_pu_bacteria | 2728368998 | 2728750789 | 187 |
| 918 | iso_pu_bacteria | 2791355197 | 2793072840 | 187 |
| 919 | iso_pu_bacteria | 2903748898 | 2903754089 | 187 |
| 920 | iso_pu_bacteria | 2904699407 | 2904707214 | 187 |
| 921 | iso_pu_bacteria | 2906635258 | 2906637132 | 187 |
| 922 | iso_pu_bacteria | 2906660503 | 2906663660 | 187 |
| 923 | iso_pu_bacteria | 2922425934 | 2922433114 | 187 |
| 924 | iso_pu_bacteria | 2941507105 | 2941507304 | 187 |
| 925 | iso_pu_bacteria | 2941515067 | 2941515731 | 187 |
| 926 | iso_pu_bacteria | 2941523033 | 2941523561 | 187 |
| 927 | iso_pu_bacteria | 8006933436 | 8006935002 | 187 |
| 928 | iso_pu_bacteria | 8006973647 | 8006974970 | 187 |
| 929 | iso_pu_bacteria | 8019555841 | 8019563655 | 187 |
| 930 | iso_pu_bacteria | 8019565922 | 8019573725 | 187 |
| 931 | 3300001989 | JGI24739J22299_10030012 | JGI24739J22299_100300122 | 196 |
| 932 | 3300001990 | JGI24737J22298_10016683 | JGI24737J22298_100166832 | 196 |
| 933 | 3300002067 | JGI24735J21928_10022236 | JGI24735J21928_100222362 | 196 |
| 934 | 3300005455 | Ga0070663_100076983 | Ga0070663_1000769834 | 196 |
| 935 | 3300005539 | Ga0068853_100015513 | Ga0068853_1000155135 | 196 |
| 936 | 3300005563 | Ga0068855_100026247 | Ga0068855_1000262472 | 196 |
| 937 | 3300005578 | Ga0068854_100002118 | Ga0068854_1000021185 | 196 |
| 938 | 3300005614 | Ga0068856_100207841 | Ga0068856_1002078412 | 196 |
| 939 | 3300009093 | Ga0105240_10031437 | Ga0105240_100314374 | 196 |
| 940 | 3300009545 | Ga0105237_10024587 | Ga0105237_100245875 | 196 |
| 941 | 3300009551 | Ga0105238_10012908 | Ga0105238_100129085 | 196 |
| 942 | 3300010375 | Ga0105239_10012010 | Ga0105239_100120105 | 196 |
| 943 | 3300025904 | Ga0207647_10002979 | Ga0207647_100029795 | 196 |
| 944 | 3300025913 | Ga0207695_10054187 | Ga0207695_100541872 | 196 |
| 945 | 3300025914 | Ga0207671_10068296 | Ga0207671_100682962 | 196 |
| 946 | 3300025924 | Ga0207694_10138458 | Ga0207694_101384582 | 196 |
| 947 | 3300025933 | Ga0207706_10060299 | Ga0207706_100602992 | 196 |
| 948 | 3300025949 | Ga0207667_10070617 | Ga0207667_100706173 | 196 |
| 949 | 3300025981 | Ga0207640_10001801 | Ga0207640_100018015 | 196 |
| 950 | 3300026067 | Ga0207678_10099266 | Ga0207678_100992664 | 196 |
| 951 | 3300026078 | Ga0207702_10010531 | Ga0207702_100105315 | 196 |
| 952 | 3300026142 | Ga0207698_10436902 | Ga0207698_104369022 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ii8-assembly1.cif.gz_B | anabaena sensory rhodopsin transducer | 0.7745 | 42 | 77 |
| 2ii8-assembly2.cif.gz_D | anabaena sensory rhodopsin transducer | 0.7738 | 42 | 77 |
| 2ii8-assembly2.cif.gz_C | anabaena sensory rhodopsin transducer | 0.7734 | 42 | 77 |
| 2ii9-assembly1.cif.gz_D | anabaena sensory rhodopsin transducer | 0.7693 | 42 | 77 |
| 2ii9-assembly1.cif.gz_C | anabaena sensory rhodopsin transducer | 0.769 | 42 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2huhA01 | Mainly Beta;Sandwich;Immunoglobulin-like;Smr-associated-like | 0.8589 | 42 | 94 | 2.60.40.1600 |
| af_Q0J2V2_44_153_2.60.40.3820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7977 | 39 | 94 | 2.60.40.3820 |
| 2ii7C00 | Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like | 0.7639 | 34 | 77 | 2.60.290.11 |
| 2qpfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.7282 | 37 | 89 | 2.60.40.180 |
| af_A4HYX0_89_181_2.60.40.1180 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7111 | 31 | 93 | 2.60.40.1180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V3WEC5-F1-model_v4 | Uncharacterized protein | 0.8853 | 36 | 93 |
|
| AF-A0A7Y2RHL9-F1-model_v4 | J domain-containing protein | 0.8797 | 36 | 97 |
GO:0016020
|
| AF-A0A521SXB0-F1-model_v4 | Uncharacterized protein | 0.8495 | 36 | 95 |
|
| AF-A0A7V6DD21-F1-model_v4 | Uncharacterized protein | 0.8495 | 33 | 93 |
GO:0016020
|
| AF-A0A2H5X6N7-F1-model_v4 | Uncharacterized protein | 0.844 | 33 | 93 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar