F486645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 953 | 395 | 1906 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10161179|Ga0065707_101611792 |
| Length | 179 |
| Sequence | MPVTISRRCAPPARRNWRAADLPRHSETRNLPYPPNQLFDLVADVPSYPEFLPWVAAVRVRSDSETEMVADLVVGFKALREHFTSKVNKERPSRIEVDYLDGPLKYLHNEWKFRPDDKGGTHVDFCVDFAFRSRLFEALAGQMFDKALRKMIGAFEQRAAMLYGPAESGISSSSAHSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 100 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 115 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 240 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 243 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 244 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 304 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 305 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 308 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 316 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 317 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 323 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 326 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 328 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 331 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 332 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 333 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 347 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 348 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 352 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 353 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 360 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 365 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 366 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 368 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 370 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 373 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 374 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 375 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 376 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 377 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 378 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 379 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 380 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 381 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 382 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 383 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 384 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 385 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 386 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 387 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 388 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 389 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 390 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 391 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 392 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 393 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 394 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 395 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0 |
| Endosphere | 11.54 |
| Nodule | 0 |
| Rhizoplane | 2.1 |
| Rhizosphere | 80.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10161179 | 3300005295 | Bacteria | 1562 |
| 2 | SwRhRL3b_contig_2210436 | 2162886006 | Bacteria | 1017 |
| 3 | SwRhRL2b_contig_2119227 | 2162886007 | Bacteria | 1087 |
| 4 | ARcpr5yngRDRAFT_c001224 | 3300000043 | Bacteria | 2887 |
| 5 | ARCol0yngRDRAFT_1002626 | 3300000652 | Bacteria | 1347 |
| 6 | JGI24741J21665_1000043 | 3300001915 | Bacteria | 30255 |
| 7 | JGI24740J21852_10003355 | 3300001979 | Bacteria | 7060 |
| 8 | JGI24740J21852_10038745 | 3300001979 | Bacteria | 1459 |
| 9 | JGI24739J22299_10006105 | 3300001989 | Bacteria | 4550 |
| 10 | JGI24739J22299_10027605 | 3300001989 | Bacteria | 1983 |
| 11 | JGI24739J22299_10032344 | 3300001989 | Bacteria | 1800 |
| 12 | JGI24739J22299_10100171 | 3300001989 | Bacteria | 875 |
| 13 | JGI24737J22298_10003105 | 3300001990 | Bacteria | 5886 |
| 14 | JGI24737J22298_10005112 | 3300001990 | Bacteria | 4541 |
| 15 | JGI24737J22298_10005425 | 3300001990 | Bacteria | 4405 |
| 16 | JGI24737J22298_10008735 | 3300001990 | Bacteria | 3383 |
| 17 | JGI24737J22298_10018638 | 3300001990 | Bacteria | 2226 |
| 18 | JGI24737J22298_10062163 | 3300001990 | Bacteria | 1122 |
| 19 | JGI24735J21928_10000815 | 3300002067 | Bacteria | 11084 |
| 20 | JGI24735J21928_10016266 | 3300002067 | Bacteria | 2311 |
| 21 | JGI24735J21928_10059358 | 3300002067 | Bacteria | 1100 |
| 22 | JGI24735J21928_10077089 | 3300002067 | Bacteria | 955 |
| 23 | JGI24748J21848_1000101 | 3300002074 | Bacteria | 19763 |
| 24 | JGI24738J21930_10000861 | 3300002075 | Bacteria | 8715 |
| 25 | JGI24738J21930_10001110 | 3300002075 | Bacteria | 7590 |
| 26 | JGI24738J21930_10028515 | 3300002075 | Bacteria | 1142 |
| 27 | JGI24738J21930_10048381 | 3300002075 | Bacteria | 866 |
| 28 | JGI24744J21845_10007970 | 3300002077 | Bacteria | 2187 |
| 29 | JGI24034J26672_10000034 | 3300002239 | Bacteria | 85929 |
| 30 | JGI24742J22300_10021369 | 3300002244 | Bacteria | 1105 |
| 31 | JGI24742J22300_10026632 | 3300002244 | Bacteria | 1000 |
| 32 | JGI24751J29686_10000002 | 3300002459 | Bacteria | 160619 |
| 33 | JGI24751J29686_10004995 | 3300002459 | Bacteria | 2704 |
| 34 | JGI24751J29686_10020488 | 3300002459 | Bacteria | 1369 |
| 35 | JGI25157J39369_1033069 | 3300002741 | Bacteria | 586 |
| 36 | JGI25164J39214_1018615 | 3300002772 | Bacteria | 621 |
| 37 | JGI25165J46597_1000032 | 3300003214 | Bacteria | 294371 |
| 38 | JGI25165J46597_1000145 | 3300003214 | Bacteria | 116948 |
| 39 | JGI25153J46596_10000044 | 3300003215 | Bacteria | 154263 |
| 40 | Ga0055542_1004873 | 3300003762 | Bacteria | 3139 |
| 41 | Ga0055529_1010095 | 3300003763 | Bacteria | 1231 |
| 42 | Ga0055537_1000874 | 3300003773 | Bacteria | 14424 |
| 43 | Ga0055524_1000088 | 3300003775 | Bacteria | 116065 |
| 44 | Ga0055530_10007014 | 3300003791 | Bacteria | 4853 |
| 45 | Ga0055530_10008160 | 3300003791 | Bacteria | 4245 |
| 46 | Ga0055530_10024363 | 3300003791 | Bacteria | 1717 |
| 47 | Ga0055530_10027381 | 3300003791 | Bacteria | 1558 |
| 48 | Ga0055540_1000717 | 3300003792 | Bacteria | 22584 |
| 49 | Ga0055531_10000016 | 3300003794 | Bacteria | 181898 |
| 50 | Ga0055531_10008252 | 3300003794 | Bacteria | 5537 |
| 51 | Ga0055531_10035079 | 3300003794 | Bacteria | 1578 |
| 52 | Ga0055531_10035325 | 3300003794 | Bacteria | 1566 |
| 53 | Ga0065165_1013352 | 3300005262 | Bacteria | 3272 |
| 54 | Ga0065704_10077336 | 3300005289 | Bacteria | 4767 |
| 55 | Ga0065715_10515292 | 3300005293 | Bacteria | 768 |
| 56 | Ga0065707_10082081 | 3300005295 | Bacteria | 22507 |
| 57 | Ga0065707_10084130 | 3300005295 | Bacteria | 7653 |
| 58 | Ga0065707_10096263 | 3300005295 | Bacteria | 3278 |
| 59 | Ga0070658_10000082 | 3300005327 | Bacteria | 89656 |
| 60 | Ga0070658_10001506 | 3300005327 | Bacteria | 19773 |
| 61 | Ga0070658_10022691 | 3300005327 | Bacteria | 5037 |
| 62 | Ga0070658_10117346 | 3300005327 | Bacteria | 2209 |
| 63 | Ga0070658_10376777 | 3300005327 | Bacteria | 1217 |
| 64 | Ga0070658_10584034 | 3300005327 | Bacteria | 968 |
| 65 | Ga0070683_100049857 | 3300005329 | Bacteria | 3874 |
| 66 | Ga0070690_100000068 | 3300005330 | Bacteria | 51626 |
| 67 | Ga0070670_100000012 | 3300005331 | Bacteria | 256314 |
| 68 | Ga0070670_100000051 | 3300005331 | Bacteria | 131351 |
| 69 | Ga0070670_100002503 | 3300005331 | Bacteria | 15155 |
| 70 | Ga0070670_100004838 | 3300005331 | Bacteria | 11321 |
| 71 | Ga0070670_100116842 | 3300005331 | Bacteria | 2300 |
| 72 | Ga0070677_10001096 | 3300005333 | Bacteria | 8710 |
| 73 | Ga0068869_100000810 | 3300005334 | Bacteria | 17866 |
| 74 | Ga0068869_100591822 | 3300005334 | Bacteria | 936 |
| 75 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 76 | Ga0070666_10000092 | 3300005335 | Bacteria | 62551 |
| 77 | Ga0070666_10183511 | 3300005335 | Bacteria | 1468 |
| 78 | Ga0070666_10370574 | 3300005335 | Bacteria | 1027 |
| 79 | Ga0070666_10374802 | 3300005335 | Bacteria | 1021 |
| 80 | Ga0070682_100311945 | 3300005337 | Bacteria | 1158 |
| 81 | Ga0068868_100000407 | 3300005338 | Bacteria | 29079 |
| 82 | Ga0070660_100000401 | 3300005339 | Bacteria | 28844 |
| 83 | Ga0070660_100097373 | 3300005339 | Bacteria | 2327 |
| 84 | Ga0070660_100191217 | 3300005339 | Bacteria | 1658 |
| 85 | Ga0070660_100896023 | 3300005339 | Bacteria | 748 |
| 86 | Ga0070661_100506926 | 3300005344 | Bacteria | 966 |
| 87 | Ga0070661_100886762 | 3300005344 | Bacteria | 736 |
| 88 | Ga0070692_10038481 | 3300005345 | Bacteria | 2438 |
| 89 | Ga0070668_100000004 | 3300005347 | Bacteria | 189408 |
| 90 | Ga0070668_100000010 | 3300005347 | Bacteria | 132833 |
| 91 | Ga0070668_100000330 | 3300005347 | Bacteria | 31137 |
| 92 | Ga0070668_100046239 | 3300005347 | Bacteria | 3341 |
| 93 | Ga0070668_100295574 | 3300005347 | Bacteria | 1357 |
| 94 | Ga0070668_100427499 | 3300005347 | Bacteria | 1135 |
| 95 | Ga0070668_100443237 | 3300005347 | Bacteria | 1115 |
| 96 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 97 | Ga0070669_100000041 | 3300005353 | Bacteria | 127426 |
| 98 | Ga0070669_100000229 | 3300005353 | Bacteria | 46742 |
| 99 | Ga0070669_100010582 | 3300005353 | Bacteria | 6550 |
| 100 | Ga0070669_100073089 | 3300005353 | Bacteria | 2540 |
| 101 | Ga0070669_100098905 | 3300005353 | Bacteria | 2198 |
| 102 | Ga0070669_101130528 | 3300005353 | Bacteria | 675 |
| 103 | Ga0070675_101380096 | 3300005354 | Bacteria | 650 |
| 104 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 105 | Ga0070671_100000014 | 3300005355 | Bacteria | 167986 |
| 106 | Ga0070671_100000136 | 3300005355 | Bacteria | 47367 |
| 107 | Ga0070671_100015156 | 3300005355 | Bacteria | 6227 |
| 108 | Ga0070671_100024929 | 3300005355 | Bacteria | 4901 |
| 109 | Ga0070674_100066686 | 3300005356 | Bacteria | 2530 |
| 110 | Ga0070674_100601912 | 3300005356 | Bacteria | 929 |
| 111 | Ga0070673_100000476 | 3300005364 | Bacteria | 21296 |
| 112 | Ga0070673_100403754 | 3300005364 | Bacteria | 1222 |
| 113 | Ga0070688_100002373 | 3300005365 | Bacteria | 9509 |
| 114 | Ga0070659_100035817 | 3300005366 | Bacteria | 3866 |
| 115 | Ga0070659_100141149 | 3300005366 | Bacteria | 1961 |
| 116 | Ga0070667_100000013 | 3300005367 | Bacteria | 255674 |
| 117 | Ga0070667_100000037 | 3300005367 | Bacteria | 172343 |
| 118 | Ga0070667_100000418 | 3300005367 | Bacteria | 45252 |
| 119 | Ga0070667_100004971 | 3300005367 | Bacteria | 11140 |
| 120 | Ga0070667_100070948 | 3300005367 | Bacteria | 2966 |
| 121 | Ga0070667_100889138 | 3300005367 | Bacteria | 829 |
| 122 | Ga0070705_100006873 | 3300005440 | Bacteria | 5591 |
| 123 | Ga0070663_100001318 | 3300005455 | Bacteria | 13580 |
| 124 | Ga0070663_100042668 | 3300005455 | Bacteria | 3188 |
| 125 | Ga0070663_100163445 | 3300005455 | Bacteria | 1715 |
| 126 | Ga0070678_100024521 | 3300005456 | Bacteria | 4041 |
| 127 | Ga0070678_100727272 | 3300005456 | Bacteria | 896 |
| 128 | Ga0070662_100310950 | 3300005457 | Bacteria | 1283 |
| 129 | Ga0070662_100418223 | 3300005457 | Bacteria | 1108 |
| 130 | Ga0070662_100508094 | 3300005457 | Bacteria | 1006 |
| 131 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 132 | Ga0070685_10000337 | 3300005466 | Bacteria | 28829 |
| 133 | Ga0070698_101147047 | 3300005471 | Bacteria | 726 |
| 134 | Ga0068853_100052401 | 3300005539 | Bacteria | 3515 |
| 135 | Ga0068853_100090889 | 3300005539 | Bacteria | 2684 |
| 136 | Ga0068853_100145477 | 3300005539 | Bacteria | 2130 |
| 137 | Ga0068853_100433929 | 3300005539 | Bacteria | 1234 |
| 138 | Ga0068853_100467657 | 3300005539 | Bacteria | 1187 |
| 139 | Ga0070672_100036776 | 3300005543 | Bacteria | 3733 |
| 140 | Ga0070672_100152509 | 3300005543 | Bacteria | 1912 |
| 141 | Ga0070672_100395991 | 3300005543 | Bacteria | 1183 |
| 142 | Ga0070672_101306826 | 3300005543 | Bacteria | 648 |
| 143 | Ga0070686_100000003 | 3300005544 | Bacteria | 308397 |
| 144 | Ga0070686_100002775 | 3300005544 | Bacteria | 9645 |
| 145 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 146 | Ga0070665_100000054 | 3300005548 | Bacteria | 244426 |
| 147 | Ga0070665_100001022 | 3300005548 | Bacteria | 35129 |
| 148 | Ga0070665_100030492 | 3300005548 | Bacteria | 5425 |
| 149 | Ga0068855_100001528 | 3300005563 | Bacteria | 29013 |
| 150 | Ga0068855_100615771 | 3300005563 | Bacteria | 1169 |
| 151 | Ga0068855_101240129 | 3300005563 | Bacteria | 774 |
| 152 | Ga0070664_100079213 | 3300005564 | Bacteria | 2827 |
| 153 | Ga0070664_100162682 | 3300005564 | Bacteria | 1975 |
| 154 | Ga0068857_100023152 | 3300005577 | Bacteria | 5465 |
| 155 | Ga0068857_100028662 | 3300005577 | Bacteria | 4913 |
| 156 | Ga0068857_100369753 | 3300005577 | Bacteria | 1330 |
| 157 | Ga0068857_100462268 | 3300005577 | Bacteria | 1188 |
| 158 | Ga0068857_100509124 | 3300005577 | Bacteria | 1130 |
| 159 | Ga0068857_101032563 | 3300005577 | Bacteria | 792 |
| 160 | Ga0068854_100000752 | 3300005578 | Bacteria | 19177 |
| 161 | Ga0068854_100005589 | 3300005578 | Bacteria | 7943 |
| 162 | Ga0068854_100146281 | 3300005578 | Bacteria | 1818 |
| 163 | Ga0068854_100663389 | 3300005578 | Bacteria | 897 |
| 164 | Ga0068856_100023608 | 3300005614 | Bacteria | 5980 |
| 165 | Ga0068856_100043123 | 3300005614 | Bacteria | 4439 |
| 166 | Ga0068856_100131386 | 3300005614 | Bacteria | 2508 |
| 167 | Ga0068852_100001463 | 3300005616 | Bacteria | 15964 |
| 168 | Ga0068852_100928977 | 3300005616 | Bacteria | 888 |
| 169 | Ga0068859_100000805 | 3300005617 | Bacteria | 31840 |
| 170 | Ga0068859_100005780 | 3300005617 | Bacteria | 12567 |
| 171 | Ga0068859_100007191 | 3300005617 | Bacteria | 11298 |
| 172 | Ga0068859_100015597 | 3300005617 | Bacteria | 7635 |
| 173 | Ga0068859_100016795 | 3300005617 | Bacteria | 7350 |
| 174 | Ga0068859_100435092 | 3300005617 | Bacteria | 1408 |
| 175 | Ga0068859_100878436 | 3300005617 | Bacteria | 982 |
| 176 | Ga0068859_101025050 | 3300005617 | Bacteria | 907 |
| 177 | Ga0068859_101169205 | 3300005617 | Bacteria | 847 |
| 178 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 179 | Ga0068864_100000010 | 3300005618 | Bacteria | 358723 |
| 180 | Ga0068864_100000403 | 3300005618 | Bacteria | 37462 |
| 181 | Ga0068864_100002670 | 3300005618 | Bacteria | 14735 |
| 182 | Ga0068864_100011361 | 3300005618 | Bacteria | 7359 |
| 183 | Ga0068864_100367328 | 3300005618 | Bacteria | 1361 |
| 184 | Ga0068866_10482294 | 3300005718 | Bacteria | 817 |
| 185 | Ga0068861_100000367 | 3300005719 | Bacteria | 25902 |
| 186 | Ga0068861_100001727 | 3300005719 | Bacteria | 14012 |
| 187 | Ga0068861_100022984 | 3300005719 | Bacteria | 4496 |
| 188 | Ga0068861_100107803 | 3300005719 | Bacteria | 2227 |
| 189 | Ga0068851_10015546 | 3300005834 | Bacteria | 3627 |
| 190 | Ga0068851_10029450 | 3300005834 | Bacteria | 2718 |
| 191 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 192 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 193 | Ga0068863_100000034 | 3300005841 | Bacteria | 168359 |
| 194 | Ga0068863_100000192 | 3300005841 | Bacteria | 64858 |
| 195 | Ga0068863_100005416 | 3300005841 | Bacteria | 12576 |
| 196 | Ga0068863_100008282 | 3300005841 | Bacteria | 10159 |
| 197 | Ga0068863_100008897 | 3300005841 | Bacteria | 9805 |
| 198 | Ga0068863_100032685 | 3300005841 | Bacteria | 4958 |
| 199 | Ga0068863_101120545 | 3300005841 | Bacteria | 792 |
| 200 | Ga0068858_100001988 | 3300005842 | Bacteria | 20899 |
| 201 | Ga0068858_100002719 | 3300005842 | Bacteria | 17826 |
| 202 | Ga0068858_100006177 | 3300005842 | Bacteria | 11684 |
| 203 | Ga0068858_100006359 | 3300005842 | Bacteria | 11503 |
| 204 | Ga0068858_100010198 | 3300005842 | Bacteria | 8917 |
| 205 | Ga0068858_100692600 | 3300005842 | Bacteria | 991 |
| 206 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 207 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 208 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 209 | Ga0068860_100001343 | 3300005843 | Bacteria | 26758 |
| 210 | Ga0068860_100012019 | 3300005843 | Bacteria | 8528 |
| 211 | Ga0068860_100050733 | 3300005843 | Bacteria | 3949 |
| 212 | Ga0068860_100056693 | 3300005843 | Bacteria | 3724 |
| 213 | Ga0068860_100234850 | 3300005843 | Bacteria | 1782 |
| 214 | Ga0068860_100400906 | 3300005843 | Bacteria | 1357 |
| 215 | Ga0068860_100433271 | 3300005843 | Bacteria | 1305 |
| 216 | Ga0068860_100727545 | 3300005843 | Bacteria | 1003 |
| 217 | Ga0068860_101352587 | 3300005843 | Bacteria | 733 |
| 218 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 219 | Ga0068862_100000016 | 3300005844 | Bacteria | 250031 |
| 220 | Ga0068862_100000280 | 3300005844 | Bacteria | 56780 |
| 221 | Ga0068862_100001230 | 3300005844 | Bacteria | 24152 |
| 222 | Ga0068862_100002391 | 3300005844 | Bacteria | 16687 |
| 223 | Ga0068862_100002643 | 3300005844 | Bacteria | 15772 |
| 224 | Ga0068862_101044601 | 3300005844 | Bacteria | 810 |
| 225 | Ga0081455_10002896 | 3300005937 | Bacteria | 20153 |
| 226 | Ga0075363_100101922 | 3300006048 | Bacteria | 1589 |
| 227 | Ga0075367_10000022 | 3300006178 | Bacteria | 33901 |
| 228 | Ga0075366_10011245 | 3300006195 | Bacteria | 5051 |
| 229 | Ga0075366_10395081 | 3300006195 | Bacteria | 851 |
| 230 | Ga0097621_100280401 | 3300006237 | Bacteria | 1467 |
| 231 | Ga0075370_10126490 | 3300006353 | Bacteria | 1490 |
| 232 | Ga0068871_100263974 | 3300006358 | Bacteria | 1502 |
| 233 | Ga0068865_100000659 | 3300006881 | Bacteria | 19500 |
| 234 | Ga0097620_100000805 | 3300006931 | Bacteria | 31840 |
| 235 | Ga0097620_100005780 | 3300006931 | Bacteria | 12567 |
| 236 | Ga0097620_100007191 | 3300006931 | Bacteria | 11298 |
| 237 | Ga0097620_100015597 | 3300006931 | Bacteria | 7635 |
| 238 | Ga0097620_100016795 | 3300006931 | Bacteria | 7350 |
| 239 | Ga0097620_100435110 | 3300006931 | Bacteria | 1408 |
| 240 | Ga0097620_100878340 | 3300006931 | Bacteria | 982 |
| 241 | Ga0097620_101024875 | 3300006931 | Bacteria | 907 |
| 242 | Ga0097620_101169055 | 3300006931 | Bacteria | 847 |
| 243 | Ga0105251_10000318 | 3300009011 | Bacteria | 48256 |
| 244 | Ga0105251_10032111 | 3300009011 | Bacteria | 2620 |
| 245 | Ga0105251_10053937 | 3300009011 | Bacteria | 1910 |
| 246 | Ga0105250_10235011 | 3300009092 | Bacteria | 780 |
| 247 | Ga0105240_10178147 | 3300009093 | Bacteria | 2511 |
| 248 | Ga0105240_10179382 | 3300009093 | Bacteria | 2501 |
| 249 | Ga0111539_10287142 | 3300009094 | Bacteria | 1914 |
| 250 | Ga0105245_10000509 | 3300009098 | Bacteria | 35710 |
| 251 | Ga0105245_10000910 | 3300009098 | Bacteria | 26901 |
| 252 | Ga0105245_11920801 | 3300009098 | Bacteria | 645 |
| 253 | Ga0105247_10004644 | 3300009101 | Bacteria | 8755 |
| 254 | Ga0105247_10025107 | 3300009101 | Bacteria | 3596 |
| 255 | Ga0105247_10050538 | 3300009101 | Bacteria | 2558 |
| 256 | Ga0105247_10386331 | 3300009101 | Bacteria | 994 |
| 257 | Ga0105247_10557647 | 3300009101 | Bacteria | 843 |
| 258 | Ga0105243_10000042 | 3300009148 | Bacteria | 159276 |
| 259 | Ga0105243_10246949 | 3300009148 | Bacteria | 1591 |
| 260 | Ga0105243_11310688 | 3300009148 | Bacteria | 742 |
| 261 | Ga0105241_10007217 | 3300009174 | Bacteria | 8180 |
| 262 | Ga0105241_10174237 | 3300009174 | Bacteria | 1779 |
| 263 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 264 | Ga0105248_10000053 | 3300009177 | Bacteria | 143972 |
| 265 | Ga0105248_10043510 | 3300009177 | Bacteria | 5035 |
| 266 | Ga0105248_10113344 | 3300009177 | Bacteria | 3058 |
| 267 | Ga0105248_10150901 | 3300009177 | Bacteria | 2622 |
| 268 | Ga0105248_10301083 | 3300009177 | Bacteria | 1805 |
| 269 | Ga0105237_10046212 | 3300009545 | Bacteria | 4379 |
| 270 | Ga0105237_10236734 | 3300009545 | Bacteria | 1827 |
| 271 | Ga0105237_10299721 | 3300009545 | Bacteria | 1611 |
| 272 | Ga0105238_10036032 | 3300009551 | Bacteria | 5029 |
| 273 | Ga0105238_10094707 | 3300009551 | Bacteria | 2974 |
| 274 | Ga0105238_10873275 | 3300009551 | Bacteria | 917 |
| 275 | Ga0105238_11446930 | 3300009551 | Bacteria | 715 |
| 276 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 277 | Ga0105249_10000041 | 3300009553 | Bacteria | 195999 |
| 278 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 279 | Ga0105249_10000748 | 3300009553 | Bacteria | 29239 |
| 280 | Ga0105249_10021968 | 3300009553 | Bacteria | 5714 |
| 281 | Ga0105249_10382895 | 3300009553 | Bacteria | 1433 |
| 282 | Ga0105249_10991245 | 3300009553 | Bacteria | 909 |
| 283 | Ga0105148_100050 | 3300009978 | Bacteria | 18144 |
| 284 | Ga0105147_102029 | 3300009982 | Bacteria | 1660 |
| 285 | Ga0105239_10014230 | 3300010375 | Bacteria | 8830 |
| 286 | Ga0105239_10363538 | 3300010375 | Bacteria | 1635 |
| 287 | Ga0105239_10392896 | 3300010375 | Bacteria | 1569 |
| 288 | Ga0105239_10472846 | 3300010375 | Bacteria | 1423 |
| 289 | Ga0157373_10047705 | 3300013100 | Bacteria | 3054 |
| 290 | Ga0157373_10069176 | 3300013100 | Bacteria | 2496 |
| 291 | Ga0157373_10148658 | 3300013100 | Bacteria | 1648 |
| 292 | Ga0157373_11083039 | 3300013100 | Bacteria | 601 |
| 293 | Ga0157371_10357376 | 3300013102 | Bacteria | 1064 |
| 294 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 295 | Ga0157370_10055343 | 3300013104 | Bacteria | 3780 |
| 296 | Ga0157370_10444763 | 3300013104 | Bacteria | 1192 |
| 297 | Ga0157369_10003976 | 3300013105 | Bacteria | 17529 |
| 298 | Ga0157369_10017785 | 3300013105 | Bacteria | 7981 |
| 299 | Ga0157369_10252353 | 3300013105 | Bacteria | 1841 |
| 300 | Ga0157369_10530230 | 3300013105 | Bacteria | 1218 |
| 301 | Ga0157378_10016100 | 3300013297 | Bacteria | 6547 |
| 302 | Ga0157378_10331163 | 3300013297 | Bacteria | 1482 |
| 303 | Ga0163162_10004388 | 3300013306 | Bacteria | 13573 |
| 304 | Ga0163162_10129721 | 3300013306 | Bacteria | 2629 |
| 305 | Ga0163162_10166387 | 3300013306 | Bacteria | 2329 |
| 306 | Ga0163162_10297164 | 3300013306 | Bacteria | 1746 |
| 307 | Ga0163162_10422078 | 3300013306 | Bacteria | 1466 |
| 308 | Ga0163162_10622720 | 3300013306 | Bacteria | 1204 |
| 309 | Ga0157372_10193166 | 3300013307 | Bacteria | 2358 |
| 310 | Ga0157372_10286770 | 3300013307 | Bacteria | 1915 |
| 311 | Ga0157372_10307967 | 3300013307 | Bacteria | 1843 |
| 312 | Ga0163163_10011243 | 3300014325 | Bacteria | 8112 |
| 313 | Ga0163163_10013186 | 3300014325 | Bacteria | 7554 |
| 314 | Ga0163163_10312735 | 3300014325 | Bacteria | 1624 |
| 315 | Ga0157380_10000134 | 3300014326 | Bacteria | 41479 |
| 316 | Ga0157380_10001682 | 3300014326 | Bacteria | 14612 |
| 317 | Ga0157380_10001822 | 3300014326 | Bacteria | 14075 |
| 318 | Ga0157380_10010225 | 3300014326 | Bacteria | 6742 |
| 319 | Ga0157380_10047718 | 3300014326 | Bacteria | 3370 |
| 320 | Ga0157377_10998009 | 3300014745 | Bacteria | 634 |
| 321 | Ga0157379_10010407 | 3300014968 | Bacteria | 8105 |
| 322 | Ga0157379_10013413 | 3300014968 | Bacteria | 7178 |
| 323 | Ga0157379_10218739 | 3300014968 | Bacteria | 1726 |
| 324 | Ga0157379_10635052 | 3300014968 | Bacteria | 999 |
| 325 | Ga0157376_10000102 | 3300014969 | Bacteria | 62110 |
| 326 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 327 | Ga0183361_10475 | 3300016635 | Bacteria | 1748 |
| 328 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 329 | Ga0163161_10089708 | 3300017792 | Bacteria | 2274 |
| 330 | Ga0163161_10400572 | 3300017792 | Bacteria | 1100 |
| 331 | Ga0163161_10583178 | 3300017792 | Bacteria | 920 |
| 332 | Ga0163161_10657667 | 3300017792 | Bacteria | 869 |
| 333 | Ga0206356_11184316 | 3300020070 | Bacteria | 657 |
| 334 | Ga0213874_10031269 | 3300021377 | Bacteria | 1540 |
| 335 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 336 | Ga0213876_10010152 | 3300021384 | Bacteria | 5059 |
| 337 | Ga0213876_10052351 | 3300021384 | Bacteria | 2158 |
| 338 | Ga0207672_1000928 | 3300025223 | Bacteria | 2887 |
| 339 | Ga0209147_102362 | 3300025229 | Bacteria | 4796 |
| 340 | Ga0207427_101178 | 3300025231 | Bacteria | 10217 |
| 341 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 342 | Ga0207425_1005446 | 3300025245 | Bacteria | 3628 |
| 343 | Ga0209026_1003126 | 3300025250 | Bacteria | 5640 |
| 344 | Ga0209148_1000338 | 3300025254 | Bacteria | 62960 |
| 345 | Ga0209148_1001156 | 3300025254 | Bacteria | 15345 |
| 346 | Ga0209129_1001922 | 3300025258 | Bacteria | 10907 |
| 347 | Ga0209233_1000066 | 3300025261 | Bacteria | 381218 |
| 348 | Ga0209233_1000207 | 3300025261 | Bacteria | 117152 |
| 349 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 350 | Ga0209565_1000064 | 3300025263 | Bacteria | 180732 |
| 351 | Ga0209455_1001029 | 3300025272 | Bacteria | 13882 |
| 352 | Ga0209455_1018015 | 3300025272 | Bacteria | 1462 |
| 353 | Ga0209455_1031397 | 3300025272 | Bacteria | 893 |
| 354 | Ga0209673_1002611 | 3300025273 | Bacteria | 12108 |
| 355 | Ga0209675_1011012 | 3300025291 | Bacteria | 3033 |
| 356 | Ga0209676_1008246 | 3300025292 | Bacteria | 4687 |
| 357 | Ga0209025_1000551 | 3300025294 | Bacteria | 69956 |
| 358 | Ga0209564_1003529 | 3300025295 | Bacteria | 10551 |
| 359 | Ga0209564_1018595 | 3300025295 | Bacteria | 2640 |
| 360 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 361 | Ga0209758_1002673 | 3300025297 | Bacteria | 17608 |
| 362 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 363 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 364 | Ga0209050_1002186 | 3300025298 | Bacteria | 17647 |
| 365 | Ga0209050_1011661 | 3300025298 | Bacteria | 4136 |
| 366 | Ga0209050_1032649 | 3300025298 | Bacteria | 1597 |
| 367 | Ga0209256_1000034 | 3300025299 | Bacteria | 388475 |
| 368 | Ga0207426_1014974 | 3300025302 | Bacteria | 2830 |
| 369 | Ga0209051_1001333 | 3300025303 | Bacteria | 21480 |
| 370 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 371 | Ga0209257_1003053 | 3300025304 | Bacteria | 15086 |
| 372 | Ga0209257_1005333 | 3300025304 | Bacteria | 9104 |
| 373 | Ga0209257_1033094 | 3300025304 | Bacteria | 1630 |
| 374 | Ga0207697_10001015 | 3300025315 | Bacteria | 15714 |
| 375 | Ga0207656_10010757 | 3300025321 | Bacteria | 3438 |
| 376 | Ga0207656_10065292 | 3300025321 | Bacteria | 1606 |
| 377 | Ga0207713_1006739 | 3300025735 | Bacteria | 6935 |
| 378 | Ga0207682_10000992 | 3300025893 | Bacteria | 13115 |
| 379 | Ga0207642_10283774 | 3300025899 | Bacteria | 953 |
| 380 | Ga0207710_10084334 | 3300025900 | Bacteria | 1478 |
| 381 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 382 | Ga0207680_10003517 | 3300025903 | Bacteria | 7371 |
| 383 | Ga0207680_10106744 | 3300025903 | Bacteria | 1809 |
| 384 | Ga0207680_10128707 | 3300025903 | Bacteria | 1666 |
| 385 | Ga0207680_10142662 | 3300025903 | Bacteria | 1589 |
| 386 | Ga0207680_10273218 | 3300025903 | Bacteria | 1173 |
| 387 | Ga0207647_10000839 | 3300025904 | Bacteria | 23869 |
| 388 | Ga0207647_10001182 | 3300025904 | Bacteria | 20104 |
| 389 | Ga0207647_10008705 | 3300025904 | Bacteria | 7249 |
| 390 | Ga0207647_10106379 | 3300025904 | Bacteria | 1661 |
| 391 | Ga0207647_10172401 | 3300025904 | Bacteria | 1259 |
| 392 | Ga0207645_10002769 | 3300025907 | Bacteria | 13642 |
| 393 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 394 | Ga0207705_10000915 | 3300025909 | Bacteria | 24186 |
| 395 | Ga0207705_10004780 | 3300025909 | Bacteria | 10199 |
| 396 | Ga0207705_10311488 | 3300025909 | Bacteria | 1208 |
| 397 | Ga0207705_10582636 | 3300025909 | Bacteria | 870 |
| 398 | Ga0207654_10021273 | 3300025911 | Bacteria | 3448 |
| 399 | Ga0207654_10048248 | 3300025911 | Bacteria | 2436 |
| 400 | Ga0207654_10122914 | 3300025911 | Bacteria | 1632 |
| 401 | Ga0207695_10005452 | 3300025913 | Bacteria | 16856 |
| 402 | Ga0207695_10013577 | 3300025913 | Bacteria | 9701 |
| 403 | Ga0207695_10227937 | 3300025913 | Bacteria | 1768 |
| 404 | Ga0207695_11347990 | 3300025913 | Bacteria | 594 |
| 405 | Ga0207671_10002604 | 3300025914 | Bacteria | 19053 |
| 406 | Ga0207671_10118564 | 3300025914 | Bacteria | 2021 |
| 407 | Ga0207660_10916929 | 3300025917 | Bacteria | 715 |
| 408 | Ga0207657_10001109 | 3300025919 | Bacteria | 28595 |
| 409 | Ga0207657_10002470 | 3300025919 | Bacteria | 19999 |
| 410 | Ga0207657_10037177 | 3300025919 | Bacteria | 4352 |
| 411 | Ga0207657_10046474 | 3300025919 | Bacteria | 3802 |
| 412 | Ga0207657_10057152 | 3300025919 | Bacteria | 3364 |
| 413 | Ga0207657_10138328 | 3300025919 | Bacteria | 1991 |
| 414 | Ga0207657_10301401 | 3300025919 | Bacteria | 1269 |
| 415 | Ga0207649_10120586 | 3300025920 | Bacteria | 1767 |
| 416 | Ga0207649_10649026 | 3300025920 | Bacteria | 815 |
| 417 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 418 | Ga0207681_10000013 | 3300025923 | Bacteria | 357411 |
| 419 | Ga0207681_10000178 | 3300025923 | Bacteria | 52013 |
| 420 | Ga0207681_10024610 | 3300025923 | Bacteria | 3865 |
| 421 | Ga0207681_10034761 | 3300025923 | Bacteria | 3316 |
| 422 | Ga0207681_10047884 | 3300025923 | Bacteria | 2883 |
| 423 | Ga0207681_10163401 | 3300025923 | Bacteria | 1681 |
| 424 | Ga0207681_10982933 | 3300025923 | Bacteria | 708 |
| 425 | Ga0207694_10001135 | 3300025924 | Bacteria | 23053 |
| 426 | Ga0207694_10042400 | 3300025924 | Bacteria | 3510 |
| 427 | Ga0207694_10236334 | 3300025924 | Bacteria | 1493 |
| 428 | Ga0207694_10321454 | 3300025924 | Bacteria | 1277 |
| 429 | Ga0207694_10474218 | 3300025924 | Bacteria | 1046 |
| 430 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 431 | Ga0207650_10000083 | 3300025925 | Bacteria | 127270 |
| 432 | Ga0207650_10001666 | 3300025925 | Bacteria | 15824 |
| 433 | Ga0207650_10007720 | 3300025925 | Bacteria | 7331 |
| 434 | Ga0207659_10020945 | 3300025926 | Bacteria | 4331 |
| 435 | Ga0207659_10616645 | 3300025926 | Bacteria | 926 |
| 436 | Ga0207687_10000877 | 3300025927 | Bacteria | 20366 |
| 437 | Ga0207687_10005573 | 3300025927 | Bacteria | 8317 |
| 438 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 439 | Ga0207644_10000030 | 3300025931 | Bacteria | 136272 |
| 440 | Ga0207644_10000046 | 3300025931 | Bacteria | 103962 |
| 441 | Ga0207644_10000570 | 3300025931 | Bacteria | 23662 |
| 442 | Ga0207644_10004648 | 3300025931 | Bacteria | 8925 |
| 443 | Ga0207644_10057001 | 3300025931 | Bacteria | 2820 |
| 444 | Ga0207644_10149696 | 3300025931 | Bacteria | 1805 |
| 445 | Ga0207690_10172008 | 3300025932 | Bacteria | 1624 |
| 446 | Ga0207690_10195570 | 3300025932 | Bacteria | 1532 |
| 447 | Ga0207690_10284841 | 3300025932 | Bacteria | 1288 |
| 448 | Ga0207690_10433939 | 3300025932 | Bacteria | 1053 |
| 449 | Ga0207690_11101010 | 3300025932 | Bacteria | 662 |
| 450 | Ga0207706_10003238 | 3300025933 | Bacteria | 15605 |
| 451 | Ga0207706_10005292 | 3300025933 | Bacteria | 12029 |
| 452 | Ga0207706_10020074 | 3300025933 | Bacteria | 6004 |
| 453 | Ga0207706_10051297 | 3300025933 | Bacteria | 3643 |
| 454 | Ga0207706_10372936 | 3300025933 | Bacteria | 1239 |
| 455 | Ga0207706_10439719 | 3300025933 | Bacteria | 1129 |
| 456 | Ga0207706_10524235 | 3300025933 | Bacteria | 1021 |
| 457 | Ga0207686_10025934 | 3300025934 | Bacteria | 3416 |
| 458 | Ga0207709_10000226 | 3300025935 | Bacteria | 71499 |
| 459 | Ga0207669_10013513 | 3300025937 | Bacteria | 4057 |
| 460 | Ga0207669_10020516 | 3300025937 | Bacteria | 3468 |
| 461 | Ga0207669_10562223 | 3300025937 | Bacteria | 922 |
| 462 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 463 | Ga0207691_10040972 | 3300025940 | Bacteria | 4279 |
| 464 | Ga0207691_10100109 | 3300025940 | Bacteria | 2587 |
| 465 | Ga0207691_10162189 | 3300025940 | Bacteria | 1961 |
| 466 | Ga0207711_10000035 | 3300025941 | Bacteria | 177223 |
| 467 | Ga0207711_10003703 | 3300025941 | Bacteria | 13178 |
| 468 | Ga0207711_10094340 | 3300025941 | Bacteria | 2637 |
| 469 | Ga0207711_10130631 | 3300025941 | Bacteria | 2252 |
| 470 | Ga0207689_10000596 | 3300025942 | Bacteria | 34519 |
| 471 | Ga0207661_11276985 | 3300025944 | Bacteria | 675 |
| 472 | Ga0207679_10381299 | 3300025945 | Bacteria | 1236 |
| 473 | Ga0207679_10596048 | 3300025945 | Bacteria | 995 |
| 474 | Ga0207667_10000109 | 3300025949 | Bacteria | 132054 |
| 475 | Ga0207667_10003169 | 3300025949 | Bacteria | 20350 |
| 476 | Ga0207667_10053655 | 3300025949 | Bacteria | 4241 |
| 477 | Ga0207667_11418109 | 3300025949 | Bacteria | 668 |
| 478 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 479 | Ga0207651_10342638 | 3300025960 | Bacteria | 1256 |
| 480 | Ga0207651_10479242 | 3300025960 | Bacteria | 1072 |
| 481 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 482 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 483 | Ga0207712_10000460 | 3300025961 | Bacteria | 34444 |
| 484 | Ga0207712_10004601 | 3300025961 | Bacteria | 8715 |
| 485 | Ga0207712_10080829 | 3300025961 | Bacteria | 2365 |
| 486 | Ga0207712_10173337 | 3300025961 | Bacteria | 1688 |
| 487 | Ga0207712_10280737 | 3300025961 | Bacteria | 1359 |
| 488 | Ga0207712_10808153 | 3300025961 | Bacteria | 824 |
| 489 | Ga0207668_10000020 | 3300025972 | Bacteria | 140737 |
| 490 | Ga0207668_10000140 | 3300025972 | Bacteria | 49509 |
| 491 | Ga0207668_10000256 | 3300025972 | Bacteria | 35517 |
| 492 | Ga0207668_10000294 | 3300025972 | Bacteria | 32757 |
| 493 | Ga0207668_10024318 | 3300025972 | Bacteria | 3908 |
| 494 | Ga0207668_10332636 | 3300025972 | Bacteria | 1264 |
| 495 | Ga0207668_10649278 | 3300025972 | Bacteria | 923 |
| 496 | Ga0207668_11058104 | 3300025972 | Bacteria | 726 |
| 497 | Ga0207640_10000312 | 3300025981 | Bacteria | 32479 |
| 498 | Ga0207640_10004411 | 3300025981 | Bacteria | 7631 |
| 499 | Ga0207640_10015179 | 3300025981 | Bacteria | 4453 |
| 500 | Ga0207640_10121481 | 3300025981 | Bacteria | 1872 |
| 501 | Ga0207640_10151533 | 3300025981 | Bacteria | 1704 |
| 502 | Ga0207640_10270149 | 3300025981 | Bacteria | 1330 |
| 503 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 504 | Ga0207658_10000068 | 3300025986 | Bacteria | 113745 |
| 505 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 506 | Ga0207658_10000575 | 3300025986 | Bacteria | 33049 |
| 507 | Ga0207658_10001256 | 3300025986 | Bacteria | 20068 |
| 508 | Ga0207658_10190280 | 3300025986 | Bacteria | 1705 |
| 509 | Ga0207677_10000530 | 3300026023 | Bacteria | 24100 |
| 510 | Ga0207703_10000501 | 3300026035 | Bacteria | 40495 |
| 511 | Ga0207703_10000677 | 3300026035 | Bacteria | 33813 |
| 512 | Ga0207703_10002971 | 3300026035 | Bacteria | 14368 |
| 513 | Ga0207703_10004439 | 3300026035 | Bacteria | 11520 |
| 514 | Ga0207703_10026618 | 3300026035 | Bacteria | 4554 |
| 515 | Ga0207703_10182370 | 3300026035 | Bacteria | 1853 |
| 516 | Ga0207703_10662250 | 3300026035 | Bacteria | 991 |
| 517 | Ga0207639_10021378 | 3300026041 | Bacteria | 4647 |
| 518 | Ga0207639_10081762 | 3300026041 | Bacteria | 2559 |
| 519 | Ga0207639_10083571 | 3300026041 | Bacteria | 2534 |
| 520 | Ga0207639_10107040 | 3300026041 | Bacteria | 2271 |
| 521 | Ga0207639_10358941 | 3300026041 | Bacteria | 1303 |
| 522 | Ga0207639_11177800 | 3300026041 | Bacteria | 719 |
| 523 | Ga0207678_10000622 | 3300026067 | Bacteria | 32445 |
| 524 | Ga0207678_10007415 | 3300026067 | Bacteria | 9714 |
| 525 | Ga0207678_10057383 | 3300026067 | Bacteria | 3350 |
| 526 | Ga0207678_10594002 | 3300026067 | Bacteria | 970 |
| 527 | Ga0207702_10004186 | 3300026078 | Bacteria | 12910 |
| 528 | Ga0207702_10019205 | 3300026078 | Bacteria | 5652 |
| 529 | Ga0207702_10025134 | 3300026078 | Bacteria | 4941 |
| 530 | Ga0207702_10030279 | 3300026078 | Bacteria | 4509 |
| 531 | Ga0207702_10043899 | 3300026078 | Bacteria | 3755 |
| 532 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 533 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 534 | Ga0207641_10000057 | 3300026088 | Bacteria | 168603 |
| 535 | Ga0207641_10000074 | 3300026088 | Bacteria | 145908 |
| 536 | Ga0207641_10000818 | 3300026088 | Bacteria | 33059 |
| 537 | Ga0207641_10001290 | 3300026088 | Bacteria | 24911 |
| 538 | Ga0207641_10002303 | 3300026088 | Bacteria | 17752 |
| 539 | Ga0207641_10004282 | 3300026088 | Bacteria | 12408 |
| 540 | Ga0207641_10004485 | 3300026088 | Bacteria | 12077 |
| 541 | Ga0207641_10098794 | 3300026088 | Bacteria | 2567 |
| 542 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 543 | Ga0207648_10971539 | 3300026089 | Bacteria | 795 |
| 544 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 545 | Ga0207676_10000012 | 3300026095 | Bacteria | 353971 |
| 546 | Ga0207676_10000184 | 3300026095 | Bacteria | 55154 |
| 547 | Ga0207676_10001239 | 3300026095 | Bacteria | 19003 |
| 548 | Ga0207676_10001402 | 3300026095 | Bacteria | 17933 |
| 549 | Ga0207676_10332862 | 3300026095 | Bacteria | 1398 |
| 550 | Ga0207674_10038181 | 3300026116 | Bacteria | 4989 |
| 551 | Ga0207674_10056687 | 3300026116 | Bacteria | 3977 |
| 552 | Ga0207674_10057607 | 3300026116 | Bacteria | 3938 |
| 553 | Ga0207674_10076729 | 3300026116 | Bacteria | 3349 |
| 554 | Ga0207674_10087862 | 3300026116 | Bacteria | 3102 |
| 555 | Ga0207674_10218212 | 3300026116 | Bacteria | 1855 |
| 556 | Ga0207674_10301106 | 3300026116 | Bacteria | 1552 |
| 557 | Ga0207674_10313831 | 3300026116 | Bacteria | 1517 |
| 558 | Ga0207675_100000822 | 3300026118 | Bacteria | 30908 |
| 559 | Ga0207675_100001962 | 3300026118 | Bacteria | 20508 |
| 560 | Ga0207675_100053569 | 3300026118 | Bacteria | 3764 |
| 561 | Ga0207675_100074606 | 3300026118 | Bacteria | 3174 |
| 562 | Ga0207683_10029537 | 3300026121 | Bacteria | 4747 |
| 563 | Ga0207683_10698720 | 3300026121 | Bacteria | 940 |
| 564 | Ga0207698_10000389 | 3300026142 | Bacteria | 25374 |
| 565 | Ga0207698_10047484 | 3300026142 | Bacteria | 3253 |
| 566 | Ga0207698_10892759 | 3300026142 | Bacteria | 896 |
| 567 | Ga0209983_1006951 | 3300027665 | Bacteria | 2323 |
| 568 | Ga0209983_1042998 | 3300027665 | Bacteria | 980 |
| 569 | Ga0209813_10000224 | 3300027866 | Bacteria | 17403 |
| 570 | Ga0209974_10008265 | 3300027876 | Bacteria | 3563 |
| 571 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 572 | Ga0268266_10000134 | 3300028379 | Bacteria | 143139 |
| 573 | Ga0268266_10002533 | 3300028379 | Bacteria | 19412 |
| 574 | Ga0268266_10088377 | 3300028379 | Bacteria | 2712 |
| 575 | Ga0268266_10647305 | 3300028379 | Bacteria | 1017 |
| 576 | Ga0268266_11142087 | 3300028379 | Bacteria | 753 |
| 577 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 578 | Ga0268265_10000006 | 3300028380 | Bacteria | 466482 |
| 579 | Ga0268265_10000064 | 3300028380 | Bacteria | 144164 |
| 580 | Ga0268265_10000233 | 3300028380 | Bacteria | 63492 |
| 581 | Ga0268265_10001032 | 3300028380 | Bacteria | 25108 |
| 582 | Ga0268265_10004641 | 3300028380 | Bacteria | 9484 |
| 583 | Ga0268265_10953429 | 3300028380 | Bacteria | 845 |
| 584 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 585 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 586 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 587 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 588 | Ga0268264_10000381 | 3300028381 | Bacteria | 64651 |
| 589 | Ga0268264_10004037 | 3300028381 | Bacteria | 12568 |
| 590 | Ga0268264_10018242 | 3300028381 | Bacteria | 5739 |
| 591 | Ga0268264_10071486 | 3300028381 | Bacteria | 2940 |
| 592 | Ga0268264_10334121 | 3300028381 | Bacteria | 1437 |
| 593 | Ga0268264_11462896 | 3300028381 | Bacteria | 694 |
| 594 | Ga0307513_10072284 | 3300031456 | Bacteria | 3596 |
| 595 | Ga0307513_10491966 | 3300031456 | Bacteria | 945 |
| 596 | Ga0307513_10563205 | 3300031456 | Bacteria | 851 |
| 597 | Ga0307408_100013448 | 3300031548 | Bacteria | 5431 |
| 598 | Ga0307408_100018574 | 3300031548 | Bacteria | 4670 |
| 599 | Ga0307408_100060456 | 3300031548 | Bacteria | 2762 |
| 600 | Ga0307408_100158245 | 3300031548 | Bacteria | 1796 |
| 601 | Ga0307408_100347793 | 3300031548 | Bacteria | 1257 |
| 602 | Ga0307408_100507895 | 3300031548 | Bacteria | 1056 |
| 603 | Ga0307408_101146973 | 3300031548 | Bacteria | 723 |
| 604 | Ga0307508_10000638 | 3300031616 | Bacteria | 42145 |
| 605 | Ga0307405_10007541 | 3300031731 | Bacteria | 5449 |
| 606 | Ga0307405_10010822 | 3300031731 | Bacteria | 4749 |
| 607 | Ga0307405_10097237 | 3300031731 | Bacteria | 1965 |
| 608 | Ga0307405_10199373 | 3300031731 | Bacteria | 1452 |
| 609 | Ga0307405_10305053 | 3300031731 | Bacteria | 1209 |
| 610 | Ga0307405_10849756 | 3300031731 | Bacteria | 768 |
| 611 | Ga0307405_10878420 | 3300031731 | Bacteria | 757 |
| 612 | Ga0307413_10007582 | 3300031824 | Bacteria | 5052 |
| 613 | Ga0307413_10009480 | 3300031824 | Bacteria | 4663 |
| 614 | Ga0307413_10153083 | 3300031824 | Bacteria | 1610 |
| 615 | Ga0307413_10259436 | 3300031824 | Bacteria | 1295 |
| 616 | Ga0307413_10482965 | 3300031824 | Bacteria | 991 |
| 617 | Ga0307413_10593898 | 3300031824 | Bacteria | 905 |
| 618 | Ga0307410_10035955 | 3300031852 | Bacteria | 3221 |
| 619 | Ga0307410_10136674 | 3300031852 | Bacteria | 1808 |
| 620 | Ga0307410_10165458 | 3300031852 | Bacteria | 1661 |
| 621 | Ga0307410_10401319 | 3300031852 | Bacteria | 1108 |
| 622 | Ga0307406_10020839 | 3300031901 | Bacteria | 3868 |
| 623 | Ga0307406_10102595 | 3300031901 | Bacteria | 1952 |
| 624 | Ga0307406_10227093 | 3300031901 | Bacteria | 1391 |
| 625 | Ga0307406_10309430 | 3300031901 | Bacteria | 1217 |
| 626 | Ga0307406_10311602 | 3300031901 | Bacteria | 1213 |
| 627 | Ga0307406_10478355 | 3300031901 | Bacteria | 1005 |
| 628 | Ga0307406_10634569 | 3300031901 | Bacteria | 885 |
| 629 | Ga0307407_10063086 | 3300031903 | Bacteria | 2173 |
| 630 | Ga0307412_10000339 | 3300031911 | Bacteria | 29443 |
| 631 | Ga0307412_10006640 | 3300031911 | Bacteria | 6555 |
| 632 | Ga0307412_10017510 | 3300031911 | Bacteria | 4289 |
| 633 | Ga0307412_10022161 | 3300031911 | Bacteria | 3890 |
| 634 | Ga0307412_10026305 | 3300031911 | Bacteria | 3615 |
| 635 | Ga0307412_10048489 | 3300031911 | Bacteria | 2794 |
| 636 | Ga0307412_10048621 | 3300031911 | Bacteria | 2790 |
| 637 | Ga0307412_10137959 | 3300031911 | Bacteria | 1782 |
| 638 | Ga0307412_10184436 | 3300031911 | Bacteria | 1572 |
| 639 | Ga0307412_11211802 | 3300031911 | Bacteria | 676 |
| 640 | Ga0307409_100027015 | 3300031995 | Bacteria | 4060 |
| 641 | Ga0307409_100136565 | 3300031995 | Bacteria | 2105 |
| 642 | Ga0307409_100175442 | 3300031995 | Bacteria | 1891 |
| 643 | Ga0307409_100395009 | 3300031995 | Bacteria | 1319 |
| 644 | Ga0307409_100521075 | 3300031995 | Bacteria | 1161 |
| 645 | Ga0307409_100627784 | 3300031995 | Bacteria | 1065 |
| 646 | Ga0307416_100004454 | 3300032002 | Bacteria | 8447 |
| 647 | Ga0307416_100020485 | 3300032002 | Bacteria | 4722 |
| 648 | Ga0307416_100174215 | 3300032002 | Bacteria | 2007 |
| 649 | Ga0307416_100225994 | 3300032002 | Bacteria | 1800 |
| 650 | Ga0307416_100364285 | 3300032002 | Bacteria | 1469 |
| 651 | Ga0307416_100487236 | 3300032002 | Bacteria | 1294 |
| 652 | Ga0307416_100540706 | 3300032002 | Bacteria | 1237 |
| 653 | Ga0307416_101020888 | 3300032002 | Bacteria | 930 |
| 654 | Ga0307416_102228501 | 3300032002 | Bacteria | 649 |
| 655 | Ga0307414_10000446 | 3300032004 | Bacteria | 21819 |
| 656 | Ga0307414_10000911 | 3300032004 | Bacteria | 15167 |
| 657 | Ga0307414_10053390 | 3300032004 | Bacteria | 2818 |
| 658 | Ga0307414_10079900 | 3300032004 | Bacteria | 2389 |
| 659 | Ga0307414_10179918 | 3300032004 | Bacteria | 1700 |
| 660 | Ga0307414_10354869 | 3300032004 | Bacteria | 1260 |
| 661 | Ga0307414_10583640 | 3300032004 | Bacteria | 1000 |
| 662 | Ga0307414_10736606 | 3300032004 | Bacteria | 895 |
| 663 | Ga0307414_11272025 | 3300032004 | Bacteria | 682 |
| 664 | Ga0307411_10002059 | 3300032005 | Bacteria | 8637 |
| 665 | Ga0307411_10037372 | 3300032005 | Bacteria | 3052 |
| 666 | Ga0307411_10125437 | 3300032005 | Bacteria | 1866 |
| 667 | Ga0307411_10136322 | 3300032005 | Bacteria | 1803 |
| 668 | Ga0307411_10174859 | 3300032005 | Bacteria | 1623 |
| 669 | Ga0307411_10369713 | 3300032005 | Bacteria | 1176 |
| 670 | Ga0307411_10592212 | 3300032005 | Bacteria | 952 |
| 671 | Ga0307415_100010444 | 3300032126 | Bacteria | 5261 |
| 672 | Ga0307415_101307983 | 3300032126 | Bacteria | 687 |
| 673 | Ga0307415_101496816 | 3300032126 | Bacteria | 646 |
| 674 | Ga0307510_10010127 | 3300033180 | Bacteria | 11208 |
| 675 | Ga0373923_0048672 | 3300035111 | Bacteria | 1771 |
| 676 | Ga0373923_0132806 | 3300035111 | Bacteria | 1120 |
| 677 | Ga0373927_0176280 | 3300035695 | Bacteria | 1402 |
| 678 | Ga0373947_0192963 | 3300035725 | Bacteria | 1330 |
| 679 | Ga0373937_0242097 | 3300036401 | Bacteria | 1700 |
| 680 | Ga0373925_0437435 | 3300037068 | Bacteria | 1070 |
| 681 | Ga0373925_0866795 | 3300037068 | Bacteria | 744 |
| 682 | Ga0395899_0001239 | 3300037312 | Bacteria | 22265 |
| 683 | Ga0395900_0137923 | 3300037418 | Bacteria | 2499 |
| 684 | Ga0395900_0304059 | 3300037418 | Bacteria | 1580 |
| 685 | Ga0395898_1205440 | 3300037466 | Bacteria | 688 |
| 686 | Ga0395905_0136583 | 3300037471 | Bacteria | 2307 |
| 687 | Ga0395905_0268838 | 3300037471 | Bacteria | 1591 |
| 688 | Ga0395905_0409127 | 3300037471 | Bacteria | 1252 |
| 689 | Ga0395901_0091016 | 3300038443 | Bacteria | 3193 |
| 690 | Ga0395901_1092795 | 3300038443 | Bacteria | 768 |
| 691 | Ga0237819_00162 | 3300038705 | Bacteria | 24529 |
| 692 | Ga0436365_0519720 | 3300039437 | Bacteria | 2155 |
| 693 | Ga0436365_1911487 | 3300039437 | Bacteria | 52227 |
| 694 | Ga0436363_1666975 | 3300039450 | Bacteria | 1530 |
| 695 | Ga0436362_0953683 | 3300039453 | Bacteria | 32384 |
| 696 | Ga0439436_0013362 | 3300041404 | Bacteria | 2483 |
| 697 | Ga0439461_0000049 | 3300041410 | Bacteria | 14329 |
| 698 | Ga0439461_0003711 | 3300041410 | Bacteria | 2522 |
| 699 | Ga0439466_0117280 | 3300041411 | Bacteria | 823 |
| 700 | Ga0439465_0001229 | 3300041413 | Bacteria | 8251 |
| 701 | Ga0451791_0580454 | 3300041451 | Bacteria | 550 |
| 702 | Ga0451793_1911553 | 3300041452 | Bacteria | 590 |
| 703 | Ga0451795_1124672 | 3300041456 | Bacteria | 746 |
| 704 | Ga0451807_0447633 | 3300041486 | Bacteria | 668 |
| 705 | Ga0439431_0000311 | 3300041997 | Bacteria | 10034 |
| 706 | Ga0439431_0012827 | 3300041997 | Bacteria | 1929 |
| 707 | Ga0439445_0000462 | 3300042004 | Bacteria | 8222 |
| 708 | Ga0439445_0004643 | 3300042004 | Bacteria | 3114 |
| 709 | Ga0439448_0019752 | 3300042005 | Bacteria | 2078 |
| 710 | Ga0439448_0020246 | 3300042005 | Bacteria | 2056 |
| 711 | Ga0439432_004749 | 3300042006 | Bacteria | 4945 |
| 712 | Ga0439452_034811 | 3300042010 | Bacteria | 1215 |
| 713 | Ga0439455_0048156 | 3300042012 | Bacteria | 1108 |
| 714 | Ga0439462_0003792 | 3300042015 | Bacteria | 3647 |
| 715 | Ga0439462_0018038 | 3300042015 | Bacteria | 1831 |
| 716 | Ga0439446_0061242 | 3300042156 | Bacteria | 1138 |
| 717 | Ga0439434_0000250 | 3300042435 | Bacteria | 15157 |
| 718 | Ga0439434_0003638 | 3300042435 | Bacteria | 4509 |
| 719 | Ga0439464_0034923 | 3300042439 | Bacteria | 1419 |
| 720 | Ga0466972_0003330 | 3300044658 | Bacteria | 7969 |
| 721 | Ga0466965_0277966 | 3300044683 | Bacteria | 904 |
| 722 | Ga0466965_0610381 | 3300044683 | Bacteria | 620 |
| 723 | Ga0466966_0265393 | 3300044684 | Bacteria | 1033 |
| 724 | Ga0466961_0147828 | 3300044693 | Bacteria | 1468 |
| 725 | Ga0466963_0005238 | 3300044694 | Bacteria | 7575 |
| 726 | Ga0466963_0324948 | 3300044694 | Bacteria | 1083 |
| 727 | Ga0466971_0004060 | 3300044719 | Bacteria | 6298 |
| 728 | Ga0466971_0180213 | 3300044719 | Bacteria | 993 |
| 729 | Ga0466968_0102816 | 3300044735 | Bacteria | 1277 |
| 730 | Ga0466970_0134492 | 3300044765 | Bacteria | 1359 |
| 731 | Ga0466957_0010079 | 3300044842 | Bacteria | 5408 |
| 732 | Ga0466957_0554489 | 3300044842 | Bacteria | 801 |
| 733 | Ga0466960_0055450 | 3300044901 | Bacteria | 1927 |
| 734 | Ga0466958_0002871 | 3300045836 | Bacteria | 8778 |
| 735 | Ga0466958_0148670 | 3300045836 | Bacteria | 1477 |
| 736 | Ga0466967_0014351 | 3300045976 | Bacteria | 6168 |
| 737 | Ga0495627_000155 | 3300046453 | Bacteria | 79691 |
| 738 | Ga0495627_009659 | 3300046453 | Bacteria | 3541 |
| 739 | Ga0495638_0001486 | 3300046460 | Bacteria | 21191 |
| 740 | Ga0495638_0167844 | 3300046460 | Bacteria | 1261 |
| 741 | Ga0495638_0269888 | 3300046460 | Bacteria | 929 |
| 742 | Ga0495638_0323331 | 3300046460 | Bacteria | 823 |
| 743 | Ga0495585_0022756 | 3300046492 | Bacteria | 3598 |
| 744 | Ga0495585_0032819 | 3300046492 | Bacteria | 2940 |
| 745 | Ga0495607_0040638 | 3300046501 | Bacteria | 2768 |
| 746 | Ga0495583_0002872 | 3300046506 | Bacteria | 13979 |
| 747 | Ga0495583_0034644 | 3300046506 | Bacteria | 2416 |
| 748 | Ga0495610_0001777 | 3300046512 | Bacteria | 18843 |
| 749 | Ga0495631_0182957 | 3300046518 | Bacteria | 898 |
| 750 | Ga0495632_0000211 | 3300046519 | Bacteria | 59066 |
| 751 | Ga0495632_0070018 | 3300046519 | Bacteria | 1688 |
| 752 | Ga0495637_0001513 | 3300046520 | Bacteria | 13621 |
| 753 | Ga0495637_0049978 | 3300046520 | Bacteria | 1755 |
| 754 | Ga0495637_0057349 | 3300046520 | Bacteria | 1609 |
| 755 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 756 | Ga0495643_0267686 | 3300046522 | Bacteria | 791 |
| 757 | Ga0495643_0317051 | 3300046522 | Bacteria | 706 |
| 758 | Ga0495648_0020353 | 3300046524 | Bacteria | 4629 |
| 759 | Ga0495648_0109292 | 3300046524 | Bacteria | 1508 |
| 760 | Ga0495648_0251367 | 3300046524 | Bacteria | 853 |
| 761 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 762 | Ga0495663_0281804 | 3300046525 | Bacteria | 595 |
| 763 | Ga0495654_0000194 | 3300046530 | Bacteria | 59637 |
| 764 | Ga0495654_0075436 | 3300046530 | Bacteria | 1591 |
| 765 | Ga0495654_0285244 | 3300046530 | Bacteria | 678 |
| 766 | Ga0495597_0028176 | 3300046542 | Bacteria | 2572 |
| 767 | Ga0495633_0002680 | 3300046558 | Bacteria | 12377 |
| 768 | Ga0495633_0178157 | 3300046558 | Bacteria | 979 |
| 769 | Ga0495668_0004403 | 3300046616 | Bacteria | 10020 |
| 770 | Ga0495668_0007591 | 3300046616 | Bacteria | 6917 |
| 771 | Ga0495668_0009349 | 3300046616 | Bacteria | 6026 |
| 772 | Ga0495668_0183214 | 3300046616 | Bacteria | 1147 |
| 773 | Ga0495611_0066498 | 3300046648 | Bacteria | 1644 |
| 774 | Ga0495625_0000570 | 3300046660 | Bacteria | 54000 |
| 775 | Ga0495625_0317077 | 3300046660 | Bacteria | 993 |
| 776 | Ga0495625_0438736 | 3300046660 | Bacteria | 809 |
| 777 | Ga0495661_0040812 | 3300046665 | Bacteria | 2875 |
| 778 | Ga0495669_0025332 | 3300046684 | Bacteria | 2587 |
| 779 | Ga0495670_0024341 | 3300046691 | Bacteria | 2992 |
| 780 | Ga0495670_0046523 | 3300046691 | Bacteria | 2167 |
| 781 | Ga0495670_0048691 | 3300046691 | Bacteria | 2120 |
| 782 | Ga0495670_0077744 | 3300046691 | Bacteria | 1687 |
| 783 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 784 | Ga0495649_0103048 | 3300046694 | Bacteria | 1515 |
| 785 | Ga0495649_0165910 | 3300046694 | Bacteria | 1157 |
| 786 | Ga0495660_0257922 | 3300046810 | Bacteria | 806 |
| 787 | Ga0495673_0047086 | 3300047469 | Bacteria | 1907 |
| 788 | Ga0495681_0000228 | 3300047470 | Bacteria | 46877 |
| 789 | Ga0495681_0018954 | 3300047470 | Bacteria | 3774 |
| 790 | Ga0495681_0065650 | 3300047470 | Bacteria | 1658 |
| 791 | Ga0495686_0000185 | 3300047472 | Bacteria | 116495 |
| 792 | Ga0495686_0000606 | 3300047472 | Bacteria | 49623 |
| 793 | Ga0495686_0046918 | 3300047472 | Bacteria | 2729 |
| 794 | Ga0495686_0113510 | 3300047472 | Bacteria | 1622 |
| 795 | Ga0495686_0123735 | 3300047472 | Bacteria | 1539 |
| 796 | Ga0495686_0655272 | 3300047472 | Bacteria | 539 |
| 797 | Ga0496101_0059561 | 3300048904 | Bacteria | 2768 |
| 798 | Ga0496102_0617804 | 3300048905 | Bacteria | 1007 |
| 799 | Ga0496102_0617890 | 3300048905 | Bacteria | 1007 |
| 800 | Ga0496102_1135396 | 3300048905 | Bacteria | 701 |
| 801 | Ga0496102_1237829 | 3300048905 | Bacteria | 666 |
| 802 | Ga0496103_0001645 | 3300048906 | Bacteria | 14637 |
| 803 | Ga0496104_0284166 | 3300048907 | Bacteria | 1567 |
| 804 | Ga0496105_0157441 | 3300048908 | Bacteria | 1865 |
| 805 | Ga0496106_0052457 | 3300048909 | Bacteria | 3077 |
| 806 | Ga0496108_0543527 | 3300048911 | Bacteria | 1014 |
| 807 | Ga0496109_0239461 | 3300048912 | Bacteria | 1708 |
| 808 | Ga0496109_0978211 | 3300048912 | Bacteria | 784 |
| 809 | Ga0496110_0536303 | 3300048913 | Bacteria | 1064 |
| 810 | Ga0496111_0237597 | 3300048914 | Bacteria | 1353 |
| 811 | Ga0496115_0322975 | 3300048918 | Bacteria | 1262 |
| 812 | Ga0496116_0031088 | 3300048919 | Bacteria | 3828 |
| 813 | Ga0496116_0104998 | 3300048919 | Bacteria | 1677 |
| 814 | Ga0496116_0116850 | 3300048919 | Bacteria | 1553 |
| 815 | Ga0496117_0011490 | 3300048920 | Bacteria | 7927 |
| 816 | Ga0496117_0015430 | 3300048920 | Bacteria | 6514 |
| 817 | Ga0496117_0060285 | 3300048920 | Bacteria | 2616 |
| 818 | Ga0496118_0000807 | 3300048921 | Bacteria | 50003 |
| 819 | Ga0496118_0019663 | 3300048921 | Bacteria | 6027 |
| 820 | Ga0496118_0034294 | 3300048921 | Bacteria | 4144 |
| 821 | Ga0496120_0151357 | 3300048923 | Bacteria | 1166 |
| 822 | Ga0496121_0001630 | 3300048924 | Bacteria | 37148 |
| 823 | Ga0496121_0259767 | 3300048924 | Bacteria | 1200 |
| 824 | Ga0496121_0344886 | 3300048924 | Bacteria | 994 |
| 825 | Ga0496122_0201786 | 3300048925 | Bacteria | 1162 |
| 826 | Ga0496123_0001872 | 3300048926 | Bacteria | 27559 |
| 827 | Ga0496123_0075283 | 3300048926 | Bacteria | 2084 |
| 828 | Ga0496123_0358438 | 3300048926 | Bacteria | 676 |
| 829 | Ga0496124_0012980 | 3300048927 | Bacteria | 8167 |
| 830 | Ga0496125_0018837 | 3300048928 | Bacteria | 6536 |
| 831 | Ga0496125_0039047 | 3300048928 | Bacteria | 4096 |
| 832 | Ga0496125_0123650 | 3300048928 | Bacteria | 1839 |
| 833 | Ga0496125_0157707 | 3300048928 | Bacteria | 1547 |
| 834 | Ga0496125_0289406 | 3300048928 | Bacteria | 1010 |
| 835 | Ga0496125_0326095 | 3300048928 | Bacteria | 928 |
| 836 | Ga0496125_0530694 | 3300048928 | Bacteria | 656 |
| 837 | Ga0496126_0016562 | 3300048929 | Bacteria | 7367 |
| 838 | Ga0496126_0670600 | 3300048929 | Bacteria | 809 |
| 839 | Ga0495678_021780 | 3300049459 | Bacteria | 2816 |
| 840 | Ga0495678_092874 | 3300049459 | Bacteria | 1059 |
| 841 | Ga0495682_0010872 | 3300049460 | Bacteria | 3508 |
| 842 | Ga0501292_000074 | 3300049515 | Bacteria | 19994 |
| 843 | Ga0501293_008171 | 3300049516 | Bacteria | 876 |
| 844 | Ga0501294_000612 | 3300049517 | Bacteria | 4074 |
| 845 | Ga0501034_0177603 | 3300049571 | Bacteria | 2095 |
| 846 | Ga0501034_0456527 | 3300049571 | Bacteria | 1195 |
| 847 | Ga0501036_0658240 | 3300049572 | Bacteria | 867 |
| 848 | Ga0501039_0572856 | 3300049575 | Bacteria | 886 |
| 849 | Ga0501043_0602705 | 3300049579 | Bacteria | 811 |
| 850 | Ga0501047_0110681 | 3300049581 | Bacteria | 2629 |
| 851 | Ga0501206_000630 | 3300049653 | Bacteria | 4238 |
| 852 | Ga0501222_001135 | 3300049662 | Bacteria | 3770 |
| 853 | Ga0501223_110178 | 3300049663 | Bacteria | 574 |
| 854 | Ga0501224_003673 | 3300049664 | Bacteria | 2154 |
| 855 | Ga0501227_022681 | 3300049665 | Bacteria | 1455 |
| 856 | Ga0501233_114374 | 3300049668 | Bacteria | 724 |
| 857 | Ga0501235_003892 | 3300049669 | Bacteria | 3230 |
| 858 | Ga0501235_013506 | 3300049669 | Bacteria | 1797 |
| 859 | Ga0501257_000568 | 3300049686 | Bacteria | 7318 |
| 860 | Ga0501259_001177 | 3300049688 | Bacteria | 4359 |
| 861 | Ga0501261_000602 | 3300049690 | Bacteria | 4577 |
| 862 | Ga0501221_005405 | 3300049704 | Bacteria | 2133 |
| 863 | Ga0501225_0003823 | 3300049705 | Bacteria | 4522 |
| 864 | Ga0501225_0099851 | 3300049705 | Bacteria | 847 |
| 865 | Ga0501245_004100 | 3300049708 | Bacteria | 1992 |
| 866 | Ga0501241_028950 | 3300049758 | Bacteria | 1041 |
| 867 | Ga0501279_000058 | 3300049775 | Bacteria | 20363 |
| 868 | Ga0501280_000122 | 3300049776 | Bacteria | 20266 |
| 869 | Ga0501280_003611 | 3300049776 | Bacteria | 2357 |
| 870 | Ga0501281_00828 | 3300049777 | Bacteria | 2645 |
| 871 | Ga0501282_000646 | 3300049778 | Bacteria | 4020 |
| 872 | Ga0501283_005863 | 3300049779 | Bacteria | 1701 |
| 873 | Ga0501035_0315471 | 3300049822 | Bacteria | 1315 |
| 874 | Ga0501044_0414353 | 3300049823 | Bacteria | 1258 |
| 875 | Ga0501044_0579176 | 3300049823 | Bacteria | 1017 |
| 876 | nmdc:mga03n38_92290_c1 | 3300050490 | Bacteria | 1444 |
| 877 | nmdc:mga0k408_39696_c1 | 3300050493 | Bacteria | 2706 |
| 878 | nmdc:mga07m45_44971_c1 | 3300050496 | Bacteria | 2478 |
| 879 | Ga0495601_0297390 | 3300053077 | Bacteria | 1052 |
| 880 | Ga0500643_000089 | 3300053087 | Bacteria | 93982 |
| 881 | Ga0500643_000641 | 3300053087 | Bacteria | 23561 |
| 882 | Ga0500643_001043 | 3300053087 | Bacteria | 16808 |
| 883 | Ga0500643_011332 | 3300053087 | Bacteria | 3257 |
| 884 | Ga0500643_011530 | 3300053087 | Bacteria | 3220 |
| 885 | Ga0500643_012809 | 3300053087 | Bacteria | 2990 |
| 886 | Ga0500647_0018649 | 3300053091 | Bacteria | 3216 |
| 887 | Ga0500651_0083340 | 3300053093 | Bacteria | 1978 |
| 888 | Ga0500650_0069216 | 3300053098 | Bacteria | 1650 |
| 889 | Ga0500555_000430 | 3300053103 | Bacteria | 17416 |
| 890 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 891 | Ga0500557_061050 | 3300053105 | Bacteria | 1224 |
| 892 | Ga0500562_000417 | 3300053108 | Bacteria | 10343 |
| 893 | Ga0500592_000086 | 3300053116 | Bacteria | 21326 |
| 894 | Ga0500595_165805 | 3300053119 | Bacteria | 615 |
| 895 | Ga0500597_025281 | 3300053120 | Bacteria | 2391 |
| 896 | Ga0500597_135384 | 3300053120 | Bacteria | 1063 |
| 897 | Ga0500608_065769 | 3300053122 | Bacteria | 1729 |
| 898 | Ga0500614_026476 | 3300053123 | Bacteria | 1386 |
| 899 | Ga0500618_007224 | 3300053125 | Bacteria | 3187 |
| 900 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 901 | Ga0500642_0003376 | 3300053130 | Bacteria | 4819 |
| 902 | Ga0500655_000122 | 3300053133 | Bacteria | 19897 |
| 903 | Ga0500658_0007651 | 3300053134 | Bacteria | 3991 |
| 904 | Ga0500658_0147952 | 3300053134 | Bacteria | 1057 |
| 905 | Ga0500559_0005855 | 3300053136 | Bacteria | 5602 |
| 906 | Ga0500559_0028777 | 3300053136 | Bacteria | 2375 |
| 907 | Ga0500559_0070803 | 3300053136 | Bacteria | 1570 |
| 908 | Ga0500559_0086269 | 3300053136 | Bacteria | 1433 |
| 909 | Ga0500559_0374868 | 3300053136 | Bacteria | 664 |
| 910 | Ga0500568_0003914 | 3300053139 | Bacteria | 8104 |
| 911 | Ga0500568_0119791 | 3300053139 | Bacteria | 981 |
| 912 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 913 | Ga0500577_0047339 | 3300053142 | Bacteria | 1598 |
| 914 | Ga0500577_0154296 | 3300053142 | Bacteria | 975 |
| 915 | Ga0500590_004273 | 3300053148 | Bacteria | 6718 |
| 916 | Ga0500604_0038857 | 3300053151 | Bacteria | 1429 |
| 917 | Ga0500616_0006486 | 3300053153 | Bacteria | 7656 |
| 918 | Ga0500622_0166598 | 3300053156 | Bacteria | 1029 |
| 919 | Ga0500622_0390728 | 3300053156 | Bacteria | 567 |
| 920 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 921 | Ga0500627_0000549 | 3300053158 | Bacteria | 10114 |
| 922 | Ga0500627_0000869 | 3300053158 | Bacteria | 8097 |
| 923 | Ga0500639_068732 | 3300053163 | Bacteria | 1809 |
| 924 | Ga0500636_0056736 | 3300053177 | Bacteria | 2293 |
| 925 | Ga0500637_0000248 | 3300053178 | Bacteria | 20072 |
| 926 | Ga0500570_003257 | 3300053724 | Bacteria | 8295 |
| 927 | Ga0500645_000424 | 3300053730 | Bacteria | 29265 |
| 928 | Ga0500645_100344 | 3300053730 | Bacteria | 817 |
| 929 | Ga0466962_0015483 | 3300061719 | Bacteria | 3678 |
| 930 | Ga0466962_0017955 | 3300061719 | Bacteria | 3404 |
| 931 | 2585262319 | 2582581305 | Bacteria | 4895574 |
| 932 | 2600200446 | 2599185354 | Bacteria | 4398675 |
| 933 | 2644037224 | 2643221605 | Bacteria | 4772303 |
| 934 | 2644126629 | 2643221622 | Bacteria | 4212502 |
| 935 | 2753763778 | 2751185897 | Bacteria | 5322941 |
| 936 | 2778123971 | 2775507255 | Bacteria | 3945731 |
| 937 | 2809062159 | 2808606401 | Bacteria | 4586670 |
| 938 | 2809078123 | 2808606404 | Bacteria | 4652788 |
| 939 | 2809082169 | 2808606405 | Bacteria | 4586632 |
| 940 | 2819712979 | 2818991466 | Bacteria | 4748179 |
| 941 | 2830077676 | 2830075706 | Bacteria | 3855215 |
| 942 | 2880519656 | 2880518877 | Bacteria | 5012590 |
| 943 | 2919709902 | 2919709256 | Bacteria | 4318106 |
| 944 | 2928027358 | 2928027323 | Bacteria | 4382488 |
| 945 | 2928527517 | 2928526807 | Bacteria | 4760224 |
| 946 | 2928968994 | 2928968154 | Bacteria | 4633371 |
| 947 | 2946788562 | 2946787523 | Bacteria | 4366789 |
| 948 | 2984558340 | 2984555340 | Bacteria | 4247089 |
| 949 | 2984567279 | 2984564862 | Bacteria | 4339992 |
| 950 | 2990266586 | 2990265787 | Bacteria | 3943888 |
| 951 | 2993358346 | 2993356040 | Bacteria | 4247105 |
| 952 | 2993695615 | 2993693658 | Bacteria | 4040749 |
| 953 | 8057103477 | 8057101203 | Bacteria | 5034064 |
| 954 | Ga0065707_10161179 | |||
| 955 | SwRhRL3b_contig_2210436 | |||
| 956 | SwRhRL2b_contig_2119227 | |||
| 957 | ARcpr5yngRDRAFT_c001224 | |||
| 958 | ARCol0yngRDRAFT_1002626 | |||
| 959 | JGI24741J21665_1000043 | |||
| 960 | JGI24740J21852_10003355 | |||
| 961 | JGI24740J21852_10038745 | |||
| 962 | JGI24739J22299_10006105 | |||
| 963 | JGI24739J22299_10027605 | |||
| 964 | JGI24739J22299_10032344 | |||
| 965 | JGI24739J22299_10100171 | |||
| 966 | JGI24737J22298_10003105 | |||
| 967 | JGI24737J22298_10005112 | |||
| 968 | JGI24737J22298_10005425 | |||
| 969 | JGI24737J22298_10008735 | |||
| 970 | JGI24737J22298_10018638 | |||
| 971 | JGI24737J22298_10062163 | |||
| 972 | JGI24735J21928_10000815 | |||
| 973 | JGI24735J21928_10016266 | |||
| 974 | JGI24735J21928_10059358 | |||
| 975 | JGI24735J21928_10077089 | |||
| 976 | JGI24748J21848_1000101 | |||
| 977 | JGI24738J21930_10000861 | |||
| 978 | JGI24738J21930_10001110 | |||
| 979 | JGI24738J21930_10028515 | |||
| 980 | JGI24738J21930_10048381 | |||
| 981 | JGI24744J21845_10007970 | |||
| 982 | JGI24034J26672_10000034 | |||
| 983 | JGI24742J22300_10021369 | |||
| 984 | JGI24742J22300_10026632 | |||
| 985 | JGI24751J29686_10000002 | |||
| 986 | JGI24751J29686_10004995 | |||
| 987 | JGI24751J29686_10020488 | |||
| 988 | JGI25157J39369_1033069 | |||
| 989 | JGI25164J39214_1018615 | |||
| 990 | JGI25165J46597_1000032 | |||
| 991 | JGI25165J46597_1000145 | |||
| 992 | JGI25153J46596_10000044 | |||
| 993 | Ga0055542_1004873 | |||
| 994 | Ga0055529_1010095 | |||
| 995 | Ga0055537_1000874 | |||
| 996 | Ga0055524_1000088 | |||
| 997 | Ga0055530_10007014 | |||
| 998 | Ga0055530_10008160 | |||
| 999 | Ga0055530_10024363 | |||
| 1000 | Ga0055530_10027381 | |||
| 1001 | Ga0055540_1000717 | |||
| 1002 | Ga0055531_10000016 | |||
| 1003 | Ga0055531_10008252 | |||
| 1004 | Ga0055531_10035079 | |||
| 1005 | Ga0055531_10035325 | |||
| 1006 | Ga0065165_1013352 | |||
| 1007 | Ga0065704_10077336 | |||
| 1008 | Ga0065715_10515292 | |||
| 1009 | Ga0065707_10082081 | |||
| 1010 | Ga0065707_10084130 | |||
| 1011 | Ga0065707_10096263 | |||
| 1012 | Ga0070658_10000082 | |||
| 1013 | Ga0070658_10001506 | |||
| 1014 | Ga0070658_10022691 | |||
| 1015 | Ga0070658_10117346 | |||
| 1016 | Ga0070658_10376777 | |||
| 1017 | Ga0070658_10584034 | |||
| 1018 | Ga0070683_100049857 | |||
| 1019 | Ga0070690_100000068 | |||
| 1020 | Ga0070670_100000012 | |||
| 1021 | Ga0070670_100000051 | |||
| 1022 | Ga0070670_100002503 | |||
| 1023 | Ga0070670_100004838 | |||
| 1024 | Ga0070670_100116842 | |||
| 1025 | Ga0070677_10001096 | |||
| 1026 | Ga0068869_100000810 | |||
| 1027 | Ga0068869_100591822 | |||
| 1028 | Ga0070666_10000002 | |||
| 1029 | Ga0070666_10000092 | |||
| 1030 | Ga0070666_10183511 | |||
| 1031 | Ga0070666_10370574 | |||
| 1032 | Ga0070666_10374802 | |||
| 1033 | Ga0070682_100311945 | |||
| 1034 | Ga0068868_100000407 | |||
| 1035 | Ga0070660_100000401 | |||
| 1036 | Ga0070660_100097373 | |||
| 1037 | Ga0070660_100191217 | |||
| 1038 | Ga0070660_100896023 | |||
| 1039 | Ga0070661_100506926 | |||
| 1040 | Ga0070661_100886762 | |||
| 1041 | Ga0070692_10038481 | |||
| 1042 | Ga0070668_100000004 | |||
| 1043 | Ga0070668_100000010 | |||
| 1044 | Ga0070668_100000330 | |||
| 1045 | Ga0070668_100046239 | |||
| 1046 | Ga0070668_100295574 | |||
| 1047 | Ga0070668_100427499 | |||
| 1048 | Ga0070668_100443237 | |||
| 1049 | Ga0070669_100000018 | |||
| 1050 | Ga0070669_100000041 | |||
| 1051 | Ga0070669_100000229 | |||
| 1052 | Ga0070669_100010582 | |||
| 1053 | Ga0070669_100073089 | |||
| 1054 | Ga0070669_100098905 | |||
| 1055 | Ga0070669_101130528 | |||
| 1056 | Ga0070675_101380096 | |||
| 1057 | Ga0070671_100000011 | |||
| 1058 | Ga0070671_100000014 | |||
| 1059 | Ga0070671_100000136 | |||
| 1060 | Ga0070671_100015156 | |||
| 1061 | Ga0070671_100024929 | |||
| 1062 | Ga0070674_100066686 | |||
| 1063 | Ga0070674_100601912 | |||
| 1064 | Ga0070673_100000476 | |||
| 1065 | Ga0070673_100403754 | |||
| 1066 | Ga0070688_100002373 | |||
| 1067 | Ga0070659_100035817 | |||
| 1068 | Ga0070659_100141149 | |||
| 1069 | Ga0070667_100000013 | |||
| 1070 | Ga0070667_100000037 | |||
| 1071 | Ga0070667_100000418 | |||
| 1072 | Ga0070667_100004971 | |||
| 1073 | Ga0070667_100070948 | |||
| 1074 | Ga0070667_100889138 | |||
| 1075 | Ga0070705_100006873 | |||
| 1076 | Ga0070663_100001318 | |||
| 1077 | Ga0070663_100042668 | |||
| 1078 | Ga0070663_100163445 | |||
| 1079 | Ga0070678_100024521 | |||
| 1080 | Ga0070678_100727272 | |||
| 1081 | Ga0070662_100310950 | |||
| 1082 | Ga0070662_100418223 | |||
| 1083 | Ga0070662_100508094 | |||
| 1084 | Ga0068867_100000001 | |||
| 1085 | Ga0070685_10000337 | |||
| 1086 | Ga0070698_101147047 | |||
| 1087 | Ga0068853_100052401 | |||
| 1088 | Ga0068853_100090889 | |||
| 1089 | Ga0068853_100145477 | |||
| 1090 | Ga0068853_100433929 | |||
| 1091 | Ga0068853_100467657 | |||
| 1092 | Ga0070672_100036776 | |||
| 1093 | Ga0070672_100152509 | |||
| 1094 | Ga0070672_100395991 | |||
| 1095 | Ga0070672_101306826 | |||
| 1096 | Ga0070686_100000003 | |||
| 1097 | Ga0070686_100002775 | |||
| 1098 | Ga0070665_100000036 | |||
| 1099 | Ga0070665_100000054 | |||
| 1100 | Ga0070665_100001022 | |||
| 1101 | Ga0070665_100030492 | |||
| 1102 | Ga0068855_100001528 | |||
| 1103 | Ga0068855_100615771 | |||
| 1104 | Ga0068855_101240129 | |||
| 1105 | Ga0070664_100079213 | |||
| 1106 | Ga0070664_100162682 | |||
| 1107 | Ga0068857_100023152 | |||
| 1108 | Ga0068857_100028662 | |||
| 1109 | Ga0068857_100369753 | |||
| 1110 | Ga0068857_100462268 | |||
| 1111 | Ga0068857_100509124 | |||
| 1112 | Ga0068857_101032563 | |||
| 1113 | Ga0068854_100000752 | |||
| 1114 | Ga0068854_100005589 | |||
| 1115 | Ga0068854_100146281 | |||
| 1116 | Ga0068854_100663389 | |||
| 1117 | Ga0068856_100023608 | |||
| 1118 | Ga0068856_100043123 | |||
| 1119 | Ga0068856_100131386 | |||
| 1120 | Ga0068852_100001463 | |||
| 1121 | Ga0068852_100928977 | |||
| 1122 | Ga0068859_100000805 | |||
| 1123 | Ga0068859_100005780 | |||
| 1124 | Ga0068859_100007191 | |||
| 1125 | Ga0068859_100015597 | |||
| 1126 | Ga0068859_100016795 | |||
| 1127 | Ga0068859_100435092 | |||
| 1128 | Ga0068859_100878436 | |||
| 1129 | Ga0068859_101025050 | |||
| 1130 | Ga0068859_101169205 | |||
| 1131 | Ga0068864_100000004 | |||
| 1132 | Ga0068864_100000010 | |||
| 1133 | Ga0068864_100000403 | |||
| 1134 | Ga0068864_100002670 | |||
| 1135 | Ga0068864_100011361 | |||
| 1136 | Ga0068864_100367328 | |||
| 1137 | Ga0068866_10482294 | |||
| 1138 | Ga0068861_100000367 | |||
| 1139 | Ga0068861_100001727 | |||
| 1140 | Ga0068861_100022984 | |||
| 1141 | Ga0068861_100107803 | |||
| 1142 | Ga0068851_10015546 | |||
| 1143 | Ga0068851_10029450 | |||
| 1144 | Ga0068863_100000001 | |||
| 1145 | Ga0068863_100000002 | |||
| 1146 | Ga0068863_100000034 | |||
| 1147 | Ga0068863_100000192 | |||
| 1148 | Ga0068863_100005416 | |||
| 1149 | Ga0068863_100008282 | |||
| 1150 | Ga0068863_100008897 | |||
| 1151 | Ga0068863_100032685 | |||
| 1152 | Ga0068863_101120545 | |||
| 1153 | Ga0068858_100001988 | |||
| 1154 | Ga0068858_100002719 | |||
| 1155 | Ga0068858_100006177 | |||
| 1156 | Ga0068858_100006359 | |||
| 1157 | Ga0068858_100010198 | |||
| 1158 | Ga0068858_100692600 | |||
| 1159 | Ga0068860_100000001 | |||
| 1160 | Ga0068860_100000002 | |||
| 1161 | Ga0068860_100000148 | |||
| 1162 | Ga0068860_100001343 | |||
| 1163 | Ga0068860_100012019 | |||
| 1164 | Ga0068860_100050733 | |||
| 1165 | Ga0068860_100056693 | |||
| 1166 | Ga0068860_100234850 | |||
| 1167 | Ga0068860_100400906 | |||
| 1168 | Ga0068860_100433271 | |||
| 1169 | Ga0068860_100727545 | |||
| 1170 | Ga0068860_101352587 | |||
| 1171 | Ga0068862_100000002 | |||
| 1172 | Ga0068862_100000016 | |||
| 1173 | Ga0068862_100000280 | |||
| 1174 | Ga0068862_100001230 | |||
| 1175 | Ga0068862_100002391 | |||
| 1176 | Ga0068862_100002643 | |||
| 1177 | Ga0068862_101044601 | |||
| 1178 | Ga0081455_10002896 | |||
| 1179 | Ga0075363_100101922 | |||
| 1180 | Ga0075367_10000022 | |||
| 1181 | Ga0075366_10011245 | |||
| 1182 | Ga0075366_10395081 | |||
| 1183 | Ga0097621_100280401 | |||
| 1184 | Ga0075370_10126490 | |||
| 1185 | Ga0068871_100263974 | |||
| 1186 | Ga0068865_100000659 | |||
| 1187 | Ga0097620_100000805 | |||
| 1188 | Ga0097620_100005780 | |||
| 1189 | Ga0097620_100007191 | |||
| 1190 | Ga0097620_100015597 | |||
| 1191 | Ga0097620_100016795 | |||
| 1192 | Ga0097620_100435110 | |||
| 1193 | Ga0097620_100878340 | |||
| 1194 | Ga0097620_101024875 | |||
| 1195 | Ga0097620_101169055 | |||
| 1196 | Ga0105251_10000318 | |||
| 1197 | Ga0105251_10032111 | |||
| 1198 | Ga0105251_10053937 | |||
| 1199 | Ga0105250_10235011 | |||
| 1200 | Ga0105240_10178147 | |||
| 1201 | Ga0105240_10179382 | |||
| 1202 | Ga0111539_10287142 | |||
| 1203 | Ga0105245_10000509 | |||
| 1204 | Ga0105245_10000910 | |||
| 1205 | Ga0105245_11920801 | |||
| 1206 | Ga0105247_10004644 | |||
| 1207 | Ga0105247_10025107 | |||
| 1208 | Ga0105247_10050538 | |||
| 1209 | Ga0105247_10386331 | |||
| 1210 | Ga0105247_10557647 | |||
| 1211 | Ga0105243_10000042 | |||
| 1212 | Ga0105243_10246949 | |||
| 1213 | Ga0105243_11310688 | |||
| 1214 | Ga0105241_10007217 | |||
| 1215 | Ga0105241_10174237 | |||
| 1216 | Ga0105248_10000010 | |||
| 1217 | Ga0105248_10000053 | |||
| 1218 | Ga0105248_10043510 | |||
| 1219 | Ga0105248_10113344 | |||
| 1220 | Ga0105248_10150901 | |||
| 1221 | Ga0105248_10301083 | |||
| 1222 | Ga0105237_10046212 | |||
| 1223 | Ga0105237_10236734 | |||
| 1224 | Ga0105237_10299721 | |||
| 1225 | Ga0105238_10036032 | |||
| 1226 | Ga0105238_10094707 | |||
| 1227 | Ga0105238_10873275 | |||
| 1228 | Ga0105238_11446930 | |||
| 1229 | Ga0105249_10000026 | |||
| 1230 | Ga0105249_10000041 | |||
| 1231 | Ga0105249_10000103 | |||
| 1232 | Ga0105249_10000748 | |||
| 1233 | Ga0105249_10021968 | |||
| 1234 | Ga0105249_10382895 | |||
| 1235 | Ga0105249_10991245 | |||
| 1236 | Ga0105148_100050 | |||
| 1237 | Ga0105147_102029 | |||
| 1238 | Ga0105239_10014230 | |||
| 1239 | Ga0105239_10363538 | |||
| 1240 | Ga0105239_10392896 | |||
| 1241 | Ga0105239_10472846 | |||
| 1242 | Ga0157373_10047705 | |||
| 1243 | Ga0157373_10069176 | |||
| 1244 | Ga0157373_10148658 | |||
| 1245 | Ga0157373_11083039 | |||
| 1246 | Ga0157371_10357376 | |||
| 1247 | Ga0157370_10000008 | |||
| 1248 | Ga0157370_10055343 | |||
| 1249 | Ga0157370_10444763 | |||
| 1250 | Ga0157369_10003976 | |||
| 1251 | Ga0157369_10017785 | |||
| 1252 | Ga0157369_10252353 | |||
| 1253 | Ga0157369_10530230 | |||
| 1254 | Ga0157378_10016100 | |||
| 1255 | Ga0157378_10331163 | |||
| 1256 | Ga0163162_10004388 | |||
| 1257 | Ga0163162_10129721 | |||
| 1258 | Ga0163162_10166387 | |||
| 1259 | Ga0163162_10297164 | |||
| 1260 | Ga0163162_10422078 | |||
| 1261 | Ga0163162_10622720 | |||
| 1262 | Ga0157372_10193166 | |||
| 1263 | Ga0157372_10286770 | |||
| 1264 | Ga0157372_10307967 | |||
| 1265 | Ga0163163_10011243 | |||
| 1266 | Ga0163163_10013186 | |||
| 1267 | Ga0163163_10312735 | |||
| 1268 | Ga0157380_10000134 | |||
| 1269 | Ga0157380_10001682 | |||
| 1270 | Ga0157380_10001822 | |||
| 1271 | Ga0157380_10010225 | |||
| 1272 | Ga0157380_10047718 | |||
| 1273 | Ga0157377_10998009 | |||
| 1274 | Ga0157379_10010407 | |||
| 1275 | Ga0157379_10013413 | |||
| 1276 | Ga0157379_10218739 | |||
| 1277 | Ga0157379_10635052 | |||
| 1278 | Ga0157376_10000102 | |||
| 1279 | Ga0183363_1001 | |||
| 1280 | Ga0183361_10475 | |||
| 1281 | Ga0163161_10000008 | |||
| 1282 | Ga0163161_10089708 | |||
| 1283 | Ga0163161_10400572 | |||
| 1284 | Ga0163161_10583178 | |||
| 1285 | Ga0163161_10657667 | |||
| 1286 | Ga0206356_11184316 | |||
| 1287 | Ga0213874_10031269 | |||
| 1288 | Ga0213876_10000004 | |||
| 1289 | Ga0213876_10010152 | |||
| 1290 | Ga0213876_10052351 | |||
| 1291 | Ga0207672_1000928 | |||
| 1292 | Ga0209147_102362 | |||
| 1293 | Ga0207427_101178 | |||
| 1294 | Ga0207425_1000026 | |||
| 1295 | Ga0207425_1005446 | |||
| 1296 | Ga0209026_1003126 | |||
| 1297 | Ga0209148_1000338 | |||
| 1298 | Ga0209148_1001156 | |||
| 1299 | Ga0209129_1001922 | |||
| 1300 | Ga0209233_1000066 | |||
| 1301 | Ga0209233_1000207 | |||
| 1302 | Ga0209565_1000010 | |||
| 1303 | Ga0209565_1000064 | |||
| 1304 | Ga0209455_1001029 | |||
| 1305 | Ga0209455_1018015 | |||
| 1306 | Ga0209455_1031397 | |||
| 1307 | Ga0209673_1002611 | |||
| 1308 | Ga0209675_1011012 | |||
| 1309 | Ga0209676_1008246 | |||
| 1310 | Ga0209025_1000551 | |||
| 1311 | Ga0209564_1003529 | |||
| 1312 | Ga0209564_1018595 | |||
| 1313 | Ga0209758_1000004 | |||
| 1314 | Ga0209758_1002673 | |||
| 1315 | Ga0209050_1000001 | |||
| 1316 | Ga0209050_1000026 | |||
| 1317 | Ga0209050_1002186 | |||
| 1318 | Ga0209050_1011661 | |||
| 1319 | Ga0209050_1032649 | |||
| 1320 | Ga0209256_1000034 | |||
| 1321 | Ga0207426_1014974 | |||
| 1322 | Ga0209051_1001333 | |||
| 1323 | Ga0209257_1000009 | |||
| 1324 | Ga0209257_1003053 | |||
| 1325 | Ga0209257_1005333 | |||
| 1326 | Ga0209257_1033094 | |||
| 1327 | Ga0207697_10001015 | |||
| 1328 | Ga0207656_10010757 | |||
| 1329 | Ga0207656_10065292 | |||
| 1330 | Ga0207713_1006739 | |||
| 1331 | Ga0207682_10000992 | |||
| 1332 | Ga0207642_10283774 | |||
| 1333 | Ga0207710_10084334 | |||
| 1334 | Ga0207680_10000004 | |||
| 1335 | Ga0207680_10003517 | |||
| 1336 | Ga0207680_10106744 | |||
| 1337 | Ga0207680_10128707 | |||
| 1338 | Ga0207680_10142662 | |||
| 1339 | Ga0207680_10273218 | |||
| 1340 | Ga0207647_10000839 | |||
| 1341 | Ga0207647_10001182 | |||
| 1342 | Ga0207647_10008705 | |||
| 1343 | Ga0207647_10106379 | |||
| 1344 | Ga0207647_10172401 | |||
| 1345 | Ga0207645_10002769 | |||
| 1346 | Ga0207705_10000027 | |||
| 1347 | Ga0207705_10000915 | |||
| 1348 | Ga0207705_10004780 | |||
| 1349 | Ga0207705_10311488 | |||
| 1350 | Ga0207705_10582636 | |||
| 1351 | Ga0207654_10021273 | |||
| 1352 | Ga0207654_10048248 | |||
| 1353 | Ga0207654_10122914 | |||
| 1354 | Ga0207695_10005452 | |||
| 1355 | Ga0207695_10013577 | |||
| 1356 | Ga0207695_10227937 | |||
| 1357 | Ga0207695_11347990 | |||
| 1358 | Ga0207671_10002604 | |||
| 1359 | Ga0207671_10118564 | |||
| 1360 | Ga0207660_10916929 | |||
| 1361 | Ga0207657_10001109 | |||
| 1362 | Ga0207657_10002470 | |||
| 1363 | Ga0207657_10037177 | |||
| 1364 | Ga0207657_10046474 | |||
| 1365 | Ga0207657_10057152 | |||
| 1366 | Ga0207657_10138328 | |||
| 1367 | Ga0207657_10301401 | |||
| 1368 | Ga0207649_10120586 | |||
| 1369 | Ga0207649_10649026 | |||
| 1370 | Ga0207681_10000008 | |||
| 1371 | Ga0207681_10000013 | |||
| 1372 | Ga0207681_10000178 | |||
| 1373 | Ga0207681_10024610 | |||
| 1374 | Ga0207681_10034761 | |||
| 1375 | Ga0207681_10047884 | |||
| 1376 | Ga0207681_10163401 | |||
| 1377 | Ga0207681_10982933 | |||
| 1378 | Ga0207694_10001135 | |||
| 1379 | Ga0207694_10042400 | |||
| 1380 | Ga0207694_10236334 | |||
| 1381 | Ga0207694_10321454 | |||
| 1382 | Ga0207694_10474218 | |||
| 1383 | Ga0207650_10000008 | |||
| 1384 | Ga0207650_10000083 | |||
| 1385 | Ga0207650_10001666 | |||
| 1386 | Ga0207650_10007720 | |||
| 1387 | Ga0207659_10020945 | |||
| 1388 | Ga0207659_10616645 | |||
| 1389 | Ga0207687_10000877 | |||
| 1390 | Ga0207687_10005573 | |||
| 1391 | Ga0207644_10000006 | |||
| 1392 | Ga0207644_10000030 | |||
| 1393 | Ga0207644_10000046 | |||
| 1394 | Ga0207644_10000570 | |||
| 1395 | Ga0207644_10004648 | |||
| 1396 | Ga0207644_10057001 | |||
| 1397 | Ga0207644_10149696 | |||
| 1398 | Ga0207690_10172008 | |||
| 1399 | Ga0207690_10195570 | |||
| 1400 | Ga0207690_10284841 | |||
| 1401 | Ga0207690_10433939 | |||
| 1402 | Ga0207690_11101010 | |||
| 1403 | Ga0207706_10003238 | |||
| 1404 | Ga0207706_10005292 | |||
| 1405 | Ga0207706_10020074 | |||
| 1406 | Ga0207706_10051297 | |||
| 1407 | Ga0207706_10372936 | |||
| 1408 | Ga0207706_10439719 | |||
| 1409 | Ga0207706_10524235 | |||
| 1410 | Ga0207686_10025934 | |||
| 1411 | Ga0207709_10000226 | |||
| 1412 | Ga0207669_10013513 | |||
| 1413 | Ga0207669_10020516 | |||
| 1414 | Ga0207669_10562223 | |||
| 1415 | Ga0207704_10000001 | |||
| 1416 | Ga0207691_10040972 | |||
| 1417 | Ga0207691_10100109 | |||
| 1418 | Ga0207691_10162189 | |||
| 1419 | Ga0207711_10000035 | |||
| 1420 | Ga0207711_10003703 | |||
| 1421 | Ga0207711_10094340 | |||
| 1422 | Ga0207711_10130631 | |||
| 1423 | Ga0207689_10000596 | |||
| 1424 | Ga0207661_11276985 | |||
| 1425 | Ga0207679_10381299 | |||
| 1426 | Ga0207679_10596048 | |||
| 1427 | Ga0207667_10000109 | |||
| 1428 | Ga0207667_10003169 | |||
| 1429 | Ga0207667_10053655 | |||
| 1430 | Ga0207667_11418109 | |||
| 1431 | Ga0207651_10000002 | |||
| 1432 | Ga0207651_10342638 | |||
| 1433 | Ga0207651_10479242 | |||
| 1434 | Ga0207712_10000001 | |||
| 1435 | Ga0207712_10000069 | |||
| 1436 | Ga0207712_10000460 | |||
| 1437 | Ga0207712_10004601 | |||
| 1438 | Ga0207712_10080829 | |||
| 1439 | Ga0207712_10173337 | |||
| 1440 | Ga0207712_10280737 | |||
| 1441 | Ga0207712_10808153 | |||
| 1442 | Ga0207668_10000020 | |||
| 1443 | Ga0207668_10000140 | |||
| 1444 | Ga0207668_10000256 | |||
| 1445 | Ga0207668_10000294 | |||
| 1446 | Ga0207668_10024318 | |||
| 1447 | Ga0207668_10332636 | |||
| 1448 | Ga0207668_10649278 | |||
| 1449 | Ga0207668_11058104 | |||
| 1450 | Ga0207640_10000312 | |||
| 1451 | Ga0207640_10004411 | |||
| 1452 | Ga0207640_10015179 | |||
| 1453 | Ga0207640_10121481 | |||
| 1454 | Ga0207640_10151533 | |||
| 1455 | Ga0207640_10270149 | |||
| 1456 | Ga0207658_10000002 | |||
| 1457 | Ga0207658_10000068 | |||
| 1458 | Ga0207658_10000069 | |||
| 1459 | Ga0207658_10000575 | |||
| 1460 | Ga0207658_10001256 | |||
| 1461 | Ga0207658_10190280 | |||
| 1462 | Ga0207677_10000530 | |||
| 1463 | Ga0207703_10000501 | |||
| 1464 | Ga0207703_10000677 | |||
| 1465 | Ga0207703_10002971 | |||
| 1466 | Ga0207703_10004439 | |||
| 1467 | Ga0207703_10026618 | |||
| 1468 | Ga0207703_10182370 | |||
| 1469 | Ga0207703_10662250 | |||
| 1470 | Ga0207639_10021378 | |||
| 1471 | Ga0207639_10081762 | |||
| 1472 | Ga0207639_10083571 | |||
| 1473 | Ga0207639_10107040 | |||
| 1474 | Ga0207639_10358941 | |||
| 1475 | Ga0207639_11177800 | |||
| 1476 | Ga0207678_10000622 | |||
| 1477 | Ga0207678_10007415 | |||
| 1478 | Ga0207678_10057383 | |||
| 1479 | Ga0207678_10594002 | |||
| 1480 | Ga0207702_10004186 | |||
| 1481 | Ga0207702_10019205 | |||
| 1482 | Ga0207702_10025134 | |||
| 1483 | Ga0207702_10030279 | |||
| 1484 | Ga0207702_10043899 | |||
| 1485 | Ga0207641_10000001 | |||
| 1486 | Ga0207641_10000002 | |||
| 1487 | Ga0207641_10000057 | |||
| 1488 | Ga0207641_10000074 | |||
| 1489 | Ga0207641_10000818 | |||
| 1490 | Ga0207641_10001290 | |||
| 1491 | Ga0207641_10002303 | |||
| 1492 | Ga0207641_10004282 | |||
| 1493 | Ga0207641_10004485 | |||
| 1494 | Ga0207641_10098794 | |||
| 1495 | Ga0207648_10000001 | |||
| 1496 | Ga0207648_10971539 | |||
| 1497 | Ga0207676_10000005 | |||
| 1498 | Ga0207676_10000012 | |||
| 1499 | Ga0207676_10000184 | |||
| 1500 | Ga0207676_10001239 | |||
| 1501 | Ga0207676_10001402 | |||
| 1502 | Ga0207676_10332862 | |||
| 1503 | Ga0207674_10038181 | |||
| 1504 | Ga0207674_10056687 | |||
| 1505 | Ga0207674_10057607 | |||
| 1506 | Ga0207674_10076729 | |||
| 1507 | Ga0207674_10087862 | |||
| 1508 | Ga0207674_10218212 | |||
| 1509 | Ga0207674_10301106 | |||
| 1510 | Ga0207674_10313831 | |||
| 1511 | Ga0207675_100000822 | |||
| 1512 | Ga0207675_100001962 | |||
| 1513 | Ga0207675_100053569 | |||
| 1514 | Ga0207675_100074606 | |||
| 1515 | Ga0207683_10029537 | |||
| 1516 | Ga0207683_10698720 | |||
| 1517 | Ga0207698_10000389 | |||
| 1518 | Ga0207698_10047484 | |||
| 1519 | Ga0207698_10892759 | |||
| 1520 | Ga0209983_1006951 | |||
| 1521 | Ga0209983_1042998 | |||
| 1522 | Ga0209813_10000224 | |||
| 1523 | Ga0209974_10008265 | |||
| 1524 | Ga0268266_10000042 | |||
| 1525 | Ga0268266_10000134 | |||
| 1526 | Ga0268266_10002533 | |||
| 1527 | Ga0268266_10088377 | |||
| 1528 | Ga0268266_10647305 | |||
| 1529 | Ga0268266_11142087 | |||
| 1530 | Ga0268265_10000003 | |||
| 1531 | Ga0268265_10000006 | |||
| 1532 | Ga0268265_10000064 | |||
| 1533 | Ga0268265_10000233 | |||
| 1534 | Ga0268265_10001032 | |||
| 1535 | Ga0268265_10004641 | |||
| 1536 | Ga0268265_10953429 | |||
| 1537 | Ga0268264_10000001 | |||
| 1538 | Ga0268264_10000006 | |||
| 1539 | Ga0268264_10000010 | |||
| 1540 | Ga0268264_10000217 | |||
| 1541 | Ga0268264_10000381 | |||
| 1542 | Ga0268264_10004037 | |||
| 1543 | Ga0268264_10018242 | |||
| 1544 | Ga0268264_10071486 | |||
| 1545 | Ga0268264_10334121 | |||
| 1546 | Ga0268264_11462896 | |||
| 1547 | Ga0307513_10072284 | |||
| 1548 | Ga0307513_10491966 | |||
| 1549 | Ga0307513_10563205 | |||
| 1550 | Ga0307408_100013448 | |||
| 1551 | Ga0307408_100018574 | |||
| 1552 | Ga0307408_100060456 | |||
| 1553 | Ga0307408_100158245 | |||
| 1554 | Ga0307408_100347793 | |||
| 1555 | Ga0307408_100507895 | |||
| 1556 | Ga0307408_101146973 | |||
| 1557 | Ga0307508_10000638 | |||
| 1558 | Ga0307405_10007541 | |||
| 1559 | Ga0307405_10010822 | |||
| 1560 | Ga0307405_10097237 | |||
| 1561 | Ga0307405_10199373 | |||
| 1562 | Ga0307405_10305053 | |||
| 1563 | Ga0307405_10849756 | |||
| 1564 | Ga0307405_10878420 | |||
| 1565 | Ga0307413_10007582 | |||
| 1566 | Ga0307413_10009480 | |||
| 1567 | Ga0307413_10153083 | |||
| 1568 | Ga0307413_10259436 | |||
| 1569 | Ga0307413_10482965 | |||
| 1570 | Ga0307413_10593898 | |||
| 1571 | Ga0307410_10035955 | |||
| 1572 | Ga0307410_10136674 | |||
| 1573 | Ga0307410_10165458 | |||
| 1574 | Ga0307410_10401319 | |||
| 1575 | Ga0307406_10020839 | |||
| 1576 | Ga0307406_10102595 | |||
| 1577 | Ga0307406_10227093 | |||
| 1578 | Ga0307406_10309430 | |||
| 1579 | Ga0307406_10311602 | |||
| 1580 | Ga0307406_10478355 | |||
| 1581 | Ga0307406_10634569 | |||
| 1582 | Ga0307407_10063086 | |||
| 1583 | Ga0307412_10000339 | |||
| 1584 | Ga0307412_10006640 | |||
| 1585 | Ga0307412_10017510 | |||
| 1586 | Ga0307412_10022161 | |||
| 1587 | Ga0307412_10026305 | |||
| 1588 | Ga0307412_10048489 | |||
| 1589 | Ga0307412_10048621 | |||
| 1590 | Ga0307412_10137959 | |||
| 1591 | Ga0307412_10184436 | |||
| 1592 | Ga0307412_11211802 | |||
| 1593 | Ga0307409_100027015 | |||
| 1594 | Ga0307409_100136565 | |||
| 1595 | Ga0307409_100175442 | |||
| 1596 | Ga0307409_100395009 | |||
| 1597 | Ga0307409_100521075 | |||
| 1598 | Ga0307409_100627784 | |||
| 1599 | Ga0307416_100004454 | |||
| 1600 | Ga0307416_100020485 | |||
| 1601 | Ga0307416_100174215 | |||
| 1602 | Ga0307416_100225994 | |||
| 1603 | Ga0307416_100364285 | |||
| 1604 | Ga0307416_100487236 | |||
| 1605 | Ga0307416_100540706 | |||
| 1606 | Ga0307416_101020888 | |||
| 1607 | Ga0307416_102228501 | |||
| 1608 | Ga0307414_10000446 | |||
| 1609 | Ga0307414_10000911 | |||
| 1610 | Ga0307414_10053390 | |||
| 1611 | Ga0307414_10079900 | |||
| 1612 | Ga0307414_10179918 | |||
| 1613 | Ga0307414_10354869 | |||
| 1614 | Ga0307414_10583640 | |||
| 1615 | Ga0307414_10736606 | |||
| 1616 | Ga0307414_11272025 | |||
| 1617 | Ga0307411_10002059 | |||
| 1618 | Ga0307411_10037372 | |||
| 1619 | Ga0307411_10125437 | |||
| 1620 | Ga0307411_10136322 | |||
| 1621 | Ga0307411_10174859 | |||
| 1622 | Ga0307411_10369713 | |||
| 1623 | Ga0307411_10592212 | |||
| 1624 | Ga0307415_100010444 | |||
| 1625 | Ga0307415_101307983 | |||
| 1626 | Ga0307415_101496816 | |||
| 1627 | Ga0307510_10010127 | |||
| 1628 | Ga0373923_0048672 | |||
| 1629 | Ga0373923_0132806 | |||
| 1630 | Ga0373927_0176280 | |||
| 1631 | Ga0373947_0192963 | |||
| 1632 | Ga0373937_0242097 | |||
| 1633 | Ga0373925_0437435 | |||
| 1634 | Ga0373925_0866795 | |||
| 1635 | Ga0395899_0001239 | |||
| 1636 | Ga0395900_0137923 | |||
| 1637 | Ga0395900_0304059 | |||
| 1638 | Ga0395898_1205440 | |||
| 1639 | Ga0395905_0136583 | |||
| 1640 | Ga0395905_0268838 | |||
| 1641 | Ga0395905_0409127 | |||
| 1642 | Ga0395901_0091016 | |||
| 1643 | Ga0395901_1092795 | |||
| 1644 | Ga0237819_00162 | |||
| 1645 | Ga0436365_0519720 | |||
| 1646 | Ga0436365_1911487 | |||
| 1647 | Ga0436363_1666975 | |||
| 1648 | Ga0436362_0953683 | |||
| 1649 | Ga0439436_0013362 | |||
| 1650 | Ga0439461_0000049 | |||
| 1651 | Ga0439461_0003711 | |||
| 1652 | Ga0439466_0117280 | |||
| 1653 | Ga0439465_0001229 | |||
| 1654 | Ga0451791_0580454 | |||
| 1655 | Ga0451793_1911553 | |||
| 1656 | Ga0451795_1124672 | |||
| 1657 | Ga0451807_0447633 | |||
| 1658 | Ga0439431_0000311 | |||
| 1659 | Ga0439431_0012827 | |||
| 1660 | Ga0439445_0000462 | |||
| 1661 | Ga0439445_0004643 | |||
| 1662 | Ga0439448_0019752 | |||
| 1663 | Ga0439448_0020246 | |||
| 1664 | Ga0439432_004749 | |||
| 1665 | Ga0439452_034811 | |||
| 1666 | Ga0439455_0048156 | |||
| 1667 | Ga0439462_0003792 | |||
| 1668 | Ga0439462_0018038 | |||
| 1669 | Ga0439446_0061242 | |||
| 1670 | Ga0439434_0000250 | |||
| 1671 | Ga0439434_0003638 | |||
| 1672 | Ga0439464_0034923 | |||
| 1673 | Ga0466972_0003330 | |||
| 1674 | Ga0466965_0277966 | |||
| 1675 | Ga0466965_0610381 | |||
| 1676 | Ga0466966_0265393 | |||
| 1677 | Ga0466961_0147828 | |||
| 1678 | Ga0466963_0005238 | |||
| 1679 | Ga0466963_0324948 | |||
| 1680 | Ga0466971_0004060 | |||
| 1681 | Ga0466971_0180213 | |||
| 1682 | Ga0466968_0102816 | |||
| 1683 | Ga0466970_0134492 | |||
| 1684 | Ga0466957_0010079 | |||
| 1685 | Ga0466957_0554489 | |||
| 1686 | Ga0466960_0055450 | |||
| 1687 | Ga0466958_0002871 | |||
| 1688 | Ga0466958_0148670 | |||
| 1689 | Ga0466967_0014351 | |||
| 1690 | Ga0495627_000155 | |||
| 1691 | Ga0495627_009659 | |||
| 1692 | Ga0495638_0001486 | |||
| 1693 | Ga0495638_0167844 | |||
| 1694 | Ga0495638_0269888 | |||
| 1695 | Ga0495638_0323331 | |||
| 1696 | Ga0495585_0022756 | |||
| 1697 | Ga0495585_0032819 | |||
| 1698 | Ga0495607_0040638 | |||
| 1699 | Ga0495583_0002872 | |||
| 1700 | Ga0495583_0034644 | |||
| 1701 | Ga0495610_0001777 | |||
| 1702 | Ga0495631_0182957 | |||
| 1703 | Ga0495632_0000211 | |||
| 1704 | Ga0495632_0070018 | |||
| 1705 | Ga0495637_0001513 | |||
| 1706 | Ga0495637_0049978 | |||
| 1707 | Ga0495637_0057349 | |||
| 1708 | Ga0495643_0000053 | |||
| 1709 | Ga0495643_0267686 | |||
| 1710 | Ga0495643_0317051 | |||
| 1711 | Ga0495648_0020353 | |||
| 1712 | Ga0495648_0109292 | |||
| 1713 | Ga0495648_0251367 | |||
| 1714 | Ga0495663_0000020 | |||
| 1715 | Ga0495663_0281804 | |||
| 1716 | Ga0495654_0000194 | |||
| 1717 | Ga0495654_0075436 | |||
| 1718 | Ga0495654_0285244 | |||
| 1719 | Ga0495597_0028176 | |||
| 1720 | Ga0495633_0002680 | |||
| 1721 | Ga0495633_0178157 | |||
| 1722 | Ga0495668_0004403 | |||
| 1723 | Ga0495668_0007591 | |||
| 1724 | Ga0495668_0009349 | |||
| 1725 | Ga0495668_0183214 | |||
| 1726 | Ga0495611_0066498 | |||
| 1727 | Ga0495625_0000570 | |||
| 1728 | Ga0495625_0317077 | |||
| 1729 | Ga0495625_0438736 | |||
| 1730 | Ga0495661_0040812 | |||
| 1731 | Ga0495669_0025332 | |||
| 1732 | Ga0495670_0024341 | |||
| 1733 | Ga0495670_0046523 | |||
| 1734 | Ga0495670_0048691 | |||
| 1735 | Ga0495670_0077744 | |||
| 1736 | Ga0495671_0000031 | |||
| 1737 | Ga0495649_0103048 | |||
| 1738 | Ga0495649_0165910 | |||
| 1739 | Ga0495660_0257922 | |||
| 1740 | Ga0495673_0047086 | |||
| 1741 | Ga0495681_0000228 | |||
| 1742 | Ga0495681_0018954 | |||
| 1743 | Ga0495681_0065650 | |||
| 1744 | Ga0495686_0000185 | |||
| 1745 | Ga0495686_0000606 | |||
| 1746 | Ga0495686_0046918 | |||
| 1747 | Ga0495686_0113510 | |||
| 1748 | Ga0495686_0123735 | |||
| 1749 | Ga0495686_0655272 | |||
| 1750 | Ga0496101_0059561 | |||
| 1751 | Ga0496102_0617804 | |||
| 1752 | Ga0496102_0617890 | |||
| 1753 | Ga0496102_1135396 | |||
| 1754 | Ga0496102_1237829 | |||
| 1755 | Ga0496103_0001645 | |||
| 1756 | Ga0496104_0284166 | |||
| 1757 | Ga0496105_0157441 | |||
| 1758 | Ga0496106_0052457 | |||
| 1759 | Ga0496108_0543527 | |||
| 1760 | Ga0496109_0239461 | |||
| 1761 | Ga0496109_0978211 | |||
| 1762 | Ga0496110_0536303 | |||
| 1763 | Ga0496111_0237597 | |||
| 1764 | Ga0496115_0322975 | |||
| 1765 | Ga0496116_0031088 | |||
| 1766 | Ga0496116_0104998 | |||
| 1767 | Ga0496116_0116850 | |||
| 1768 | Ga0496117_0011490 | |||
| 1769 | Ga0496117_0015430 | |||
| 1770 | Ga0496117_0060285 | |||
| 1771 | Ga0496118_0000807 | |||
| 1772 | Ga0496118_0019663 | |||
| 1773 | Ga0496118_0034294 | |||
| 1774 | Ga0496120_0151357 | |||
| 1775 | Ga0496121_0001630 | |||
| 1776 | Ga0496121_0259767 | |||
| 1777 | Ga0496121_0344886 | |||
| 1778 | Ga0496122_0201786 | |||
| 1779 | Ga0496123_0001872 | |||
| 1780 | Ga0496123_0075283 | |||
| 1781 | Ga0496123_0358438 | |||
| 1782 | Ga0496124_0012980 | |||
| 1783 | Ga0496125_0018837 | |||
| 1784 | Ga0496125_0039047 | |||
| 1785 | Ga0496125_0123650 | |||
| 1786 | Ga0496125_0157707 | |||
| 1787 | Ga0496125_0289406 | |||
| 1788 | Ga0496125_0326095 | |||
| 1789 | Ga0496125_0530694 | |||
| 1790 | Ga0496126_0016562 | |||
| 1791 | Ga0496126_0670600 | |||
| 1792 | Ga0495678_021780 | |||
| 1793 | Ga0495678_092874 | |||
| 1794 | Ga0495682_0010872 | |||
| 1795 | Ga0501292_000074 | |||
| 1796 | Ga0501293_008171 | |||
| 1797 | Ga0501294_000612 | |||
| 1798 | Ga0501034_0177603 | |||
| 1799 | Ga0501034_0456527 | |||
| 1800 | Ga0501036_0658240 | |||
| 1801 | Ga0501039_0572856 | |||
| 1802 | Ga0501043_0602705 | |||
| 1803 | Ga0501047_0110681 | |||
| 1804 | Ga0501206_000630 | |||
| 1805 | Ga0501222_001135 | |||
| 1806 | Ga0501223_110178 | |||
| 1807 | Ga0501224_003673 | |||
| 1808 | Ga0501227_022681 | |||
| 1809 | Ga0501233_114374 | |||
| 1810 | Ga0501235_003892 | |||
| 1811 | Ga0501235_013506 | |||
| 1812 | Ga0501257_000568 | |||
| 1813 | Ga0501259_001177 | |||
| 1814 | Ga0501261_000602 | |||
| 1815 | Ga0501221_005405 | |||
| 1816 | Ga0501225_0003823 | |||
| 1817 | Ga0501225_0099851 | |||
| 1818 | Ga0501245_004100 | |||
| 1819 | Ga0501241_028950 | |||
| 1820 | Ga0501279_000058 | |||
| 1821 | Ga0501280_000122 | |||
| 1822 | Ga0501280_003611 | |||
| 1823 | Ga0501281_00828 | |||
| 1824 | Ga0501282_000646 | |||
| 1825 | Ga0501283_005863 | |||
| 1826 | Ga0501035_0315471 | |||
| 1827 | Ga0501044_0414353 | |||
| 1828 | Ga0501044_0579176 | |||
| 1829 | nmdc:mga03n38_92290_c1 | |||
| 1830 | nmdc:mga0k408_39696_c1 | |||
| 1831 | nmdc:mga07m45_44971_c1 | |||
| 1832 | Ga0495601_0297390 | |||
| 1833 | Ga0500643_000089 | |||
| 1834 | Ga0500643_000641 | |||
| 1835 | Ga0500643_001043 | |||
| 1836 | Ga0500643_011332 | |||
| 1837 | Ga0500643_011530 | |||
| 1838 | Ga0500643_012809 | |||
| 1839 | Ga0500647_0018649 | |||
| 1840 | Ga0500651_0083340 | |||
| 1841 | Ga0500650_0069216 | |||
| 1842 | Ga0500555_000430 | |||
| 1843 | Ga0500556_0000027 | |||
| 1844 | Ga0500557_061050 | |||
| 1845 | Ga0500562_000417 | |||
| 1846 | Ga0500592_000086 | |||
| 1847 | Ga0500595_165805 | |||
| 1848 | Ga0500597_025281 | |||
| 1849 | Ga0500597_135384 | |||
| 1850 | Ga0500608_065769 | |||
| 1851 | Ga0500614_026476 | |||
| 1852 | Ga0500618_007224 | |||
| 1853 | Ga0500642_0000003 | |||
| 1854 | Ga0500642_0003376 | |||
| 1855 | Ga0500655_000122 | |||
| 1856 | Ga0500658_0007651 | |||
| 1857 | Ga0500658_0147952 | |||
| 1858 | Ga0500559_0005855 | |||
| 1859 | Ga0500559_0028777 | |||
| 1860 | Ga0500559_0070803 | |||
| 1861 | Ga0500559_0086269 | |||
| 1862 | Ga0500559_0374868 | |||
| 1863 | Ga0500568_0003914 | |||
| 1864 | Ga0500568_0119791 | |||
| 1865 | Ga0500573_0000016 | |||
| 1866 | Ga0500577_0047339 | |||
| 1867 | Ga0500577_0154296 | |||
| 1868 | Ga0500590_004273 | |||
| 1869 | Ga0500604_0038857 | |||
| 1870 | Ga0500616_0006486 | |||
| 1871 | Ga0500622_0166598 | |||
| 1872 | Ga0500622_0390728 | |||
| 1873 | Ga0500624_000001 | |||
| 1874 | Ga0500627_0000549 | |||
| 1875 | Ga0500627_0000869 | |||
| 1876 | Ga0500639_068732 | |||
| 1877 | Ga0500636_0056736 | |||
| 1878 | Ga0500637_0000248 | |||
| 1879 | Ga0500570_003257 | |||
| 1880 | Ga0500645_000424 | |||
| 1881 | Ga0500645_100344 | |||
| 1882 | Ga0466962_0015483 | |||
| 1883 | Ga0466962_0017955 | |||
| 1884 | 2585262319 | |||
| 1885 | 2600200446 | |||
| 1886 | 2644037224 | |||
| 1887 | 2644126629 | |||
| 1888 | 2753763778 | |||
| 1889 | 2778123971 | |||
| 1890 | 2809062159 | |||
| 1891 | 2809078123 | |||
| 1892 | 2809082169 | |||
| 1893 | 2819712979 | |||
| 1894 | 2830077676 | |||
| 1895 | 2880519656 | |||
| 1896 | 2919709902 | |||
| 1897 | 2928027358 | |||
| 1898 | 2928527517 | |||
| 1899 | 2928968994 | |||
| 1900 | 2946788562 | |||
| 1901 | 2984558340 | |||
| 1902 | 2984567279 | |||
| 1903 | 2990266586 | |||
| 1904 | 2993358346 | |||
| 1905 | 2993695615 | |||
| 1906 | 8057103477 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tfz-assembly1.cif.gz_B | crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 | 0.8435 | 2 | 144 |
| 4xrt-assembly1.cif.gz_A | crystal structure of the di-domain aro/cyc stfq from the steffimycin biosynthetic pathway | 0.8404 | 3 | 140 |
| 3tvr-assembly1.cif.gz_A | crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi | 0.8376 | 3 | 143 |
| 3tl1-assembly2.cif.gz_B | crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase | 0.8234 | 3 | 143 |
| 5gwp-assembly2.cif.gz_D | crystal structure of rcar3:pp2c wild-type with (+)-aba | 0.8218 | 2 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PNQ2_25_168_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8881 | 2 | 141 | 3.30.530.20 |
| af_O53519_3_143_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8764 | 2 | 138 | 3.30.530.20 |
| af_Q556V1_54_199_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8606 | 4 | 144 | 3.30.530.20 |
| af_A0A1D8PNQ2_25_168_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8593 | 2 | 141 | 3.30.530.20 |
| 3tfzE00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8555 | 2 | 140 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q5R599-F1-model_v4 | Coenzyme Q10A (Uncharacterized protein DKFZp469E1114) | 0.9447 | 4 | 78 |
GO:0005739
GO:0045333 GO:0048039 |
| AF-A0A3B5MWR9-F1-model_v4 | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial | 0.9438 | 2 | 78 |
GO:0005743
GO:0045333 GO:0048039 |
| AF-A0A351KQT9-F1-model_v4 | Ubiquinone-binding protein | 0.943 | 1 | 94 |
GO:0045333
GO:0048039 |
| AF-A0A521UBG5-F1-model_v4 | SRPBCC family protein | 0.9328 | 3 | 108 |
|
| AF-A0A351KQT9-F1-model_v4 | Ubiquinone-binding protein | 0.9242 | 1 | 94 |
GO:0045333
GO:0048039 |