F486672

General Info

Members Datasets Scaffolds Average Seq Length
953 702 1906 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221634|2644194209
Length 469
Sequence AFFKNELDGLHTEGRYRVFADLERHRGSFPRATRHTADGPKDVTVWCSNDYLGMGQNPKVIEAMKNAIDHCGAGAGGTRNISGTTHYHVLLERELADLHGKEAALVFTSGYVSNWAALGTLGAKIPGLVIFSDALNHASMIEGIRYAKCDKVIWKHNDIQDLEAKLAAADPKAPKLIAFESVYSMDGDIAPIKEICDLADKYGAMTYLDEVHAVGMYGPRGGGIAEREGLMDRLTVIEGTLGKAFGVMGGYIAASTALCDFIRSFASGFIFTTALPPALAAGAVASIQHLKVSPFERARHQERVRALRALLDKRGIPHMPNPSHIVPVMVGDAAKCKWISDLLLDNCGVYVQPINYPTVPKKTERLRITPTPLHTDAXARQLRRLRPADQLSDGAEEDRAPAHHADAAAHRCRYRASGRGAALALGALRAGQARRLAWLIHTAIRRLCQWCLPTKLTCQLGWHEHLPQK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
55 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
58 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
98 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
99 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
107 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
179 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
180 2509276019 Ensifer aridi TW10 Isolate Nodule
181 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
182 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
183 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
184 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
185 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
186 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
187 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
188 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
189 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
190 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
191 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
192 2512875024
193 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
194 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
195 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
196 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
197 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
198 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
199 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
200 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
201 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
202 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
203 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
204 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
205 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
206 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
207 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
208 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
209 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
210 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
211 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
212 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
213 2516143018 Ensifer sp. BR816 Isolate Nodule
214 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
215 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
216 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
217 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
218 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
219 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
220 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
221 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
222 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
223 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
224 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
225 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
226 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
227 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
228 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
229 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
230 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
231 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
232 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
233 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
234 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
235 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
236 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
237 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
238 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
239 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
240 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
241 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
242 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
243 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
244 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
245 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
246 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
247 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
248 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
249 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
250 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
251 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
252 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
253 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
254 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
255 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
256 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
257 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
258 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
259 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
260 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
261 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
262 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
263 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
264 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
265 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
266 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
267 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
268 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
269 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
270 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
271 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
272 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
273 2643221557 Ensifer sp. Root558 Isolate Unclassified
274 2643221558 Rhizobium sp. Root149 Isolate Unclassified
275 2643221568 Rhizobium sp. Root564 Isolate Unclassified
276 2643221582 Rhizobium sp. Root651 Isolate Unclassified
277 2643221610 Ensifer sp. Root74 Isolate Unclassified
278 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
279 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
280 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
281 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
282 2643221668 Ensifer sp. Root423 Isolate Unclassified
283 2643221675 Ensifer sp. Root1298 Isolate Unclassified
284 2643221680 Ensifer sp. Root1312 Isolate Unclassified
285 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
286 2643221688 Rhizobium sp. Root482 Isolate Unclassified
287 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
288 2643221693 Rhizobium sp. Root491 Isolate Unclassified
289 2643221718 Rhizobium sp. Root268 Isolate Unclassified
290 2643221719 Rhizobium sp. Root274 Isolate Unclassified
291 2643221723 Ensifer sp. Root278 Isolate Unclassified
292 2643221726 Ensifer sp. Root954 Isolate Unclassified
293 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
294 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
295 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
296 2718217882 Rhizobium sp. N741 Isolate Nodule
297 2718217927 Rhizobium sp. N324 Isolate Nodule
298 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
299 2718218009 Rhizobium sp. N561 Isolate Nodule
300 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
301 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
302 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
303 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
304 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
305 2718218363 Rhizobium sp. N113 Isolate Nodule
306 2718218365 Rhizobium sp. N731 Isolate Nodule
307 2718218366 Rhizobium sp. N621 Isolate Nodule
308 2718218423 Rhizobium sp. N941 Isolate Nodule
309 2721755514 Rhizobium sp. N6212 Isolate Nodule
310 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
311 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
312 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
313 2721755809 Rhizobium sp. N541 Isolate Nodule
314 2721755810 Rhizobium sp. N871 Isolate Nodule
315 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
316 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
317 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
318 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
319 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
320 2728369365 Rhizobium sp. N1341 Isolate Nodule
321 2728369397 Rhizobium sp. N1314 Isolate Nodule
322 2738541293 Rhizobium sp. GV031 Isolate Unclassified
323 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
324 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
325 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
326 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
327 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
328 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
329 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
330 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
331 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
332 2791355262 Rhizobium sp. M1 Isolate Nodule
333 2791355263 Rhizobium chutanense C5 Isolate Nodule
334 2791355264 Rhizobium sp. S9 Isolate Nodule
335 2791355265 Rhizobium sp. H4 Isolate Nodule
336 2791355266 Rhizobium sp. L43 Isolate Nodule
337 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
338 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
339 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
340 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
341 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
342 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
343 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
344 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
345 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
346 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
347 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
348 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
349 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
350 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
351 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
352 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
353 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
354 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
355 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
356 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
357 2838048938 Rhizobium pisi 27/80 Isolate Nodule
358 2838061910 Rhizobium phaseoli L15 Isolate Nodule
359 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
360 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
361 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
362 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
363 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
364 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
365 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
366 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
367 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
368 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
369 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
370 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
371 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
372 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
373 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
374 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
375 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
376 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
377 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
378 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
379 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
380 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
381 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
382 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
383 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
384 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
385 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
386 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
387 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
388 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
389 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
390 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
391 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
392 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
393 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
394 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
395 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
396 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
397 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
398 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
399 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
400 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
401 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
402 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
403 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
404 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
405 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
406 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
407 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
408 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
409 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
410 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
411 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
412 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
413 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
414 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
415 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
416 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
417 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
418 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
419 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
420 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
421 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
422 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
423 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
424 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
425 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
426 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
427 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
428 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
429 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
430 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
431 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
432 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
433 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
434 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
435 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
436 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
437 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
438 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
439 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
440 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
441 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
442 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
443 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
444 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
445 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
446 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
447 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
448 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
449 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
450 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
451 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
452 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
453 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
454 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
455 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
456 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
457 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
458 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
459 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
460 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
461 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
462 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
463 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
464 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
465 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
466 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
467 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
468 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
469 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
470 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
471 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
472 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
473 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
474 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
475 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
476 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
477 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
478 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
479 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
480 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
481 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
482 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
483 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
484 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
485 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
486 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
487 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
488 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
489 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
490 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
491 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
492 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
493 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
494 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
495 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
496 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
497 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
498 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
499 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
500 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
501 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
502 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
503 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
504 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
505 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
506 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
507 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
508 2933599457 Rhizobium phaseoli M3 Isolate Nodule
509 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
510 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
511 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
512 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
513 2936381700 Rhizobium chutanense C16 Isolate Unclassified
514 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
515 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
516 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
517 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
518 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
519 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
520 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
521 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
522 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
523 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
524 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
525 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
526 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
527 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
528 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
529 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
530 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
531 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
532 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
533 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
534 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
535 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
536 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
537 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
538 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
539 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
540 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
541 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
542 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
543 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
544 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
545 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
546 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
547 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
548 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
549 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
550 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
551 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
552 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
553 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
554 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
555 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
556 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
557 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
558 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
559 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
560 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
561 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
562 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
563 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
564 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
565 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
566 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
567 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
568 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
569 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
570 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
571 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
572 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
573 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
574 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
575 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
576 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
577 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
578 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
579 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
580 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
581 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
582 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
583 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
584 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
585 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
586 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
587 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
588 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
589 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
590 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
591 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
592 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
593 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
594 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
595 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
596 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
597 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
598 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
599 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
600 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
601 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
602 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
603 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
604 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
605 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
606 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
607 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
608 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
609 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
610 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
611 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
612 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
613 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
614 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
615 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
616 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
617 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
618 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
619 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
620 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
621 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
622 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
623 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
624 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
625 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
626 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
627 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
628 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
629 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
630 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
631 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
632 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
633 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
634 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
635 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
636 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
637 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
638 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
639 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
640 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
641 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
642 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
643 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
644 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
645 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
646 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
647 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
648 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
649 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
650 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
651 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
652 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
653 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
654 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
655 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
656 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
657 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
658 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
659 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
660 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
661 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
662 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
663 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
664 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
665 8005275841 Rhizobium sp. N4311 Isolate Nodule
666 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
667 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
668 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
669 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
670 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
671 8005395548 Rhizobium sp. R339 Isolate Nodule
672 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
673 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
674 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
675 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
676 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
677 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
678 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
679 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
680 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
681 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
682 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
683 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
684 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
685 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
686 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
687 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
688 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
689 8018176218 Rhizobium sp. N122 Isolate Nodule
690 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
691 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
692 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
693 8024501048 Rhizobium sp. H4 Isolate Nodule
694 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
695 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
696 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
697 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
698 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
699 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
700 8056382006 Rhizobium croatiense 13T Isolate Nodule
701 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
702 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.41
Metatranscriptomes 0.84
Isolates 60.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 12.8
Nodule 46.38
Rhizoplane 1.15
Rhizosphere 22.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000066 3300001979 Bacteria 34178
2 JGI25156J39149_1000033 3300002705 Bacteria 114688
3 JGI25162J39368_1002799 3300002737 Bacteria 6147
4 JGI25162J39368_1003551 3300002737 Bacteria 4394
5 JGI25154J39366_1000058 3300002738 Bacteria 107363
6 JGI25158J39367_1000028 3300002739 Bacteria 33872
7 JGI25158J39367_1005781 3300002739 Bacteria 1800
8 JGI25157J39369_1000009 3300002741 Bacteria 207868
9 JGI25152J39213_1000862 3300002773 Bacteria 14971
10 JGI25152J39213_1003891 3300002773 Bacteria 4908
11 JGI25152J39213_1007403 3300002773 Bacteria 2847
12 JGI25152J39213_1012349 3300002773 Bacteria 1840
13 JGI25150J39212_1000181 3300002774 Bacteria 35419
14 JGI25150J39212_1002835 3300002774 Bacteria 4193
15 JGI25159J45721_1000050 3300002987 Bacteria 57206
16 JGI25159J45721_1001206 3300002987 Bacteria 10999
17 JGI25151J46595_10000081 3300003187 Bacteria 131317
18 JGI25151J46595_10009736 3300003187 Bacteria 4528
19 JGI25151J46595_10046770 3300003187 Bacteria 1512
20 JGI25406J46586_10007946 3300003203 Bacteria 4826
21 JGI25165J46597_1000509 3300003214 Bacteria 37163
22 JGI25165J46597_1000514 3300003214 Bacteria 36799
23 JGI25165J46597_1002614 3300003214 Bacteria 5446
24 JGI25160J50197_1000097 3300003354 Bacteria 87619
25 JGI25160J50197_1003171 3300003354 Bacteria 7466
26 JGI25161J50226_1000155 3300003374 Bacteria 47660
27 JGI25161J50226_1003425 3300003374 Bacteria 3629
28 JGI25161J50226_1004951 3300003374 Bacteria 2694
29 Ga0006562J51391_1013127 3300003578 Bacteria 1480
30 Ga0055526_1000756 3300003771 Bacteria 24169
31 Ga0055526_1001632 3300003771 Bacteria 15747
32 Ga0055526_1003400 3300003771 Bacteria 10130
33 Ga0055526_1013140 3300003771 Bacteria 3533
34 Ga0055524_1001434 3300003775 Bacteria 13695
35 Ga0055524_1002281 3300003775 Bacteria 10014
36 Ga0055524_1006172 3300003775 Bacteria 5234
37 Ga0055536_1002648 3300003781 Bacteria 9945
38 Ga0055536_1010015 3300003781 Bacteria 3830
39 Ga0055528_1001269 3300003790 Bacteria 15941
40 Ga0055528_1001563 3300003790 Bacteria 13736
41 Ga0055528_1019037 3300003790 Bacteria 2298
42 Ga0055540_1005283 3300003792 Bacteria 5493
43 Ga0055540_1006447 3300003792 Bacteria 4657
44 Ga0055540_1012448 3300003792 Bacteria 2669
45 Ga0055531_10000744 3300003794 Bacteria 27459
46 Ga0055543_1000543 3300004625 Bacteria 21152
47 Ga0065165_1000427 3300005262 Bacteria 66083
48 Ga0065165_1014049 3300005262 Bacteria 3131
49 Ga0065165_1020239 3300005262 Bacteria 2348
50 Ga0070670_100000326 3300005331 Bacteria 40332
51 Ga0070691_10008826 3300005341 Bacteria 4615
52 Ga0070695_100040141 3300005545 Bacteria 2962
53 Ga0070665_100003569 3300005548 Bacteria 16491
54 Ga0070665_100049643 3300005548 Bacteria 4210
55 Ga0068855_100088629 3300005563 Bacteria 3574
56 Ga0070664_100019889 3300005564 Bacteria 5526
57 Ga0068856_100012528 3300005614 Bacteria 8209
58 Ga0068856_100050913 3300005614 Bacteria 4084
59 Ga0068851_10040779 3300005834 Bacteria 2334
60 Ga0081540_1020420 3300005983 Bacteria 3985
61 Ga0081539_10001994 3300005985 Bacteria 31016
62 Ga0081539_10012572 3300005985 Bacteria 6501
63 Ga0075365_10000538 3300006038 Bacteria 14556
64 Ga0075368_10016002 3300006042 Bacteria 2789
65 Ga0075369_10020761 3300006186 Bacteria 2691
66 Ga0075370_10018881 3300006353 Bacteria 3744
67 Ga0075431_100000522 3300006847 Bacteria 32229
68 Ga0079104_1000101 3300006946 Bacteria 125456
69 Ga0079104_1001906 3300006946 Bacteria 12584
70 Ga0079104_1003928 3300006946 Bacteria 6638
71 Ga0099826_10000067 3300006948 Bacteria 56132
72 Ga0105240_10000013 3300009093 Bacteria 483458
73 Ga0105243_10008956 3300009148 Bacteria 7650
74 Ga0105237_10000714 3300009545 Bacteria 45945
75 Ga0123341_1000020 3300009765 Bacteria 79523
76 Ga0157373_10009912 3300013100 Bacteria 7023
77 Ga0157373_10093115 3300013100 Bacteria 2122
78 Ga0157371_10000195 3300013102 Bacteria 89727
79 Ga0157370_10000209 3300013104 Bacteria 74351
80 Ga0157370_10001395 3300013104 Bacteria 29952
81 Ga0157370_10148180 3300013104 Bacteria 2185
82 Ga0157369_10042259 3300013105 Bacteria 4973
83 Ga0157369_10042952 3300013105 Bacteria 4929
84 Ga0157369_10083234 3300013105 Bacteria 3422
85 Ga0157369_10109902 3300013105 Bacteria 2931
86 Ga0171463_1004 3300013249 Bacteria 437207
87 Ga0163162_10060866 3300013306 Bacteria 3812
88 Ga0157372_10103374 3300013307 Bacteria 3255
89 Ga0182007_10010973 3300015262 Bacteria 3549
90 Ga0183363_1024 3300015690 Bacteria 54122
91 Ga0214544_1002560 3300021320 Bacteria 38129
92 Ga0214542_1000008 3300021321 Bacteria 278895
93 Ga0214542_1025941 3300021321 Bacteria 2956
94 Ga0214543_1000031 3300021327 Bacteria 206436
95 Ga0214543_1000053 3300021327 Bacteria 141797
96 Ga0228711_1003012 3300022739 Bacteria 26140
97 Ga0228710_1003154 3300022740 Bacteria 26273
98 Ga0209435_100009 3300025206 Bacteria 476614
99 Ga0209436_100296 3300025208 Bacteria 23018
100 Ga0209436_100651 3300025208 Bacteria 14802
101 Ga0209437_100057 3300025233 Bacteria 362922
102 Ga0209437_100107 3300025233 Bacteria 218656
103 Ga0207425_1000034 3300025245 Bacteria 227886
104 Ga0207425_1003822 3300025245 Bacteria 4693
105 Ga0207425_1008225 3300025245 Bacteria 2686
106 Ga0209646_1000018 3300025246 Bacteria 476716
107 Ga0209026_1000068 3300025250 Bacteria 207601
108 Ga0209677_100297 3300025253 Bacteria 32532
109 Ga0209759_1000007 3300025256 Bacteria 476614
110 Ga0209129_1000094 3300025258 Bacteria 172051
111 Ga0209129_1000653 3300025258 Bacteria 23204
112 Ga0209129_1000935 3300025258 Bacteria 17616
113 Ga0209129_1000970 3300025258 Bacteria 17236
114 Ga0209129_1002548 3300025258 Bacteria 8818
115 Ga0209233_1000072 3300025261 Bacteria 363074
116 Ga0209233_1000134 3300025261 Bacteria 202535
117 Ga0209233_1000440 3300025261 Bacteria 28932
118 Ga0209673_1000158 3300025273 Bacteria 143067
119 Ga0209673_1000584 3300025273 Bacteria 57616
120 Ga0209130_1000009 3300025284 Bacteria 498952
121 Ga0209130_1000027 3300025284 Bacteria 327700
122 Ga0209676_1007498 3300025292 Bacteria 5099
123 Ga0209676_1021483 3300025292 Bacteria 2166
124 Ga0209025_1000184 3300025294 Bacteria 155611
125 Ga0209025_1000245 3300025294 Bacteria 127801
126 Ga0209025_1000617 3300025294 Bacteria 63860
127 Ga0209025_1000706 3300025294 Bacteria 56897
128 Ga0209025_1000765 3300025294 Bacteria 53466
129 Ga0209025_1005057 3300025294 Bacteria 10982
130 Ga0209025_1013471 3300025294 Bacteria 5133
131 Ga0209025_1014351 3300025294 Bacteria 4881
132 Ga0209564_1000111 3300025295 Bacteria 212210
133 Ga0209564_1000675 3300025295 Bacteria 50429
134 Ga0209564_1001140 3300025295 Bacteria 31141
135 Ga0209564_1001469 3300025295 Bacteria 23854
136 Ga0209564_1005362 3300025295 Bacteria 7353
137 Ga0209564_1013299 3300025295 Bacteria 3511
138 Ga0209564_1018796 3300025295 Bacteria 2614
139 Ga0209758_1000159 3300025297 Bacteria 155588
140 Ga0209758_1000323 3300025297 Bacteria 92123
141 Ga0209758_1001909 3300025297 Bacteria 22693
142 Ga0209758_1002600 3300025297 Bacteria 18055
143 Ga0209758_1013397 3300025297 Bacteria 4474
144 Ga0209050_1002021 3300025298 Bacteria 18884
145 Ga0209050_1012841 3300025298 Bacteria 3792
146 Ga0209256_1000132 3300025299 Bacteria 160806
147 Ga0209256_1001025 3300025299 Bacteria 32812
148 Ga0209256_1001314 3300025299 Bacteria 26601
149 Ga0209256_1002722 3300025299 Bacteria 13703
150 Ga0209256_1006316 3300025299 Bacteria 6339
151 Ga0209256_1010379 3300025299 Bacteria 3911
152 Ga0209256_1016266 3300025299 Bacteria 2547
153 Ga0207426_1000041 3300025302 Bacteria 433536
154 Ga0207426_1000072 3300025302 Bacteria 327700
155 Ga0207426_1002067 3300025302 Bacteria 13950
156 Ga0209051_1000402 3300025303 Bacteria 60065
157 Ga0209051_1000493 3300025303 Bacteria 50978
158 Ga0209051_1016485 3300025303 Bacteria 3340
159 Ga0209051_1019186 3300025303 Bacteria 2995
160 Ga0209051_1032470 3300025303 Bacteria 1991
161 Ga0209257_1006579 3300025304 Bacteria 7411
162 Ga0209257_1018065 3300025304 Bacteria 2737
163 Ga0207695_10000044 3300025913 Bacteria 440819
164 Ga0207671_10000364 3300025914 Bacteria 64550
165 Ga0207650_10000151 3300025925 Bacteria 83229
166 Ga0207709_10007084 3300025935 Bacteria 6264
167 Ga0207661_10029918 3300025944 Bacteria 4188
168 Ga0207667_10131072 3300025949 Bacteria 2582
169 Ga0207702_10033297 3300026078 Bacteria 4304
170 Ga0209281_1000028 3300027111 Bacteria 440027
171 Ga0209281_1000596 3300027111 Bacteria 41157
172 Ga0209281_1000760 3300027111 Bacteria 30959
173 Ga0209371_1000037 3300027312 Bacteria 367074
174 Ga0209371_1001945 3300027312 Bacteria 12553
175 Ga0209371_1001958 3300027312 Bacteria 12473
176 Ga0209282_1000267 3300027666 Bacteria 26143
177 Ga0209282_1000803 3300027666 Bacteria 16024
178 Ga0268266_10002491 3300028379 Bacteria 19661
179 Ga0307515_10000434 3300028794 Bacteria 100265
180 Ga0307515_10002407 3300028794 Bacteria 40813
181 Ga0307515_10130503 3300028794 Bacteria 2772
182 Ga0268256_1000039 3300030500 Bacteria 354969
183 Ga0268256_1000890 3300030500 Bacteria 20629
184 Ga0268256_1002013 3300030500 Bacteria 11008
185 Ga0307513_10001773 3300031456 Bacteria 30712
186 Ga0307513_10101893 3300031456 Bacteria 2892
187 Ga0307408_100013679 3300031548 Bacteria 5390
188 Ga0307406_10030232 3300031901 Bacteria 3287
189 Ga0307412_10003953 3300031911 Bacteria 8260
190 Ga0307412_10111939 3300031911 Bacteria 1951
191 Ga0315914_1000965 3300031967 Bacteria 40741
192 Ga0315913_1000276 3300033430 Bacteria 40740
193 Ga0315915_1000499 3300033464 Bacteria 40728
194 Ga0373927_0000074 3300035695 Bacteria 72943
195 Ga0395905_0000836 3300037471 Bacteria 40186
196 Ga0395905_0012177 3300037471 Bacteria 8283
197 Ga0400483_057556 3300039062 Bacteria 7499
198 Ga0400483_168905 3300039062 Bacteria 7467
199 Ga0436360_0088138 3300039438 Bacteria 1514
200 Ga0451791_0145945 3300041451 Bacteria 2034
201 Ga0451833_0204696 3300041491 Bacteria 2355
202 Ga0451854_27941 3300041510 Bacteria 1616
203 Ga0452268_27494 3300041907 Bacteria 2122
204 Ga0439449_0008526 3300042007 Bacteria 3894
205 Ga0451577_0294211 3300042876 Bacteria 1471
206 Ga0466968_0038503 3300044735 Bacteria 2009
207 Ga0451576_0000040 3300045051 Bacteria 349778
208 Ga0495638_0036762 3300046460 Bacteria 3117
209 Ga0495605_0000575 3300046474 Bacteria 29803
210 Ga0495606_0001739 3300046507 Bacteria 27980
211 Ga0495610_0000915 3300046512 Bacteria 27419
212 Ga0495632_0001194 3300046519 Bacteria 22047
213 Ga0495625_0002177 3300046660 Bacteria 21760
214 Ga0495657_0110878 3300046675 Bacteria 1738
215 Ga0495589_0068106 3300046794 Bacteria 1742
216 Ga0495600_0024445 3300046809 Bacteria 3888
217 Ga0495604_0127223 3300047317 Bacteria 1835
218 Ga0495686_0000007 3300047472 Bacteria 732622
219 Ga0495686_0000922 3300047472 Bacteria 36620
220 Ga0496114_0137941 3300048917 Bacteria 2110
221 Ga0496116_0000380 3300048919 Bacteria 65998
222 Ga0496116_0004572 3300048919 Bacteria 13124
223 Ga0496116_0007357 3300048919 Bacteria 9783
224 Ga0496116_0036635 3300048919 Bacteria 3429
225 Ga0496116_0071482 3300048919 Bacteria 2197
226 Ga0496117_0000031 3300048920 Bacteria 381048
227 Ga0496117_0001675 3300048920 Bacteria 30978
228 Ga0496117_0002447 3300048920 Bacteria 23390
229 Ga0496117_0003875 3300048920 Bacteria 17001
230 Ga0496117_0017954 3300048920 Bacteria 5889
231 Ga0496118_0002290 3300048921 Bacteria 26056
232 Ga0496118_0002502 3300048921 Bacteria 24644
233 Ga0496118_0033542 3300048921 Bacteria 4210
234 Ga0496120_0002700 3300048923 Bacteria 17386
235 Ga0496120_0010575 3300048923 Bacteria 6422
236 Ga0496120_0049174 3300048923 Bacteria 2421
237 Ga0496121_0000034 3300048924 Bacteria 377095
238 Ga0496121_0002365 3300048924 Bacteria 29031
239 Ga0496121_0002652 3300048924 Bacteria 26846
240 Ga0496121_0015989 3300048924 Bacteria 7781
241 Ga0496121_0041943 3300048924 Bacteria 3989
242 Ga0496121_0049082 3300048924 Bacteria 3583
243 Ga0496121_0075661 3300048924 Bacteria 2688
244 Ga0496122_0000023 3300048925 Bacteria 381035
245 Ga0496122_0000068 3300048925 Bacteria 226155
246 Ga0496122_0000777 3300048925 Bacteria 61385
247 Ga0496122_0003156 3300048925 Bacteria 22048
248 Ga0496122_0006273 3300048925 Bacteria 13725
249 Ga0496122_0017400 3300048925 Bacteria 6725
250 Ga0496122_0050827 3300048925 Bacteria 3157
251 Ga0496123_0000059 3300048926 Bacteria 226155
252 Ga0496123_0000519 3300048926 Bacteria 66923
253 Ga0496123_0034170 3300048926 Bacteria 3646
254 Ga0496123_0061871 3300048926 Bacteria 2402
255 Ga0496124_0000130 3300048927 Bacteria 156467
256 Ga0496124_0000781 3300048927 Bacteria 51927
257 Ga0496124_0000909 3300048927 Bacteria 47773
258 Ga0496124_0001790 3300048927 Bacteria 29882
259 Ga0496124_0007537 3300048927 Bacteria 11548
260 Ga0496124_0010851 3300048927 Bacteria 9172
261 Ga0496124_0017090 3300048927 Bacteria 6858
262 Ga0496124_0070613 3300048927 Bacteria 2896
263 Ga0496125_0000790 3300048928 Bacteria 51640
264 Ga0496125_0006012 3300048928 Bacteria 13278
265 Ga0496125_0027907 3300048928 Bacteria 5107
266 Ga0496125_0169248 3300048928 Bacteria 1471
267 Ga0496126_0000293 3300048929 Bacteria 106340
268 Ga0496126_0000466 3300048929 Bacteria 80395
269 Ga0496126_0085072 3300048929 Bacteria 2788
270 Ga0501031_0022019 3300049568 Bacteria 4153
271 Ga0501031_0148361 3300049568 Bacteria 1532
272 Ga0501032_0002318 3300049569 Bacteria 14925
273 Ga0501032_0003148 3300049569 Bacteria 12688
274 Ga0501032_0015324 3300049569 Bacteria 5411
275 Ga0501032_0070420 3300049569 Bacteria 2332
276 Ga0501032_0089793 3300049569 Bacteria 2039
277 Ga0501032_0091545 3300049569 Bacteria 2017
278 Ga0501033_0000361 3300049570 Bacteria 43373
279 Ga0501033_0001947 3300049570 Bacteria 17975
280 Ga0501033_0015427 3300049570 Bacteria 5796
281 Ga0501033_0097621 3300049570 Bacteria 2146
282 Ga0501033_0106782 3300049570 Bacteria 2039
283 Ga0501034_0000609 3300049571 Bacteria 56233
284 Ga0501034_0001008 3300049571 Bacteria 40385
285 Ga0501034_0011247 3300049571 Bacteria 9290
286 Ga0501034_0015694 3300049571 Bacteria 7780
287 Ga0501034_0040554 3300049571 Bacteria 4712
288 Ga0501034_0046731 3300049571 Bacteria 4374
289 Ga0501034_0064534 3300049571 Bacteria 3675
290 Ga0501034_0073714 3300049571 Bacteria 3422
291 Ga0501034_0082589 3300049571 Bacteria 3215
292 Ga0501034_0107243 3300049571 Bacteria 2785
293 Ga0501034_0108720 3300049571 Bacteria 2764
294 Ga0501034_0253335 3300049571 Bacteria 1704
295 Ga0501036_0015146 3300049572 Bacteria 6439
296 Ga0501036_0095725 3300049572 Bacteria 2510
297 Ga0501037_0006238 3300049573 Bacteria 8719
298 Ga0501037_0019279 3300049573 Bacteria 5029
299 Ga0501037_0097203 3300049573 Bacteria 2127
300 Ga0501038_0000187 3300049574 Bacteria 53566
301 Ga0501038_0000362 3300049574 Bacteria 39190
302 Ga0501038_0000394 3300049574 Bacteria 37908
303 Ga0501038_0011745 3300049574 Bacteria 7990
304 Ga0501038_0133052 3300049574 Bacteria 2039
305 Ga0501038_0145272 3300049574 Bacteria 1937
306 Ga0501039_0000932 3300049575 Bacteria 21347
307 Ga0501039_0002217 3300049575 Bacteria 14363
308 Ga0501039_0079326 3300049575 Bacteria 2554
309 Ga0501040_0103038 3300049576 Bacteria 1992
310 Ga0501043_0001876 3300049579 Bacteria 18021
311 Ga0501043_0002292 3300049579 Bacteria 16231
312 Ga0501043_0006291 3300049579 Bacteria 9534
313 Ga0501043_0022843 3300049579 Bacteria 4905
314 Ga0501046_0001124 3300049580 Bacteria 26161
315 Ga0501046_0042889 3300049580 Bacteria 3605
316 Ga0501047_0011027 3300049581 Bacteria 8551
317 Ga0501047_0024402 3300049581 Bacteria 5804
318 Ga0501047_0092159 3300049581 Bacteria 2908
319 Ga0501047_0133404 3300049581 Bacteria 2363
320 Ga0501047_0171304 3300049581 Bacteria 2039
321 Ga0501047_0177056 3300049581 Bacteria 2000
322 Ga0501067_0000083 3300049583 Bacteria 54765
323 Ga0501067_0001189 3300049583 Bacteria 14130
324 Ga0501067_0072724 3300049583 Bacteria 1905
325 Ga0501068_0005450 3300049584 Bacteria 6963
326 Ga0501068_0044245 3300049584 Bacteria 2680
327 Ga0501068_0045393 3300049584 Bacteria 2647
328 Ga0501069_0001984 3300049585 Bacteria 10236
329 Ga0501070_0002177 3300049586 Bacteria 17230
330 Ga0501070_0104134 3300049586 Bacteria 2347
331 Ga0501071_0034352 3300049587 Bacteria 3609
332 Ga0501073_0000021 3300049589 Bacteria 135534
333 Ga0501073_0018399 3300049589 Bacteria 5049
334 Ga0501073_0020835 3300049589 Bacteria 4728
335 Ga0501073_0027887 3300049589 Bacteria 4035
336 Ga0501074_0017685 3300049590 Bacteria 5178
337 Ga0501077_0000045 3300049593 Bacteria 62973
338 Ga0501079_0028105 3300049741 Bacteria 4315
339 Ga0501079_0059105 3300049741 Bacteria 2958
340 Ga0501080_0000394 3300049742 Bacteria 33653
341 Ga0501080_0047648 3300049742 Bacteria 3990
342 Ga0501083_0013576 3300049744 Bacteria 5695
343 Ga0501083_0023153 3300049744 Bacteria 4309
344 Ga0501035_0000398 3300049822 Bacteria 49830
345 Ga0501035_0001173 3300049822 Bacteria 27300
346 Ga0501035_0005409 3300049822 Bacteria 12071
347 Ga0501035_0006142 3300049822 Bacteria 11308
348 Ga0501035_0148053 3300049822 Bacteria 2039
349 Ga0501044_0025589 3300049823 Bacteria 6256
350 Ga0501044_0186360 3300049823 Bacteria 2039
351 Ga0501045_0026526 3300049824 Bacteria 4168
352 nmdc:mga0yw44_14554_c1 3300050492 Bacteria 4182
353 nmdc:mga0yw44_25318_c1 3300050492 Bacteria 3372
354 nmdc:mga09592_94243_c1 3300050508 Bacteria 2560
355 nmdc:mga0sz30_630_c1 3300050516 Bacteria 13067
356 Ga0500618_000241 3300053125 Bacteria 43403
357 Ga0500618_000464 3300053125 Bacteria 26377
358 Ga0500559_0003811 3300053136 Bacteria 7302
359 Ga0500568_0000082 3300053139 Bacteria 92308
360 Ga0500568_0000640 3300053139 Bacteria 25250
361 Ga0500573_0000126 3300053140 Bacteria 29747
362 Ga0500590_001068 3300053148 Bacteria 10750
363 Ga0500616_0000986 3300053153 Bacteria 30745
364 Ga0500624_000493 3300053157 Bacteria 11543
365 Ga0500634_0068893 3300053161 Bacteria 1857
366 Ga0500636_0000032 3300053177 Bacteria 74084
367 Ga0587084_008216 3300059477 Bacteria 1317
368 Ga0587077_014599 3300059493 Bacteria 1295
369 Ga0587088_010398 3300059508 Bacteria 1362
370 Ga0587090_005326 3300059510 Bacteria 1607
371 Ga0587072_004545 3300059643 Bacteria 2024
372 Ga0501082_0010865 3300060353 Bacteria 7841
373 Ga0501082_0015259 3300060353 Bacteria 6617
374 Ga0501082_0024006 3300060353 Bacteria 5259
375 2644194209 2643221634 Bacteria 6705461
376 2509109408 2508501122 Bacteria 6292184
377 2509378282 2509276019 Bacteria 6802256
378 2509389541 2509276021 Bacteria 7634384
379 2509391672 2509276021 Bacteria 7634384
380 2509446044 2509276033 Bacteria 7180565
381 2509446045 2509276033 Bacteria 7180565
382 2510135108 2510065019 Bacteria 6903379
383 2510306901 2510065057 Bacteria 6649661
384 2510897003 2510461076 Bacteria 8618824
385 2511132026 2510917022 Bacteria 6504556
386 2511171203 2510917026 Bacteria 7046020
387 2511184302 2510917028 Bacteria 6185411
388 2511198179 2510917030 Bacteria 7460662
389 2511503139 2511231052 Bacteria 6974333
390 2512534420 2512047086 Bacteria 6850303
391 2512963788 2512875024 Bacteria 7195110
392 2512973777 2512875026 Bacteria 6861065
393 2513571477 2513237084 Bacteria 7231967
394 2513580679 2513237085 Bacteria 7695351
395 2513587055 2513237086 Bacteria 7265287
396 2513606755 2513237089 Bacteria 6553624
397 2513616890 2513237091 Bacteria 6900273
398 2513630322 2513237093 Bacteria 7545552
399 2513713700 2513237103 Bacteria 7647401
400 2513714266 2513237103 Bacteria 7647401
401 2513722252 2513237104 Bacteria 10034502
402 2513868401 2513237138 Bacteria 7368160
403 2513886293 2513237140 Bacteria 7076289
404 2513903424 2513237143 Bacteria 6664116
405 2513929087 2513237146 Bacteria 7166346
406 2513987455 2513237156 Bacteria 6402557
407 2514008366 2513237160 Bacteria 6650282
408 2515114261 2515075009 Bacteria 7288508
409 2515610881 2515154107 Bacteria 6795637
410 2515639147 2515154113 Bacteria 7807172
411 2515639562 2515154113 Bacteria 7807172
412 2515644900 2515154114 Bacteria 7848616
413 2515646429 2515154114 Bacteria 7848616
414 2515741424 2515154134 Bacteria 7220242
415 2516205448 2516143018 Bacteria 6951533
416 2516894567 2516653046 Bacteria 6989037
417 2517037878 2516653077 Bacteria 7555578
418 2517042152 2516653077 Bacteria 7555578
419 2517042736 2516653077 Bacteria 7555578
420 2517078144 2516653085 Bacteria 7346596
421 2517096913 2517093000 Bacteria 7412387
422 2517408006 2517287029 Bacteria 6905599
423 2517408670 2517287029 Bacteria 6905599
424 2517571221 2517487022 Bacteria 7227575
425 2524453275 2524023207 Bacteria 6813453
426 2530647467 2529292951 Bacteria 6916614
427 2535518903 2534681796 Bacteria 7146037
428 2537874562 2537561587 Bacteria 5425293
429 2551681280 2551306084 Bacteria 8942552
430 2551688846 2551306085 Bacteria 7347181
431 2551693701 2551306086 Bacteria 6843938
432 2551699003 2551306087 Bacteria 7351905
433 2551709200 2551306089 Bacteria 7162724
434 2551721953 2551306090 Bacteria 7953713
435 2551729492 2551306091 Bacteria 7086830
436 2551738606 2551306092 Bacteria 6992595
437 2551743714 2551306093 Bacteria 7064773
438 2554248776 2554235003 Bacteria 5877155
439 2558867234 2558860100 Bacteria 8458965
440 2558868458 2558860100 Bacteria 8458965
441 2559295864 2558860242 Bacteria 5568029
442 2559298122 2558860242 Bacteria 5568029
443 2561467014 2558860983 Bacteria 4133860
444 2585166861 2582581283 Bacteria 6030556
445 2585169300 2582581283 Bacteria 6030556
446 2585201853 2582581294 Bacteria 6626667
447 2585223807 2582581298 Bacteria 7315509
448 2585257476 2582581304 Bacteria 5831370
449 2585266784 2582581306 Bacteria 6450535
450 2585271538 2582581307 Bacteria 6597605
451 2585280603 2582581308 Bacteria 7413247
452 2585327975 2582581315 Bacteria 7318924
453 2585334278 2582581316 Bacteria 7774528
454 2585387825 2582581865 Bacteria 6644329
455 2585526210 2585427526 Bacteria 7258840
456 2585531538 2585427527 Bacteria 7273426
457 2585540637 2585427528 Bacteria 6842387
458 2585543592 2585427528 Bacteria 6842387
459 2585549030 2585427529 Bacteria 7395659
460 2585551516 2585427530 Bacteria 7383882
461 2585563222 2585427531 Bacteria 6992870
462 2585821421 2585427590 Bacteria 6824633
463 2585824111 2585427590 Bacteria 6824633
464 2585838906 2585427593 Bacteria 7141551
465 2585842020 2585427593 Bacteria 7141551
466 2585844691 2585427594 Bacteria 6180594
467 2585902728 2585427608 Bacteria 6544331
468 2585907440 2585427609 Bacteria 6667127
469 2585997668 2585427633 Bacteria 6413184
470 2586002256 2585427634 Bacteria 6455027
471 2587982566 2585428125 Bacteria 6662905
472 2599335000 2599185156 Bacteria 5403036
473 2599420264 2599185170 Bacteria 7295545
474 2599603345 2599185210 Bacteria 5624189
475 2599720223 2599185236 Bacteria 6875203
476 2600193542 2599185352 Bacteria 7228948
477 2600373330 2600254933 Bacteria 4750527
478 2601610749 2600255279 Bacteria 5605316
479 2601747523 2600255308 Bacteria 5611129
480 2616296430 2615840624 Bacteria 6557588
481 2616306853 2615840626 Bacteria 7921970
482 2616557705 2615840698 Bacteria 7319877
483 2617384957 2617270742 Bacteria 6808054
484 2643808234 2643221557 Bacteria 7184309
485 2643813652 2643221558 Bacteria 5460675
486 2643854990 2643221568 Bacteria 5187270
487 2643921389 2643221582 Bacteria 5804683
488 2644068577 2643221610 Bacteria 7480339
489 2644195241 2643221634 Bacteria 6705461
490 2644201541 2643221636 Bacteria 6583769
491 2644209348 2643221637 Bacteria 5345260
492 2644240601 2643221643 Bacteria 5749658
493 2644299991 2643221653 Bacteria 4569637
494 2644379668 2643221668 Bacteria 7306521
495 2644419646 2643221675 Bacteria 7473456
496 2644453003 2643221680 Bacteria 7473610
497 2644484355 2643221686 Bacteria 6310811
498 2644492374 2643221688 Bacteria 5260751
499 2644499914 2643221689 Bacteria 6042950
500 2644521442 2643221693 Bacteria 5513853
501 2644652876 2643221718 Bacteria 5345506
502 2644658217 2643221719 Bacteria 4568197
503 2644677260 2643221723 Bacteria 7095460
504 2644688968 2643221726 Bacteria 7455827
505 2657682580 2657244999 Bacteria 5946535
506 2671113598 2667528174 Bacteria 6435400
507 2692320137 2690316117 Bacteria 6800650
508 2719182846 2718217882 Bacteria 6556348
509 2719184091 2718217882 Bacteria 6556348
510 2719387540 2718217927 Bacteria 6972593
511 2719667185 2718217997 Bacteria 6740740
512 2719669429 2718217997 Bacteria 6740740
513 2719729664 2718218009 Bacteria 6478651
514 2719733563 2718218009 Bacteria 6478651
515 2720493605 2718218199 Bacteria 6740745
516 2720494445 2718218199 Bacteria 6740745
517 2720610782 2718218232 Bacteria 6720332
518 2720615061 2718218232 Bacteria 6720332
519 2720616660 2718218233 Bacteria 6662049
520 2720621854 2718218233 Bacteria 6662049
521 2720628016 2718218235 Bacteria 6630699
522 2720633204 2718218235 Bacteria 6630699
523 2720771596 2718218269 Bacteria 6906114
524 2720776901 2718218269 Bacteria 6906114
525 2721143914 2718218363 Bacteria 6524337
526 2721148958 2718218363 Bacteria 6524337
527 2721156602 2718218365 Bacteria 6274507
528 2721160356 2718218365 Bacteria 6274507
529 2721161289 2718218366 Bacteria 6425255
530 2721165771 2718218366 Bacteria 6425255
531 2721401174 2718218423 Bacteria 6438183
532 2722837242 2721755514 Bacteria 6424414
533 2722841941 2721755514 Bacteria 6424414
534 2723028501 2721755556 Bacteria 6745503
535 2723030858 2721755556 Bacteria 6745503
536 2723562105 2721755684 Bacteria 6859907
537 2723563360 2721755684 Bacteria 6859907
538 2723568807 2721755685 Bacteria 6704835
539 2723571350 2721755685 Bacteria 6704835
540 2724039988 2721755809 Bacteria 6438790
541 2724040818 2721755810 Bacteria 6479005
542 2724046319 2721755810 Bacteria 6479005
543 2724087145 2721755819 Bacteria 6906405
544 2724091508 2721755819 Bacteria 6906405
545 2724100856 2721755822 Bacteria 6726041
546 2724106072 2721755822 Bacteria 6726041
547 2724108098 2721755823 Bacteria 6752556
548 2724111877 2721755823 Bacteria 6752556
549 2725947363 2724679232 Bacteria 7646494
550 2730105324 2728369352 Bacteria 6745171
551 2730109437 2728369352 Bacteria 6745171
552 2730162231 2728369365 Bacteria 6555560
553 2730166081 2728369365 Bacteria 6555560
554 2730295363 2728369397 Bacteria 6274511
555 2730299988 2728369397 Bacteria 6274511
556 2738803917 2738541293 Bacteria 7065685
557 2738947524 2738541317 Bacteria 5340176
558 2766062640 2765235942 Bacteria 7445910
559 2776915367 2775507049 Bacteria 6284736
560 2778173635 2775507266 Bacteria 7392367
561 2792582066 2791355082 Bacteria 5973319
562 2792622076 2791355091 Bacteria 6135441
563 2792628667 2791355092 Bacteria 6248105
564 2793281141 2791355253 Bacteria 5171699
565 2793313525 2791355259 Bacteria 7254731
566 2793332113 2791355262 Bacteria 6774204
567 2793338681 2791355263 Bacteria 6872478
568 2793340839 2791355263 Bacteria 6872478
569 2793346483 2791355264 Bacteria 6429314
570 2793353993 2791355265 Bacteria 6539969
571 2793359516 2791355266 Bacteria 7116587
572 2802721551 2802428858 Bacteria 6636079
573 2802728437 2802428859 Bacteria 6667919
574 2802734436 2802428860 Bacteria 6525526
575 2802741075 2802428861 Bacteria 6534206
576 2802747191 2802428862 Bacteria 6633353
577 2802753899 2802428863 Bacteria 6410669
578 2804753530 2802429268 Bacteria 6094027
579 2805926092 2802429605 Bacteria 6875453
580 2805937041 2802429606 Bacteria 6346811
581 2808988312 2808606387 Bacteria 5697198
582 2819243678 2818991272 Bacteria 4622173
583 2819560874 2818991439 Bacteria 6907412
584 2819611124 2818991448 Bacteria 6772224
585 2819638946 2818991453 Bacteria 7181617
586 2819687120 2818991461 Bacteria 7026071
587 2821128617 2821123053 Bacteria 7836056
588 2838018459 2838016132 Bacteria 6577831
589 2838024138 2838022645 Bacteria 6494267
590 2838030812 2838029111 Bacteria 6603031
591 2838040471 2838035591 Bacteria 7166484
592 2838053691 2838048938 Bacteria 6044578
593 2838062447 2838061910 Bacteria 6794874
594 2838071998 2838068647 Bacteria 6208656
595 2838072712 2838068647 Bacteria 6208656
596 2838078344 2838074704 Bacteria 6785777
597 2838672939 2838668709 Bacteria 6671819
598 2838678763 2838675328 Bacteria 4909118
599 2838684015 2838680041 Bacteria 6545511
600 2838690110 2838686498 Bacteria 7807632
601 2838698544 2838694306 Bacteria 6853137
602 2838705583 2838701080 Bacteria 6669771
603 2838711659 2838707686 Bacteria 6619912
604 2838718148 2838714209 Bacteria 5525906
605 2838723060 2838719591 Bacteria 5523910
606 2838728215 2838724970 Bacteria 4908691
607 2838741634 2838736955 Bacteria 5760694
608 2838744781 2838742623 Bacteria 7396178
609 2841845532 2841840854 Bacteria 5761912
610 2841850617 2841846520 Bacteria 5345850
611 2841857912 2841851746 Bacteria 7532261
612 2841863131 2841859092 Bacteria 5436171
613 2841867893 2841864319 Bacteria 6742987
614 2842081460 2842077413 Bacteria 6508645
615 2842116288 2842110456 Bacteria 7656360
616 2842121763 2842118031 Bacteria 7033875
617 2842128873 2842124991 Bacteria 5346824
618 2842133655 2842130223 Bacteria 4909145
619 2842145235 2842140634 Bacteria 5759631
620 2842149913 2842146304 Bacteria 5957337
621 2842155433 2842152218 Bacteria 4908957
622 2842161008 2842156927 Bacteria 6894975
623 2842166526 2842163707 Bacteria 6916235
624 2842174610 2842170452 Bacteria 5525737
625 2842179269 2842175837 Bacteria 4908771
626 2842184624 2842180545 Bacteria 6888678
627 2842190572 2842187318 Bacteria 5524014
628 2842195008 2842192696 Bacteria 6147454
629 2842201732 2842198810 Bacteria 6608673
630 2842207285 2842205361 Bacteria 6340321
631 2842215104 2842211629 Bacteria 5523832
632 2842227825 2842224351 Bacteria 5524473
633 2842232207 2842229732 Bacteria 7475766
634 2842240778 2842237096 Bacteria 6620661
635 2842246622 2842243621 Bacteria 7421798
636 2842255263 2842250916 Bacteria 6579627
637 2842261276 2842257432 Bacteria 7401195
638 2842269037 2842264693 Bacteria 6472963
639 2842274130 2842271015 Bacteria 7807131
640 2842281004 2842278818 Bacteria 6340002
641 2842288383 2842285085 Bacteria 6011953
642 2842295117 2842291075 Bacteria 7076806
643 2842306011 2842304105 Bacteria 7023636
644 2842311285 2842311132 Bacteria 6616990
645 2842320986 2842317721 Bacteria 6793725
646 2842346715 2842341865 Bacteria 7003929
647 2842366397 2842363717 Bacteria 6844742
648 2842374865 2842370503 Bacteria 7038661
649 2842381516 2842377471 Bacteria 7140707
650 2842388586 2842384541 Bacteria 7057858
651 2842396082 2842395702 Bacteria 6780583
652 2842396903 2842395702 Bacteria 6780583
653 2842406271 2842402390 Bacteria 6681310
654 2842412856 2842409023 Bacteria 6687331
655 2842419265 2842415677 Bacteria 6596907
656 2842425630 2842422224 Bacteria 6239196
657 2842426190 2842422224 Bacteria 6239196
658 2842433270 2842428310 Bacteria 6767288
659 2842439696 2842434925 Bacteria 6502746
660 2842446225 2842441272 Bacteria 6769273
661 2842448906 2842447887 Bacteria 6754142
662 2842453796 2842447887 Bacteria 6754142
663 2842467420 2842462802 Bacteria 6588055
664 2842474085 2842469257 Bacteria 6752936
665 2842477544 2842475841 Bacteria 6603183
666 2842488014 2842482326 Bacteria 7212537
667 2842491038 2842489311 Bacteria 6620893
668 2842498376 2842495871 Bacteria 6820686
669 2842504583 2842502639 Bacteria 6604161
670 2842520131 2842515876 Bacteria 5436280
671 2842524172 2842521101 Bacteria 6569494
672 2842524344 2842521101 Bacteria 6569494
673 2842926189 2842922631 Bacteria 5824079
674 2844457192 2844454524 Bacteria 7952546
675 2847420655 2847417321 Bacteria 6913799
676 2848995486 2848992105 Bacteria 6810864
677 2850082468 2850079185 Bacteria 6848280
678 2852391565 2852387548 Bacteria 8025568
679 2854897016 2854896431 Bacteria 5869725
680 2854917164 2854916844 Bacteria 5725939
681 2855827186 2855825444 Bacteria 6785811
682 2855842580 2855839649 Bacteria 7135830
683 2855878014 2855872281 Bacteria 6964271
684 2857521133 2857516855 Bacteria 7787325
685 2857534230 2857531043 Bacteria 6754041
686 2858803391 2858800743 Bacteria 6603254
687 2891050523 2891048133 Bacteria 4447501
688 2891373731 2891373044 Bacteria 5202277
689 2896388047 2896384573 Bacteria 7700774
690 2899795230 2899792073 Bacteria 4926588
691 2899808151 2899803654 Bacteria 5577784
692 2899848254 2899845264 Bacteria 5672268
693 2913300005 2913295892 Bacteria 6333755
694 2913312432 2913308742 Bacteria 5350706
695 2915984941 2915980308 Bacteria 6624279
696 2915988858 2915986958 Bacteria 6739310
697 2915996940 2915993759 Bacteria 7016183
698 2916004059 2916000859 Bacteria 6865702
699 2916008458 2916007675 Bacteria 6898660
700 2916020929 2916014648 Bacteria 6946486
701 2916026994 2916021584 Bacteria 6854472
702 2916033608 2916028427 Bacteria 6748433
703 2916039539 2916035215 Bacteria 6755766
704 2916045490 2916041962 Bacteria 6820487
705 2916051159 2916048683 Bacteria 6543552
706 2916057530 2916055098 Bacteria 6758838
707 2916066848 2916061851 Bacteria 6737736
708 2916082369 2916076590 Bacteria 6596108
709 2919105267 2919100787 Bacteria 7710546
710 2919118594 2919114240 Bacteria 5700270
711 2919170676 2919166419 Bacteria 4952238
712 2919175902 2919171160 Bacteria 6499771
713 2919410945 2919408235 Bacteria 6149349
714 2920760526 2920760137 Bacteria 7427611
715 2920825765 2920822456 Bacteria 6897201
716 2921208332 2921201388 Bacteria 6926299
717 2921212423 2921208531 Bacteria 6745326
718 2921241068 2921237296 Bacteria 6876710
719 2921249563 2921244191 Bacteria 6568419
720 2921255612 2921250672 Bacteria 6677771
721 2921262151 2921257292 Bacteria 6808382
722 2921270604 2921263974 Bacteria 6864552
723 2921284117 2921282425 Bacteria 6826397
724 2921290823 2921289301 Bacteria 7316391
725 2921297108 2921296804 Bacteria 7176999
726 2923559606 2923556063 Bacteria 6793593
727 2924150133 2924144063 Bacteria 6883928
728 2924154122 2924150972 Bacteria 7169444
729 2924160255 2924158325 Bacteria 7188855
730 2924169302 2924165586 Bacteria 7260590
731 2924175915 2924172951 Bacteria 6749356
732 2924181662 2924179722 Bacteria 6843264
733 2924192233 2924186466 Bacteria 6876637
734 2924195310 2924193448 Bacteria 6955718
735 2924205998 2924200457 Bacteria 6757188
736 2924209428 2924207177 Bacteria 6917007
737 2924218642 2924214083 Bacteria 7080103
738 2924222731 2924221636 Bacteria 7113495
739 2924233108 2924228884 Bacteria 6633132
740 2926755124 2926754445 Bacteria 5964435
741 2926762284 2926760298 Bacteria 5505990
742 2929141771 2929138655 Bacteria 5810547
743 2933010717 2933006813 Bacteria 4912075
744 2933015608 2933011516 Bacteria 5439334
745 2933572515 2933570622 Bacteria 7023390
746 2933592505 2933586486 Bacteria 7667493
747 2933597651 2933594066 Bacteria 5594265
748 2933603148 2933599457 Bacteria 5858799
749 2935897807 2935894831 Bacteria 6620579
750 2935903802 2935901341 Bacteria 7341747
751 2936369746 2936367885 Bacteria 7324495
752 2936378935 2936375103 Bacteria 6652732
753 2936385848 2936381700 Bacteria 7006523
754 2936388214 2936381700 Bacteria 7006523
755 2936997640 2936996657 Bacteria 6298727
756 2937008661 2937002841 Bacteria 6934057
757 2937013398 2937009748 Bacteria 6746052
758 2937020264 2937016420 Bacteria 6782579
759 2937024686 2937023124 Bacteria 6815156
760 2937034288 2937029754 Bacteria 6424026
761 2937040954 2937036028 Bacteria 6846469
762 2937044165 2937042894 Bacteria 6741576
763 2937050731 2937049772 Bacteria 6757901
764 2937063314 2937056579 Bacteria 7107896
765 2937067917 2937063883 Bacteria 7199456
766 2937075608 2937071275 Bacteria 6984483
767 2937083086 2937078374 Bacteria 6610289
768 2937086757 2937084907 Bacteria 6618516
769 2937093992 2937091812 Bacteria 6979387
770 2937103291 2937098957 Bacteria 7249374
771 2937111623 2937106411 Bacteria 6947143
772 2937118006 2937113482 Bacteria 6505872
773 2937121814 2937119839 Bacteria 6597547
774 2937127909 2937126314 Bacteria 6771275
775 2937846934 2937843397 Bacteria 5256375
776 2941501171 2941499720 Bacteria 7599444
777 2957380408 2957375807 Bacteria 6425588
778 2957383781 2957382221 Bacteria 6737050
779 2957394365 2957388812 Bacteria 6778072
780 2957398175 2957395598 Bacteria 6822399
781 2957404016 2957402308 Bacteria 6741770
782 2957409926 2957408893 Bacteria 6558585
783 2957417922 2957415311 Bacteria 6991633
784 2957431543 2957430029 Bacteria 7022557
785 2957443213 2957437181 Bacteria 6568994
786 2957447552 2957443900 Bacteria 6869977
787 2957455580 2957450854 Bacteria 6765715
788 2957458416 2957457609 Bacteria 6967680
789 2957469889 2957464669 Bacteria 6568877
790 2957471813 2957471148 Bacteria 6797643
791 2957480063 2957478035 Bacteria 6756658
792 2957485532 2957484790 Bacteria 6703082
793 2957493658 2957491536 Bacteria 6695180
794 2957502151 2957498199 Bacteria 7126688
795 2957512054 2957505466 Bacteria 7253085
796 2958065389 2958064165 Bacteria 7158582
797 2960586794 2960584000 Bacteria 6864594
798 2960595792 2960591022 Bacteria 6622873
799 2960599317 2960597568 Bacteria 6550735
800 2960608013 2960603979 Bacteria 6898737
801 2960612098 2960610863 Bacteria 6691244
802 2960618248 2960617483 Bacteria 6727748
803 2960627397 2960624210 Bacteria 6875384
804 2960634840 2960631154 Bacteria 6732508
805 2960640766 2960637947 Bacteria 7296468
806 2960649553 2960645483 Bacteria 7211087
807 2960655474 2960652885 Bacteria 7083688
808 2960663514 2960660292 Bacteria 7041660
809 2960671825 2960667422 Bacteria 6763020
810 2960674982 2960674078 Bacteria 6609048
811 2960685496 2960680706 Bacteria 6624464
812 2960693754 2960687367 Bacteria 6535474
813 2960700005 2960693952 Bacteria 6749742
814 2964609331 2964607997 Bacteria 7101408
815 2964621105 2964615318 Bacteria 6809089
816 2964628813 2964621998 Bacteria 6834995
817 2964630355 2964628898 Bacteria 7083044
818 2964641969 2964636051 Bacteria 7091832
819 2964645325 2964643177 Bacteria 6820887
820 2964656184 2964649959 Bacteria 6675118
821 2964657204 2964656573 Bacteria 7100150
822 2964667946 2964663802 Bacteria 7019362
823 2964671849 2964670856 Bacteria 6851364
824 2964679275 2964678106 Bacteria 6792020
825 2964690824 2964685014 Bacteria 6839111
826 2964695310 2964691889 Bacteria 6802758
827 2964702573 2964698721 Bacteria 6765331
828 2964709336 2964705432 Bacteria 7114648
829 2964719162 2964712639 Bacteria 6695970
830 2964722500 2964719344 Bacteria 7286602
831 2967668166 2967664464 Bacteria 6948836
832 2967673554 2967671571 Bacteria 7021409
833 2967682725 2967678726 Bacteria 7264382
834 2967691063 2967686174 Bacteria 6678622
835 2967699424 2967693043 Bacteria 6804451
836 2967718215 2967714385 Bacteria 7000047
837 2967725337 2967721400 Bacteria 7073753
838 2967733453 2967728569 Bacteria 6641507
839 2967736726 2967735183 Bacteria 6827012
840 2967746656 2967742019 Bacteria 6794534
841 2967749958 2967748971 Bacteria 6733771
842 2967757979 2967755722 Bacteria 6814706
843 2967762766 2967762386 Bacteria 6923502
844 2967774877 2967769361 Bacteria 6587838
845 2967778459 2967775926 Bacteria 6738189
846 2970023418 2970019648 Bacteria 7072033
847 2970032318 2970026789 Bacteria 6785236
848 2970038327 2970033650 Bacteria 7118744
849 2970047683 2970040964 Bacteria 6731123
850 2970061118 2970054988 Bacteria 6611507
851 2970064867 2970061556 Bacteria 7099761
852 2970073130 2970068827 Bacteria 7123112
853 2970079709 2970076120 Bacteria 6697332
854 2970086455 2970082768 Bacteria 6183754
855 2970091299 2970088815 Bacteria 6933825
856 2970099493 2970095765 Bacteria 6936963
857 2970106793 2970102677 Bacteria 6812532
858 2970115919 2970109326 Bacteria 6863976
859 2970122365 2970116247 Bacteria 6501857
860 2970127483 2970122695 Bacteria 6625855
861 2970135493 2970129317 Bacteria 6806560
862 2970138282 2970136068 Bacteria 7207982
863 2970148271 2970143518 Bacteria 6446480
864 2970156724 2970149975 Bacteria 6779706
865 2970159130 2970156795 Bacteria 7168044
866 2970167979 2970164137 Bacteria 6861252
867 2970176769 2970170962 Bacteria 6876229
868 2970184151 2970177841 Bacteria 6768001
869 2970185767 2970184632 Bacteria 7054431
870 2970198138 2970191845 Bacteria 7032787
871 2977520255 2977516862 Bacteria 6940108
872 2977524595 2977523885 Bacteria 6960446
873 2977535950 2977530762 Bacteria 6951399
874 2977541509 2977537788 Bacteria 6929320
875 2977551015 2977544691 Bacteria 6875412
876 2977553382 2977551784 Bacteria 7125765
877 2977565248 2977558990 Bacteria 6863948
878 2977571541 2977565890 Bacteria 6901543
879 2977576466 2977572785 Bacteria 6763888
880 2977585621 2977579622 Bacteria 6772100
881 2978972512 2978969890 Bacteria 5400756
882 2979092446 2979089926 Bacteria 5670289
883 2979100163 2979095461 Bacteria 5669583
884 2979104417 2979100975 Bacteria 5423623
885 2984513787 2984509177 Bacteria 5274802
886 2984522635 2984518228 Bacteria 5277463
887 2984541941 2984537506 Bacteria 5277481
888 2984590766 2984587000 Bacteria 5263363
889 2984601371 2984601300 Bacteria 5455244
890 2989350774 2989349275 Bacteria 6349068
891 2989771424 2989771324 Bacteria 5605128
892 2989779967 2989776772 Bacteria 4843317
893 2995395333 2995392953 Bacteria 4539380
894 3003930799 3003930520 Bacteria 5667563
895 3005409520 3005409236 Bacteria 7188837
896 3005417929 3005416602 Bacteria 7064308
897 3005421753 3005416602 Bacteria 7064308
898 3005449539 3005445848 Bacteria 6906074
899 3005457032 3005452660 Bacteria 5889319
900 639645558 639633055 Bacteria 7751309
901 639650262 639633055 Bacteria 7751309
902 648737020 648276728 Bacteria 6968865
903 650741078 650716007 Bacteria 5573770
904 8003573864 8003570095 Bacteria 5747666
905 8003995162 8003992118 Bacteria 7266902
906 8004002880 8003999396 Bacteria 7063185
907 8005249111 8005246636 Bacteria 4933972
908 8005282293 8005275841 Bacteria 6929066
909 8005286875 8005282627 Bacteria 6675747
910 8005287533 8005282627 Bacteria 6675747
911 8005294056 8005289223 Bacteria 6634003
912 8005305841 8005301065 Bacteria 6614431
913 8005307302 8005301065 Bacteria 6614431
914 8005316096 8005314921 Bacteria 7072929
915 8005318057 8005314921 Bacteria 7072929
916 8005319547 8005314921 Bacteria 7072929
917 8005381709 8005376324 Bacteria 6590079
918 8005400933 8005395548 Bacteria 6806915
919 8005433711 8005430974 Bacteria 6689030
920 8005435979 8005430974 Bacteria 6689030
921 8005464953 8005460587 Bacteria 7157962
922 8005490176 8005484373 Bacteria 6297373
923 8005497547 8005497431 Bacteria 6477605
924 8005546553 8005542996 Bacteria 7077758
925 8005560994 8005556819 Bacteria 6908598
926 8005565619 8005563573 Bacteria 7153261
927 8005623280 8005619151 Bacteria 7030230
928 8005646834 8005645114 Bacteria 6950293
929 8005660710 8005658619 Bacteria 4500593
930 8005668952 8005668836 Bacteria 6953162
931 8005687584 8005682033 Bacteria 6726518
932 8005693214 8005688590 Bacteria 6610080
933 8005695594 8005695170 Bacteria 6912330
934 8005697001 8005695170 Bacteria 6912330
935 8018129492 8018127388 Bacteria 7351159
936 8018134203 8018127388 Bacteria 7351159
937 8018154488 8018150411 Bacteria 5549903
938 8018165270 8018163183 Bacteria 7277977
939 8018177022 8018176218 Bacteria 6896178
940 8023686369 8023680758 Bacteria 7729763
941 8024484226 8024479707 Bacteria 6954785
942 8024490735 8024486573 Bacteria 6540512
943 8024502451 8024501048 Bacteria 6427847
944 8046768159 8046767195 Bacteria 7547379
945 8049296094 8049293176 Bacteria 6128433
946 8054463675 8054460903 Bacteria 4872905
947 8054558863 8054558443 Bacteria 5204801
948 8055435652 8055431914 Bacteria 4551896
949 8056375831 8056375014 Bacteria 7006639
950 8056378479 8056375014 Bacteria 7006639
951 8056383931 8056382006 Bacteria 6408074
952 8056878139 8056875544 Bacteria 4355797
953 8057581480 8057575449 Bacteria 7367519
954 JGI24740J21852_10000066
955 JGI25156J39149_1000033
956 JGI25162J39368_1002799
957 JGI25162J39368_1003551
958 JGI25154J39366_1000058
959 JGI25158J39367_1000028
960 JGI25158J39367_1005781
961 JGI25157J39369_1000009
962 JGI25152J39213_1000862
963 JGI25152J39213_1003891
964 JGI25152J39213_1007403
965 JGI25152J39213_1012349
966 JGI25150J39212_1000181
967 JGI25150J39212_1002835
968 JGI25159J45721_1000050
969 JGI25159J45721_1001206
970 JGI25151J46595_10000081
971 JGI25151J46595_10009736
972 JGI25151J46595_10046770
973 JGI25406J46586_10007946
974 JGI25165J46597_1000509
975 JGI25165J46597_1000514
976 JGI25165J46597_1002614
977 JGI25160J50197_1000097
978 JGI25160J50197_1003171
979 JGI25161J50226_1000155
980 JGI25161J50226_1003425
981 JGI25161J50226_1004951
982 Ga0006562J51391_1013127
983 Ga0055526_1000756
984 Ga0055526_1001632
985 Ga0055526_1003400
986 Ga0055526_1013140
987 Ga0055524_1001434
988 Ga0055524_1002281
989 Ga0055524_1006172
990 Ga0055536_1002648
991 Ga0055536_1010015
992 Ga0055528_1001269
993 Ga0055528_1001563
994 Ga0055528_1019037
995 Ga0055540_1005283
996 Ga0055540_1006447
997 Ga0055540_1012448
998 Ga0055531_10000744
999 Ga0055543_1000543
1000 Ga0065165_1000427
1001 Ga0065165_1014049
1002 Ga0065165_1020239
1003 Ga0070670_100000326
1004 Ga0070691_10008826
1005 Ga0070695_100040141
1006 Ga0070665_100003569
1007 Ga0070665_100049643
1008 Ga0068855_100088629
1009 Ga0070664_100019889
1010 Ga0068856_100012528
1011 Ga0068856_100050913
1012 Ga0068851_10040779
1013 Ga0081540_1020420
1014 Ga0081539_10001994
1015 Ga0081539_10012572
1016 Ga0075365_10000538
1017 Ga0075368_10016002
1018 Ga0075369_10020761
1019 Ga0075370_10018881
1020 Ga0075431_100000522
1021 Ga0079104_1000101
1022 Ga0079104_1001906
1023 Ga0079104_1003928
1024 Ga0099826_10000067
1025 Ga0105240_10000013
1026 Ga0105243_10008956
1027 Ga0105237_10000714
1028 Ga0123341_1000020
1029 Ga0157373_10009912
1030 Ga0157373_10093115
1031 Ga0157371_10000195
1032 Ga0157370_10000209
1033 Ga0157370_10001395
1034 Ga0157370_10148180
1035 Ga0157369_10042259
1036 Ga0157369_10042952
1037 Ga0157369_10083234
1038 Ga0157369_10109902
1039 Ga0171463_1004
1040 Ga0163162_10060866
1041 Ga0157372_10103374
1042 Ga0182007_10010973
1043 Ga0183363_1024
1044 Ga0214544_1002560
1045 Ga0214542_1000008
1046 Ga0214542_1025941
1047 Ga0214543_1000031
1048 Ga0214543_1000053
1049 Ga0228711_1003012
1050 Ga0228710_1003154
1051 Ga0209435_100009
1052 Ga0209436_100296
1053 Ga0209436_100651
1054 Ga0209437_100057
1055 Ga0209437_100107
1056 Ga0207425_1000034
1057 Ga0207425_1003822
1058 Ga0207425_1008225
1059 Ga0209646_1000018
1060 Ga0209026_1000068
1061 Ga0209677_100297
1062 Ga0209759_1000007
1063 Ga0209129_1000094
1064 Ga0209129_1000653
1065 Ga0209129_1000935
1066 Ga0209129_1000970
1067 Ga0209129_1002548
1068 Ga0209233_1000072
1069 Ga0209233_1000134
1070 Ga0209233_1000440
1071 Ga0209673_1000158
1072 Ga0209673_1000584
1073 Ga0209130_1000009
1074 Ga0209130_1000027
1075 Ga0209676_1007498
1076 Ga0209676_1021483
1077 Ga0209025_1000184
1078 Ga0209025_1000245
1079 Ga0209025_1000617
1080 Ga0209025_1000706
1081 Ga0209025_1000765
1082 Ga0209025_1005057
1083 Ga0209025_1013471
1084 Ga0209025_1014351
1085 Ga0209564_1000111
1086 Ga0209564_1000675
1087 Ga0209564_1001140
1088 Ga0209564_1001469
1089 Ga0209564_1005362
1090 Ga0209564_1013299
1091 Ga0209564_1018796
1092 Ga0209758_1000159
1093 Ga0209758_1000323
1094 Ga0209758_1001909
1095 Ga0209758_1002600
1096 Ga0209758_1013397
1097 Ga0209050_1002021
1098 Ga0209050_1012841
1099 Ga0209256_1000132
1100 Ga0209256_1001025
1101 Ga0209256_1001314
1102 Ga0209256_1002722
1103 Ga0209256_1006316
1104 Ga0209256_1010379
1105 Ga0209256_1016266
1106 Ga0207426_1000041
1107 Ga0207426_1000072
1108 Ga0207426_1002067
1109 Ga0209051_1000402
1110 Ga0209051_1000493
1111 Ga0209051_1016485
1112 Ga0209051_1019186
1113 Ga0209051_1032470
1114 Ga0209257_1006579
1115 Ga0209257_1018065
1116 Ga0207695_10000044
1117 Ga0207671_10000364
1118 Ga0207650_10000151
1119 Ga0207709_10007084
1120 Ga0207661_10029918
1121 Ga0207667_10131072
1122 Ga0207702_10033297
1123 Ga0209281_1000028
1124 Ga0209281_1000596
1125 Ga0209281_1000760
1126 Ga0209371_1000037
1127 Ga0209371_1001945
1128 Ga0209371_1001958
1129 Ga0209282_1000267
1130 Ga0209282_1000803
1131 Ga0268266_10002491
1132 Ga0307515_10000434
1133 Ga0307515_10002407
1134 Ga0307515_10130503
1135 Ga0268256_1000039
1136 Ga0268256_1000890
1137 Ga0268256_1002013
1138 Ga0307513_10001773
1139 Ga0307513_10101893
1140 Ga0307408_100013679
1141 Ga0307406_10030232
1142 Ga0307412_10003953
1143 Ga0307412_10111939
1144 Ga0315914_1000965
1145 Ga0315913_1000276
1146 Ga0315915_1000499
1147 Ga0373927_0000074
1148 Ga0395905_0000836
1149 Ga0395905_0012177
1150 Ga0400483_057556
1151 Ga0400483_168905
1152 Ga0436360_0088138
1153 Ga0451791_0145945
1154 Ga0451833_0204696
1155 Ga0451854_27941
1156 Ga0452268_27494
1157 Ga0439449_0008526
1158 Ga0451577_0294211
1159 Ga0466968_0038503
1160 Ga0451576_0000040
1161 Ga0495638_0036762
1162 Ga0495605_0000575
1163 Ga0495606_0001739
1164 Ga0495610_0000915
1165 Ga0495632_0001194
1166 Ga0495625_0002177
1167 Ga0495657_0110878
1168 Ga0495589_0068106
1169 Ga0495600_0024445
1170 Ga0495604_0127223
1171 Ga0495686_0000007
1172 Ga0495686_0000922
1173 Ga0496114_0137941
1174 Ga0496116_0000380
1175 Ga0496116_0004572
1176 Ga0496116_0007357
1177 Ga0496116_0036635
1178 Ga0496116_0071482
1179 Ga0496117_0000031
1180 Ga0496117_0001675
1181 Ga0496117_0002447
1182 Ga0496117_0003875
1183 Ga0496117_0017954
1184 Ga0496118_0002290
1185 Ga0496118_0002502
1186 Ga0496118_0033542
1187 Ga0496120_0002700
1188 Ga0496120_0010575
1189 Ga0496120_0049174
1190 Ga0496121_0000034
1191 Ga0496121_0002365
1192 Ga0496121_0002652
1193 Ga0496121_0015989
1194 Ga0496121_0041943
1195 Ga0496121_0049082
1196 Ga0496121_0075661
1197 Ga0496122_0000023
1198 Ga0496122_0000068
1199 Ga0496122_0000777
1200 Ga0496122_0003156
1201 Ga0496122_0006273
1202 Ga0496122_0017400
1203 Ga0496122_0050827
1204 Ga0496123_0000059
1205 Ga0496123_0000519
1206 Ga0496123_0034170
1207 Ga0496123_0061871
1208 Ga0496124_0000130
1209 Ga0496124_0000781
1210 Ga0496124_0000909
1211 Ga0496124_0001790
1212 Ga0496124_0007537
1213 Ga0496124_0010851
1214 Ga0496124_0017090
1215 Ga0496124_0070613
1216 Ga0496125_0000790
1217 Ga0496125_0006012
1218 Ga0496125_0027907
1219 Ga0496125_0169248
1220 Ga0496126_0000293
1221 Ga0496126_0000466
1222 Ga0496126_0085072
1223 Ga0501031_0022019
1224 Ga0501031_0148361
1225 Ga0501032_0002318
1226 Ga0501032_0003148
1227 Ga0501032_0015324
1228 Ga0501032_0070420
1229 Ga0501032_0089793
1230 Ga0501032_0091545
1231 Ga0501033_0000361
1232 Ga0501033_0001947
1233 Ga0501033_0015427
1234 Ga0501033_0097621
1235 Ga0501033_0106782
1236 Ga0501034_0000609
1237 Ga0501034_0001008
1238 Ga0501034_0011247
1239 Ga0501034_0015694
1240 Ga0501034_0040554
1241 Ga0501034_0046731
1242 Ga0501034_0064534
1243 Ga0501034_0073714
1244 Ga0501034_0082589
1245 Ga0501034_0107243
1246 Ga0501034_0108720
1247 Ga0501034_0253335
1248 Ga0501036_0015146
1249 Ga0501036_0095725
1250 Ga0501037_0006238
1251 Ga0501037_0019279
1252 Ga0501037_0097203
1253 Ga0501038_0000187
1254 Ga0501038_0000362
1255 Ga0501038_0000394
1256 Ga0501038_0011745
1257 Ga0501038_0133052
1258 Ga0501038_0145272
1259 Ga0501039_0000932
1260 Ga0501039_0002217
1261 Ga0501039_0079326
1262 Ga0501040_0103038
1263 Ga0501043_0001876
1264 Ga0501043_0002292
1265 Ga0501043_0006291
1266 Ga0501043_0022843
1267 Ga0501046_0001124
1268 Ga0501046_0042889
1269 Ga0501047_0011027
1270 Ga0501047_0024402
1271 Ga0501047_0092159
1272 Ga0501047_0133404
1273 Ga0501047_0171304
1274 Ga0501047_0177056
1275 Ga0501067_0000083
1276 Ga0501067_0001189
1277 Ga0501067_0072724
1278 Ga0501068_0005450
1279 Ga0501068_0044245
1280 Ga0501068_0045393
1281 Ga0501069_0001984
1282 Ga0501070_0002177
1283 Ga0501070_0104134
1284 Ga0501071_0034352
1285 Ga0501073_0000021
1286 Ga0501073_0018399
1287 Ga0501073_0020835
1288 Ga0501073_0027887
1289 Ga0501074_0017685
1290 Ga0501077_0000045
1291 Ga0501079_0028105
1292 Ga0501079_0059105
1293 Ga0501080_0000394
1294 Ga0501080_0047648
1295 Ga0501083_0013576
1296 Ga0501083_0023153
1297 Ga0501035_0000398
1298 Ga0501035_0001173
1299 Ga0501035_0005409
1300 Ga0501035_0006142
1301 Ga0501035_0148053
1302 Ga0501044_0025589
1303 Ga0501044_0186360
1304 Ga0501045_0026526
1305 nmdc:mga0yw44_14554_c1
1306 nmdc:mga0yw44_25318_c1
1307 nmdc:mga09592_94243_c1
1308 nmdc:mga0sz30_630_c1
1309 Ga0500618_000241
1310 Ga0500618_000464
1311 Ga0500559_0003811
1312 Ga0500568_0000082
1313 Ga0500568_0000640
1314 Ga0500573_0000126
1315 Ga0500590_001068
1316 Ga0500616_0000986
1317 Ga0500624_000493
1318 Ga0500634_0068893
1319 Ga0500636_0000032
1320 Ga0587084_008216
1321 Ga0587077_014599
1322 Ga0587088_010398
1323 Ga0587090_005326
1324 Ga0587072_004545
1325 Ga0501082_0010865
1326 Ga0501082_0015259
1327 Ga0501082_0024006
1328 2644194209
1329 2509109408
1330 2509378282
1331 2509389541
1332 2509391672
1333 2509446044
1334 2509446045
1335 2510135108
1336 2510306901
1337 2510897003
1338 2511132026
1339 2511171203
1340 2511184302
1341 2511198179
1342 2511503139
1343 2512534420
1344 2512963788
1345 2512973777
1346 2513571477
1347 2513580679
1348 2513587055
1349 2513606755
1350 2513616890
1351 2513630322
1352 2513713700
1353 2513714266
1354 2513722252
1355 2513868401
1356 2513886293
1357 2513903424
1358 2513929087
1359 2513987455
1360 2514008366
1361 2515114261
1362 2515610881
1363 2515639147
1364 2515639562
1365 2515644900
1366 2515646429
1367 2515741424
1368 2516205448
1369 2516894567
1370 2517037878
1371 2517042152
1372 2517042736
1373 2517078144
1374 2517096913
1375 2517408006
1376 2517408670
1377 2517571221
1378 2524453275
1379 2530647467
1380 2535518903
1381 2537874562
1382 2551681280
1383 2551688846
1384 2551693701
1385 2551699003
1386 2551709200
1387 2551721953
1388 2551729492
1389 2551738606
1390 2551743714
1391 2554248776
1392 2558867234
1393 2558868458
1394 2559295864
1395 2559298122
1396 2561467014
1397 2585166861
1398 2585169300
1399 2585201853
1400 2585223807
1401 2585257476
1402 2585266784
1403 2585271538
1404 2585280603
1405 2585327975
1406 2585334278
1407 2585387825
1408 2585526210
1409 2585531538
1410 2585540637
1411 2585543592
1412 2585549030
1413 2585551516
1414 2585563222
1415 2585821421
1416 2585824111
1417 2585838906
1418 2585842020
1419 2585844691
1420 2585902728
1421 2585907440
1422 2585997668
1423 2586002256
1424 2587982566
1425 2599335000
1426 2599420264
1427 2599603345
1428 2599720223
1429 2600193542
1430 2600373330
1431 2601610749
1432 2601747523
1433 2616296430
1434 2616306853
1435 2616557705
1436 2617384957
1437 2643808234
1438 2643813652
1439 2643854990
1440 2643921389
1441 2644068577
1442 2644195241
1443 2644201541
1444 2644209348
1445 2644240601
1446 2644299991
1447 2644379668
1448 2644419646
1449 2644453003
1450 2644484355
1451 2644492374
1452 2644499914
1453 2644521442
1454 2644652876
1455 2644658217
1456 2644677260
1457 2644688968
1458 2657682580
1459 2671113598
1460 2692320137
1461 2719182846
1462 2719184091
1463 2719387540
1464 2719667185
1465 2719669429
1466 2719729664
1467 2719733563
1468 2720493605
1469 2720494445
1470 2720610782
1471 2720615061
1472 2720616660
1473 2720621854
1474 2720628016
1475 2720633204
1476 2720771596
1477 2720776901
1478 2721143914
1479 2721148958
1480 2721156602
1481 2721160356
1482 2721161289
1483 2721165771
1484 2721401174
1485 2722837242
1486 2722841941
1487 2723028501
1488 2723030858
1489 2723562105
1490 2723563360
1491 2723568807
1492 2723571350
1493 2724039988
1494 2724040818
1495 2724046319
1496 2724087145
1497 2724091508
1498 2724100856
1499 2724106072
1500 2724108098
1501 2724111877
1502 2725947363
1503 2730105324
1504 2730109437
1505 2730162231
1506 2730166081
1507 2730295363
1508 2730299988
1509 2738803917
1510 2738947524
1511 2766062640
1512 2776915367
1513 2778173635
1514 2792582066
1515 2792622076
1516 2792628667
1517 2793281141
1518 2793313525
1519 2793332113
1520 2793338681
1521 2793340839
1522 2793346483
1523 2793353993
1524 2793359516
1525 2802721551
1526 2802728437
1527 2802734436
1528 2802741075
1529 2802747191
1530 2802753899
1531 2804753530
1532 2805926092
1533 2805937041
1534 2808988312
1535 2819243678
1536 2819560874
1537 2819611124
1538 2819638946
1539 2819687120
1540 2821128617
1541 2838018459
1542 2838024138
1543 2838030812
1544 2838040471
1545 2838053691
1546 2838062447
1547 2838071998
1548 2838072712
1549 2838078344
1550 2838672939
1551 2838678763
1552 2838684015
1553 2838690110
1554 2838698544
1555 2838705583
1556 2838711659
1557 2838718148
1558 2838723060
1559 2838728215
1560 2838741634
1561 2838744781
1562 2841845532
1563 2841850617
1564 2841857912
1565 2841863131
1566 2841867893
1567 2842081460
1568 2842116288
1569 2842121763
1570 2842128873
1571 2842133655
1572 2842145235
1573 2842149913
1574 2842155433
1575 2842161008
1576 2842166526
1577 2842174610
1578 2842179269
1579 2842184624
1580 2842190572
1581 2842195008
1582 2842201732
1583 2842207285
1584 2842215104
1585 2842227825
1586 2842232207
1587 2842240778
1588 2842246622
1589 2842255263
1590 2842261276
1591 2842269037
1592 2842274130
1593 2842281004
1594 2842288383
1595 2842295117
1596 2842306011
1597 2842311285
1598 2842320986
1599 2842346715
1600 2842366397
1601 2842374865
1602 2842381516
1603 2842388586
1604 2842396082
1605 2842396903
1606 2842406271
1607 2842412856
1608 2842419265
1609 2842425630
1610 2842426190
1611 2842433270
1612 2842439696
1613 2842446225
1614 2842448906
1615 2842453796
1616 2842467420
1617 2842474085
1618 2842477544
1619 2842488014
1620 2842491038
1621 2842498376
1622 2842504583
1623 2842520131
1624 2842524172
1625 2842524344
1626 2842926189
1627 2844457192
1628 2847420655
1629 2848995486
1630 2850082468
1631 2852391565
1632 2854897016
1633 2854917164
1634 2855827186
1635 2855842580
1636 2855878014
1637 2857521133
1638 2857534230
1639 2858803391
1640 2891050523
1641 2891373731
1642 2896388047
1643 2899795230
1644 2899808151
1645 2899848254
1646 2913300005
1647 2913312432
1648 2915984941
1649 2915988858
1650 2915996940
1651 2916004059
1652 2916008458
1653 2916020929
1654 2916026994
1655 2916033608
1656 2916039539
1657 2916045490
1658 2916051159
1659 2916057530
1660 2916066848
1661 2916082369
1662 2919105267
1663 2919118594
1664 2919170676
1665 2919175902
1666 2919410945
1667 2920760526
1668 2920825765
1669 2921208332
1670 2921212423
1671 2921241068
1672 2921249563
1673 2921255612
1674 2921262151
1675 2921270604
1676 2921284117
1677 2921290823
1678 2921297108
1679 2923559606
1680 2924150133
1681 2924154122
1682 2924160255
1683 2924169302
1684 2924175915
1685 2924181662
1686 2924192233
1687 2924195310
1688 2924205998
1689 2924209428
1690 2924218642
1691 2924222731
1692 2924233108
1693 2926755124
1694 2926762284
1695 2929141771
1696 2933010717
1697 2933015608
1698 2933572515
1699 2933592505
1700 2933597651
1701 2933603148
1702 2935897807
1703 2935903802
1704 2936369746
1705 2936378935
1706 2936385848
1707 2936388214
1708 2936997640
1709 2937008661
1710 2937013398
1711 2937020264
1712 2937024686
1713 2937034288
1714 2937040954
1715 2937044165
1716 2937050731
1717 2937063314
1718 2937067917
1719 2937075608
1720 2937083086
1721 2937086757
1722 2937093992
1723 2937103291
1724 2937111623
1725 2937118006
1726 2937121814
1727 2937127909
1728 2937846934
1729 2941501171
1730 2957380408
1731 2957383781
1732 2957394365
1733 2957398175
1734 2957404016
1735 2957409926
1736 2957417922
1737 2957431543
1738 2957443213
1739 2957447552
1740 2957455580
1741 2957458416
1742 2957469889
1743 2957471813
1744 2957480063
1745 2957485532
1746 2957493658
1747 2957502151
1748 2957512054
1749 2958065389
1750 2960586794
1751 2960595792
1752 2960599317
1753 2960608013
1754 2960612098
1755 2960618248
1756 2960627397
1757 2960634840
1758 2960640766
1759 2960649553
1760 2960655474
1761 2960663514
1762 2960671825
1763 2960674982
1764 2960685496
1765 2960693754
1766 2960700005
1767 2964609331
1768 2964621105
1769 2964628813
1770 2964630355
1771 2964641969
1772 2964645325
1773 2964656184
1774 2964657204
1775 2964667946
1776 2964671849
1777 2964679275
1778 2964690824
1779 2964695310
1780 2964702573
1781 2964709336
1782 2964719162
1783 2964722500
1784 2967668166
1785 2967673554
1786 2967682725
1787 2967691063
1788 2967699424
1789 2967718215
1790 2967725337
1791 2967733453
1792 2967736726
1793 2967746656
1794 2967749958
1795 2967757979
1796 2967762766
1797 2967774877
1798 2967778459
1799 2970023418
1800 2970032318
1801 2970038327
1802 2970047683
1803 2970061118
1804 2970064867
1805 2970073130
1806 2970079709
1807 2970086455
1808 2970091299
1809 2970099493
1810 2970106793
1811 2970115919
1812 2970122365
1813 2970127483
1814 2970135493
1815 2970138282
1816 2970148271
1817 2970156724
1818 2970159130
1819 2970167979
1820 2970176769
1821 2970184151
1822 2970185767
1823 2970198138
1824 2977520255
1825 2977524595
1826 2977535950
1827 2977541509
1828 2977551015
1829 2977553382
1830 2977565248
1831 2977571541
1832 2977576466
1833 2977585621
1834 2978972512
1835 2979092446
1836 2979100163
1837 2979104417
1838 2984513787
1839 2984522635
1840 2984541941
1841 2984590766
1842 2984601371
1843 2989350774
1844 2989771424
1845 2989779967
1846 2995395333
1847 3003930799
1848 3005409520
1849 3005417929
1850 3005421753
1851 3005449539
1852 3005457032
1853 639645558
1854 639650262
1855 648737020
1856 650741078
1857 8003573864
1858 8003995162
1859 8004002880
1860 8005249111
1861 8005282293
1862 8005286875
1863 8005287533
1864 8005294056
1865 8005305841
1866 8005307302
1867 8005316096
1868 8005318057
1869 8005319547
1870 8005381709
1871 8005400933
1872 8005433711
1873 8005435979
1874 8005464953
1875 8005490176
1876 8005497547
1877 8005546553
1878 8005560994
1879 8005565619
1880 8005623280
1881 8005646834
1882 8005660710
1883 8005668952
1884 8005687584
1885 8005693214
1886 8005695594
1887 8005697001
1888 8018129492
1889 8018134203
1890 8018154488
1891 8018165270
1892 8018177022
1893 8023686369
1894 8024484226
1895 8024490735
1896 8024502451
1897 8046768159
1898 8049296094
1899 8054463675
1900 8054558863
1901 8055435652
1902 8056375831
1903 8056378479
1904 8056383931
1905 8056878139
1906 8057581480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

41

384

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9797 1 397
2bwo-assembly2.cif.gz_D 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa 0.9785 1 393
5txt-assembly2.cif.gz_D structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9764 47 395
5txt-assembly3.cif.gz_E structure of asymmetric apo/holo alas dimer from s. cerevisiae 0.9761 47 395
7x98-assembly2.cif.gz_D 5-aminolevulinate synthase hema from rhodopseudomonas palustris 0.9725 1 397
ID Description Score Start End Superfamily
af_O18680_387_483_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9866 298 385 3.90.1150.10
af_O94069_405_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9838 300 385 3.90.1150.10
af_Q8I4X1_515_606_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9823 300 387 3.90.1150.10
af_I1JW06_395_456_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9763 327 387 3.90.1150.10
af_P09950_130_384_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9745 62 293 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A537RIS6-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9886 86 200 GO:0008483
GO:0009058
GO:0030170
AF-A0A2W4ZVT4-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9885 101 394 GO:0003870
GO:0006782
GO:0030170
AF-F6RYA6-F1-model_v4 Aminolevulinic acid synthase 1 0.9884 162 252 GO:0009058
GO:0016746
GO:0030170
AF-A0A0L0FH53-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9882 59 396 GO:0003870
GO:0005739
GO:0006782
GO:0030170
AF-A0A845S274-F1-model_v4 5-aminolevulinate synthase (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-ALA synthase) (Delta-aminolevulinate synthase) 0.9877 134 397 GO:0003870
GO:0006782
GO:0030170

Map