F486702

General Info

Members Datasets Scaffolds Average Seq Length
955 443 1910 534

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100008741|Ga0070689_1000087412
Length 599
Sequence MGDGWQGFQNRMAVMHSDASVRPHYPPPVPIPLQSPDSITPPPMLTSLYVRHFAVVEEAEIAFGPGLTVVSGETGAGKSLLVDALMLLAGARADSGMVRAGSDRAELTAEFDLTQLPEAREWLRRQELDEEDSCQLRRVIRAEGSSRAWINGRPANASQLGELATLLVEIHGQHEHQALLSRAHQMELLDAYAGNEALVAQVRELAQQWXXXXNRIRKLSGGDDRDQRIELLSHELGELDKWALPADELTELEASHKRLANAGRLAEGAGGVVELLDGESEFALRRALGRAQLEMTKLAALDDRLAPLLELLDNASIQLSEAADGLGRYALDVDLDPNRYAEVDTHLTRLHELSRRHRVTVAELHDKAGTLRIELSELEGAGDALEKLATQRMRLQQQYGEHAAQLSQARQQAAERLGGEVSVLMGELGMSGGRLVVELEATSESDPDPQGRERCELLVSANPGQPPRALRKVASGGELARISLAIEVATLGKDTIGTMVFDEVDTGIGGAVAEVVGQKLRALGGQRQVLCVTHLPQVAAQGHAHLRVSKDSDGESTRTRIEKLDANGRRDELARMLGGVEITRETRAHAKQMLERAQV

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
115 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
217 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
222 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
228 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
239 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
350 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
352 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
359 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
360 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
361 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
362 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
363 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
364 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
365 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
366 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
367 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
368 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
369 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
370 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
371 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
372 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
373 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
374 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
375 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
376 2671180694 Paenibacillus sp. A3 Isolate Unclassified
377 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
378 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
379 2734482264 Dyella sp. AD052 Isolate Unclassified
380 2738543009 Luteibacter sp. OK325 Isolate Unclassified
381 2739367700 Dyella sp. YR388 Isolate Unclassified
382 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
383 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
384 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
385 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
386 2818991457 Xanthomonas translucens 569 Isolate Unclassified
387 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
388 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
389 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
390 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
391 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
392 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
393 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
394 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
395 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
396 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
397 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
398 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
399 2884411467 Dyella sp. AD56 Isolate Rhizosphere
400 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
401 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
402 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
403 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
404 2919085039 Luteibacter sp. 1214 Isolate Unclassified
405 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
406 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
407 2919404418 Luteibacter sp. 3190 Isolate Unclassified
408 2919513703 Luteimonas sp. 3794 Isolate Unclassified
409 2919675420 Luteimonas terrae 4099 Isolate Unclassified
410 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
411 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
412 2928963466 Dyella japonica 1073 Isolate Unclassified
413 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
414 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
415 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
416 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
417 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
418 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
419 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
420 2941471342 Luteibacter sp. 621 Isolate Unclassified
421 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
422 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
423 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
424 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
425 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
426 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
427 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
428 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
429 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
430 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
431 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
432 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
433 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
434 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
435 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
436 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
437 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
438 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
439 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
440 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
441 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
442 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
443 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.37
Metatranscriptomes 0.73
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 16.34
Nodule 0.21
Rhizoplane 2.41
Rhizosphere 65.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100008741 3300005340 Bacteria 7150
2 JGI24741J21665_1009606 3300001915 Bacteria 1769
3 JGI24740J21852_10004853 3300001979 Bacteria 5719
4 JGI24739J22299_10000167 3300001989 Bacteria 21671
5 JGI25156J39149_1001689 3300002705 Bacteria 8887
6 JGI25156J39149_1008279 3300002705 Bacteria 2635
7 JGI25162J39368_1002522 3300002737 Bacteria 7004
8 JGI25162J39368_1002756 3300002737 Bacteria 6268
9 JGI25162J39368_1002946 3300002737 Bacteria 5748
10 JGI25162J39368_1003492 3300002737 Bacteria 4485
11 JGI25157J39369_1000760 3300002741 Bacteria 16774
12 JGI25157J39369_1001514 3300002741 Bacteria 8465
13 JGI25157J39369_1001601 3300002741 Bacteria 7926
14 JGI25163J39215_1001514 3300002771 Bacteria 3659
15 JGI25164J39214_1000049 3300002772 Bacteria 123464
16 JGI25164J39214_1000088 3300002772 Bacteria 91375
17 JGI25164J39214_1001313 3300002772 Bacteria 6260
18 JGI25164J39214_1001318 3300002772 Bacteria 6234
19 JGI25152J39213_1000102 3300002773 Bacteria 59507
20 JGI25150J39212_1000099 3300002774 Bacteria 49634
21 JGI25150J39212_1000290 3300002774 Bacteria 26031
22 JGI25151J46595_10000041 3300003187 Bacteria 174472
23 JGI25151J46595_10000269 3300003187 Bacteria 59507
24 JGI25151J46595_10011611 3300003187 Bacteria 4042
25 JGI25165J46597_1000009 3300003214 Bacteria 467965
26 JGI25165J46597_1000088 3300003214 Bacteria 169821
27 JGI25165J46597_1002376 3300003214 Bacteria 6268
28 JGI25165J46597_1002837 3300003214 Bacteria 4966
29 JGI25153J46596_10000189 3300003215 Bacteria 59507
30 rootH2_10092143 3300003320 Bacteria 5533
31 Ga0006562J51391_1029636 3300003578 Bacteria 10630
32 Ga0006562J51391_1029638 3300003578 Bacteria 2260
33 Ga0055525_1000146 3300003759 Bacteria 97114
34 Ga0055527_1000328 3300003760 Bacteria 25551
35 Ga0055527_1000605 3300003760 Bacteria 11556
36 Ga0055535_1000082 3300003761 Bacteria 106958
37 Ga0055535_1000745 3300003761 Bacteria 24313
38 Ga0055535_1000756 3300003761 Bacteria 24051
39 Ga0055535_1001284 3300003761 Bacteria 13598
40 Ga0055542_1000765 3300003762 Bacteria 24313
41 Ga0055542_1000774 3300003762 Bacteria 24051
42 Ga0055542_1000856 3300003762 Bacteria 21343
43 Ga0055542_1001065 3300003762 Bacteria 16915
44 Ga0055542_1002159 3300003762 Bacteria 7122
45 Ga0055542_1002186 3300003762 Bacteria 7004
46 Ga0055529_1000020 3300003763 Bacteria 324857
47 Ga0055529_1000663 3300003763 Bacteria 24291
48 Ga0055529_1000666 3300003763 Bacteria 24043
49 Ga0055529_1000887 3300003763 Bacteria 16921
50 Ga0055526_1006635 3300003771 Bacteria 6219
51 Ga0055537_1000407 3300003773 Bacteria 28206
52 Ga0055524_1017968 3300003775 Bacteria 2475
53 Ga0055536_1005286 3300003781 Bacteria 6357
54 Ga0055536_1005928 3300003781 Bacteria 5844
55 Ga0055536_1006000 3300003781 Bacteria 5776
56 Ga0055536_1019665 3300003781 Bacteria 2115
57 Ga0055534_1000039 3300003784 Bacteria 104863
58 Ga0055528_1000529 3300003790 Bacteria 29538
59 Ga0055530_10002892 3300003791 Bacteria 10448
60 Ga0055530_10005063 3300003791 Bacteria 6471
61 Ga0055530_10008054 3300003791 Bacteria 4296
62 Ga0055531_10006146 3300003794 Bacteria 6871
63 Ga0055531_10007661 3300003794 Bacteria 5844
64 Ga0055531_10007781 3300003794 Bacteria 5776
65 Ga0055531_10011589 3300003794 Bacteria 4231
66 Ga0058692_1000018 3300003856 Bacteria 264544
67 Ga0065165_1003051 3300005262 Bacteria 12552
68 Ga0065704_10002333 3300005289 Bacteria 7689
69 Ga0065704_10072174 3300005289 Bacteria 9007
70 Ga0065715_10093484 3300005293 Bacteria 4663
71 Ga0065715_10110437 3300005293 Bacteria 2620
72 Ga0070658_10012294 3300005327 Bacteria 6873
73 Ga0070670_100007924 3300005331 Bacteria 9039
74 Ga0070666_10000003 3300005335 Bacteria 463666
75 Ga0070666_10000757 3300005335 Bacteria 19578
76 Ga0070666_10009654 3300005335 Bacteria 6024
77 Ga0070680_100008297 3300005336 Bacteria 7947
78 Ga0070680_100073618 3300005336 Bacteria 2810
79 Ga0070682_100002136 3300005337 Bacteria 10982
80 Ga0070682_100008145 3300005337 Bacteria 5911
81 Ga0068868_100007207 3300005338 Bacteria 7901
82 Ga0068868_100027499 3300005338 Bacteria 4340
83 Ga0068868_100032309 3300005338 Bacteria 4026
84 Ga0070660_100011933 3300005339 Bacteria 6199
85 Ga0070660_100025556 3300005339 Bacteria 4390
86 Ga0070660_100051136 3300005339 Bacteria 3181
87 Ga0070691_10000561 3300005341 Bacteria 14128
88 Ga0070661_100001862 3300005344 Bacteria 14599
89 Ga0070661_100033926 3300005344 Bacteria 3700
90 Ga0070661_100104718 3300005344 Bacteria 2108
91 Ga0070692_10000139 3300005345 Bacteria 17503
92 Ga0070692_10001873 3300005345 Bacteria 7918
93 Ga0070669_100016268 3300005353 Bacteria 5306
94 Ga0070669_100079690 3300005353 Bacteria 2436
95 Ga0070675_100013380 3300005354 Bacteria 6448
96 Ga0070659_100007436 3300005366 Bacteria 7959
97 Ga0070667_100000084 3300005367 Bacteria 118027
98 Ga0070667_100009456 3300005367 Bacteria 8086
99 Ga0070667_100149360 3300005367 Bacteria 2052
100 Ga0070714_100000372 3300005435 Bacteria 33436
101 Ga0070714_100000713 3300005435 Bacteria 23558
102 Ga0070714_100013529 3300005435 Bacteria 6540
103 Ga0070714_100021754 3300005435 Bacteria 5249
104 Ga0070714_100022773 3300005435 Bacteria 5139
105 Ga0070694_100032508 3300005444 Bacteria 3426
106 Ga0070663_100041672 3300005455 Bacteria 3223
107 Ga0070663_100069432 3300005455 Bacteria 2560
108 Ga0070678_100003696 3300005456 Bacteria 8558
109 Ga0070681_10009408 3300005458 Bacteria 9616
110 Ga0070681_10017636 3300005458 Bacteria 7134
111 Ga0070681_10025596 3300005458 Bacteria 5936
112 Ga0068867_100071691 3300005459 Bacteria 2592
113 Ga0070685_10004666 3300005466 Bacteria 6934
114 Ga0070698_100064803 3300005471 Bacteria 3680
115 Ga0070679_100016456 3300005530 Bacteria 7134
116 Ga0070679_100081626 3300005530 Bacteria 3222
117 Ga0070679_100106460 3300005530 Bacteria 2790
118 Ga0070679_100127285 3300005530 Bacteria 2529
119 Ga0070684_100033959 3300005535 Bacteria 4359
120 Ga0068853_100002068 3300005539 Bacteria 14881
121 Ga0068853_100004423 3300005539 Bacteria 10877
122 Ga0068853_100012109 3300005539 Bacteria 7016
123 Ga0068853_100139593 3300005539 Bacteria 2175
124 Ga0070672_100009562 3300005543 Bacteria 6689
125 Ga0070696_100000851 3300005546 Bacteria 19698
126 Ga0070696_100001442 3300005546 Bacteria 15555
127 Ga0070696_100011770 3300005546 Bacteria 5863
128 Ga0070693_100004059 3300005547 Bacteria 6892
129 Ga0070665_100013099 3300005548 Bacteria 8350
130 Ga0070665_100023453 3300005548 Bacteria 6213
131 Ga0070665_100037857 3300005548 Bacteria 4849
132 Ga0068855_100020753 3300005563 Bacteria 7879
133 Ga0068855_100031696 3300005563 Bacteria 6311
134 Ga0068855_100108259 3300005563 Bacteria 3192
135 Ga0068855_100171159 3300005563 Bacteria 2460
136 Ga0068857_100004292 3300005577 Bacteria 12022
137 Ga0068857_100020788 3300005577 Bacteria 5775
138 Ga0068854_100003470 3300005578 Bacteria 9844
139 Ga0068854_100007127 3300005578 Bacteria 7138
140 Ga0068854_100010098 3300005578 Bacteria 6116
141 Ga0068856_100000983 3300005614 Bacteria 30421
142 Ga0068856_100052772 3300005614 Bacteria 4010
143 Ga0068852_100021578 3300005616 Bacteria 5146
144 Ga0068852_100057982 3300005616 Bacteria 3352
145 Ga0068859_100021151 3300005617 Bacteria 6529
146 Ga0068859_100061891 3300005617 Bacteria 3772
147 Ga0068859_100186169 3300005617 Bacteria 2160
148 Ga0068864_100030923 3300005618 Bacteria 4540
149 Ga0068864_100128090 3300005618 Bacteria 2277
150 Ga0068851_10004998 3300005834 Bacteria 6006
151 Ga0068870_10009151 3300005840 Bacteria 4489
152 Ga0068863_100013560 3300005841 Bacteria 7863
153 Ga0068863_100127670 3300005841 Bacteria 2427
154 Ga0068860_100009881 3300005843 Bacteria 9460
155 Ga0068860_100105026 3300005843 Bacteria 2697
156 Ga0068862_100064307 3300005844 Bacteria 3158
157 Ga0075364_10001000 3300006051 Bacteria 14962
158 Ga0097621_100019126 3300006237 Bacteria 5250
159 Ga0068871_100012103 3300006358 Bacteria 6350
160 Ga0075428_100009101 3300006844 Bacteria 11018
161 Ga0075428_100057180 3300006844 Bacteria 4270
162 Ga0075433_10005362 3300006852 Bacteria 10068
163 Ga0075434_100000572 3300006871 Bacteria 28363
164 Ga0075434_100071461 3300006871 Bacteria 3462
165 Ga0068865_100042758 3300006881 Bacteria 3092
166 Ga0097620_100021151 3300006931 Bacteria 6529
167 Ga0097620_100061888 3300006931 Bacteria 3772
168 Ga0097620_100186173 3300006931 Bacteria 2160
169 Ga0075435_100063636 3300007076 Bacteria 2996
170 Ga0105251_10000880 3300009011 Bacteria 26879
171 Ga0105251_10009176 3300009011 Bacteria 5877
172 Ga0105240_10012346 3300009093 Bacteria 11795
173 Ga0105240_10035843 3300009093 Bacteria 6388
174 Ga0105240_10043064 3300009093 Bacteria 5748
175 Ga0105240_10049909 3300009093 Bacteria 5278
176 Ga0105240_10063542 3300009093 Bacteria 4592
177 Ga0105240_10084533 3300009093 Bacteria 3891
178 Ga0105240_10097448 3300009093 Bacteria 3583
179 Ga0111539_10006755 3300009094 Bacteria 14763
180 Ga0105245_10003428 3300009098 Bacteria 14208
181 Ga0105245_10116590 3300009098 Bacteria 2490
182 Ga0105247_10010854 3300009101 Bacteria 5502
183 Ga0105243_10021826 3300009148 Bacteria 4861
184 Ga0105241_10042237 3300009174 Bacteria 3448
185 Ga0105241_10076264 3300009174 Bacteria 2614
186 Ga0105242_10001298 3300009176 Bacteria 19754
187 Ga0105242_10044328 3300009176 Bacteria 3602
188 Ga0105248_10000429 3300009177 Bacteria 47562
189 Ga0105248_10005167 3300009177 Bacteria 14394
190 Ga0105248_10054583 3300009177 Bacteria 4481
191 Ga0105237_10000016 3300009545 Bacteria 256506
192 Ga0105237_10000388 3300009545 Bacteria 62620
193 Ga0105238_10000362 3300009551 Bacteria 48708
194 Ga0105238_10002989 3300009551 Bacteria 16888
195 Ga0105238_10024524 3300009551 Bacteria 6147
196 Ga0105238_10032850 3300009551 Bacteria 5282
197 Ga0105238_10072023 3300009551 Bacteria 3453
198 Ga0105238_10097547 3300009551 Bacteria 2925
199 Ga0105249_10009937 3300009553 Bacteria 8345
200 Ga0105030_100130 3300009987 Bacteria 5905
201 Ga0105239_10000063 3300010375 Bacteria 151845
202 Ga0105239_10007002 3300010375 Bacteria 12975
203 Ga0105239_10012123 3300010375 Bacteria 9611
204 Ga0105239_10013284 3300010375 Bacteria 9149
205 Ga0105239_10038848 3300010375 Bacteria 5215
206 Ga0105239_10069647 3300010375 Bacteria 3865
207 Ga0157373_10005152 3300013100 Bacteria 9826
208 Ga0157373_10022169 3300013100 Bacteria 4608
209 Ga0157371_10000487 3300013102 Bacteria 48309
210 Ga0157371_10002814 3300013102 Bacteria 16290
211 Ga0157371_10010486 3300013102 Bacteria 7211
212 Ga0157371_10028762 3300013102 Bacteria 4023
213 Ga0157370_10010813 3300013104 Bacteria 9591
214 Ga0157370_10013028 3300013104 Bacteria 8587
215 Ga0157370_10014321 3300013104 Bacteria 8115
216 Ga0157370_10025566 3300013104 Bacteria 5844
217 Ga0157369_10000027 3300013105 Bacteria 213988
218 Ga0157369_10002364 3300013105 Bacteria 22678
219 Ga0157369_10016391 3300013105 Bacteria 8335
220 Ga0157369_10042658 3300013105 Bacteria 4949
221 Ga0157374_10080245 3300013296 Bacteria 3094
222 Ga0157378_10000006 3300013297 Bacteria 192683
223 Ga0157378_10026393 3300013297 Bacteria 5120
224 Ga0163162_10000357 3300013306 Bacteria 41422
225 Ga0163162_10002734 3300013306 Bacteria 16743
226 Ga0163162_10031567 3300013306 Bacteria 5255
227 Ga0157372_10003304 3300013307 Bacteria 17420
228 Ga0157372_10027342 3300013307 Bacteria 6211
229 Ga0157372_10036984 3300013307 Bacteria 5382
230 Ga0157372_10053894 3300013307 Bacteria 4484
231 Ga0157372_10121842 3300013307 Bacteria 2996
232 Ga0157375_10000102 3300013308 Bacteria 86408
233 Ga0157375_10004302 3300013308 Bacteria 12350
234 Ga0157375_10055469 3300013308 Bacteria 3907
235 Ga0157375_10287370 3300013308 Bacteria 1807
236 Ga0163163_10000877 3300014325 Bacteria 25623
237 Ga0163163_10023588 3300014325 Bacteria 5840
238 Ga0182008_10000143 3300014497 Bacteria 55118
239 Ga0182008_10007235 3300014497 Bacteria 6138
240 Ga0182008_10018312 3300014497 Bacteria 3626
241 Ga0182008_10026014 3300014497 Bacteria 2969
242 Ga0157379_10000992 3300014968 Bacteria 23037
243 Ga0157379_10001842 3300014968 Bacteria 17527
244 Ga0157376_10003668 3300014969 Bacteria 10602
245 Ga0157376_10008252 3300014969 Bacteria 7501
246 Ga0157376_10206001 3300014969 Bacteria 1813
247 Ga0182006_1000074 3300015261 Bacteria 130403
248 Ga0182006_1001229 3300015261 Bacteria 15917
249 Ga0182006_1018348 3300015261 Bacteria 2958
250 Ga0182007_10000043 3300015262 Bacteria 107693
251 Ga0182007_10004954 3300015262 Bacteria 5938
252 Ga0182005_1000267 3300015265 Bacteria 32953
253 Ga0182005_1000326 3300015265 Bacteria 28190
254 Ga0182005_1001110 3300015265 Bacteria 11246
255 Ga0182005_1002979 3300015265 Bacteria 5862
256 Ga0183369_1006 3300015685 Bacteria 449058
257 Ga0183368_1004 3300015687 Bacteria 1211761
258 Ga0163161_10007748 3300017792 Bacteria 7428
259 Ga0197907_10862894 3300020069 Bacteria 2956
260 Ga0197907_11474155 3300020069 Bacteria 2395
261 Ga0206356_10168839 3300020070 Bacteria 6249
262 Ga0206351_10908139 3300020077 Bacteria 2664
263 Ga0206353_10073144 3300020082 Bacteria 2454
264 Ga0209784_100013 3300025224 Bacteria 518664
265 Ga0209566_100544 3300025225 Bacteria 25458
266 Ga0209674_100026 3300025226 Bacteria 490631
267 Ga0209674_100062 3300025226 Bacteria 276316
268 Ga0209674_100974 3300025226 Bacteria 8974
269 Ga0209672_100007 3300025228 Bacteria 959482
270 Ga0209672_100017 3300025228 Bacteria 514236
271 Ga0209672_100743 3300025228 Bacteria 15906
272 Ga0209672_100839 3300025228 Bacteria 14268
273 Ga0209672_102291 3300025228 Bacteria 4891
274 Ga0209563_100131 3300025230 Bacteria 97465
275 Ga0207427_100021 3300025231 Bacteria 494115
276 Ga0207427_100073 3300025231 Bacteria 156503
277 Ga0207427_100289 3300025231 Bacteria 35918
278 Ga0207427_100306 3300025231 Bacteria 34125
279 Ga0209437_100012 3300025233 Bacteria 792625
280 Ga0209437_100039 3300025233 Bacteria 448321
281 Ga0209437_100087 3300025233 Bacteria 253432
282 Ga0209437_100129 3300025233 Bacteria 184661
283 Ga0209437_100159 3300025233 Bacteria 149598
284 Ga0209437_100637 3300025233 Bacteria 20495
285 Ga0209258_100017 3300025242 Bacteria 590785
286 Ga0209258_100019 3300025242 Bacteria 566728
287 Ga0209258_100206 3300025242 Bacteria 119449
288 Ga0209258_100213 3300025242 Bacteria 115394
289 Ga0209258_100594 3300025242 Bacteria 29847
290 Ga0209258_102146 3300025242 Bacteria 5484
291 Ga0207425_1000092 3300025245 Bacteria 87673
292 Ga0209646_1001828 3300025246 Bacteria 5261
293 Ga0209026_1000051 3300025250 Bacteria 250792
294 Ga0209026_1000079 3300025250 Bacteria 198355
295 Ga0209026_1000125 3300025250 Bacteria 124729
296 Ga0209026_1000592 3300025250 Bacteria 23632
297 Ga0209026_1002773 3300025250 Bacteria 6249
298 Ga0209677_100969 3300025253 Bacteria 13954
299 Ga0209148_1000001 3300025254 Bacteria 2545271
300 Ga0209148_1000005 3300025254 Bacteria 1806504
301 Ga0209148_1000009 3300025254 Bacteria 1395625
302 Ga0209148_1000044 3300025254 Bacteria 458417
303 Ga0209148_1000176 3300025254 Bacteria 128357
304 Ga0209148_1000185 3300025254 Bacteria 118117
305 Ga0209759_1000145 3300025256 Bacteria 121772
306 Ga0209759_1000328 3300025256 Bacteria 62531
307 Ga0209759_1002334 3300025256 Bacteria 8510
308 Ga0209759_1005371 3300025256 Bacteria 4509
309 Ga0209129_1000151 3300025258 Bacteria 113221
310 Ga0209129_1003459 3300025258 Bacteria 6852
311 Ga0209129_1007561 3300025258 Bacteria 3205
312 Ga0209233_1000002 3300025261 Bacteria 2501366
313 Ga0209233_1000020 3300025261 Bacteria 798224
314 Ga0209233_1000023 3300025261 Bacteria 738870
315 Ga0209233_1000090 3300025261 Bacteria 315680
316 Ga0209565_1000014 3300025263 Bacteria 530302
317 Ga0209455_1000010 3300025272 Bacteria 959482
318 Ga0209455_1000027 3300025272 Bacteria 566710
319 Ga0209455_1000032 3300025272 Bacteria 514243
320 Ga0209455_1000081 3300025272 Bacteria 263674
321 Ga0209673_1000171 3300025273 Bacteria 133493
322 Ga0209130_1012874 3300025284 Bacteria 2166
323 Ga0209675_1000011 3300025291 Bacteria 520597
324 Ga0209675_1016461 3300025291 Bacteria 2152
325 Ga0209676_1000079 3300025292 Bacteria 290447
326 Ga0209676_1000086 3300025292 Bacteria 264155
327 Ga0209676_1000092 3300025292 Bacteria 250453
328 Ga0209676_1002465 3300025292 Bacteria 13076
329 Ga0209676_1003076 3300025292 Bacteria 10754
330 Ga0209676_1003077 3300025292 Bacteria 10754
331 Ga0209676_1006826 3300025292 Bacteria 5536
332 Ga0209025_1000012 3300025294 Bacteria 924362
333 Ga0209025_1000015 3300025294 Bacteria 808120
334 Ga0209025_1002444 3300025294 Bacteria 19667
335 Ga0209025_1008928 3300025294 Bacteria 7094
336 Ga0209564_1000221 3300025295 Bacteria 129537
337 Ga0209758_1000018 3300025297 Bacteria 753320
338 Ga0209758_1005446 3300025297 Bacteria 9799
339 Ga0209758_1008116 3300025297 Bacteria 6909
340 Ga0209758_1015576 3300025297 Bacteria 3924
341 Ga0209758_1016918 3300025297 Bacteria 3671
342 Ga0209050_1000329 3300025298 Bacteria 94932
343 Ga0209050_1000415 3300025298 Bacteria 79058
344 Ga0209050_1000528 3300025298 Bacteria 63464
345 Ga0209050_1004837 3300025298 Bacteria 8846
346 Ga0209050_1005515 3300025298 Bacteria 7908
347 Ga0209256_1004521 3300025299 Bacteria 8679
348 Ga0209256_1018718 3300025299 Bacteria 2235
349 Ga0209051_1002764 3300025303 Bacteria 12119
350 Ga0209051_1007093 3300025303 Bacteria 6193
351 Ga0209051_1032538 3300025303 Bacteria 1987
352 Ga0209257_1000080 3300025304 Bacteria 312038
353 Ga0209257_1000081 3300025304 Bacteria 306577
354 Ga0209257_1000121 3300025304 Bacteria 222588
355 Ga0209257_1000145 3300025304 Bacteria 195152
356 Ga0209257_1002505 3300025304 Bacteria 18133
357 Ga0209257_1004877 3300025304 Bacteria 9909
358 Ga0209257_1005274 3300025304 Bacteria 9213
359 Ga0209257_1015664 3300025304 Bacteria 3135
360 Ga0207656_10001780 3300025321 Bacteria 7168
361 Ga0207713_1000710 3300025735 Bacteria 31158
362 Ga0207713_1009080 3300025735 Bacteria 5647
363 Ga0207710_10034415 3300025900 Bacteria 2226
364 Ga0207680_10000006 3300025903 Bacteria 635950
365 Ga0207680_10020353 3300025903 Bacteria 3569
366 Ga0207647_10000607 3300025904 Bacteria 27924
367 Ga0207647_10001539 3300025904 Bacteria 17764
368 Ga0207647_10002712 3300025904 Bacteria 13374
369 Ga0207647_10012222 3300025904 Bacteria 5985
370 Ga0207647_10024280 3300025904 Bacteria 3999
371 Ga0207645_10013275 3300025907 Bacteria 5557
372 Ga0207705_10000165 3300025909 Bacteria 71603
373 Ga0207705_10000353 3300025909 Bacteria 41498
374 Ga0207705_10000355 3300025909 Bacteria 41474
375 Ga0207705_10001403 3300025909 Bacteria 19215
376 Ga0207705_10008340 3300025909 Bacteria 7564
377 Ga0207707_10000391 3300025912 Bacteria 45809
378 Ga0207707_10001033 3300025912 Bacteria 26719
379 Ga0207707_10001308 3300025912 Bacteria 23205
380 Ga0207707_10010325 3300025912 Bacteria 8102
381 Ga0207707_10011013 3300025912 Bacteria 7869
382 Ga0207707_10012035 3300025912 Bacteria 7521
383 Ga0207707_10017065 3300025912 Bacteria 6325
384 Ga0207707_10046729 3300025912 Bacteria 3771
385 Ga0207707_10051686 3300025912 Bacteria 3579
386 Ga0207695_10000975 3300025913 Bacteria 50860
387 Ga0207695_10006463 3300025913 Bacteria 15214
388 Ga0207695_10007085 3300025913 Bacteria 14367
389 Ga0207695_10009557 3300025913 Bacteria 11986
390 Ga0207695_10011615 3300025913 Bacteria 10651
391 Ga0207695_10012347 3300025913 Bacteria 10263
392 Ga0207695_10031715 3300025913 Bacteria 5791
393 Ga0207695_10046563 3300025913 Bacteria 4597
394 Ga0207695_10087165 3300025913 Bacteria 3145
395 Ga0207671_10000137 3300025914 Bacteria 112029
396 Ga0207671_10003811 3300025914 Bacteria 14763
397 Ga0207671_10004200 3300025914 Bacteria 13892
398 Ga0207660_10000931 3300025917 Bacteria 19331
399 Ga0207660_10001391 3300025917 Bacteria 16259
400 Ga0207660_10003395 3300025917 Bacteria 10378
401 Ga0207660_10005061 3300025917 Bacteria 8583
402 Ga0207657_10010252 3300025919 Bacteria 9360
403 Ga0207657_10017203 3300025919 Bacteria 6945
404 Ga0207649_10005594 3300025920 Bacteria 6795
405 Ga0207649_10031454 3300025920 Bacteria 3154
406 Ga0207649_10089027 3300025920 Bacteria 2017
407 Ga0207652_10000030 3300025921 Bacteria 144884
408 Ga0207652_10001197 3300025921 Bacteria 23349
409 Ga0207652_10041489 3300025921 Bacteria 3912
410 Ga0207681_10004705 3300025923 Bacteria 8395
411 Ga0207694_10000563 3300025924 Bacteria 33592
412 Ga0207694_10004402 3300025924 Bacteria 11002
413 Ga0207694_10012219 3300025924 Bacteria 6473
414 Ga0207694_10012898 3300025924 Bacteria 6292
415 Ga0207694_10041831 3300025924 Bacteria 3532
416 Ga0207650_10044596 3300025925 Bacteria 3260
417 Ga0207700_10000822 3300025928 Bacteria 17939
418 Ga0207664_10000474 3300025929 Bacteria 28453
419 Ga0207664_10000584 3300025929 Bacteria 25442
420 Ga0207664_10000585 3300025929 Bacteria 25440
421 Ga0207644_10000313 3300025931 Bacteria 31603
422 Ga0207644_10060403 3300025931 Bacteria 2743
423 Ga0207690_10000443 3300025932 Bacteria 26830
424 Ga0207690_10001772 3300025932 Bacteria 13272
425 Ga0207690_10001851 3300025932 Bacteria 13004
426 Ga0207690_10001946 3300025932 Bacteria 12658
427 Ga0207690_10007510 3300025932 Bacteria 6470
428 Ga0207690_10008552 3300025932 Bacteria 6074
429 Ga0207690_10009506 3300025932 Bacteria 5775
430 Ga0207706_10029417 3300025933 Bacteria 4903
431 Ga0207709_10018744 3300025935 Bacteria 3880
432 Ga0207670_10005060 3300025936 Bacteria 7190
433 Ga0207704_10001296 3300025938 Bacteria 11176
434 Ga0207691_10007639 3300025940 Bacteria 10406
435 Ga0207711_10001015 3300025941 Bacteria 26915
436 Ga0207711_10004854 3300025941 Bacteria 11428
437 Ga0207711_10061557 3300025941 Bacteria 3237
438 Ga0207661_10004417 3300025944 Bacteria 9865
439 Ga0207667_10000250 3300025949 Bacteria 75738
440 Ga0207667_10000679 3300025949 Bacteria 44080
441 Ga0207667_10001003 3300025949 Bacteria 36039
442 Ga0207667_10001167 3300025949 Bacteria 32985
443 Ga0207667_10005715 3300025949 Bacteria 15171
444 Ga0207667_10016516 3300025949 Bacteria 8337
445 Ga0207712_10000343 3300025961 Bacteria 42053
446 Ga0207640_10001071 3300025981 Bacteria 15167
447 Ga0207640_10003830 3300025981 Bacteria 8116
448 Ga0207640_10005529 3300025981 Bacteria 6887
449 Ga0207658_10000093 3300025986 Bacteria 98928
450 Ga0207677_10094535 3300026023 Bacteria 2182
451 Ga0207639_10001634 3300026041 Bacteria 15086
452 Ga0207639_10002124 3300026041 Bacteria 13352
453 Ga0207639_10005666 3300026041 Bacteria 8451
454 Ga0207639_10007609 3300026041 Bacteria 7389
455 Ga0207678_10000433 3300026067 Bacteria 37961
456 Ga0207678_10005962 3300026067 Bacteria 10852
457 Ga0207678_10050893 3300026067 Bacteria 3578
458 Ga0207678_10080157 3300026067 Bacteria 2795
459 Ga0207702_10000943 3300026078 Bacteria 29865
460 Ga0207702_10003531 3300026078 Bacteria 14234
461 Ga0207702_10140169 3300026078 Bacteria 2187
462 Ga0207648_10029340 3300026089 Bacteria 4878
463 Ga0207674_10007214 3300026116 Bacteria 12971
464 Ga0207674_10019944 3300026116 Bacteria 7255
465 Ga0207674_10024820 3300026116 Bacteria 6399
466 Ga0207674_10065193 3300026116 Bacteria 3672
467 Ga0207674_10066528 3300026116 Bacteria 3630
468 Ga0207683_10025237 3300026121 Bacteria 5125
469 Ga0207698_10000592 3300026142 Bacteria 21149
470 Ga0207698_10002980 3300026142 Bacteria 10149
471 Ga0207698_10038811 3300026142 Bacteria 3522
472 Ga0209371_1000011 3300027312 Bacteria 848456
473 Ga0268266_10000043 3300028379 Bacteria 316604
474 Ga0268266_10045565 3300028379 Bacteria 3752
475 Ga0268265_10094964 3300028380 Bacteria 2393
476 Ga0268264_10022370 3300028381 Bacteria 5163
477 Ga0268264_10069503 3300028381 Bacteria 2978
478 Ga0265334_10000009 3300028573 Bacteria 194312
479 Ga0265338_10009730 3300028800 Bacteria 11404
480 Ga0268256_1000011 3300030500 Bacteria 848625
481 Ga0316177_1203723 3300030731 Bacteria 6164
482 Ga0307513_10053920 3300031456 Bacteria 4316
483 Ga0307408_100046420 3300031548 Bacteria 3107
484 Ga0265313_10007989 3300031595 Bacteria 7104
485 Ga0316575_10011930 3300031665 Bacteria 3224
486 Ga0316575_10040661 3300031665 Bacteria 1837
487 Ga0316578_10016352 3300031728 Bacteria 4012
488 Ga0307516_10001401 3300031730 Bacteria 33337
489 Ga0307516_10018328 3300031730 Bacteria 7275
490 Ga0307516_10035332 3300031730 Bacteria 5015
491 Ga0307405_10003809 3300031731 Bacteria 7013
492 Ga0316577_10009829 3300031733 Bacteria 5155
493 Ga0307413_10001746 3300031824 Bacteria 8494
494 Ga0307410_10005487 3300031852 Bacteria 6720
495 Ga0307407_10013528 3300031903 Bacteria 3965
496 Ga0307412_10006145 3300031911 Bacteria 6768
497 Ga0307409_100126975 3300031995 Bacteria 2171
498 Ga0307416_100000500 3300032002 Bacteria 19946
499 Ga0307414_10003986 3300032004 Bacteria 7967
500 Ga0307414_10017858 3300032004 Bacteria 4351
501 Ga0307411_10017445 3300032005 Bacteria 4091
502 Ga0307415_100014074 3300032126 Bacteria 4690
503 Ga0316583_10000626 3300032133 Bacteria 10804
504 Ga0316585_10000572 3300032137 Bacteria 9022
505 Ga0316580_10003247 3300032139 Bacteria 4592
506 Ga0307510_10001938 3300033180 Bacteria 23267
507 Ga0316574_0002354 3300035398 Bacteria 9458
508 Ga0316574_0008582 3300035398 Bacteria 5682
509 Ga0316574_0009969 3300035398 Bacteria 5346
510 Ga0373927_0000003 3300035695 Bacteria 480348
511 Ga0316582_0002212 3300036647 Bacteria 9026
512 Ga0316584_0002179 3300036712 Bacteria 12271
513 Ga0316584_0042445 3300036712 Bacteria 3392
514 Ga0395899_0000142 3300037312 Bacteria 109659
515 Ga0395899_0009818 3300037312 Bacteria 7342
516 Ga0395899_0016093 3300037312 Bacteria 5701
517 Ga0395899_0022754 3300037312 Bacteria 4749
518 Ga0395899_0053918 3300037312 Bacteria 2976
519 Ga0395899_0134478 3300037312 Bacteria 1763
520 Ga0395900_0000069 3300037418 Bacteria 190578
521 Ga0395900_0002387 3300037418 Bacteria 20737
522 Ga0395900_0010793 3300037418 Bacteria 9345
523 Ga0395900_0031124 3300037418 Bacteria 5481
524 Ga0395900_0082649 3300037418 Bacteria 3300
525 Ga0395898_0000097 3300037466 Bacteria 230579
526 Ga0395898_0001079 3300037466 Bacteria 42224
527 Ga0395898_0015073 3300037466 Bacteria 7934
528 Ga0395898_0025910 3300037466 Bacteria 5904
529 Ga0395901_0000983 3300038443 Bacteria 30866
530 Ga0395901_0002935 3300038443 Bacteria 17206
531 Ga0395901_0010713 3300038443 Bacteria 9295
532 Ga0395901_0149263 3300038443 Bacteria 2456
533 Ga0237819_00127 3300038705 Bacteria 28645
534 Ga0439436_0000010 3300041404 Bacteria 104480
535 Ga0439436_0006040 3300041404 Bacteria 3712
536 Ga0439465_0000123 3300041413 Bacteria 18623
537 Ga0439465_0003861 3300041413 Bacteria 4889
538 Ga0439465_0018945 3300041413 Bacteria 2151
539 Ga0451791_0612411 3300041451 Bacteria 1981
540 Ga0439433_0012744 3300041999 Bacteria 1845
541 Ga0439432_007320 3300042006 Bacteria 3915
542 Ga0439432_019438 3300042006 Bacteria 2262
543 Ga0439449_0000905 3300042007 Bacteria 11573
544 Ga0450908_000564 3300042184 Bacteria 7116
545 Ga0450908_000860 3300042184 Bacteria 5854
546 Ga0451577_0009927 3300042876 Bacteria 9126
547 Ga0466969_0002807 3300044656 Bacteria 9304
548 Ga0466969_0003343 3300044656 Bacteria 8536
549 Ga0466969_0004136 3300044656 Bacteria 7701
550 Ga0466969_0017661 3300044656 Bacteria 3722
551 Ga0466972_0016098 3300044658 Bacteria 3738
552 Ga0466989_0020182 3300044663 Bacteria 3832
553 Ga0466982_0000019 3300044672 Bacteria 111595
554 Ga0466982_0000098 3300044672 Bacteria 21160
555 Ga0453683_0008814 3300044673 Bacteria 6755
556 Ga0466965_0019349 3300044683 Bacteria 3269
557 Ga0466966_0020730 3300044684 Bacteria 4320
558 Ga0466961_0007963 3300044693 Bacteria 6754
559 Ga0466961_0013744 3300044693 Bacteria 5188
560 Ga0466961_0075758 3300044693 Bacteria 2132
561 Ga0466961_0091704 3300044693 Bacteria 1918
562 Ga0466964_0015082 3300044706 Bacteria 2942
563 Ga0466971_0016812 3300044719 Bacteria 3232
564 Ga0466968_0004448 3300044735 Bacteria 5244
565 Ga0466968_0030742 3300044735 Bacteria 2225
566 Ga0466970_0001674 3300044765 Bacteria 10642
567 Ga0466970_0009926 3300044765 Bacteria 4819
568 Ga0466970_0057341 3300044765 Bacteria 2082
569 Ga0466960_0031658 3300044901 Bacteria 2442
570 Ga0466959_0024013 3300045049 Bacteria 4514
571 Ga0466959_0053115 3300045049 Bacteria 2963
572 Ga0451576_0000821 3300045051 Bacteria 60704
573 Ga0451576_0072609 3300045051 Bacteria 3581
574 Ga0466967_0041735 3300045976 Bacteria 3959
575 Ga0495617_003046 3300046452 Bacteria 6383
576 Ga0495617_003503 3300046452 Bacteria 5881
577 Ga0495627_006082 3300046453 Bacteria 4770
578 Ga0495638_0000069 3300046460 Bacteria 167503
579 Ga0495638_0000122 3300046460 Bacteria 125872
580 Ga0495638_0001156 3300046460 Bacteria 25430
581 Ga0495638_0001504 3300046460 Bacteria 20993
582 Ga0495638_0005088 3300046460 Bacteria 9854
583 Ga0495650_0000209 3300046471 Bacteria 125495
584 Ga0495650_0003763 3300046471 Bacteria 10827
585 Ga0495605_0023124 3300046474 Bacteria 3272
586 Ga0495585_0000423 3300046492 Bacteria 40748
587 Ga0495585_0010514 3300046492 Bacteria 5504
588 Ga0495607_0000080 3300046501 Bacteria 97217
589 Ga0495607_0008882 3300046501 Bacteria 6846
590 Ga0495607_0021638 3300046501 Bacteria 4044
591 Ga0495607_0077432 3300046501 Bacteria 1837
592 Ga0495606_0000203 3300046507 Bacteria 103887
593 Ga0495606_0000348 3300046507 Bacteria 79254
594 Ga0495606_0016437 3300046507 Bacteria 5640
595 Ga0495610_0004716 3300046512 Bacteria 9951
596 Ga0495610_0043035 3300046512 Bacteria 2253
597 Ga0495616_0000067 3300046513 Bacteria 89610
598 Ga0495616_0025426 3300046513 Bacteria 3164
599 Ga0495620_0003391 3300046515 Bacteria 9116
600 Ga0495631_0003301 3300046518 Bacteria 8873
601 Ga0495631_0004603 3300046518 Bacteria 7301
602 Ga0495632_0000046 3300046519 Bacteria 139365
603 Ga0495637_0014700 3300046520 Bacteria 3688
604 Ga0495643_0001740 3300046522 Bacteria 18773
605 Ga0495648_0018232 3300046524 Bacteria 4983
606 Ga0495663_0000872 3300046525 Bacteria 10172
607 Ga0495663_0001432 3300046525 Bacteria 7534
608 Ga0495621_0003739 3300046539 Bacteria 4217
609 Ga0495633_0013730 3300046558 Bacteria 4257
610 Ga0495633_0022068 3300046558 Bacteria 3173
611 Ga0495668_0000804 3300046616 Bacteria 36089
612 Ga0495611_0000001 3300046648 Bacteria 2628469
613 Ga0495625_0000001 3300046660 Bacteria 1641829
614 Ga0495625_0024027 3300046660 Bacteria 4646
615 Ga0495625_0044660 3300046660 Bacteria 3206
616 Ga0495661_0004547 3300046665 Bacteria 9991
617 Ga0495647_0021574 3300046681 Bacteria 2320
618 Ga0495670_0009454 3300046691 Bacteria 4791
619 Ga0495671_0000875 3300046692 Bacteria 21477
620 Ga0495649_0012109 3300046694 Bacteria 5034
621 Ga0495649_0015980 3300046694 Bacteria 4261
622 Ga0495589_0000138 3300046794 Bacteria 66651
623 Ga0495660_0004009 3300046810 Bacteria 8989
624 Ga0495672_0000373 3300047320 Bacteria 55844
625 Ga0495679_000029 3300047446 Bacteria 190883
626 Ga0495673_0000001 3300047469 Bacteria 1630730
627 Ga0495673_0014223 3300047469 Bacteria 4144
628 Ga0495686_0000043 3300047472 Bacteria 291565
629 Ga0495686_0085291 3300047472 Bacteria 1923
630 Ga0496101_0016866 3300048904 Bacteria 4944
631 Ga0496104_0000022 3300048907 Bacteria 237390
632 Ga0496104_0012882 3300048907 Bacteria 7532
633 Ga0496105_0000012 3300048908 Bacteria 261713
634 Ga0496105_0006290 3300048908 Bacteria 9118
635 Ga0496105_0018943 3300048908 Bacteria 5545
636 Ga0496105_0090311 3300048908 Bacteria 2530
637 Ga0496106_0009989 3300048909 Bacteria 7009
638 Ga0496106_0014736 3300048909 Bacteria 5780
639 Ga0496108_0030769 3300048911 Bacteria 4448
640 Ga0496109_0200161 3300048912 Bacteria 1877
641 Ga0496110_0005613 3300048913 Bacteria 9846
642 Ga0496110_0035169 3300048913 Bacteria 4344
643 Ga0496113_0067201 3300048916 Bacteria 2717
644 Ga0496114_0001917 3300048917 Bacteria 15837
645 Ga0496114_0046500 3300048917 Bacteria 3607
646 Ga0496115_0000163 3300048918 Bacteria 62399
647 Ga0496115_0000181 3300048918 Bacteria 58749
648 Ga0496115_0013485 3300048918 Bacteria 6184
649 Ga0496115_0020279 3300048918 Bacteria 5126
650 Ga0496115_0038116 3300048918 Bacteria 3812
651 Ga0496115_0071919 3300048918 Bacteria 2805
652 Ga0496116_0000005 3300048919 Bacteria 827804
653 Ga0496116_0017392 3300048919 Bacteria 5580
654 Ga0496117_0005762 3300048920 Bacteria 12872
655 Ga0496117_0009952 3300048920 Bacteria 8743
656 Ga0496117_0013593 3300048920 Bacteria 7089
657 Ga0496117_0015798 3300048920 Bacteria 6407
658 Ga0496117_0020923 3300048920 Bacteria 5319
659 Ga0496117_0024725 3300048920 Bacteria 4739
660 Ga0496117_0028315 3300048920 Bacteria 4342
661 Ga0496117_0057321 3300048920 Bacteria 2706
662 Ga0496118_0000528 3300048921 Bacteria 62711
663 Ga0496118_0000848 3300048921 Bacteria 48534
664 Ga0496118_0004154 3300048921 Bacteria 17490
665 Ga0496118_0005474 3300048921 Bacteria 14415
666 Ga0496118_0016346 3300048921 Bacteria 6811
667 Ga0496118_0017635 3300048921 Bacteria 6485
668 Ga0496118_0025548 3300048921 Bacteria 5059
669 Ga0496118_0029280 3300048921 Bacteria 4621
670 Ga0496118_0031026 3300048921 Bacteria 4443
671 Ga0496119_0000184 3300048922 Bacteria 87765
672 Ga0496119_0000659 3300048922 Bacteria 46235
673 Ga0496119_0001426 3300048922 Bacteria 28899
674 Ga0496119_0021762 3300048922 Bacteria 4619
675 Ga0496120_0000217 3300048923 Bacteria 99402
676 Ga0496120_0000307 3300048923 Bacteria 81552
677 Ga0496120_0001091 3300048923 Bacteria 35465
678 Ga0496120_0004293 3300048923 Bacteria 12085
679 Ga0496121_0000029 3300048924 Bacteria 430303
680 Ga0496121_0000045 3300048924 Bacteria 336130
681 Ga0496121_0004159 3300048924 Bacteria 19788
682 Ga0496121_0009184 3300048924 Bacteria 11428
683 Ga0496121_0009283 3300048924 Bacteria 11346
684 Ga0496121_0017494 3300048924 Bacteria 7318
685 Ga0496121_0029782 3300048924 Bacteria 5034
686 Ga0496121_0037992 3300048924 Bacteria 4270
687 Ga0496121_0040589 3300048924 Bacteria 4080
688 Ga0496122_0000267 3300048925 Bacteria 116950
689 Ga0496122_0001038 3300048925 Bacteria 48750
690 Ga0496122_0001998 3300048925 Bacteria 30375
691 Ga0496122_0005854 3300048925 Bacteria 14421
692 Ga0496122_0016541 3300048925 Bacteria 6966
693 Ga0496122_0019191 3300048925 Bacteria 6261
694 Ga0496122_0019274 3300048925 Bacteria 6242
695 Ga0496122_0030232 3300048925 Bacteria 4546
696 Ga0496123_0000161 3300048926 Bacteria 134623
697 Ga0496123_0000848 3300048926 Bacteria 48801
698 Ga0496123_0001899 3300048926 Bacteria 27259
699 Ga0496123_0015448 3300048926 Bacteria 6261
700 Ga0496123_0024797 3300048926 Bacteria 4543
701 Ga0496123_0026628 3300048926 Bacteria 4327
702 Ga0496123_0031037 3300048926 Bacteria 3897
703 Ga0496124_0000009 3300048927 Bacteria 734820
704 Ga0496124_0000734 3300048927 Bacteria 53581
705 Ga0496124_0001490 3300048927 Bacteria 34391
706 Ga0496124_0004066 3300048927 Bacteria 17329
707 Ga0496124_0025689 3300048927 Bacteria 5328
708 Ga0496124_0042962 3300048927 Bacteria 3888
709 Ga0496125_0000149 3300048928 Bacteria 154223
710 Ga0496125_0010887 3300048928 Bacteria 9147
711 Ga0496125_0031770 3300048928 Bacteria 4699
712 Ga0496125_0031902 3300048928 Bacteria 4687
713 Ga0496125_0036240 3300048928 Bacteria 4311
714 Ga0496125_0041611 3300048928 Bacteria 3926
715 Ga0496126_0002149 3300048929 Bacteria 27466
716 Ga0496126_0003384 3300048929 Bacteria 20200
717 Ga0496126_0004290 3300048929 Bacteria 17144
718 Ga0496126_0013547 3300048929 Bacteria 8286
719 Ga0496126_0020995 3300048929 Bacteria 6391
720 Ga0496126_0060008 3300048929 Bacteria 3423
721 Ga0496126_0060980 3300048929 Bacteria 3390
722 Ga0496126_0120754 3300048929 Bacteria 2273
723 Ga0495678_000718 3300049459 Bacteria 30159
724 Ga0501031_0013662 3300049568 Bacteria 5290
725 Ga0501031_0059928 3300049568 Bacteria 2480
726 Ga0501032_0027853 3300049569 Bacteria 3883
727 Ga0501032_0037308 3300049569 Bacteria 3314
728 Ga0501033_0000747 3300049570 Bacteria 29937
729 Ga0501033_0001508 3300049570 Bacteria 20623
730 Ga0501033_0005847 3300049570 Bacteria 9668
731 Ga0501033_0015113 3300049570 Bacteria 5858
732 Ga0501033_0032897 3300049570 Bacteria 3893
733 Ga0501033_0062985 3300049570 Bacteria 2730
734 Ga0501034_0000344 3300049571 Bacteria 80851
735 Ga0501034_0000355 3300049571 Bacteria 78528
736 Ga0501034_0012809 3300049571 Bacteria 8650
737 Ga0501034_0032668 3300049571 Bacteria 5285
738 Ga0501034_0055878 3300049571 Bacteria 3972
739 Ga0501036_0011935 3300049572 Bacteria 7202
740 Ga0501036_0035985 3300049572 Bacteria 4189
741 Ga0501036_0042201 3300049572 Bacteria 3862
742 Ga0501037_0005211 3300049573 Bacteria 9454
743 Ga0501037_0006927 3300049573 Bacteria 8278
744 Ga0501037_0012184 3300049573 Bacteria 6330
745 Ga0501037_0029467 3300049573 Bacteria 4055
746 Ga0501037_0033049 3300049573 Bacteria 3822
747 Ga0501038_0025329 3300049574 Bacteria 5289
748 Ga0501038_0026037 3300049574 Bacteria 5209
749 Ga0501038_0079480 3300049574 Bacteria 2765
750 Ga0501039_0007584 3300049575 Bacteria 8286
751 Ga0501039_0127614 3300049575 Bacteria 1995
752 Ga0501040_0001093 3300049576 Bacteria 17147
753 Ga0501040_0008567 3300049576 Bacteria 6637
754 Ga0501040_0009299 3300049576 Bacteria 6402
755 Ga0501040_0009725 3300049576 Bacteria 6276
756 Ga0501040_0012191 3300049576 Bacteria 5628
757 Ga0501041_0037583 3300049577 Bacteria 2934
758 Ga0501042_0004185 3300049578 Bacteria 9175
759 Ga0501042_0004613 3300049578 Bacteria 8796
760 Ga0501042_0007705 3300049578 Bacteria 7071
761 Ga0501042_0043650 3300049578 Bacteria 3193
762 Ga0501043_0002540 3300049579 Bacteria 15433
763 Ga0501043_0019418 3300049579 Bacteria 5335
764 Ga0501043_0041262 3300049579 Bacteria 3626
765 Ga0501046_0002537 3300049580 Bacteria 17078
766 Ga0501046_0012062 3300049580 Bacteria 7368
767 Ga0501046_0022811 3300049580 Bacteria 5155
768 Ga0501047_0004475 3300049581 Bacteria 13151
769 Ga0501047_0010659 3300049581 Bacteria 8686
770 Ga0501047_0015450 3300049581 Bacteria 7274
771 Ga0501047_0069784 3300049581 Bacteria 3383
772 Ga0501047_0076899 3300049581 Bacteria 3212
773 Ga0501047_0141866 3300049581 Bacteria 2280
774 Ga0501048_0013116 3300049582 Bacteria 6151
775 Ga0501048_0018366 3300049582 Bacteria 5144
776 Ga0501048_0020049 3300049582 Bacteria 4904
777 Ga0501048_0055113 3300049582 Bacteria 2823
778 Ga0501048_0069922 3300049582 Bacteria 2479
779 Ga0501068_0024287 3300049584 Bacteria 3559
780 Ga0501068_0030043 3300049584 Bacteria 3221
781 Ga0501069_0001683 3300049585 Bacteria 10987
782 Ga0501069_0023366 3300049585 Bacteria 3371
783 Ga0501070_0001120 3300049586 Bacteria 24055
784 Ga0501070_0011003 3300049586 Bacteria 7637
785 Ga0501070_0013738 3300049586 Bacteria 6820
786 Ga0501070_0018995 3300049586 Bacteria 5765
787 Ga0501070_0023611 3300049586 Bacteria 5152
788 Ga0501070_0075225 3300049586 Bacteria 2795
789 Ga0501071_0008278 3300049587 Bacteria 6867
790 Ga0501071_0033521 3300049587 Bacteria 3648
791 Ga0501071_0046255 3300049587 Bacteria 3125
792 Ga0501072_0004152 3300049588 Bacteria 10964
793 Ga0501072_0008841 3300049588 Bacteria 7653
794 Ga0501072_0019046 3300049588 Bacteria 5300
795 Ga0501072_0027365 3300049588 Bacteria 4447
796 Ga0501073_0003721 3300049589 Bacteria 11458
797 Ga0501073_0005507 3300049589 Bacteria 9483
798 Ga0501073_0010681 3300049589 Bacteria 6724
799 Ga0501073_0012681 3300049589 Bacteria 6147
800 Ga0501073_0069917 3300049589 Bacteria 2446
801 Ga0501073_0107067 3300049589 Bacteria 1940
802 Ga0501074_0004079 3300049590 Bacteria 10423
803 Ga0501074_0024713 3300049590 Bacteria 4365
804 Ga0501074_0037632 3300049590 Bacteria 3507
805 Ga0501075_0065660 3300049591 Bacteria 2738
806 Ga0501076_0002535 3300049592 Bacteria 12567
807 Ga0501076_0004710 3300049592 Bacteria 9727
808 Ga0501076_0023151 3300049592 Bacteria 4784
809 Ga0501077_0018306 3300049593 Bacteria 4433
810 Ga0501077_0103282 3300049593 Bacteria 1806
811 Ga0501079_0007763 3300049741 Bacteria 8121
812 Ga0501079_0059639 3300049741 Bacteria 2943
813 Ga0501079_0199192 3300049741 Bacteria 1564
814 Ga0501080_0004279 3300049742 Bacteria 12672
815 Ga0501080_0028382 3300049742 Bacteria 5205
816 Ga0501080_0028686 3300049742 Bacteria 5180
817 Ga0501080_0084412 3300049742 Bacteria 2950
818 Ga0501081_0004658 3300049743 Bacteria 8817
819 Ga0501081_0005725 3300049743 Bacteria 8042
820 Ga0501081_0009346 3300049743 Bacteria 6387
821 Ga0501081_0021742 3300049743 Bacteria 4283
822 Ga0501083_0012139 3300049744 Bacteria 6029
823 Ga0501035_0003148 3300049822 Bacteria 15853
824 Ga0501035_0010022 3300049822 Bacteria 8792
825 Ga0501035_0019320 3300049822 Bacteria 6270
826 Ga0501035_0022285 3300049822 Bacteria 5817
827 Ga0501035_0025947 3300049822 Bacteria 5368
828 Ga0501035_0032024 3300049822 Bacteria 4787
829 Ga0501035_0095280 3300049822 Bacteria 2616
830 Ga0501035_0141934 3300049822 Bacteria 2088
831 Ga0501035_0161756 3300049822 Bacteria 1937
832 Ga0501044_0007144 3300049823 Bacteria 12285
833 Ga0501044_0011428 3300049823 Bacteria 9619
834 Ga0501044_0029738 3300049823 Bacteria 5759
835 Ga0501044_0041271 3300049823 Bacteria 4803
836 Ga0501044_0043549 3300049823 Bacteria 4662
837 Ga0501044_0083293 3300049823 Bacteria 3235
838 Ga0501044_0121429 3300049823 Bacteria 2613
839 Ga0501044_0151906 3300049823 Bacteria 2297
840 Ga0501045_0000225 3300049824 Bacteria 32621
841 Ga0501045_0019176 3300049824 Bacteria 4872
842 nmdc:mga00v17_10476_c1 3300050491 Bacteria 5064
843 nmdc:mga00v17_5307_c1 3300050491 Bacteria 6789
844 nmdc:mga08y16_54621_c1 3300050511 Bacteria 4174
845 nmdc:mga0n895_17491_c1 3300050512 Bacteria 6608
846 nmdc:mga0rr50_152611_c1 3300050513 Bacteria 1868
847 nmdc:mga0a205_603_c1 3300050515 Bacteria 28564
848 nmdc:mga0sz30_14786_c1 3300050516 Bacteria 3078
849 Ga0500610_0023463 3300053079 Bacteria 3055
850 Ga0500643_000002 3300053087 Bacteria 1277657
851 Ga0500643_001805 3300053087 Bacteria 11703
852 Ga0500651_0000088 3300053093 Bacteria 59179
853 Ga0500556_0000234 3300053104 Bacteria 45118
854 Ga0500594_0001943 3300053118 Bacteria 4465
855 Ga0500597_000873 3300053120 Bacteria 6975
856 Ga0500642_0000014 3300053130 Bacteria 182110
857 Ga0500634_0001229 3300053161 Bacteria 9679
858 Ga0500645_000395 3300053730 Bacteria 30555
859 Ga0500645_005302 3300053730 Bacteria 4773
860 Ga0501084_0014642 3300054114 Bacteria 6502
861 Ga0501084_0042413 3300054114 Bacteria 3806
862 Ga0501084_0094713 3300054114 Bacteria 2507
863 Ga0501084_0128527 3300054114 Bacteria 2132
864 Ga0500661_005416 3300055283 Bacteria 2386
865 Ga0501082_0009187 3300060353 Bacteria 8525
866 Ga0501082_0030869 3300060353 Bacteria 4619
867 Ga0466962_0027328 3300061719 Bacteria 2738
868 Ga0466962_0042936 3300061719 Bacteria 2164
869 Ga0530510_0004136 3300061734 Bacteria 10019
870 Ga0530510_0025249 3300061734 Bacteria 4247
871 2512732436 2512564039 Bacteria 8739048
872 2524190819 2524023129 Bacteria 6762600
873 2525556682 2524614729 Bacteria 3091755
874 2538832646 2537561836 Bacteria 3910579
875 2547502785 2547132130 Bacteria 4660562
876 2578458700 2576861471 Bacteria 4648976
877 2587738596 2585428059 Bacteria 8696589
878 2595318519 2593339198 Bacteria 7267884
879 2595446484 2593339238 Bacteria 4182970
880 2595451985 2593339239 Bacteria 4124669
881 2630648278 2627854209 Bacteria 3093011
882 2643830108 2643221562 Bacteria 4048635
883 2643894365 2643221577 Bacteria 3710843
884 2643907792 2643221579 Bacteria 4443405
885 2643916003 2643221581 Bacteria 3893603
886 2644426890 2643221676 Bacteria 8119172
887 2644476569 2643221685 Bacteria 3673288
888 2673822801 2671180694 Bacteria 7506943
889 2687583262 2687453130 Bacteria 4227172
890 2721026882 2718218334 Bacteria 4765486
891 2735837567 2734482264 Unclassified 5014763
892 2739228174 2738543009 Bacteria 4944499
893 2739731596 2739367700 Bacteria 4747630
894 2748015862 2747842501 Bacteria 5293829
895 2765578683 2765235840 Bacteria 4663337
896 2816516758 2816332141 Bacteria 4436036
897 2819565239 2818991440 Bacteria 4774720
898 2819662981 2818991457 Bacteria 5323295
899 2842394993 2842391507 Bacteria 4486072
900 2842758400 2842757796 Bacteria 3981385
901 2842780775 2842780639 Bacteria 4337790
902 2842917424 2842914999 Bacteria 4419378
903 2842919614 2842918807 Bacteria 4289178
904 2852651069 2852649853 Bacteria 4036942
905 2852686028 2852684882 Bacteria 5463342
906 2857446885 2857442823 Bacteria 4562550
907 2857453701 2857453340 Bacteria 8090534
908 2864997913 2864997549 Bacteria 5139696
909 2874221311 2874220319 Bacteria 4594709
910 2884341164 2884338543 Bacteria 4610696
911 2884413505 2884411467 Bacteria 5246714
912 2889297287 2889295896 Bacteria 4704906
913 2894415659 2894414249 Bacteria 4405451
914 2895395690 2895395659 Bacteria 3983269
915 2904466907 2904463128 Bacteria 4775606
916 2919087871 2919085039 Bacteria 4532964
917 2919133565 2919130084 Bacteria 5301837
918 2919136107 2919134579 Bacteria 4480386
919 2919405093 2919404418 Bacteria 4232372
920 2919514563 2919513703 Bacteria 3844312
921 2919676605 2919675420 Bacteria 3969095
922 2923518469 2923516293 Bacteria 3716336
923 2928496280 2928496128 Bacteria 4631123
924 2928967501 2928963466 Bacteria 5165703
925 2929197381 2929195423 Bacteria 5325372
926 2931381035 2931380184 Bacteria 4455911
927 2937612132 2937610967 Bacteria 4618818
928 2939590774 2939589442 Bacteria 4214238
929 2939611992 2939611941 Bacteria 3892017
930 2939622956 2939622612 Bacteria 4698046
931 2939630871 2939626828 Bacteria 4695272
932 2941472620 2941471342 Bacteria 5018624
933 2941478054 2941475908 Bacteria 4145589
934 2953994892 2953994433 Bacteria 4303959
935 2961048077 2961047084 Bacteria 4594415
936 2961065095 2961064222 Bacteria 4749990
937 2971411064 2971410472 Bacteria 8311090
938 2974309197 2974307012 Bacteria 4172388
939 2977249916 2977247770 Bacteria 4160543
940 2980128969 2980125574 Bacteria 5567337
941 2981285766 2981284811 Bacteria 4641497
942 2981290713 2981289755 Bacteria 4641509
943 2981980665 2981980479 Bacteria 4641628
944 2981985543 2981985349 Bacteria 4641497
945 2984515594 2984514374 Bacteria 4172479
946 8002323647 8002317523 Bacteria 8051857
947 8002872224 8002869464 Bacteria 3588529
948 8003015923 8003014200 Bacteria 4059994
949 8021623762 8021622325 Bacteria 4844743
950 8021630458 8021626552 Bacteria 4665214
951 8021650620 8021648035 Bacteria 4772378
952 8046998894 8046991243 Bacteria 8497463
953 8054798322 8054795415 Bacteria 9785225
954 8056536393 8056533031 Bacteria 8964429
955 8057477228 8057473075 Bacteria 5892720
956 Ga0070689_100008741
957 JGI24741J21665_1009606
958 JGI24740J21852_10004853
959 JGI24739J22299_10000167
960 JGI25156J39149_1001689
961 JGI25156J39149_1008279
962 JGI25162J39368_1002522
963 JGI25162J39368_1002756
964 JGI25162J39368_1002946
965 JGI25162J39368_1003492
966 JGI25157J39369_1000760
967 JGI25157J39369_1001514
968 JGI25157J39369_1001601
969 JGI25163J39215_1001514
970 JGI25164J39214_1000049
971 JGI25164J39214_1000088
972 JGI25164J39214_1001313
973 JGI25164J39214_1001318
974 JGI25152J39213_1000102
975 JGI25150J39212_1000099
976 JGI25150J39212_1000290
977 JGI25151J46595_10000041
978 JGI25151J46595_10000269
979 JGI25151J46595_10011611
980 JGI25165J46597_1000009
981 JGI25165J46597_1000088
982 JGI25165J46597_1002376
983 JGI25165J46597_1002837
984 JGI25153J46596_10000189
985 rootH2_10092143
986 Ga0006562J51391_1029636
987 Ga0006562J51391_1029638
988 Ga0055525_1000146
989 Ga0055527_1000328
990 Ga0055527_1000605
991 Ga0055535_1000082
992 Ga0055535_1000745
993 Ga0055535_1000756
994 Ga0055535_1001284
995 Ga0055542_1000765
996 Ga0055542_1000774
997 Ga0055542_1000856
998 Ga0055542_1001065
999 Ga0055542_1002159
1000 Ga0055542_1002186
1001 Ga0055529_1000020
1002 Ga0055529_1000663
1003 Ga0055529_1000666
1004 Ga0055529_1000887
1005 Ga0055526_1006635
1006 Ga0055537_1000407
1007 Ga0055524_1017968
1008 Ga0055536_1005286
1009 Ga0055536_1005928
1010 Ga0055536_1006000
1011 Ga0055536_1019665
1012 Ga0055534_1000039
1013 Ga0055528_1000529
1014 Ga0055530_10002892
1015 Ga0055530_10005063
1016 Ga0055530_10008054
1017 Ga0055531_10006146
1018 Ga0055531_10007661
1019 Ga0055531_10007781
1020 Ga0055531_10011589
1021 Ga0058692_1000018
1022 Ga0065165_1003051
1023 Ga0065704_10002333
1024 Ga0065704_10072174
1025 Ga0065715_10093484
1026 Ga0065715_10110437
1027 Ga0070658_10012294
1028 Ga0070670_100007924
1029 Ga0070666_10000003
1030 Ga0070666_10000757
1031 Ga0070666_10009654
1032 Ga0070680_100008297
1033 Ga0070680_100073618
1034 Ga0070682_100002136
1035 Ga0070682_100008145
1036 Ga0068868_100007207
1037 Ga0068868_100027499
1038 Ga0068868_100032309
1039 Ga0070660_100011933
1040 Ga0070660_100025556
1041 Ga0070660_100051136
1042 Ga0070691_10000561
1043 Ga0070661_100001862
1044 Ga0070661_100033926
1045 Ga0070661_100104718
1046 Ga0070692_10000139
1047 Ga0070692_10001873
1048 Ga0070669_100016268
1049 Ga0070669_100079690
1050 Ga0070675_100013380
1051 Ga0070659_100007436
1052 Ga0070667_100000084
1053 Ga0070667_100009456
1054 Ga0070667_100149360
1055 Ga0070714_100000372
1056 Ga0070714_100000713
1057 Ga0070714_100013529
1058 Ga0070714_100021754
1059 Ga0070714_100022773
1060 Ga0070694_100032508
1061 Ga0070663_100041672
1062 Ga0070663_100069432
1063 Ga0070678_100003696
1064 Ga0070681_10009408
1065 Ga0070681_10017636
1066 Ga0070681_10025596
1067 Ga0068867_100071691
1068 Ga0070685_10004666
1069 Ga0070698_100064803
1070 Ga0070679_100016456
1071 Ga0070679_100081626
1072 Ga0070679_100106460
1073 Ga0070679_100127285
1074 Ga0070684_100033959
1075 Ga0068853_100002068
1076 Ga0068853_100004423
1077 Ga0068853_100012109
1078 Ga0068853_100139593
1079 Ga0070672_100009562
1080 Ga0070696_100000851
1081 Ga0070696_100001442
1082 Ga0070696_100011770
1083 Ga0070693_100004059
1084 Ga0070665_100013099
1085 Ga0070665_100023453
1086 Ga0070665_100037857
1087 Ga0068855_100020753
1088 Ga0068855_100031696
1089 Ga0068855_100108259
1090 Ga0068855_100171159
1091 Ga0068857_100004292
1092 Ga0068857_100020788
1093 Ga0068854_100003470
1094 Ga0068854_100007127
1095 Ga0068854_100010098
1096 Ga0068856_100000983
1097 Ga0068856_100052772
1098 Ga0068852_100021578
1099 Ga0068852_100057982
1100 Ga0068859_100021151
1101 Ga0068859_100061891
1102 Ga0068859_100186169
1103 Ga0068864_100030923
1104 Ga0068864_100128090
1105 Ga0068851_10004998
1106 Ga0068870_10009151
1107 Ga0068863_100013560
1108 Ga0068863_100127670
1109 Ga0068860_100009881
1110 Ga0068860_100105026
1111 Ga0068862_100064307
1112 Ga0075364_10001000
1113 Ga0097621_100019126
1114 Ga0068871_100012103
1115 Ga0075428_100009101
1116 Ga0075428_100057180
1117 Ga0075433_10005362
1118 Ga0075434_100000572
1119 Ga0075434_100071461
1120 Ga0068865_100042758
1121 Ga0097620_100021151
1122 Ga0097620_100061888
1123 Ga0097620_100186173
1124 Ga0075435_100063636
1125 Ga0105251_10000880
1126 Ga0105251_10009176
1127 Ga0105240_10012346
1128 Ga0105240_10035843
1129 Ga0105240_10043064
1130 Ga0105240_10049909
1131 Ga0105240_10063542
1132 Ga0105240_10084533
1133 Ga0105240_10097448
1134 Ga0111539_10006755
1135 Ga0105245_10003428
1136 Ga0105245_10116590
1137 Ga0105247_10010854
1138 Ga0105243_10021826
1139 Ga0105241_10042237
1140 Ga0105241_10076264
1141 Ga0105242_10001298
1142 Ga0105242_10044328
1143 Ga0105248_10000429
1144 Ga0105248_10005167
1145 Ga0105248_10054583
1146 Ga0105237_10000016
1147 Ga0105237_10000388
1148 Ga0105238_10000362
1149 Ga0105238_10002989
1150 Ga0105238_10024524
1151 Ga0105238_10032850
1152 Ga0105238_10072023
1153 Ga0105238_10097547
1154 Ga0105249_10009937
1155 Ga0105030_100130
1156 Ga0105239_10000063
1157 Ga0105239_10007002
1158 Ga0105239_10012123
1159 Ga0105239_10013284
1160 Ga0105239_10038848
1161 Ga0105239_10069647
1162 Ga0157373_10005152
1163 Ga0157373_10022169
1164 Ga0157371_10000487
1165 Ga0157371_10002814
1166 Ga0157371_10010486
1167 Ga0157371_10028762
1168 Ga0157370_10010813
1169 Ga0157370_10013028
1170 Ga0157370_10014321
1171 Ga0157370_10025566
1172 Ga0157369_10000027
1173 Ga0157369_10002364
1174 Ga0157369_10016391
1175 Ga0157369_10042658
1176 Ga0157374_10080245
1177 Ga0157378_10000006
1178 Ga0157378_10026393
1179 Ga0163162_10000357
1180 Ga0163162_10002734
1181 Ga0163162_10031567
1182 Ga0157372_10003304
1183 Ga0157372_10027342
1184 Ga0157372_10036984
1185 Ga0157372_10053894
1186 Ga0157372_10121842
1187 Ga0157375_10000102
1188 Ga0157375_10004302
1189 Ga0157375_10055469
1190 Ga0157375_10287370
1191 Ga0163163_10000877
1192 Ga0163163_10023588
1193 Ga0182008_10000143
1194 Ga0182008_10007235
1195 Ga0182008_10018312
1196 Ga0182008_10026014
1197 Ga0157379_10000992
1198 Ga0157379_10001842
1199 Ga0157376_10003668
1200 Ga0157376_10008252
1201 Ga0157376_10206001
1202 Ga0182006_1000074
1203 Ga0182006_1001229
1204 Ga0182006_1018348
1205 Ga0182007_10000043
1206 Ga0182007_10004954
1207 Ga0182005_1000267
1208 Ga0182005_1000326
1209 Ga0182005_1001110
1210 Ga0182005_1002979
1211 Ga0183369_1006
1212 Ga0183368_1004
1213 Ga0163161_10007748
1214 Ga0197907_10862894
1215 Ga0197907_11474155
1216 Ga0206356_10168839
1217 Ga0206351_10908139
1218 Ga0206353_10073144
1219 Ga0209784_100013
1220 Ga0209566_100544
1221 Ga0209674_100026
1222 Ga0209674_100062
1223 Ga0209674_100974
1224 Ga0209672_100007
1225 Ga0209672_100017
1226 Ga0209672_100743
1227 Ga0209672_100839
1228 Ga0209672_102291
1229 Ga0209563_100131
1230 Ga0207427_100021
1231 Ga0207427_100073
1232 Ga0207427_100289
1233 Ga0207427_100306
1234 Ga0209437_100012
1235 Ga0209437_100039
1236 Ga0209437_100087
1237 Ga0209437_100129
1238 Ga0209437_100159
1239 Ga0209437_100637
1240 Ga0209258_100017
1241 Ga0209258_100019
1242 Ga0209258_100206
1243 Ga0209258_100213
1244 Ga0209258_100594
1245 Ga0209258_102146
1246 Ga0207425_1000092
1247 Ga0209646_1001828
1248 Ga0209026_1000051
1249 Ga0209026_1000079
1250 Ga0209026_1000125
1251 Ga0209026_1000592
1252 Ga0209026_1002773
1253 Ga0209677_100969
1254 Ga0209148_1000001
1255 Ga0209148_1000005
1256 Ga0209148_1000009
1257 Ga0209148_1000044
1258 Ga0209148_1000176
1259 Ga0209148_1000185
1260 Ga0209759_1000145
1261 Ga0209759_1000328
1262 Ga0209759_1002334
1263 Ga0209759_1005371
1264 Ga0209129_1000151
1265 Ga0209129_1003459
1266 Ga0209129_1007561
1267 Ga0209233_1000002
1268 Ga0209233_1000020
1269 Ga0209233_1000023
1270 Ga0209233_1000090
1271 Ga0209565_1000014
1272 Ga0209455_1000010
1273 Ga0209455_1000027
1274 Ga0209455_1000032
1275 Ga0209455_1000081
1276 Ga0209673_1000171
1277 Ga0209130_1012874
1278 Ga0209675_1000011
1279 Ga0209675_1016461
1280 Ga0209676_1000079
1281 Ga0209676_1000086
1282 Ga0209676_1000092
1283 Ga0209676_1002465
1284 Ga0209676_1003076
1285 Ga0209676_1003077
1286 Ga0209676_1006826
1287 Ga0209025_1000012
1288 Ga0209025_1000015
1289 Ga0209025_1002444
1290 Ga0209025_1008928
1291 Ga0209564_1000221
1292 Ga0209758_1000018
1293 Ga0209758_1005446
1294 Ga0209758_1008116
1295 Ga0209758_1015576
1296 Ga0209758_1016918
1297 Ga0209050_1000329
1298 Ga0209050_1000415
1299 Ga0209050_1000528
1300 Ga0209050_1004837
1301 Ga0209050_1005515
1302 Ga0209256_1004521
1303 Ga0209256_1018718
1304 Ga0209051_1002764
1305 Ga0209051_1007093
1306 Ga0209051_1032538
1307 Ga0209257_1000080
1308 Ga0209257_1000081
1309 Ga0209257_1000121
1310 Ga0209257_1000145
1311 Ga0209257_1002505
1312 Ga0209257_1004877
1313 Ga0209257_1005274
1314 Ga0209257_1015664
1315 Ga0207656_10001780
1316 Ga0207713_1000710
1317 Ga0207713_1009080
1318 Ga0207710_10034415
1319 Ga0207680_10000006
1320 Ga0207680_10020353
1321 Ga0207647_10000607
1322 Ga0207647_10001539
1323 Ga0207647_10002712
1324 Ga0207647_10012222
1325 Ga0207647_10024280
1326 Ga0207645_10013275
1327 Ga0207705_10000165
1328 Ga0207705_10000353
1329 Ga0207705_10000355
1330 Ga0207705_10001403
1331 Ga0207705_10008340
1332 Ga0207707_10000391
1333 Ga0207707_10001033
1334 Ga0207707_10001308
1335 Ga0207707_10010325
1336 Ga0207707_10011013
1337 Ga0207707_10012035
1338 Ga0207707_10017065
1339 Ga0207707_10046729
1340 Ga0207707_10051686
1341 Ga0207695_10000975
1342 Ga0207695_10006463
1343 Ga0207695_10007085
1344 Ga0207695_10009557
1345 Ga0207695_10011615
1346 Ga0207695_10012347
1347 Ga0207695_10031715
1348 Ga0207695_10046563
1349 Ga0207695_10087165
1350 Ga0207671_10000137
1351 Ga0207671_10003811
1352 Ga0207671_10004200
1353 Ga0207660_10000931
1354 Ga0207660_10001391
1355 Ga0207660_10003395
1356 Ga0207660_10005061
1357 Ga0207657_10010252
1358 Ga0207657_10017203
1359 Ga0207649_10005594
1360 Ga0207649_10031454
1361 Ga0207649_10089027
1362 Ga0207652_10000030
1363 Ga0207652_10001197
1364 Ga0207652_10041489
1365 Ga0207681_10004705
1366 Ga0207694_10000563
1367 Ga0207694_10004402
1368 Ga0207694_10012219
1369 Ga0207694_10012898
1370 Ga0207694_10041831
1371 Ga0207650_10044596
1372 Ga0207700_10000822
1373 Ga0207664_10000474
1374 Ga0207664_10000584
1375 Ga0207664_10000585
1376 Ga0207644_10000313
1377 Ga0207644_10060403
1378 Ga0207690_10000443
1379 Ga0207690_10001772
1380 Ga0207690_10001851
1381 Ga0207690_10001946
1382 Ga0207690_10007510
1383 Ga0207690_10008552
1384 Ga0207690_10009506
1385 Ga0207706_10029417
1386 Ga0207709_10018744
1387 Ga0207670_10005060
1388 Ga0207704_10001296
1389 Ga0207691_10007639
1390 Ga0207711_10001015
1391 Ga0207711_10004854
1392 Ga0207711_10061557
1393 Ga0207661_10004417
1394 Ga0207667_10000250
1395 Ga0207667_10000679
1396 Ga0207667_10001003
1397 Ga0207667_10001167
1398 Ga0207667_10005715
1399 Ga0207667_10016516
1400 Ga0207712_10000343
1401 Ga0207640_10001071
1402 Ga0207640_10003830
1403 Ga0207640_10005529
1404 Ga0207658_10000093
1405 Ga0207677_10094535
1406 Ga0207639_10001634
1407 Ga0207639_10002124
1408 Ga0207639_10005666
1409 Ga0207639_10007609
1410 Ga0207678_10000433
1411 Ga0207678_10005962
1412 Ga0207678_10050893
1413 Ga0207678_10080157
1414 Ga0207702_10000943
1415 Ga0207702_10003531
1416 Ga0207702_10140169
1417 Ga0207648_10029340
1418 Ga0207674_10007214
1419 Ga0207674_10019944
1420 Ga0207674_10024820
1421 Ga0207674_10065193
1422 Ga0207674_10066528
1423 Ga0207683_10025237
1424 Ga0207698_10000592
1425 Ga0207698_10002980
1426 Ga0207698_10038811
1427 Ga0209371_1000011
1428 Ga0268266_10000043
1429 Ga0268266_10045565
1430 Ga0268265_10094964
1431 Ga0268264_10022370
1432 Ga0268264_10069503
1433 Ga0265334_10000009
1434 Ga0265338_10009730
1435 Ga0268256_1000011
1436 Ga0316177_1203723
1437 Ga0307513_10053920
1438 Ga0307408_100046420
1439 Ga0265313_10007989
1440 Ga0316575_10011930
1441 Ga0316575_10040661
1442 Ga0316578_10016352
1443 Ga0307516_10001401
1444 Ga0307516_10018328
1445 Ga0307516_10035332
1446 Ga0307405_10003809
1447 Ga0316577_10009829
1448 Ga0307413_10001746
1449 Ga0307410_10005487
1450 Ga0307407_10013528
1451 Ga0307412_10006145
1452 Ga0307409_100126975
1453 Ga0307416_100000500
1454 Ga0307414_10003986
1455 Ga0307414_10017858
1456 Ga0307411_10017445
1457 Ga0307415_100014074
1458 Ga0316583_10000626
1459 Ga0316585_10000572
1460 Ga0316580_10003247
1461 Ga0307510_10001938
1462 Ga0316574_0002354
1463 Ga0316574_0008582
1464 Ga0316574_0009969
1465 Ga0373927_0000003
1466 Ga0316582_0002212
1467 Ga0316584_0002179
1468 Ga0316584_0042445
1469 Ga0395899_0000142
1470 Ga0395899_0009818
1471 Ga0395899_0016093
1472 Ga0395899_0022754
1473 Ga0395899_0053918
1474 Ga0395899_0134478
1475 Ga0395900_0000069
1476 Ga0395900_0002387
1477 Ga0395900_0010793
1478 Ga0395900_0031124
1479 Ga0395900_0082649
1480 Ga0395898_0000097
1481 Ga0395898_0001079
1482 Ga0395898_0015073
1483 Ga0395898_0025910
1484 Ga0395901_0000983
1485 Ga0395901_0002935
1486 Ga0395901_0010713
1487 Ga0395901_0149263
1488 Ga0237819_00127
1489 Ga0439436_0000010
1490 Ga0439436_0006040
1491 Ga0439465_0000123
1492 Ga0439465_0003861
1493 Ga0439465_0018945
1494 Ga0451791_0612411
1495 Ga0439433_0012744
1496 Ga0439432_007320
1497 Ga0439432_019438
1498 Ga0439449_0000905
1499 Ga0450908_000564
1500 Ga0450908_000860
1501 Ga0451577_0009927
1502 Ga0466969_0002807
1503 Ga0466969_0003343
1504 Ga0466969_0004136
1505 Ga0466969_0017661
1506 Ga0466972_0016098
1507 Ga0466989_0020182
1508 Ga0466982_0000019
1509 Ga0466982_0000098
1510 Ga0453683_0008814
1511 Ga0466965_0019349
1512 Ga0466966_0020730
1513 Ga0466961_0007963
1514 Ga0466961_0013744
1515 Ga0466961_0075758
1516 Ga0466961_0091704
1517 Ga0466964_0015082
1518 Ga0466971_0016812
1519 Ga0466968_0004448
1520 Ga0466968_0030742
1521 Ga0466970_0001674
1522 Ga0466970_0009926
1523 Ga0466970_0057341
1524 Ga0466960_0031658
1525 Ga0466959_0024013
1526 Ga0466959_0053115
1527 Ga0451576_0000821
1528 Ga0451576_0072609
1529 Ga0466967_0041735
1530 Ga0495617_003046
1531 Ga0495617_003503
1532 Ga0495627_006082
1533 Ga0495638_0000069
1534 Ga0495638_0000122
1535 Ga0495638_0001156
1536 Ga0495638_0001504
1537 Ga0495638_0005088
1538 Ga0495650_0000209
1539 Ga0495650_0003763
1540 Ga0495605_0023124
1541 Ga0495585_0000423
1542 Ga0495585_0010514
1543 Ga0495607_0000080
1544 Ga0495607_0008882
1545 Ga0495607_0021638
1546 Ga0495607_0077432
1547 Ga0495606_0000203
1548 Ga0495606_0000348
1549 Ga0495606_0016437
1550 Ga0495610_0004716
1551 Ga0495610_0043035
1552 Ga0495616_0000067
1553 Ga0495616_0025426
1554 Ga0495620_0003391
1555 Ga0495631_0003301
1556 Ga0495631_0004603
1557 Ga0495632_0000046
1558 Ga0495637_0014700
1559 Ga0495643_0001740
1560 Ga0495648_0018232
1561 Ga0495663_0000872
1562 Ga0495663_0001432
1563 Ga0495621_0003739
1564 Ga0495633_0013730
1565 Ga0495633_0022068
1566 Ga0495668_0000804
1567 Ga0495611_0000001
1568 Ga0495625_0000001
1569 Ga0495625_0024027
1570 Ga0495625_0044660
1571 Ga0495661_0004547
1572 Ga0495647_0021574
1573 Ga0495670_0009454
1574 Ga0495671_0000875
1575 Ga0495649_0012109
1576 Ga0495649_0015980
1577 Ga0495589_0000138
1578 Ga0495660_0004009
1579 Ga0495672_0000373
1580 Ga0495679_000029
1581 Ga0495673_0000001
1582 Ga0495673_0014223
1583 Ga0495686_0000043
1584 Ga0495686_0085291
1585 Ga0496101_0016866
1586 Ga0496104_0000022
1587 Ga0496104_0012882
1588 Ga0496105_0000012
1589 Ga0496105_0006290
1590 Ga0496105_0018943
1591 Ga0496105_0090311
1592 Ga0496106_0009989
1593 Ga0496106_0014736
1594 Ga0496108_0030769
1595 Ga0496109_0200161
1596 Ga0496110_0005613
1597 Ga0496110_0035169
1598 Ga0496113_0067201
1599 Ga0496114_0001917
1600 Ga0496114_0046500
1601 Ga0496115_0000163
1602 Ga0496115_0000181
1603 Ga0496115_0013485
1604 Ga0496115_0020279
1605 Ga0496115_0038116
1606 Ga0496115_0071919
1607 Ga0496116_0000005
1608 Ga0496116_0017392
1609 Ga0496117_0005762
1610 Ga0496117_0009952
1611 Ga0496117_0013593
1612 Ga0496117_0015798
1613 Ga0496117_0020923
1614 Ga0496117_0024725
1615 Ga0496117_0028315
1616 Ga0496117_0057321
1617 Ga0496118_0000528
1618 Ga0496118_0000848
1619 Ga0496118_0004154
1620 Ga0496118_0005474
1621 Ga0496118_0016346
1622 Ga0496118_0017635
1623 Ga0496118_0025548
1624 Ga0496118_0029280
1625 Ga0496118_0031026
1626 Ga0496119_0000184
1627 Ga0496119_0000659
1628 Ga0496119_0001426
1629 Ga0496119_0021762
1630 Ga0496120_0000217
1631 Ga0496120_0000307
1632 Ga0496120_0001091
1633 Ga0496120_0004293
1634 Ga0496121_0000029
1635 Ga0496121_0000045
1636 Ga0496121_0004159
1637 Ga0496121_0009184
1638 Ga0496121_0009283
1639 Ga0496121_0017494
1640 Ga0496121_0029782
1641 Ga0496121_0037992
1642 Ga0496121_0040589
1643 Ga0496122_0000267
1644 Ga0496122_0001038
1645 Ga0496122_0001998
1646 Ga0496122_0005854
1647 Ga0496122_0016541
1648 Ga0496122_0019191
1649 Ga0496122_0019274
1650 Ga0496122_0030232
1651 Ga0496123_0000161
1652 Ga0496123_0000848
1653 Ga0496123_0001899
1654 Ga0496123_0015448
1655 Ga0496123_0024797
1656 Ga0496123_0026628
1657 Ga0496123_0031037
1658 Ga0496124_0000009
1659 Ga0496124_0000734
1660 Ga0496124_0001490
1661 Ga0496124_0004066
1662 Ga0496124_0025689
1663 Ga0496124_0042962
1664 Ga0496125_0000149
1665 Ga0496125_0010887
1666 Ga0496125_0031770
1667 Ga0496125_0031902
1668 Ga0496125_0036240
1669 Ga0496125_0041611
1670 Ga0496126_0002149
1671 Ga0496126_0003384
1672 Ga0496126_0004290
1673 Ga0496126_0013547
1674 Ga0496126_0020995
1675 Ga0496126_0060008
1676 Ga0496126_0060980
1677 Ga0496126_0120754
1678 Ga0495678_000718
1679 Ga0501031_0013662
1680 Ga0501031_0059928
1681 Ga0501032_0027853
1682 Ga0501032_0037308
1683 Ga0501033_0000747
1684 Ga0501033_0001508
1685 Ga0501033_0005847
1686 Ga0501033_0015113
1687 Ga0501033_0032897
1688 Ga0501033_0062985
1689 Ga0501034_0000344
1690 Ga0501034_0000355
1691 Ga0501034_0012809
1692 Ga0501034_0032668
1693 Ga0501034_0055878
1694 Ga0501036_0011935
1695 Ga0501036_0035985
1696 Ga0501036_0042201
1697 Ga0501037_0005211
1698 Ga0501037_0006927
1699 Ga0501037_0012184
1700 Ga0501037_0029467
1701 Ga0501037_0033049
1702 Ga0501038_0025329
1703 Ga0501038_0026037
1704 Ga0501038_0079480
1705 Ga0501039_0007584
1706 Ga0501039_0127614
1707 Ga0501040_0001093
1708 Ga0501040_0008567
1709 Ga0501040_0009299
1710 Ga0501040_0009725
1711 Ga0501040_0012191
1712 Ga0501041_0037583
1713 Ga0501042_0004185
1714 Ga0501042_0004613
1715 Ga0501042_0007705
1716 Ga0501042_0043650
1717 Ga0501043_0002540
1718 Ga0501043_0019418
1719 Ga0501043_0041262
1720 Ga0501046_0002537
1721 Ga0501046_0012062
1722 Ga0501046_0022811
1723 Ga0501047_0004475
1724 Ga0501047_0010659
1725 Ga0501047_0015450
1726 Ga0501047_0069784
1727 Ga0501047_0076899
1728 Ga0501047_0141866
1729 Ga0501048_0013116
1730 Ga0501048_0018366
1731 Ga0501048_0020049
1732 Ga0501048_0055113
1733 Ga0501048_0069922
1734 Ga0501068_0024287
1735 Ga0501068_0030043
1736 Ga0501069_0001683
1737 Ga0501069_0023366
1738 Ga0501070_0001120
1739 Ga0501070_0011003
1740 Ga0501070_0013738
1741 Ga0501070_0018995
1742 Ga0501070_0023611
1743 Ga0501070_0075225
1744 Ga0501071_0008278
1745 Ga0501071_0033521
1746 Ga0501071_0046255
1747 Ga0501072_0004152
1748 Ga0501072_0008841
1749 Ga0501072_0019046
1750 Ga0501072_0027365
1751 Ga0501073_0003721
1752 Ga0501073_0005507
1753 Ga0501073_0010681
1754 Ga0501073_0012681
1755 Ga0501073_0069917
1756 Ga0501073_0107067
1757 Ga0501074_0004079
1758 Ga0501074_0024713
1759 Ga0501074_0037632
1760 Ga0501075_0065660
1761 Ga0501076_0002535
1762 Ga0501076_0004710
1763 Ga0501076_0023151
1764 Ga0501077_0018306
1765 Ga0501077_0103282
1766 Ga0501079_0007763
1767 Ga0501079_0059639
1768 Ga0501079_0199192
1769 Ga0501080_0004279
1770 Ga0501080_0028382
1771 Ga0501080_0028686
1772 Ga0501080_0084412
1773 Ga0501081_0004658
1774 Ga0501081_0005725
1775 Ga0501081_0009346
1776 Ga0501081_0021742
1777 Ga0501083_0012139
1778 Ga0501035_0003148
1779 Ga0501035_0010022
1780 Ga0501035_0019320
1781 Ga0501035_0022285
1782 Ga0501035_0025947
1783 Ga0501035_0032024
1784 Ga0501035_0095280
1785 Ga0501035_0141934
1786 Ga0501035_0161756
1787 Ga0501044_0007144
1788 Ga0501044_0011428
1789 Ga0501044_0029738
1790 Ga0501044_0041271
1791 Ga0501044_0043549
1792 Ga0501044_0083293
1793 Ga0501044_0121429
1794 Ga0501044_0151906
1795 Ga0501045_0000225
1796 Ga0501045_0019176
1797 nmdc:mga00v17_10476_c1
1798 nmdc:mga00v17_5307_c1
1799 nmdc:mga08y16_54621_c1
1800 nmdc:mga0n895_17491_c1
1801 nmdc:mga0rr50_152611_c1
1802 nmdc:mga0a205_603_c1
1803 nmdc:mga0sz30_14786_c1
1804 Ga0500610_0023463
1805 Ga0500643_000002
1806 Ga0500643_001805
1807 Ga0500651_0000088
1808 Ga0500556_0000234
1809 Ga0500594_0001943
1810 Ga0500597_000873
1811 Ga0500642_0000014
1812 Ga0500634_0001229
1813 Ga0500645_000395
1814 Ga0500645_005302
1815 Ga0501084_0014642
1816 Ga0501084_0042413
1817 Ga0501084_0094713
1818 Ga0501084_0128527
1819 Ga0500661_005416
1820 Ga0501082_0009187
1821 Ga0501082_0030869
1822 Ga0466962_0027328
1823 Ga0466962_0042936
1824 Ga0530510_0004136
1825 Ga0530510_0025249
1826 2512732436
1827 2524190819
1828 2525556682
1829 2538832646
1830 2547502785
1831 2578458700
1832 2587738596
1833 2595318519
1834 2595446484
1835 2595451985
1836 2630648278
1837 2643830108
1838 2643894365
1839 2643907792
1840 2643916003
1841 2644426890
1842 2644476569
1843 2673822801
1844 2687583262
1845 2721026882
1846 2735837567
1847 2739228174
1848 2739731596
1849 2748015862
1850 2765578683
1851 2816516758
1852 2819565239
1853 2819662981
1854 2842394993
1855 2842758400
1856 2842780775
1857 2842917424
1858 2842919614
1859 2852651069
1860 2852686028
1861 2857446885
1862 2857453701
1863 2864997913
1864 2874221311
1865 2884341164
1866 2884413505
1867 2889297287
1868 2894415659
1869 2895395690
1870 2904466907
1871 2919087871
1872 2919133565
1873 2919136107
1874 2919405093
1875 2919514563
1876 2919676605
1877 2923518469
1878 2928496280
1879 2928967501
1880 2929197381
1881 2931381035
1882 2937612132
1883 2939590774
1884 2939611992
1885 2939622956
1886 2939630871
1887 2941472620
1888 2941478054
1889 2953994892
1890 2961048077
1891 2961065095
1892 2971411064
1893 2974309197
1894 2977249916
1895 2980128969
1896 2981285766
1897 2981290713
1898 2981980665
1899 2981985543
1900 2984515594
1901 8002323647
1902 8002872224
1903 8003015923
1904 8021623762
1905 8021630458
1906 8021650620
1907 8046998894
1908 8054798322
1909 8056536393
1910 8057477228

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02463

SMC_N

RecF/RecN/SMC N terminal domain

44

557

0.92

PF13476

AAA_23

AAA domain

47

263

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h66-assembly1.cif.gz_A crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain 0.8473 2 120
1xew-assembly1.cif.gz_X structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. 0.8441 2 120
5h67-assembly1.cif.gz_A crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain and soaked atp 0.8371 2 120
3kta-assembly2.cif.gz_C structural basis for adenylate kinase activity in abc atpases 0.8346 2 120
1xex-assembly1.cif.gz_A-2 structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. 0.8225 2 120
ID Description Score Start End Superfamily
af_Q9LFS8_23_178_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.854 4 120 3.40.50.300
5h66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8473 2 120 3.40.50.300
af_Q8IPT2_15_211_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8425 1 123 3.40.50.300
af_P0A7H0_3_104_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8396 2 113 3.40.50.300
af_A0A1D6GTS1_30_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8381 1 120 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C2K5X3-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9861 1 124 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590
AF-A0A7C2K5X3-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9783 1 124 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590
AF-F7K175-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9766 442 542 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-M6T6B3-F1-model_v4 deleted 0.9735 442 544
AF-A0A3D5NK97-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9729 1 115 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590

Map