F486702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 955 | 443 | 1910 | 534 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100008741|Ga0070689_1000087412 |
| Length | 599 |
| Sequence | MGDGWQGFQNRMAVMHSDASVRPHYPPPVPIPLQSPDSITPPPMLTSLYVRHFAVVEEAEIAFGPGLTVVSGETGAGKSLLVDALMLLAGARADSGMVRAGSDRAELTAEFDLTQLPEAREWLRRQELDEEDSCQLRRVIRAEGSSRAWINGRPANASQLGELATLLVEIHGQHEHQALLSRAHQMELLDAYAGNEALVAQVRELAQQWXXXXNRIRKLSGGDDRDQRIELLSHELGELDKWALPADELTELEASHKRLANAGRLAEGAGGVVELLDGESEFALRRALGRAQLEMTKLAALDDRLAPLLELLDNASIQLSEAADGLGRYALDVDLDPNRYAEVDTHLTRLHELSRRHRVTVAELHDKAGTLRIELSELEGAGDALEKLATQRMRLQQQYGEHAAQLSQARQQAAERLGGEVSVLMGELGMSGGRLVVELEATSESDPDPQGRERCELLVSANPGQPPRALRKVASGGELARISLAIEVATLGKDTIGTMVFDEVDTGIGGAVAEVVGQKLRALGGQRQVLCVTHLPQVAAQGHAHLRVSKDSDGESTRTRIEKLDANGRRDELARMLGGVEITRETRAHAKQMLERAQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 115 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 222 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 228 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 234 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 239 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 352 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 359 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 360 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 361 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 362 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 363 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 364 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 365 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 366 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 367 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 368 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 369 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 370 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 371 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 372 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 373 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 374 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 375 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 376 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 377 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 378 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 379 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 380 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 381 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 382 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 383 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 384 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 385 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 386 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 387 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 388 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 389 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 390 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 391 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 392 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 393 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 394 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 395 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 396 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 397 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 398 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 399 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 400 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 401 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 402 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 403 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 404 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 405 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 406 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 407 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 408 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 409 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 410 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 411 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 412 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 413 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 414 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 415 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 416 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 417 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 418 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 419 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 420 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 421 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 422 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 423 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 424 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 425 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 426 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 427 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 428 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 429 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 430 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 431 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 432 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 433 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 434 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 435 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 436 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 437 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 438 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 439 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 440 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 441 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 442 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 443 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.37 |
| Metatranscriptomes | 0.73 |
| Isolates | 8.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 16.34 |
| Nodule | 0.21 |
| Rhizoplane | 2.41 |
| Rhizosphere | 65.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070689_100008741 | 3300005340 | Bacteria | 7150 |
| 2 | JGI24741J21665_1009606 | 3300001915 | Bacteria | 1769 |
| 3 | JGI24740J21852_10004853 | 3300001979 | Bacteria | 5719 |
| 4 | JGI24739J22299_10000167 | 3300001989 | Bacteria | 21671 |
| 5 | JGI25156J39149_1001689 | 3300002705 | Bacteria | 8887 |
| 6 | JGI25156J39149_1008279 | 3300002705 | Bacteria | 2635 |
| 7 | JGI25162J39368_1002522 | 3300002737 | Bacteria | 7004 |
| 8 | JGI25162J39368_1002756 | 3300002737 | Bacteria | 6268 |
| 9 | JGI25162J39368_1002946 | 3300002737 | Bacteria | 5748 |
| 10 | JGI25162J39368_1003492 | 3300002737 | Bacteria | 4485 |
| 11 | JGI25157J39369_1000760 | 3300002741 | Bacteria | 16774 |
| 12 | JGI25157J39369_1001514 | 3300002741 | Bacteria | 8465 |
| 13 | JGI25157J39369_1001601 | 3300002741 | Bacteria | 7926 |
| 14 | JGI25163J39215_1001514 | 3300002771 | Bacteria | 3659 |
| 15 | JGI25164J39214_1000049 | 3300002772 | Bacteria | 123464 |
| 16 | JGI25164J39214_1000088 | 3300002772 | Bacteria | 91375 |
| 17 | JGI25164J39214_1001313 | 3300002772 | Bacteria | 6260 |
| 18 | JGI25164J39214_1001318 | 3300002772 | Bacteria | 6234 |
| 19 | JGI25152J39213_1000102 | 3300002773 | Bacteria | 59507 |
| 20 | JGI25150J39212_1000099 | 3300002774 | Bacteria | 49634 |
| 21 | JGI25150J39212_1000290 | 3300002774 | Bacteria | 26031 |
| 22 | JGI25151J46595_10000041 | 3300003187 | Bacteria | 174472 |
| 23 | JGI25151J46595_10000269 | 3300003187 | Bacteria | 59507 |
| 24 | JGI25151J46595_10011611 | 3300003187 | Bacteria | 4042 |
| 25 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 26 | JGI25165J46597_1000088 | 3300003214 | Bacteria | 169821 |
| 27 | JGI25165J46597_1002376 | 3300003214 | Bacteria | 6268 |
| 28 | JGI25165J46597_1002837 | 3300003214 | Bacteria | 4966 |
| 29 | JGI25153J46596_10000189 | 3300003215 | Bacteria | 59507 |
| 30 | rootH2_10092143 | 3300003320 | Bacteria | 5533 |
| 31 | Ga0006562J51391_1029636 | 3300003578 | Bacteria | 10630 |
| 32 | Ga0006562J51391_1029638 | 3300003578 | Bacteria | 2260 |
| 33 | Ga0055525_1000146 | 3300003759 | Bacteria | 97114 |
| 34 | Ga0055527_1000328 | 3300003760 | Bacteria | 25551 |
| 35 | Ga0055527_1000605 | 3300003760 | Bacteria | 11556 |
| 36 | Ga0055535_1000082 | 3300003761 | Bacteria | 106958 |
| 37 | Ga0055535_1000745 | 3300003761 | Bacteria | 24313 |
| 38 | Ga0055535_1000756 | 3300003761 | Bacteria | 24051 |
| 39 | Ga0055535_1001284 | 3300003761 | Bacteria | 13598 |
| 40 | Ga0055542_1000765 | 3300003762 | Bacteria | 24313 |
| 41 | Ga0055542_1000774 | 3300003762 | Bacteria | 24051 |
| 42 | Ga0055542_1000856 | 3300003762 | Bacteria | 21343 |
| 43 | Ga0055542_1001065 | 3300003762 | Bacteria | 16915 |
| 44 | Ga0055542_1002159 | 3300003762 | Bacteria | 7122 |
| 45 | Ga0055542_1002186 | 3300003762 | Bacteria | 7004 |
| 46 | Ga0055529_1000020 | 3300003763 | Bacteria | 324857 |
| 47 | Ga0055529_1000663 | 3300003763 | Bacteria | 24291 |
| 48 | Ga0055529_1000666 | 3300003763 | Bacteria | 24043 |
| 49 | Ga0055529_1000887 | 3300003763 | Bacteria | 16921 |
| 50 | Ga0055526_1006635 | 3300003771 | Bacteria | 6219 |
| 51 | Ga0055537_1000407 | 3300003773 | Bacteria | 28206 |
| 52 | Ga0055524_1017968 | 3300003775 | Bacteria | 2475 |
| 53 | Ga0055536_1005286 | 3300003781 | Bacteria | 6357 |
| 54 | Ga0055536_1005928 | 3300003781 | Bacteria | 5844 |
| 55 | Ga0055536_1006000 | 3300003781 | Bacteria | 5776 |
| 56 | Ga0055536_1019665 | 3300003781 | Bacteria | 2115 |
| 57 | Ga0055534_1000039 | 3300003784 | Bacteria | 104863 |
| 58 | Ga0055528_1000529 | 3300003790 | Bacteria | 29538 |
| 59 | Ga0055530_10002892 | 3300003791 | Bacteria | 10448 |
| 60 | Ga0055530_10005063 | 3300003791 | Bacteria | 6471 |
| 61 | Ga0055530_10008054 | 3300003791 | Bacteria | 4296 |
| 62 | Ga0055531_10006146 | 3300003794 | Bacteria | 6871 |
| 63 | Ga0055531_10007661 | 3300003794 | Bacteria | 5844 |
| 64 | Ga0055531_10007781 | 3300003794 | Bacteria | 5776 |
| 65 | Ga0055531_10011589 | 3300003794 | Bacteria | 4231 |
| 66 | Ga0058692_1000018 | 3300003856 | Bacteria | 264544 |
| 67 | Ga0065165_1003051 | 3300005262 | Bacteria | 12552 |
| 68 | Ga0065704_10002333 | 3300005289 | Bacteria | 7689 |
| 69 | Ga0065704_10072174 | 3300005289 | Bacteria | 9007 |
| 70 | Ga0065715_10093484 | 3300005293 | Bacteria | 4663 |
| 71 | Ga0065715_10110437 | 3300005293 | Bacteria | 2620 |
| 72 | Ga0070658_10012294 | 3300005327 | Bacteria | 6873 |
| 73 | Ga0070670_100007924 | 3300005331 | Bacteria | 9039 |
| 74 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 75 | Ga0070666_10000757 | 3300005335 | Bacteria | 19578 |
| 76 | Ga0070666_10009654 | 3300005335 | Bacteria | 6024 |
| 77 | Ga0070680_100008297 | 3300005336 | Bacteria | 7947 |
| 78 | Ga0070680_100073618 | 3300005336 | Bacteria | 2810 |
| 79 | Ga0070682_100002136 | 3300005337 | Bacteria | 10982 |
| 80 | Ga0070682_100008145 | 3300005337 | Bacteria | 5911 |
| 81 | Ga0068868_100007207 | 3300005338 | Bacteria | 7901 |
| 82 | Ga0068868_100027499 | 3300005338 | Bacteria | 4340 |
| 83 | Ga0068868_100032309 | 3300005338 | Bacteria | 4026 |
| 84 | Ga0070660_100011933 | 3300005339 | Bacteria | 6199 |
| 85 | Ga0070660_100025556 | 3300005339 | Bacteria | 4390 |
| 86 | Ga0070660_100051136 | 3300005339 | Bacteria | 3181 |
| 87 | Ga0070691_10000561 | 3300005341 | Bacteria | 14128 |
| 88 | Ga0070661_100001862 | 3300005344 | Bacteria | 14599 |
| 89 | Ga0070661_100033926 | 3300005344 | Bacteria | 3700 |
| 90 | Ga0070661_100104718 | 3300005344 | Bacteria | 2108 |
| 91 | Ga0070692_10000139 | 3300005345 | Bacteria | 17503 |
| 92 | Ga0070692_10001873 | 3300005345 | Bacteria | 7918 |
| 93 | Ga0070669_100016268 | 3300005353 | Bacteria | 5306 |
| 94 | Ga0070669_100079690 | 3300005353 | Bacteria | 2436 |
| 95 | Ga0070675_100013380 | 3300005354 | Bacteria | 6448 |
| 96 | Ga0070659_100007436 | 3300005366 | Bacteria | 7959 |
| 97 | Ga0070667_100000084 | 3300005367 | Bacteria | 118027 |
| 98 | Ga0070667_100009456 | 3300005367 | Bacteria | 8086 |
| 99 | Ga0070667_100149360 | 3300005367 | Bacteria | 2052 |
| 100 | Ga0070714_100000372 | 3300005435 | Bacteria | 33436 |
| 101 | Ga0070714_100000713 | 3300005435 | Bacteria | 23558 |
| 102 | Ga0070714_100013529 | 3300005435 | Bacteria | 6540 |
| 103 | Ga0070714_100021754 | 3300005435 | Bacteria | 5249 |
| 104 | Ga0070714_100022773 | 3300005435 | Bacteria | 5139 |
| 105 | Ga0070694_100032508 | 3300005444 | Bacteria | 3426 |
| 106 | Ga0070663_100041672 | 3300005455 | Bacteria | 3223 |
| 107 | Ga0070663_100069432 | 3300005455 | Bacteria | 2560 |
| 108 | Ga0070678_100003696 | 3300005456 | Bacteria | 8558 |
| 109 | Ga0070681_10009408 | 3300005458 | Bacteria | 9616 |
| 110 | Ga0070681_10017636 | 3300005458 | Bacteria | 7134 |
| 111 | Ga0070681_10025596 | 3300005458 | Bacteria | 5936 |
| 112 | Ga0068867_100071691 | 3300005459 | Bacteria | 2592 |
| 113 | Ga0070685_10004666 | 3300005466 | Bacteria | 6934 |
| 114 | Ga0070698_100064803 | 3300005471 | Bacteria | 3680 |
| 115 | Ga0070679_100016456 | 3300005530 | Bacteria | 7134 |
| 116 | Ga0070679_100081626 | 3300005530 | Bacteria | 3222 |
| 117 | Ga0070679_100106460 | 3300005530 | Bacteria | 2790 |
| 118 | Ga0070679_100127285 | 3300005530 | Bacteria | 2529 |
| 119 | Ga0070684_100033959 | 3300005535 | Bacteria | 4359 |
| 120 | Ga0068853_100002068 | 3300005539 | Bacteria | 14881 |
| 121 | Ga0068853_100004423 | 3300005539 | Bacteria | 10877 |
| 122 | Ga0068853_100012109 | 3300005539 | Bacteria | 7016 |
| 123 | Ga0068853_100139593 | 3300005539 | Bacteria | 2175 |
| 124 | Ga0070672_100009562 | 3300005543 | Bacteria | 6689 |
| 125 | Ga0070696_100000851 | 3300005546 | Bacteria | 19698 |
| 126 | Ga0070696_100001442 | 3300005546 | Bacteria | 15555 |
| 127 | Ga0070696_100011770 | 3300005546 | Bacteria | 5863 |
| 128 | Ga0070693_100004059 | 3300005547 | Bacteria | 6892 |
| 129 | Ga0070665_100013099 | 3300005548 | Bacteria | 8350 |
| 130 | Ga0070665_100023453 | 3300005548 | Bacteria | 6213 |
| 131 | Ga0070665_100037857 | 3300005548 | Bacteria | 4849 |
| 132 | Ga0068855_100020753 | 3300005563 | Bacteria | 7879 |
| 133 | Ga0068855_100031696 | 3300005563 | Bacteria | 6311 |
| 134 | Ga0068855_100108259 | 3300005563 | Bacteria | 3192 |
| 135 | Ga0068855_100171159 | 3300005563 | Bacteria | 2460 |
| 136 | Ga0068857_100004292 | 3300005577 | Bacteria | 12022 |
| 137 | Ga0068857_100020788 | 3300005577 | Bacteria | 5775 |
| 138 | Ga0068854_100003470 | 3300005578 | Bacteria | 9844 |
| 139 | Ga0068854_100007127 | 3300005578 | Bacteria | 7138 |
| 140 | Ga0068854_100010098 | 3300005578 | Bacteria | 6116 |
| 141 | Ga0068856_100000983 | 3300005614 | Bacteria | 30421 |
| 142 | Ga0068856_100052772 | 3300005614 | Bacteria | 4010 |
| 143 | Ga0068852_100021578 | 3300005616 | Bacteria | 5146 |
| 144 | Ga0068852_100057982 | 3300005616 | Bacteria | 3352 |
| 145 | Ga0068859_100021151 | 3300005617 | Bacteria | 6529 |
| 146 | Ga0068859_100061891 | 3300005617 | Bacteria | 3772 |
| 147 | Ga0068859_100186169 | 3300005617 | Bacteria | 2160 |
| 148 | Ga0068864_100030923 | 3300005618 | Bacteria | 4540 |
| 149 | Ga0068864_100128090 | 3300005618 | Bacteria | 2277 |
| 150 | Ga0068851_10004998 | 3300005834 | Bacteria | 6006 |
| 151 | Ga0068870_10009151 | 3300005840 | Bacteria | 4489 |
| 152 | Ga0068863_100013560 | 3300005841 | Bacteria | 7863 |
| 153 | Ga0068863_100127670 | 3300005841 | Bacteria | 2427 |
| 154 | Ga0068860_100009881 | 3300005843 | Bacteria | 9460 |
| 155 | Ga0068860_100105026 | 3300005843 | Bacteria | 2697 |
| 156 | Ga0068862_100064307 | 3300005844 | Bacteria | 3158 |
| 157 | Ga0075364_10001000 | 3300006051 | Bacteria | 14962 |
| 158 | Ga0097621_100019126 | 3300006237 | Bacteria | 5250 |
| 159 | Ga0068871_100012103 | 3300006358 | Bacteria | 6350 |
| 160 | Ga0075428_100009101 | 3300006844 | Bacteria | 11018 |
| 161 | Ga0075428_100057180 | 3300006844 | Bacteria | 4270 |
| 162 | Ga0075433_10005362 | 3300006852 | Bacteria | 10068 |
| 163 | Ga0075434_100000572 | 3300006871 | Bacteria | 28363 |
| 164 | Ga0075434_100071461 | 3300006871 | Bacteria | 3462 |
| 165 | Ga0068865_100042758 | 3300006881 | Bacteria | 3092 |
| 166 | Ga0097620_100021151 | 3300006931 | Bacteria | 6529 |
| 167 | Ga0097620_100061888 | 3300006931 | Bacteria | 3772 |
| 168 | Ga0097620_100186173 | 3300006931 | Bacteria | 2160 |
| 169 | Ga0075435_100063636 | 3300007076 | Bacteria | 2996 |
| 170 | Ga0105251_10000880 | 3300009011 | Bacteria | 26879 |
| 171 | Ga0105251_10009176 | 3300009011 | Bacteria | 5877 |
| 172 | Ga0105240_10012346 | 3300009093 | Bacteria | 11795 |
| 173 | Ga0105240_10035843 | 3300009093 | Bacteria | 6388 |
| 174 | Ga0105240_10043064 | 3300009093 | Bacteria | 5748 |
| 175 | Ga0105240_10049909 | 3300009093 | Bacteria | 5278 |
| 176 | Ga0105240_10063542 | 3300009093 | Bacteria | 4592 |
| 177 | Ga0105240_10084533 | 3300009093 | Bacteria | 3891 |
| 178 | Ga0105240_10097448 | 3300009093 | Bacteria | 3583 |
| 179 | Ga0111539_10006755 | 3300009094 | Bacteria | 14763 |
| 180 | Ga0105245_10003428 | 3300009098 | Bacteria | 14208 |
| 181 | Ga0105245_10116590 | 3300009098 | Bacteria | 2490 |
| 182 | Ga0105247_10010854 | 3300009101 | Bacteria | 5502 |
| 183 | Ga0105243_10021826 | 3300009148 | Bacteria | 4861 |
| 184 | Ga0105241_10042237 | 3300009174 | Bacteria | 3448 |
| 185 | Ga0105241_10076264 | 3300009174 | Bacteria | 2614 |
| 186 | Ga0105242_10001298 | 3300009176 | Bacteria | 19754 |
| 187 | Ga0105242_10044328 | 3300009176 | Bacteria | 3602 |
| 188 | Ga0105248_10000429 | 3300009177 | Bacteria | 47562 |
| 189 | Ga0105248_10005167 | 3300009177 | Bacteria | 14394 |
| 190 | Ga0105248_10054583 | 3300009177 | Bacteria | 4481 |
| 191 | Ga0105237_10000016 | 3300009545 | Bacteria | 256506 |
| 192 | Ga0105237_10000388 | 3300009545 | Bacteria | 62620 |
| 193 | Ga0105238_10000362 | 3300009551 | Bacteria | 48708 |
| 194 | Ga0105238_10002989 | 3300009551 | Bacteria | 16888 |
| 195 | Ga0105238_10024524 | 3300009551 | Bacteria | 6147 |
| 196 | Ga0105238_10032850 | 3300009551 | Bacteria | 5282 |
| 197 | Ga0105238_10072023 | 3300009551 | Bacteria | 3453 |
| 198 | Ga0105238_10097547 | 3300009551 | Bacteria | 2925 |
| 199 | Ga0105249_10009937 | 3300009553 | Bacteria | 8345 |
| 200 | Ga0105030_100130 | 3300009987 | Bacteria | 5905 |
| 201 | Ga0105239_10000063 | 3300010375 | Bacteria | 151845 |
| 202 | Ga0105239_10007002 | 3300010375 | Bacteria | 12975 |
| 203 | Ga0105239_10012123 | 3300010375 | Bacteria | 9611 |
| 204 | Ga0105239_10013284 | 3300010375 | Bacteria | 9149 |
| 205 | Ga0105239_10038848 | 3300010375 | Bacteria | 5215 |
| 206 | Ga0105239_10069647 | 3300010375 | Bacteria | 3865 |
| 207 | Ga0157373_10005152 | 3300013100 | Bacteria | 9826 |
| 208 | Ga0157373_10022169 | 3300013100 | Bacteria | 4608 |
| 209 | Ga0157371_10000487 | 3300013102 | Bacteria | 48309 |
| 210 | Ga0157371_10002814 | 3300013102 | Bacteria | 16290 |
| 211 | Ga0157371_10010486 | 3300013102 | Bacteria | 7211 |
| 212 | Ga0157371_10028762 | 3300013102 | Bacteria | 4023 |
| 213 | Ga0157370_10010813 | 3300013104 | Bacteria | 9591 |
| 214 | Ga0157370_10013028 | 3300013104 | Bacteria | 8587 |
| 215 | Ga0157370_10014321 | 3300013104 | Bacteria | 8115 |
| 216 | Ga0157370_10025566 | 3300013104 | Bacteria | 5844 |
| 217 | Ga0157369_10000027 | 3300013105 | Bacteria | 213988 |
| 218 | Ga0157369_10002364 | 3300013105 | Bacteria | 22678 |
| 219 | Ga0157369_10016391 | 3300013105 | Bacteria | 8335 |
| 220 | Ga0157369_10042658 | 3300013105 | Bacteria | 4949 |
| 221 | Ga0157374_10080245 | 3300013296 | Bacteria | 3094 |
| 222 | Ga0157378_10000006 | 3300013297 | Bacteria | 192683 |
| 223 | Ga0157378_10026393 | 3300013297 | Bacteria | 5120 |
| 224 | Ga0163162_10000357 | 3300013306 | Bacteria | 41422 |
| 225 | Ga0163162_10002734 | 3300013306 | Bacteria | 16743 |
| 226 | Ga0163162_10031567 | 3300013306 | Bacteria | 5255 |
| 227 | Ga0157372_10003304 | 3300013307 | Bacteria | 17420 |
| 228 | Ga0157372_10027342 | 3300013307 | Bacteria | 6211 |
| 229 | Ga0157372_10036984 | 3300013307 | Bacteria | 5382 |
| 230 | Ga0157372_10053894 | 3300013307 | Bacteria | 4484 |
| 231 | Ga0157372_10121842 | 3300013307 | Bacteria | 2996 |
| 232 | Ga0157375_10000102 | 3300013308 | Bacteria | 86408 |
| 233 | Ga0157375_10004302 | 3300013308 | Bacteria | 12350 |
| 234 | Ga0157375_10055469 | 3300013308 | Bacteria | 3907 |
| 235 | Ga0157375_10287370 | 3300013308 | Bacteria | 1807 |
| 236 | Ga0163163_10000877 | 3300014325 | Bacteria | 25623 |
| 237 | Ga0163163_10023588 | 3300014325 | Bacteria | 5840 |
| 238 | Ga0182008_10000143 | 3300014497 | Bacteria | 55118 |
| 239 | Ga0182008_10007235 | 3300014497 | Bacteria | 6138 |
| 240 | Ga0182008_10018312 | 3300014497 | Bacteria | 3626 |
| 241 | Ga0182008_10026014 | 3300014497 | Bacteria | 2969 |
| 242 | Ga0157379_10000992 | 3300014968 | Bacteria | 23037 |
| 243 | Ga0157379_10001842 | 3300014968 | Bacteria | 17527 |
| 244 | Ga0157376_10003668 | 3300014969 | Bacteria | 10602 |
| 245 | Ga0157376_10008252 | 3300014969 | Bacteria | 7501 |
| 246 | Ga0157376_10206001 | 3300014969 | Bacteria | 1813 |
| 247 | Ga0182006_1000074 | 3300015261 | Bacteria | 130403 |
| 248 | Ga0182006_1001229 | 3300015261 | Bacteria | 15917 |
| 249 | Ga0182006_1018348 | 3300015261 | Bacteria | 2958 |
| 250 | Ga0182007_10000043 | 3300015262 | Bacteria | 107693 |
| 251 | Ga0182007_10004954 | 3300015262 | Bacteria | 5938 |
| 252 | Ga0182005_1000267 | 3300015265 | Bacteria | 32953 |
| 253 | Ga0182005_1000326 | 3300015265 | Bacteria | 28190 |
| 254 | Ga0182005_1001110 | 3300015265 | Bacteria | 11246 |
| 255 | Ga0182005_1002979 | 3300015265 | Bacteria | 5862 |
| 256 | Ga0183369_1006 | 3300015685 | Bacteria | 449058 |
| 257 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 258 | Ga0163161_10007748 | 3300017792 | Bacteria | 7428 |
| 259 | Ga0197907_10862894 | 3300020069 | Bacteria | 2956 |
| 260 | Ga0197907_11474155 | 3300020069 | Bacteria | 2395 |
| 261 | Ga0206356_10168839 | 3300020070 | Bacteria | 6249 |
| 262 | Ga0206351_10908139 | 3300020077 | Bacteria | 2664 |
| 263 | Ga0206353_10073144 | 3300020082 | Bacteria | 2454 |
| 264 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 265 | Ga0209566_100544 | 3300025225 | Bacteria | 25458 |
| 266 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 267 | Ga0209674_100062 | 3300025226 | Bacteria | 276316 |
| 268 | Ga0209674_100974 | 3300025226 | Bacteria | 8974 |
| 269 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 270 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 271 | Ga0209672_100743 | 3300025228 | Bacteria | 15906 |
| 272 | Ga0209672_100839 | 3300025228 | Bacteria | 14268 |
| 273 | Ga0209672_102291 | 3300025228 | Bacteria | 4891 |
| 274 | Ga0209563_100131 | 3300025230 | Bacteria | 97465 |
| 275 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 276 | Ga0207427_100073 | 3300025231 | Bacteria | 156503 |
| 277 | Ga0207427_100289 | 3300025231 | Bacteria | 35918 |
| 278 | Ga0207427_100306 | 3300025231 | Bacteria | 34125 |
| 279 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 280 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 281 | Ga0209437_100087 | 3300025233 | Bacteria | 253432 |
| 282 | Ga0209437_100129 | 3300025233 | Bacteria | 184661 |
| 283 | Ga0209437_100159 | 3300025233 | Bacteria | 149598 |
| 284 | Ga0209437_100637 | 3300025233 | Bacteria | 20495 |
| 285 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 286 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 287 | Ga0209258_100206 | 3300025242 | Bacteria | 119449 |
| 288 | Ga0209258_100213 | 3300025242 | Bacteria | 115394 |
| 289 | Ga0209258_100594 | 3300025242 | Bacteria | 29847 |
| 290 | Ga0209258_102146 | 3300025242 | Bacteria | 5484 |
| 291 | Ga0207425_1000092 | 3300025245 | Bacteria | 87673 |
| 292 | Ga0209646_1001828 | 3300025246 | Bacteria | 5261 |
| 293 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 294 | Ga0209026_1000079 | 3300025250 | Bacteria | 198355 |
| 295 | Ga0209026_1000125 | 3300025250 | Bacteria | 124729 |
| 296 | Ga0209026_1000592 | 3300025250 | Bacteria | 23632 |
| 297 | Ga0209026_1002773 | 3300025250 | Bacteria | 6249 |
| 298 | Ga0209677_100969 | 3300025253 | Bacteria | 13954 |
| 299 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 300 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 301 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 302 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 303 | Ga0209148_1000176 | 3300025254 | Bacteria | 128357 |
| 304 | Ga0209148_1000185 | 3300025254 | Bacteria | 118117 |
| 305 | Ga0209759_1000145 | 3300025256 | Bacteria | 121772 |
| 306 | Ga0209759_1000328 | 3300025256 | Bacteria | 62531 |
| 307 | Ga0209759_1002334 | 3300025256 | Bacteria | 8510 |
| 308 | Ga0209759_1005371 | 3300025256 | Bacteria | 4509 |
| 309 | Ga0209129_1000151 | 3300025258 | Bacteria | 113221 |
| 310 | Ga0209129_1003459 | 3300025258 | Bacteria | 6852 |
| 311 | Ga0209129_1007561 | 3300025258 | Bacteria | 3205 |
| 312 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 313 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 314 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 315 | Ga0209233_1000090 | 3300025261 | Bacteria | 315680 |
| 316 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 317 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 318 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 319 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 320 | Ga0209455_1000081 | 3300025272 | Bacteria | 263674 |
| 321 | Ga0209673_1000171 | 3300025273 | Bacteria | 133493 |
| 322 | Ga0209130_1012874 | 3300025284 | Bacteria | 2166 |
| 323 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 324 | Ga0209675_1016461 | 3300025291 | Bacteria | 2152 |
| 325 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 326 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 327 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 328 | Ga0209676_1002465 | 3300025292 | Bacteria | 13076 |
| 329 | Ga0209676_1003076 | 3300025292 | Bacteria | 10754 |
| 330 | Ga0209676_1003077 | 3300025292 | Bacteria | 10754 |
| 331 | Ga0209676_1006826 | 3300025292 | Bacteria | 5536 |
| 332 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 333 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 334 | Ga0209025_1002444 | 3300025294 | Bacteria | 19667 |
| 335 | Ga0209025_1008928 | 3300025294 | Bacteria | 7094 |
| 336 | Ga0209564_1000221 | 3300025295 | Bacteria | 129537 |
| 337 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 338 | Ga0209758_1005446 | 3300025297 | Bacteria | 9799 |
| 339 | Ga0209758_1008116 | 3300025297 | Bacteria | 6909 |
| 340 | Ga0209758_1015576 | 3300025297 | Bacteria | 3924 |
| 341 | Ga0209758_1016918 | 3300025297 | Bacteria | 3671 |
| 342 | Ga0209050_1000329 | 3300025298 | Bacteria | 94932 |
| 343 | Ga0209050_1000415 | 3300025298 | Bacteria | 79058 |
| 344 | Ga0209050_1000528 | 3300025298 | Bacteria | 63464 |
| 345 | Ga0209050_1004837 | 3300025298 | Bacteria | 8846 |
| 346 | Ga0209050_1005515 | 3300025298 | Bacteria | 7908 |
| 347 | Ga0209256_1004521 | 3300025299 | Bacteria | 8679 |
| 348 | Ga0209256_1018718 | 3300025299 | Bacteria | 2235 |
| 349 | Ga0209051_1002764 | 3300025303 | Bacteria | 12119 |
| 350 | Ga0209051_1007093 | 3300025303 | Bacteria | 6193 |
| 351 | Ga0209051_1032538 | 3300025303 | Bacteria | 1987 |
| 352 | Ga0209257_1000080 | 3300025304 | Bacteria | 312038 |
| 353 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 354 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 355 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 356 | Ga0209257_1002505 | 3300025304 | Bacteria | 18133 |
| 357 | Ga0209257_1004877 | 3300025304 | Bacteria | 9909 |
| 358 | Ga0209257_1005274 | 3300025304 | Bacteria | 9213 |
| 359 | Ga0209257_1015664 | 3300025304 | Bacteria | 3135 |
| 360 | Ga0207656_10001780 | 3300025321 | Bacteria | 7168 |
| 361 | Ga0207713_1000710 | 3300025735 | Bacteria | 31158 |
| 362 | Ga0207713_1009080 | 3300025735 | Bacteria | 5647 |
| 363 | Ga0207710_10034415 | 3300025900 | Bacteria | 2226 |
| 364 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 365 | Ga0207680_10020353 | 3300025903 | Bacteria | 3569 |
| 366 | Ga0207647_10000607 | 3300025904 | Bacteria | 27924 |
| 367 | Ga0207647_10001539 | 3300025904 | Bacteria | 17764 |
| 368 | Ga0207647_10002712 | 3300025904 | Bacteria | 13374 |
| 369 | Ga0207647_10012222 | 3300025904 | Bacteria | 5985 |
| 370 | Ga0207647_10024280 | 3300025904 | Bacteria | 3999 |
| 371 | Ga0207645_10013275 | 3300025907 | Bacteria | 5557 |
| 372 | Ga0207705_10000165 | 3300025909 | Bacteria | 71603 |
| 373 | Ga0207705_10000353 | 3300025909 | Bacteria | 41498 |
| 374 | Ga0207705_10000355 | 3300025909 | Bacteria | 41474 |
| 375 | Ga0207705_10001403 | 3300025909 | Bacteria | 19215 |
| 376 | Ga0207705_10008340 | 3300025909 | Bacteria | 7564 |
| 377 | Ga0207707_10000391 | 3300025912 | Bacteria | 45809 |
| 378 | Ga0207707_10001033 | 3300025912 | Bacteria | 26719 |
| 379 | Ga0207707_10001308 | 3300025912 | Bacteria | 23205 |
| 380 | Ga0207707_10010325 | 3300025912 | Bacteria | 8102 |
| 381 | Ga0207707_10011013 | 3300025912 | Bacteria | 7869 |
| 382 | Ga0207707_10012035 | 3300025912 | Bacteria | 7521 |
| 383 | Ga0207707_10017065 | 3300025912 | Bacteria | 6325 |
| 384 | Ga0207707_10046729 | 3300025912 | Bacteria | 3771 |
| 385 | Ga0207707_10051686 | 3300025912 | Bacteria | 3579 |
| 386 | Ga0207695_10000975 | 3300025913 | Bacteria | 50860 |
| 387 | Ga0207695_10006463 | 3300025913 | Bacteria | 15214 |
| 388 | Ga0207695_10007085 | 3300025913 | Bacteria | 14367 |
| 389 | Ga0207695_10009557 | 3300025913 | Bacteria | 11986 |
| 390 | Ga0207695_10011615 | 3300025913 | Bacteria | 10651 |
| 391 | Ga0207695_10012347 | 3300025913 | Bacteria | 10263 |
| 392 | Ga0207695_10031715 | 3300025913 | Bacteria | 5791 |
| 393 | Ga0207695_10046563 | 3300025913 | Bacteria | 4597 |
| 394 | Ga0207695_10087165 | 3300025913 | Bacteria | 3145 |
| 395 | Ga0207671_10000137 | 3300025914 | Bacteria | 112029 |
| 396 | Ga0207671_10003811 | 3300025914 | Bacteria | 14763 |
| 397 | Ga0207671_10004200 | 3300025914 | Bacteria | 13892 |
| 398 | Ga0207660_10000931 | 3300025917 | Bacteria | 19331 |
| 399 | Ga0207660_10001391 | 3300025917 | Bacteria | 16259 |
| 400 | Ga0207660_10003395 | 3300025917 | Bacteria | 10378 |
| 401 | Ga0207660_10005061 | 3300025917 | Bacteria | 8583 |
| 402 | Ga0207657_10010252 | 3300025919 | Bacteria | 9360 |
| 403 | Ga0207657_10017203 | 3300025919 | Bacteria | 6945 |
| 404 | Ga0207649_10005594 | 3300025920 | Bacteria | 6795 |
| 405 | Ga0207649_10031454 | 3300025920 | Bacteria | 3154 |
| 406 | Ga0207649_10089027 | 3300025920 | Bacteria | 2017 |
| 407 | Ga0207652_10000030 | 3300025921 | Bacteria | 144884 |
| 408 | Ga0207652_10001197 | 3300025921 | Bacteria | 23349 |
| 409 | Ga0207652_10041489 | 3300025921 | Bacteria | 3912 |
| 410 | Ga0207681_10004705 | 3300025923 | Bacteria | 8395 |
| 411 | Ga0207694_10000563 | 3300025924 | Bacteria | 33592 |
| 412 | Ga0207694_10004402 | 3300025924 | Bacteria | 11002 |
| 413 | Ga0207694_10012219 | 3300025924 | Bacteria | 6473 |
| 414 | Ga0207694_10012898 | 3300025924 | Bacteria | 6292 |
| 415 | Ga0207694_10041831 | 3300025924 | Bacteria | 3532 |
| 416 | Ga0207650_10044596 | 3300025925 | Bacteria | 3260 |
| 417 | Ga0207700_10000822 | 3300025928 | Bacteria | 17939 |
| 418 | Ga0207664_10000474 | 3300025929 | Bacteria | 28453 |
| 419 | Ga0207664_10000584 | 3300025929 | Bacteria | 25442 |
| 420 | Ga0207664_10000585 | 3300025929 | Bacteria | 25440 |
| 421 | Ga0207644_10000313 | 3300025931 | Bacteria | 31603 |
| 422 | Ga0207644_10060403 | 3300025931 | Bacteria | 2743 |
| 423 | Ga0207690_10000443 | 3300025932 | Bacteria | 26830 |
| 424 | Ga0207690_10001772 | 3300025932 | Bacteria | 13272 |
| 425 | Ga0207690_10001851 | 3300025932 | Bacteria | 13004 |
| 426 | Ga0207690_10001946 | 3300025932 | Bacteria | 12658 |
| 427 | Ga0207690_10007510 | 3300025932 | Bacteria | 6470 |
| 428 | Ga0207690_10008552 | 3300025932 | Bacteria | 6074 |
| 429 | Ga0207690_10009506 | 3300025932 | Bacteria | 5775 |
| 430 | Ga0207706_10029417 | 3300025933 | Bacteria | 4903 |
| 431 | Ga0207709_10018744 | 3300025935 | Bacteria | 3880 |
| 432 | Ga0207670_10005060 | 3300025936 | Bacteria | 7190 |
| 433 | Ga0207704_10001296 | 3300025938 | Bacteria | 11176 |
| 434 | Ga0207691_10007639 | 3300025940 | Bacteria | 10406 |
| 435 | Ga0207711_10001015 | 3300025941 | Bacteria | 26915 |
| 436 | Ga0207711_10004854 | 3300025941 | Bacteria | 11428 |
| 437 | Ga0207711_10061557 | 3300025941 | Bacteria | 3237 |
| 438 | Ga0207661_10004417 | 3300025944 | Bacteria | 9865 |
| 439 | Ga0207667_10000250 | 3300025949 | Bacteria | 75738 |
| 440 | Ga0207667_10000679 | 3300025949 | Bacteria | 44080 |
| 441 | Ga0207667_10001003 | 3300025949 | Bacteria | 36039 |
| 442 | Ga0207667_10001167 | 3300025949 | Bacteria | 32985 |
| 443 | Ga0207667_10005715 | 3300025949 | Bacteria | 15171 |
| 444 | Ga0207667_10016516 | 3300025949 | Bacteria | 8337 |
| 445 | Ga0207712_10000343 | 3300025961 | Bacteria | 42053 |
| 446 | Ga0207640_10001071 | 3300025981 | Bacteria | 15167 |
| 447 | Ga0207640_10003830 | 3300025981 | Bacteria | 8116 |
| 448 | Ga0207640_10005529 | 3300025981 | Bacteria | 6887 |
| 449 | Ga0207658_10000093 | 3300025986 | Bacteria | 98928 |
| 450 | Ga0207677_10094535 | 3300026023 | Bacteria | 2182 |
| 451 | Ga0207639_10001634 | 3300026041 | Bacteria | 15086 |
| 452 | Ga0207639_10002124 | 3300026041 | Bacteria | 13352 |
| 453 | Ga0207639_10005666 | 3300026041 | Bacteria | 8451 |
| 454 | Ga0207639_10007609 | 3300026041 | Bacteria | 7389 |
| 455 | Ga0207678_10000433 | 3300026067 | Bacteria | 37961 |
| 456 | Ga0207678_10005962 | 3300026067 | Bacteria | 10852 |
| 457 | Ga0207678_10050893 | 3300026067 | Bacteria | 3578 |
| 458 | Ga0207678_10080157 | 3300026067 | Bacteria | 2795 |
| 459 | Ga0207702_10000943 | 3300026078 | Bacteria | 29865 |
| 460 | Ga0207702_10003531 | 3300026078 | Bacteria | 14234 |
| 461 | Ga0207702_10140169 | 3300026078 | Bacteria | 2187 |
| 462 | Ga0207648_10029340 | 3300026089 | Bacteria | 4878 |
| 463 | Ga0207674_10007214 | 3300026116 | Bacteria | 12971 |
| 464 | Ga0207674_10019944 | 3300026116 | Bacteria | 7255 |
| 465 | Ga0207674_10024820 | 3300026116 | Bacteria | 6399 |
| 466 | Ga0207674_10065193 | 3300026116 | Bacteria | 3672 |
| 467 | Ga0207674_10066528 | 3300026116 | Bacteria | 3630 |
| 468 | Ga0207683_10025237 | 3300026121 | Bacteria | 5125 |
| 469 | Ga0207698_10000592 | 3300026142 | Bacteria | 21149 |
| 470 | Ga0207698_10002980 | 3300026142 | Bacteria | 10149 |
| 471 | Ga0207698_10038811 | 3300026142 | Bacteria | 3522 |
| 472 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 473 | Ga0268266_10000043 | 3300028379 | Bacteria | 316604 |
| 474 | Ga0268266_10045565 | 3300028379 | Bacteria | 3752 |
| 475 | Ga0268265_10094964 | 3300028380 | Bacteria | 2393 |
| 476 | Ga0268264_10022370 | 3300028381 | Bacteria | 5163 |
| 477 | Ga0268264_10069503 | 3300028381 | Bacteria | 2978 |
| 478 | Ga0265334_10000009 | 3300028573 | Bacteria | 194312 |
| 479 | Ga0265338_10009730 | 3300028800 | Bacteria | 11404 |
| 480 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 481 | Ga0316177_1203723 | 3300030731 | Bacteria | 6164 |
| 482 | Ga0307513_10053920 | 3300031456 | Bacteria | 4316 |
| 483 | Ga0307408_100046420 | 3300031548 | Bacteria | 3107 |
| 484 | Ga0265313_10007989 | 3300031595 | Bacteria | 7104 |
| 485 | Ga0316575_10011930 | 3300031665 | Bacteria | 3224 |
| 486 | Ga0316575_10040661 | 3300031665 | Bacteria | 1837 |
| 487 | Ga0316578_10016352 | 3300031728 | Bacteria | 4012 |
| 488 | Ga0307516_10001401 | 3300031730 | Bacteria | 33337 |
| 489 | Ga0307516_10018328 | 3300031730 | Bacteria | 7275 |
| 490 | Ga0307516_10035332 | 3300031730 | Bacteria | 5015 |
| 491 | Ga0307405_10003809 | 3300031731 | Bacteria | 7013 |
| 492 | Ga0316577_10009829 | 3300031733 | Bacteria | 5155 |
| 493 | Ga0307413_10001746 | 3300031824 | Bacteria | 8494 |
| 494 | Ga0307410_10005487 | 3300031852 | Bacteria | 6720 |
| 495 | Ga0307407_10013528 | 3300031903 | Bacteria | 3965 |
| 496 | Ga0307412_10006145 | 3300031911 | Bacteria | 6768 |
| 497 | Ga0307409_100126975 | 3300031995 | Bacteria | 2171 |
| 498 | Ga0307416_100000500 | 3300032002 | Bacteria | 19946 |
| 499 | Ga0307414_10003986 | 3300032004 | Bacteria | 7967 |
| 500 | Ga0307414_10017858 | 3300032004 | Bacteria | 4351 |
| 501 | Ga0307411_10017445 | 3300032005 | Bacteria | 4091 |
| 502 | Ga0307415_100014074 | 3300032126 | Bacteria | 4690 |
| 503 | Ga0316583_10000626 | 3300032133 | Bacteria | 10804 |
| 504 | Ga0316585_10000572 | 3300032137 | Bacteria | 9022 |
| 505 | Ga0316580_10003247 | 3300032139 | Bacteria | 4592 |
| 506 | Ga0307510_10001938 | 3300033180 | Bacteria | 23267 |
| 507 | Ga0316574_0002354 | 3300035398 | Bacteria | 9458 |
| 508 | Ga0316574_0008582 | 3300035398 | Bacteria | 5682 |
| 509 | Ga0316574_0009969 | 3300035398 | Bacteria | 5346 |
| 510 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 511 | Ga0316582_0002212 | 3300036647 | Bacteria | 9026 |
| 512 | Ga0316584_0002179 | 3300036712 | Bacteria | 12271 |
| 513 | Ga0316584_0042445 | 3300036712 | Bacteria | 3392 |
| 514 | Ga0395899_0000142 | 3300037312 | Bacteria | 109659 |
| 515 | Ga0395899_0009818 | 3300037312 | Bacteria | 7342 |
| 516 | Ga0395899_0016093 | 3300037312 | Bacteria | 5701 |
| 517 | Ga0395899_0022754 | 3300037312 | Bacteria | 4749 |
| 518 | Ga0395899_0053918 | 3300037312 | Bacteria | 2976 |
| 519 | Ga0395899_0134478 | 3300037312 | Bacteria | 1763 |
| 520 | Ga0395900_0000069 | 3300037418 | Bacteria | 190578 |
| 521 | Ga0395900_0002387 | 3300037418 | Bacteria | 20737 |
| 522 | Ga0395900_0010793 | 3300037418 | Bacteria | 9345 |
| 523 | Ga0395900_0031124 | 3300037418 | Bacteria | 5481 |
| 524 | Ga0395900_0082649 | 3300037418 | Bacteria | 3300 |
| 525 | Ga0395898_0000097 | 3300037466 | Bacteria | 230579 |
| 526 | Ga0395898_0001079 | 3300037466 | Bacteria | 42224 |
| 527 | Ga0395898_0015073 | 3300037466 | Bacteria | 7934 |
| 528 | Ga0395898_0025910 | 3300037466 | Bacteria | 5904 |
| 529 | Ga0395901_0000983 | 3300038443 | Bacteria | 30866 |
| 530 | Ga0395901_0002935 | 3300038443 | Bacteria | 17206 |
| 531 | Ga0395901_0010713 | 3300038443 | Bacteria | 9295 |
| 532 | Ga0395901_0149263 | 3300038443 | Bacteria | 2456 |
| 533 | Ga0237819_00127 | 3300038705 | Bacteria | 28645 |
| 534 | Ga0439436_0000010 | 3300041404 | Bacteria | 104480 |
| 535 | Ga0439436_0006040 | 3300041404 | Bacteria | 3712 |
| 536 | Ga0439465_0000123 | 3300041413 | Bacteria | 18623 |
| 537 | Ga0439465_0003861 | 3300041413 | Bacteria | 4889 |
| 538 | Ga0439465_0018945 | 3300041413 | Bacteria | 2151 |
| 539 | Ga0451791_0612411 | 3300041451 | Bacteria | 1981 |
| 540 | Ga0439433_0012744 | 3300041999 | Bacteria | 1845 |
| 541 | Ga0439432_007320 | 3300042006 | Bacteria | 3915 |
| 542 | Ga0439432_019438 | 3300042006 | Bacteria | 2262 |
| 543 | Ga0439449_0000905 | 3300042007 | Bacteria | 11573 |
| 544 | Ga0450908_000564 | 3300042184 | Bacteria | 7116 |
| 545 | Ga0450908_000860 | 3300042184 | Bacteria | 5854 |
| 546 | Ga0451577_0009927 | 3300042876 | Bacteria | 9126 |
| 547 | Ga0466969_0002807 | 3300044656 | Bacteria | 9304 |
| 548 | Ga0466969_0003343 | 3300044656 | Bacteria | 8536 |
| 549 | Ga0466969_0004136 | 3300044656 | Bacteria | 7701 |
| 550 | Ga0466969_0017661 | 3300044656 | Bacteria | 3722 |
| 551 | Ga0466972_0016098 | 3300044658 | Bacteria | 3738 |
| 552 | Ga0466989_0020182 | 3300044663 | Bacteria | 3832 |
| 553 | Ga0466982_0000019 | 3300044672 | Bacteria | 111595 |
| 554 | Ga0466982_0000098 | 3300044672 | Bacteria | 21160 |
| 555 | Ga0453683_0008814 | 3300044673 | Bacteria | 6755 |
| 556 | Ga0466965_0019349 | 3300044683 | Bacteria | 3269 |
| 557 | Ga0466966_0020730 | 3300044684 | Bacteria | 4320 |
| 558 | Ga0466961_0007963 | 3300044693 | Bacteria | 6754 |
| 559 | Ga0466961_0013744 | 3300044693 | Bacteria | 5188 |
| 560 | Ga0466961_0075758 | 3300044693 | Bacteria | 2132 |
| 561 | Ga0466961_0091704 | 3300044693 | Bacteria | 1918 |
| 562 | Ga0466964_0015082 | 3300044706 | Bacteria | 2942 |
| 563 | Ga0466971_0016812 | 3300044719 | Bacteria | 3232 |
| 564 | Ga0466968_0004448 | 3300044735 | Bacteria | 5244 |
| 565 | Ga0466968_0030742 | 3300044735 | Bacteria | 2225 |
| 566 | Ga0466970_0001674 | 3300044765 | Bacteria | 10642 |
| 567 | Ga0466970_0009926 | 3300044765 | Bacteria | 4819 |
| 568 | Ga0466970_0057341 | 3300044765 | Bacteria | 2082 |
| 569 | Ga0466960_0031658 | 3300044901 | Bacteria | 2442 |
| 570 | Ga0466959_0024013 | 3300045049 | Bacteria | 4514 |
| 571 | Ga0466959_0053115 | 3300045049 | Bacteria | 2963 |
| 572 | Ga0451576_0000821 | 3300045051 | Bacteria | 60704 |
| 573 | Ga0451576_0072609 | 3300045051 | Bacteria | 3581 |
| 574 | Ga0466967_0041735 | 3300045976 | Bacteria | 3959 |
| 575 | Ga0495617_003046 | 3300046452 | Bacteria | 6383 |
| 576 | Ga0495617_003503 | 3300046452 | Bacteria | 5881 |
| 577 | Ga0495627_006082 | 3300046453 | Bacteria | 4770 |
| 578 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 579 | Ga0495638_0000122 | 3300046460 | Bacteria | 125872 |
| 580 | Ga0495638_0001156 | 3300046460 | Bacteria | 25430 |
| 581 | Ga0495638_0001504 | 3300046460 | Bacteria | 20993 |
| 582 | Ga0495638_0005088 | 3300046460 | Bacteria | 9854 |
| 583 | Ga0495650_0000209 | 3300046471 | Bacteria | 125495 |
| 584 | Ga0495650_0003763 | 3300046471 | Bacteria | 10827 |
| 585 | Ga0495605_0023124 | 3300046474 | Bacteria | 3272 |
| 586 | Ga0495585_0000423 | 3300046492 | Bacteria | 40748 |
| 587 | Ga0495585_0010514 | 3300046492 | Bacteria | 5504 |
| 588 | Ga0495607_0000080 | 3300046501 | Bacteria | 97217 |
| 589 | Ga0495607_0008882 | 3300046501 | Bacteria | 6846 |
| 590 | Ga0495607_0021638 | 3300046501 | Bacteria | 4044 |
| 591 | Ga0495607_0077432 | 3300046501 | Bacteria | 1837 |
| 592 | Ga0495606_0000203 | 3300046507 | Bacteria | 103887 |
| 593 | Ga0495606_0000348 | 3300046507 | Bacteria | 79254 |
| 594 | Ga0495606_0016437 | 3300046507 | Bacteria | 5640 |
| 595 | Ga0495610_0004716 | 3300046512 | Bacteria | 9951 |
| 596 | Ga0495610_0043035 | 3300046512 | Bacteria | 2253 |
| 597 | Ga0495616_0000067 | 3300046513 | Bacteria | 89610 |
| 598 | Ga0495616_0025426 | 3300046513 | Bacteria | 3164 |
| 599 | Ga0495620_0003391 | 3300046515 | Bacteria | 9116 |
| 600 | Ga0495631_0003301 | 3300046518 | Bacteria | 8873 |
| 601 | Ga0495631_0004603 | 3300046518 | Bacteria | 7301 |
| 602 | Ga0495632_0000046 | 3300046519 | Bacteria | 139365 |
| 603 | Ga0495637_0014700 | 3300046520 | Bacteria | 3688 |
| 604 | Ga0495643_0001740 | 3300046522 | Bacteria | 18773 |
| 605 | Ga0495648_0018232 | 3300046524 | Bacteria | 4983 |
| 606 | Ga0495663_0000872 | 3300046525 | Bacteria | 10172 |
| 607 | Ga0495663_0001432 | 3300046525 | Bacteria | 7534 |
| 608 | Ga0495621_0003739 | 3300046539 | Bacteria | 4217 |
| 609 | Ga0495633_0013730 | 3300046558 | Bacteria | 4257 |
| 610 | Ga0495633_0022068 | 3300046558 | Bacteria | 3173 |
| 611 | Ga0495668_0000804 | 3300046616 | Bacteria | 36089 |
| 612 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 613 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 614 | Ga0495625_0024027 | 3300046660 | Bacteria | 4646 |
| 615 | Ga0495625_0044660 | 3300046660 | Bacteria | 3206 |
| 616 | Ga0495661_0004547 | 3300046665 | Bacteria | 9991 |
| 617 | Ga0495647_0021574 | 3300046681 | Bacteria | 2320 |
| 618 | Ga0495670_0009454 | 3300046691 | Bacteria | 4791 |
| 619 | Ga0495671_0000875 | 3300046692 | Bacteria | 21477 |
| 620 | Ga0495649_0012109 | 3300046694 | Bacteria | 5034 |
| 621 | Ga0495649_0015980 | 3300046694 | Bacteria | 4261 |
| 622 | Ga0495589_0000138 | 3300046794 | Bacteria | 66651 |
| 623 | Ga0495660_0004009 | 3300046810 | Bacteria | 8989 |
| 624 | Ga0495672_0000373 | 3300047320 | Bacteria | 55844 |
| 625 | Ga0495679_000029 | 3300047446 | Bacteria | 190883 |
| 626 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 627 | Ga0495673_0014223 | 3300047469 | Bacteria | 4144 |
| 628 | Ga0495686_0000043 | 3300047472 | Bacteria | 291565 |
| 629 | Ga0495686_0085291 | 3300047472 | Bacteria | 1923 |
| 630 | Ga0496101_0016866 | 3300048904 | Bacteria | 4944 |
| 631 | Ga0496104_0000022 | 3300048907 | Bacteria | 237390 |
| 632 | Ga0496104_0012882 | 3300048907 | Bacteria | 7532 |
| 633 | Ga0496105_0000012 | 3300048908 | Bacteria | 261713 |
| 634 | Ga0496105_0006290 | 3300048908 | Bacteria | 9118 |
| 635 | Ga0496105_0018943 | 3300048908 | Bacteria | 5545 |
| 636 | Ga0496105_0090311 | 3300048908 | Bacteria | 2530 |
| 637 | Ga0496106_0009989 | 3300048909 | Bacteria | 7009 |
| 638 | Ga0496106_0014736 | 3300048909 | Bacteria | 5780 |
| 639 | Ga0496108_0030769 | 3300048911 | Bacteria | 4448 |
| 640 | Ga0496109_0200161 | 3300048912 | Bacteria | 1877 |
| 641 | Ga0496110_0005613 | 3300048913 | Bacteria | 9846 |
| 642 | Ga0496110_0035169 | 3300048913 | Bacteria | 4344 |
| 643 | Ga0496113_0067201 | 3300048916 | Bacteria | 2717 |
| 644 | Ga0496114_0001917 | 3300048917 | Bacteria | 15837 |
| 645 | Ga0496114_0046500 | 3300048917 | Bacteria | 3607 |
| 646 | Ga0496115_0000163 | 3300048918 | Bacteria | 62399 |
| 647 | Ga0496115_0000181 | 3300048918 | Bacteria | 58749 |
| 648 | Ga0496115_0013485 | 3300048918 | Bacteria | 6184 |
| 649 | Ga0496115_0020279 | 3300048918 | Bacteria | 5126 |
| 650 | Ga0496115_0038116 | 3300048918 | Bacteria | 3812 |
| 651 | Ga0496115_0071919 | 3300048918 | Bacteria | 2805 |
| 652 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 653 | Ga0496116_0017392 | 3300048919 | Bacteria | 5580 |
| 654 | Ga0496117_0005762 | 3300048920 | Bacteria | 12872 |
| 655 | Ga0496117_0009952 | 3300048920 | Bacteria | 8743 |
| 656 | Ga0496117_0013593 | 3300048920 | Bacteria | 7089 |
| 657 | Ga0496117_0015798 | 3300048920 | Bacteria | 6407 |
| 658 | Ga0496117_0020923 | 3300048920 | Bacteria | 5319 |
| 659 | Ga0496117_0024725 | 3300048920 | Bacteria | 4739 |
| 660 | Ga0496117_0028315 | 3300048920 | Bacteria | 4342 |
| 661 | Ga0496117_0057321 | 3300048920 | Bacteria | 2706 |
| 662 | Ga0496118_0000528 | 3300048921 | Bacteria | 62711 |
| 663 | Ga0496118_0000848 | 3300048921 | Bacteria | 48534 |
| 664 | Ga0496118_0004154 | 3300048921 | Bacteria | 17490 |
| 665 | Ga0496118_0005474 | 3300048921 | Bacteria | 14415 |
| 666 | Ga0496118_0016346 | 3300048921 | Bacteria | 6811 |
| 667 | Ga0496118_0017635 | 3300048921 | Bacteria | 6485 |
| 668 | Ga0496118_0025548 | 3300048921 | Bacteria | 5059 |
| 669 | Ga0496118_0029280 | 3300048921 | Bacteria | 4621 |
| 670 | Ga0496118_0031026 | 3300048921 | Bacteria | 4443 |
| 671 | Ga0496119_0000184 | 3300048922 | Bacteria | 87765 |
| 672 | Ga0496119_0000659 | 3300048922 | Bacteria | 46235 |
| 673 | Ga0496119_0001426 | 3300048922 | Bacteria | 28899 |
| 674 | Ga0496119_0021762 | 3300048922 | Bacteria | 4619 |
| 675 | Ga0496120_0000217 | 3300048923 | Bacteria | 99402 |
| 676 | Ga0496120_0000307 | 3300048923 | Bacteria | 81552 |
| 677 | Ga0496120_0001091 | 3300048923 | Bacteria | 35465 |
| 678 | Ga0496120_0004293 | 3300048923 | Bacteria | 12085 |
| 679 | Ga0496121_0000029 | 3300048924 | Bacteria | 430303 |
| 680 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 681 | Ga0496121_0004159 | 3300048924 | Bacteria | 19788 |
| 682 | Ga0496121_0009184 | 3300048924 | Bacteria | 11428 |
| 683 | Ga0496121_0009283 | 3300048924 | Bacteria | 11346 |
| 684 | Ga0496121_0017494 | 3300048924 | Bacteria | 7318 |
| 685 | Ga0496121_0029782 | 3300048924 | Bacteria | 5034 |
| 686 | Ga0496121_0037992 | 3300048924 | Bacteria | 4270 |
| 687 | Ga0496121_0040589 | 3300048924 | Bacteria | 4080 |
| 688 | Ga0496122_0000267 | 3300048925 | Bacteria | 116950 |
| 689 | Ga0496122_0001038 | 3300048925 | Bacteria | 48750 |
| 690 | Ga0496122_0001998 | 3300048925 | Bacteria | 30375 |
| 691 | Ga0496122_0005854 | 3300048925 | Bacteria | 14421 |
| 692 | Ga0496122_0016541 | 3300048925 | Bacteria | 6966 |
| 693 | Ga0496122_0019191 | 3300048925 | Bacteria | 6261 |
| 694 | Ga0496122_0019274 | 3300048925 | Bacteria | 6242 |
| 695 | Ga0496122_0030232 | 3300048925 | Bacteria | 4546 |
| 696 | Ga0496123_0000161 | 3300048926 | Bacteria | 134623 |
| 697 | Ga0496123_0000848 | 3300048926 | Bacteria | 48801 |
| 698 | Ga0496123_0001899 | 3300048926 | Bacteria | 27259 |
| 699 | Ga0496123_0015448 | 3300048926 | Bacteria | 6261 |
| 700 | Ga0496123_0024797 | 3300048926 | Bacteria | 4543 |
| 701 | Ga0496123_0026628 | 3300048926 | Bacteria | 4327 |
| 702 | Ga0496123_0031037 | 3300048926 | Bacteria | 3897 |
| 703 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 704 | Ga0496124_0000734 | 3300048927 | Bacteria | 53581 |
| 705 | Ga0496124_0001490 | 3300048927 | Bacteria | 34391 |
| 706 | Ga0496124_0004066 | 3300048927 | Bacteria | 17329 |
| 707 | Ga0496124_0025689 | 3300048927 | Bacteria | 5328 |
| 708 | Ga0496124_0042962 | 3300048927 | Bacteria | 3888 |
| 709 | Ga0496125_0000149 | 3300048928 | Bacteria | 154223 |
| 710 | Ga0496125_0010887 | 3300048928 | Bacteria | 9147 |
| 711 | Ga0496125_0031770 | 3300048928 | Bacteria | 4699 |
| 712 | Ga0496125_0031902 | 3300048928 | Bacteria | 4687 |
| 713 | Ga0496125_0036240 | 3300048928 | Bacteria | 4311 |
| 714 | Ga0496125_0041611 | 3300048928 | Bacteria | 3926 |
| 715 | Ga0496126_0002149 | 3300048929 | Bacteria | 27466 |
| 716 | Ga0496126_0003384 | 3300048929 | Bacteria | 20200 |
| 717 | Ga0496126_0004290 | 3300048929 | Bacteria | 17144 |
| 718 | Ga0496126_0013547 | 3300048929 | Bacteria | 8286 |
| 719 | Ga0496126_0020995 | 3300048929 | Bacteria | 6391 |
| 720 | Ga0496126_0060008 | 3300048929 | Bacteria | 3423 |
| 721 | Ga0496126_0060980 | 3300048929 | Bacteria | 3390 |
| 722 | Ga0496126_0120754 | 3300048929 | Bacteria | 2273 |
| 723 | Ga0495678_000718 | 3300049459 | Bacteria | 30159 |
| 724 | Ga0501031_0013662 | 3300049568 | Bacteria | 5290 |
| 725 | Ga0501031_0059928 | 3300049568 | Bacteria | 2480 |
| 726 | Ga0501032_0027853 | 3300049569 | Bacteria | 3883 |
| 727 | Ga0501032_0037308 | 3300049569 | Bacteria | 3314 |
| 728 | Ga0501033_0000747 | 3300049570 | Bacteria | 29937 |
| 729 | Ga0501033_0001508 | 3300049570 | Bacteria | 20623 |
| 730 | Ga0501033_0005847 | 3300049570 | Bacteria | 9668 |
| 731 | Ga0501033_0015113 | 3300049570 | Bacteria | 5858 |
| 732 | Ga0501033_0032897 | 3300049570 | Bacteria | 3893 |
| 733 | Ga0501033_0062985 | 3300049570 | Bacteria | 2730 |
| 734 | Ga0501034_0000344 | 3300049571 | Bacteria | 80851 |
| 735 | Ga0501034_0000355 | 3300049571 | Bacteria | 78528 |
| 736 | Ga0501034_0012809 | 3300049571 | Bacteria | 8650 |
| 737 | Ga0501034_0032668 | 3300049571 | Bacteria | 5285 |
| 738 | Ga0501034_0055878 | 3300049571 | Bacteria | 3972 |
| 739 | Ga0501036_0011935 | 3300049572 | Bacteria | 7202 |
| 740 | Ga0501036_0035985 | 3300049572 | Bacteria | 4189 |
| 741 | Ga0501036_0042201 | 3300049572 | Bacteria | 3862 |
| 742 | Ga0501037_0005211 | 3300049573 | Bacteria | 9454 |
| 743 | Ga0501037_0006927 | 3300049573 | Bacteria | 8278 |
| 744 | Ga0501037_0012184 | 3300049573 | Bacteria | 6330 |
| 745 | Ga0501037_0029467 | 3300049573 | Bacteria | 4055 |
| 746 | Ga0501037_0033049 | 3300049573 | Bacteria | 3822 |
| 747 | Ga0501038_0025329 | 3300049574 | Bacteria | 5289 |
| 748 | Ga0501038_0026037 | 3300049574 | Bacteria | 5209 |
| 749 | Ga0501038_0079480 | 3300049574 | Bacteria | 2765 |
| 750 | Ga0501039_0007584 | 3300049575 | Bacteria | 8286 |
| 751 | Ga0501039_0127614 | 3300049575 | Bacteria | 1995 |
| 752 | Ga0501040_0001093 | 3300049576 | Bacteria | 17147 |
| 753 | Ga0501040_0008567 | 3300049576 | Bacteria | 6637 |
| 754 | Ga0501040_0009299 | 3300049576 | Bacteria | 6402 |
| 755 | Ga0501040_0009725 | 3300049576 | Bacteria | 6276 |
| 756 | Ga0501040_0012191 | 3300049576 | Bacteria | 5628 |
| 757 | Ga0501041_0037583 | 3300049577 | Bacteria | 2934 |
| 758 | Ga0501042_0004185 | 3300049578 | Bacteria | 9175 |
| 759 | Ga0501042_0004613 | 3300049578 | Bacteria | 8796 |
| 760 | Ga0501042_0007705 | 3300049578 | Bacteria | 7071 |
| 761 | Ga0501042_0043650 | 3300049578 | Bacteria | 3193 |
| 762 | Ga0501043_0002540 | 3300049579 | Bacteria | 15433 |
| 763 | Ga0501043_0019418 | 3300049579 | Bacteria | 5335 |
| 764 | Ga0501043_0041262 | 3300049579 | Bacteria | 3626 |
| 765 | Ga0501046_0002537 | 3300049580 | Bacteria | 17078 |
| 766 | Ga0501046_0012062 | 3300049580 | Bacteria | 7368 |
| 767 | Ga0501046_0022811 | 3300049580 | Bacteria | 5155 |
| 768 | Ga0501047_0004475 | 3300049581 | Bacteria | 13151 |
| 769 | Ga0501047_0010659 | 3300049581 | Bacteria | 8686 |
| 770 | Ga0501047_0015450 | 3300049581 | Bacteria | 7274 |
| 771 | Ga0501047_0069784 | 3300049581 | Bacteria | 3383 |
| 772 | Ga0501047_0076899 | 3300049581 | Bacteria | 3212 |
| 773 | Ga0501047_0141866 | 3300049581 | Bacteria | 2280 |
| 774 | Ga0501048_0013116 | 3300049582 | Bacteria | 6151 |
| 775 | Ga0501048_0018366 | 3300049582 | Bacteria | 5144 |
| 776 | Ga0501048_0020049 | 3300049582 | Bacteria | 4904 |
| 777 | Ga0501048_0055113 | 3300049582 | Bacteria | 2823 |
| 778 | Ga0501048_0069922 | 3300049582 | Bacteria | 2479 |
| 779 | Ga0501068_0024287 | 3300049584 | Bacteria | 3559 |
| 780 | Ga0501068_0030043 | 3300049584 | Bacteria | 3221 |
| 781 | Ga0501069_0001683 | 3300049585 | Bacteria | 10987 |
| 782 | Ga0501069_0023366 | 3300049585 | Bacteria | 3371 |
| 783 | Ga0501070_0001120 | 3300049586 | Bacteria | 24055 |
| 784 | Ga0501070_0011003 | 3300049586 | Bacteria | 7637 |
| 785 | Ga0501070_0013738 | 3300049586 | Bacteria | 6820 |
| 786 | Ga0501070_0018995 | 3300049586 | Bacteria | 5765 |
| 787 | Ga0501070_0023611 | 3300049586 | Bacteria | 5152 |
| 788 | Ga0501070_0075225 | 3300049586 | Bacteria | 2795 |
| 789 | Ga0501071_0008278 | 3300049587 | Bacteria | 6867 |
| 790 | Ga0501071_0033521 | 3300049587 | Bacteria | 3648 |
| 791 | Ga0501071_0046255 | 3300049587 | Bacteria | 3125 |
| 792 | Ga0501072_0004152 | 3300049588 | Bacteria | 10964 |
| 793 | Ga0501072_0008841 | 3300049588 | Bacteria | 7653 |
| 794 | Ga0501072_0019046 | 3300049588 | Bacteria | 5300 |
| 795 | Ga0501072_0027365 | 3300049588 | Bacteria | 4447 |
| 796 | Ga0501073_0003721 | 3300049589 | Bacteria | 11458 |
| 797 | Ga0501073_0005507 | 3300049589 | Bacteria | 9483 |
| 798 | Ga0501073_0010681 | 3300049589 | Bacteria | 6724 |
| 799 | Ga0501073_0012681 | 3300049589 | Bacteria | 6147 |
| 800 | Ga0501073_0069917 | 3300049589 | Bacteria | 2446 |
| 801 | Ga0501073_0107067 | 3300049589 | Bacteria | 1940 |
| 802 | Ga0501074_0004079 | 3300049590 | Bacteria | 10423 |
| 803 | Ga0501074_0024713 | 3300049590 | Bacteria | 4365 |
| 804 | Ga0501074_0037632 | 3300049590 | Bacteria | 3507 |
| 805 | Ga0501075_0065660 | 3300049591 | Bacteria | 2738 |
| 806 | Ga0501076_0002535 | 3300049592 | Bacteria | 12567 |
| 807 | Ga0501076_0004710 | 3300049592 | Bacteria | 9727 |
| 808 | Ga0501076_0023151 | 3300049592 | Bacteria | 4784 |
| 809 | Ga0501077_0018306 | 3300049593 | Bacteria | 4433 |
| 810 | Ga0501077_0103282 | 3300049593 | Bacteria | 1806 |
| 811 | Ga0501079_0007763 | 3300049741 | Bacteria | 8121 |
| 812 | Ga0501079_0059639 | 3300049741 | Bacteria | 2943 |
| 813 | Ga0501079_0199192 | 3300049741 | Bacteria | 1564 |
| 814 | Ga0501080_0004279 | 3300049742 | Bacteria | 12672 |
| 815 | Ga0501080_0028382 | 3300049742 | Bacteria | 5205 |
| 816 | Ga0501080_0028686 | 3300049742 | Bacteria | 5180 |
| 817 | Ga0501080_0084412 | 3300049742 | Bacteria | 2950 |
| 818 | Ga0501081_0004658 | 3300049743 | Bacteria | 8817 |
| 819 | Ga0501081_0005725 | 3300049743 | Bacteria | 8042 |
| 820 | Ga0501081_0009346 | 3300049743 | Bacteria | 6387 |
| 821 | Ga0501081_0021742 | 3300049743 | Bacteria | 4283 |
| 822 | Ga0501083_0012139 | 3300049744 | Bacteria | 6029 |
| 823 | Ga0501035_0003148 | 3300049822 | Bacteria | 15853 |
| 824 | Ga0501035_0010022 | 3300049822 | Bacteria | 8792 |
| 825 | Ga0501035_0019320 | 3300049822 | Bacteria | 6270 |
| 826 | Ga0501035_0022285 | 3300049822 | Bacteria | 5817 |
| 827 | Ga0501035_0025947 | 3300049822 | Bacteria | 5368 |
| 828 | Ga0501035_0032024 | 3300049822 | Bacteria | 4787 |
| 829 | Ga0501035_0095280 | 3300049822 | Bacteria | 2616 |
| 830 | Ga0501035_0141934 | 3300049822 | Bacteria | 2088 |
| 831 | Ga0501035_0161756 | 3300049822 | Bacteria | 1937 |
| 832 | Ga0501044_0007144 | 3300049823 | Bacteria | 12285 |
| 833 | Ga0501044_0011428 | 3300049823 | Bacteria | 9619 |
| 834 | Ga0501044_0029738 | 3300049823 | Bacteria | 5759 |
| 835 | Ga0501044_0041271 | 3300049823 | Bacteria | 4803 |
| 836 | Ga0501044_0043549 | 3300049823 | Bacteria | 4662 |
| 837 | Ga0501044_0083293 | 3300049823 | Bacteria | 3235 |
| 838 | Ga0501044_0121429 | 3300049823 | Bacteria | 2613 |
| 839 | Ga0501044_0151906 | 3300049823 | Bacteria | 2297 |
| 840 | Ga0501045_0000225 | 3300049824 | Bacteria | 32621 |
| 841 | Ga0501045_0019176 | 3300049824 | Bacteria | 4872 |
| 842 | nmdc:mga00v17_10476_c1 | 3300050491 | Bacteria | 5064 |
| 843 | nmdc:mga00v17_5307_c1 | 3300050491 | Bacteria | 6789 |
| 844 | nmdc:mga08y16_54621_c1 | 3300050511 | Bacteria | 4174 |
| 845 | nmdc:mga0n895_17491_c1 | 3300050512 | Bacteria | 6608 |
| 846 | nmdc:mga0rr50_152611_c1 | 3300050513 | Bacteria | 1868 |
| 847 | nmdc:mga0a205_603_c1 | 3300050515 | Bacteria | 28564 |
| 848 | nmdc:mga0sz30_14786_c1 | 3300050516 | Bacteria | 3078 |
| 849 | Ga0500610_0023463 | 3300053079 | Bacteria | 3055 |
| 850 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 851 | Ga0500643_001805 | 3300053087 | Bacteria | 11703 |
| 852 | Ga0500651_0000088 | 3300053093 | Bacteria | 59179 |
| 853 | Ga0500556_0000234 | 3300053104 | Bacteria | 45118 |
| 854 | Ga0500594_0001943 | 3300053118 | Bacteria | 4465 |
| 855 | Ga0500597_000873 | 3300053120 | Bacteria | 6975 |
| 856 | Ga0500642_0000014 | 3300053130 | Bacteria | 182110 |
| 857 | Ga0500634_0001229 | 3300053161 | Bacteria | 9679 |
| 858 | Ga0500645_000395 | 3300053730 | Bacteria | 30555 |
| 859 | Ga0500645_005302 | 3300053730 | Bacteria | 4773 |
| 860 | Ga0501084_0014642 | 3300054114 | Bacteria | 6502 |
| 861 | Ga0501084_0042413 | 3300054114 | Bacteria | 3806 |
| 862 | Ga0501084_0094713 | 3300054114 | Bacteria | 2507 |
| 863 | Ga0501084_0128527 | 3300054114 | Bacteria | 2132 |
| 864 | Ga0500661_005416 | 3300055283 | Bacteria | 2386 |
| 865 | Ga0501082_0009187 | 3300060353 | Bacteria | 8525 |
| 866 | Ga0501082_0030869 | 3300060353 | Bacteria | 4619 |
| 867 | Ga0466962_0027328 | 3300061719 | Bacteria | 2738 |
| 868 | Ga0466962_0042936 | 3300061719 | Bacteria | 2164 |
| 869 | Ga0530510_0004136 | 3300061734 | Bacteria | 10019 |
| 870 | Ga0530510_0025249 | 3300061734 | Bacteria | 4247 |
| 871 | 2512732436 | 2512564039 | Bacteria | 8739048 |
| 872 | 2524190819 | 2524023129 | Bacteria | 6762600 |
| 873 | 2525556682 | 2524614729 | Bacteria | 3091755 |
| 874 | 2538832646 | 2537561836 | Bacteria | 3910579 |
| 875 | 2547502785 | 2547132130 | Bacteria | 4660562 |
| 876 | 2578458700 | 2576861471 | Bacteria | 4648976 |
| 877 | 2587738596 | 2585428059 | Bacteria | 8696589 |
| 878 | 2595318519 | 2593339198 | Bacteria | 7267884 |
| 879 | 2595446484 | 2593339238 | Bacteria | 4182970 |
| 880 | 2595451985 | 2593339239 | Bacteria | 4124669 |
| 881 | 2630648278 | 2627854209 | Bacteria | 3093011 |
| 882 | 2643830108 | 2643221562 | Bacteria | 4048635 |
| 883 | 2643894365 | 2643221577 | Bacteria | 3710843 |
| 884 | 2643907792 | 2643221579 | Bacteria | 4443405 |
| 885 | 2643916003 | 2643221581 | Bacteria | 3893603 |
| 886 | 2644426890 | 2643221676 | Bacteria | 8119172 |
| 887 | 2644476569 | 2643221685 | Bacteria | 3673288 |
| 888 | 2673822801 | 2671180694 | Bacteria | 7506943 |
| 889 | 2687583262 | 2687453130 | Bacteria | 4227172 |
| 890 | 2721026882 | 2718218334 | Bacteria | 4765486 |
| 891 | 2735837567 | 2734482264 | Unclassified | 5014763 |
| 892 | 2739228174 | 2738543009 | Bacteria | 4944499 |
| 893 | 2739731596 | 2739367700 | Bacteria | 4747630 |
| 894 | 2748015862 | 2747842501 | Bacteria | 5293829 |
| 895 | 2765578683 | 2765235840 | Bacteria | 4663337 |
| 896 | 2816516758 | 2816332141 | Bacteria | 4436036 |
| 897 | 2819565239 | 2818991440 | Bacteria | 4774720 |
| 898 | 2819662981 | 2818991457 | Bacteria | 5323295 |
| 899 | 2842394993 | 2842391507 | Bacteria | 4486072 |
| 900 | 2842758400 | 2842757796 | Bacteria | 3981385 |
| 901 | 2842780775 | 2842780639 | Bacteria | 4337790 |
| 902 | 2842917424 | 2842914999 | Bacteria | 4419378 |
| 903 | 2842919614 | 2842918807 | Bacteria | 4289178 |
| 904 | 2852651069 | 2852649853 | Bacteria | 4036942 |
| 905 | 2852686028 | 2852684882 | Bacteria | 5463342 |
| 906 | 2857446885 | 2857442823 | Bacteria | 4562550 |
| 907 | 2857453701 | 2857453340 | Bacteria | 8090534 |
| 908 | 2864997913 | 2864997549 | Bacteria | 5139696 |
| 909 | 2874221311 | 2874220319 | Bacteria | 4594709 |
| 910 | 2884341164 | 2884338543 | Bacteria | 4610696 |
| 911 | 2884413505 | 2884411467 | Bacteria | 5246714 |
| 912 | 2889297287 | 2889295896 | Bacteria | 4704906 |
| 913 | 2894415659 | 2894414249 | Bacteria | 4405451 |
| 914 | 2895395690 | 2895395659 | Bacteria | 3983269 |
| 915 | 2904466907 | 2904463128 | Bacteria | 4775606 |
| 916 | 2919087871 | 2919085039 | Bacteria | 4532964 |
| 917 | 2919133565 | 2919130084 | Bacteria | 5301837 |
| 918 | 2919136107 | 2919134579 | Bacteria | 4480386 |
| 919 | 2919405093 | 2919404418 | Bacteria | 4232372 |
| 920 | 2919514563 | 2919513703 | Bacteria | 3844312 |
| 921 | 2919676605 | 2919675420 | Bacteria | 3969095 |
| 922 | 2923518469 | 2923516293 | Bacteria | 3716336 |
| 923 | 2928496280 | 2928496128 | Bacteria | 4631123 |
| 924 | 2928967501 | 2928963466 | Bacteria | 5165703 |
| 925 | 2929197381 | 2929195423 | Bacteria | 5325372 |
| 926 | 2931381035 | 2931380184 | Bacteria | 4455911 |
| 927 | 2937612132 | 2937610967 | Bacteria | 4618818 |
| 928 | 2939590774 | 2939589442 | Bacteria | 4214238 |
| 929 | 2939611992 | 2939611941 | Bacteria | 3892017 |
| 930 | 2939622956 | 2939622612 | Bacteria | 4698046 |
| 931 | 2939630871 | 2939626828 | Bacteria | 4695272 |
| 932 | 2941472620 | 2941471342 | Bacteria | 5018624 |
| 933 | 2941478054 | 2941475908 | Bacteria | 4145589 |
| 934 | 2953994892 | 2953994433 | Bacteria | 4303959 |
| 935 | 2961048077 | 2961047084 | Bacteria | 4594415 |
| 936 | 2961065095 | 2961064222 | Bacteria | 4749990 |
| 937 | 2971411064 | 2971410472 | Bacteria | 8311090 |
| 938 | 2974309197 | 2974307012 | Bacteria | 4172388 |
| 939 | 2977249916 | 2977247770 | Bacteria | 4160543 |
| 940 | 2980128969 | 2980125574 | Bacteria | 5567337 |
| 941 | 2981285766 | 2981284811 | Bacteria | 4641497 |
| 942 | 2981290713 | 2981289755 | Bacteria | 4641509 |
| 943 | 2981980665 | 2981980479 | Bacteria | 4641628 |
| 944 | 2981985543 | 2981985349 | Bacteria | 4641497 |
| 945 | 2984515594 | 2984514374 | Bacteria | 4172479 |
| 946 | 8002323647 | 8002317523 | Bacteria | 8051857 |
| 947 | 8002872224 | 8002869464 | Bacteria | 3588529 |
| 948 | 8003015923 | 8003014200 | Bacteria | 4059994 |
| 949 | 8021623762 | 8021622325 | Bacteria | 4844743 |
| 950 | 8021630458 | 8021626552 | Bacteria | 4665214 |
| 951 | 8021650620 | 8021648035 | Bacteria | 4772378 |
| 952 | 8046998894 | 8046991243 | Bacteria | 8497463 |
| 953 | 8054798322 | 8054795415 | Bacteria | 9785225 |
| 954 | 8056536393 | 8056533031 | Bacteria | 8964429 |
| 955 | 8057477228 | 8057473075 | Bacteria | 5892720 |
| 956 | Ga0070689_100008741 | |||
| 957 | JGI24741J21665_1009606 | |||
| 958 | JGI24740J21852_10004853 | |||
| 959 | JGI24739J22299_10000167 | |||
| 960 | JGI25156J39149_1001689 | |||
| 961 | JGI25156J39149_1008279 | |||
| 962 | JGI25162J39368_1002522 | |||
| 963 | JGI25162J39368_1002756 | |||
| 964 | JGI25162J39368_1002946 | |||
| 965 | JGI25162J39368_1003492 | |||
| 966 | JGI25157J39369_1000760 | |||
| 967 | JGI25157J39369_1001514 | |||
| 968 | JGI25157J39369_1001601 | |||
| 969 | JGI25163J39215_1001514 | |||
| 970 | JGI25164J39214_1000049 | |||
| 971 | JGI25164J39214_1000088 | |||
| 972 | JGI25164J39214_1001313 | |||
| 973 | JGI25164J39214_1001318 | |||
| 974 | JGI25152J39213_1000102 | |||
| 975 | JGI25150J39212_1000099 | |||
| 976 | JGI25150J39212_1000290 | |||
| 977 | JGI25151J46595_10000041 | |||
| 978 | JGI25151J46595_10000269 | |||
| 979 | JGI25151J46595_10011611 | |||
| 980 | JGI25165J46597_1000009 | |||
| 981 | JGI25165J46597_1000088 | |||
| 982 | JGI25165J46597_1002376 | |||
| 983 | JGI25165J46597_1002837 | |||
| 984 | JGI25153J46596_10000189 | |||
| 985 | rootH2_10092143 | |||
| 986 | Ga0006562J51391_1029636 | |||
| 987 | Ga0006562J51391_1029638 | |||
| 988 | Ga0055525_1000146 | |||
| 989 | Ga0055527_1000328 | |||
| 990 | Ga0055527_1000605 | |||
| 991 | Ga0055535_1000082 | |||
| 992 | Ga0055535_1000745 | |||
| 993 | Ga0055535_1000756 | |||
| 994 | Ga0055535_1001284 | |||
| 995 | Ga0055542_1000765 | |||
| 996 | Ga0055542_1000774 | |||
| 997 | Ga0055542_1000856 | |||
| 998 | Ga0055542_1001065 | |||
| 999 | Ga0055542_1002159 | |||
| 1000 | Ga0055542_1002186 | |||
| 1001 | Ga0055529_1000020 | |||
| 1002 | Ga0055529_1000663 | |||
| 1003 | Ga0055529_1000666 | |||
| 1004 | Ga0055529_1000887 | |||
| 1005 | Ga0055526_1006635 | |||
| 1006 | Ga0055537_1000407 | |||
| 1007 | Ga0055524_1017968 | |||
| 1008 | Ga0055536_1005286 | |||
| 1009 | Ga0055536_1005928 | |||
| 1010 | Ga0055536_1006000 | |||
| 1011 | Ga0055536_1019665 | |||
| 1012 | Ga0055534_1000039 | |||
| 1013 | Ga0055528_1000529 | |||
| 1014 | Ga0055530_10002892 | |||
| 1015 | Ga0055530_10005063 | |||
| 1016 | Ga0055530_10008054 | |||
| 1017 | Ga0055531_10006146 | |||
| 1018 | Ga0055531_10007661 | |||
| 1019 | Ga0055531_10007781 | |||
| 1020 | Ga0055531_10011589 | |||
| 1021 | Ga0058692_1000018 | |||
| 1022 | Ga0065165_1003051 | |||
| 1023 | Ga0065704_10002333 | |||
| 1024 | Ga0065704_10072174 | |||
| 1025 | Ga0065715_10093484 | |||
| 1026 | Ga0065715_10110437 | |||
| 1027 | Ga0070658_10012294 | |||
| 1028 | Ga0070670_100007924 | |||
| 1029 | Ga0070666_10000003 | |||
| 1030 | Ga0070666_10000757 | |||
| 1031 | Ga0070666_10009654 | |||
| 1032 | Ga0070680_100008297 | |||
| 1033 | Ga0070680_100073618 | |||
| 1034 | Ga0070682_100002136 | |||
| 1035 | Ga0070682_100008145 | |||
| 1036 | Ga0068868_100007207 | |||
| 1037 | Ga0068868_100027499 | |||
| 1038 | Ga0068868_100032309 | |||
| 1039 | Ga0070660_100011933 | |||
| 1040 | Ga0070660_100025556 | |||
| 1041 | Ga0070660_100051136 | |||
| 1042 | Ga0070691_10000561 | |||
| 1043 | Ga0070661_100001862 | |||
| 1044 | Ga0070661_100033926 | |||
| 1045 | Ga0070661_100104718 | |||
| 1046 | Ga0070692_10000139 | |||
| 1047 | Ga0070692_10001873 | |||
| 1048 | Ga0070669_100016268 | |||
| 1049 | Ga0070669_100079690 | |||
| 1050 | Ga0070675_100013380 | |||
| 1051 | Ga0070659_100007436 | |||
| 1052 | Ga0070667_100000084 | |||
| 1053 | Ga0070667_100009456 | |||
| 1054 | Ga0070667_100149360 | |||
| 1055 | Ga0070714_100000372 | |||
| 1056 | Ga0070714_100000713 | |||
| 1057 | Ga0070714_100013529 | |||
| 1058 | Ga0070714_100021754 | |||
| 1059 | Ga0070714_100022773 | |||
| 1060 | Ga0070694_100032508 | |||
| 1061 | Ga0070663_100041672 | |||
| 1062 | Ga0070663_100069432 | |||
| 1063 | Ga0070678_100003696 | |||
| 1064 | Ga0070681_10009408 | |||
| 1065 | Ga0070681_10017636 | |||
| 1066 | Ga0070681_10025596 | |||
| 1067 | Ga0068867_100071691 | |||
| 1068 | Ga0070685_10004666 | |||
| 1069 | Ga0070698_100064803 | |||
| 1070 | Ga0070679_100016456 | |||
| 1071 | Ga0070679_100081626 | |||
| 1072 | Ga0070679_100106460 | |||
| 1073 | Ga0070679_100127285 | |||
| 1074 | Ga0070684_100033959 | |||
| 1075 | Ga0068853_100002068 | |||
| 1076 | Ga0068853_100004423 | |||
| 1077 | Ga0068853_100012109 | |||
| 1078 | Ga0068853_100139593 | |||
| 1079 | Ga0070672_100009562 | |||
| 1080 | Ga0070696_100000851 | |||
| 1081 | Ga0070696_100001442 | |||
| 1082 | Ga0070696_100011770 | |||
| 1083 | Ga0070693_100004059 | |||
| 1084 | Ga0070665_100013099 | |||
| 1085 | Ga0070665_100023453 | |||
| 1086 | Ga0070665_100037857 | |||
| 1087 | Ga0068855_100020753 | |||
| 1088 | Ga0068855_100031696 | |||
| 1089 | Ga0068855_100108259 | |||
| 1090 | Ga0068855_100171159 | |||
| 1091 | Ga0068857_100004292 | |||
| 1092 | Ga0068857_100020788 | |||
| 1093 | Ga0068854_100003470 | |||
| 1094 | Ga0068854_100007127 | |||
| 1095 | Ga0068854_100010098 | |||
| 1096 | Ga0068856_100000983 | |||
| 1097 | Ga0068856_100052772 | |||
| 1098 | Ga0068852_100021578 | |||
| 1099 | Ga0068852_100057982 | |||
| 1100 | Ga0068859_100021151 | |||
| 1101 | Ga0068859_100061891 | |||
| 1102 | Ga0068859_100186169 | |||
| 1103 | Ga0068864_100030923 | |||
| 1104 | Ga0068864_100128090 | |||
| 1105 | Ga0068851_10004998 | |||
| 1106 | Ga0068870_10009151 | |||
| 1107 | Ga0068863_100013560 | |||
| 1108 | Ga0068863_100127670 | |||
| 1109 | Ga0068860_100009881 | |||
| 1110 | Ga0068860_100105026 | |||
| 1111 | Ga0068862_100064307 | |||
| 1112 | Ga0075364_10001000 | |||
| 1113 | Ga0097621_100019126 | |||
| 1114 | Ga0068871_100012103 | |||
| 1115 | Ga0075428_100009101 | |||
| 1116 | Ga0075428_100057180 | |||
| 1117 | Ga0075433_10005362 | |||
| 1118 | Ga0075434_100000572 | |||
| 1119 | Ga0075434_100071461 | |||
| 1120 | Ga0068865_100042758 | |||
| 1121 | Ga0097620_100021151 | |||
| 1122 | Ga0097620_100061888 | |||
| 1123 | Ga0097620_100186173 | |||
| 1124 | Ga0075435_100063636 | |||
| 1125 | Ga0105251_10000880 | |||
| 1126 | Ga0105251_10009176 | |||
| 1127 | Ga0105240_10012346 | |||
| 1128 | Ga0105240_10035843 | |||
| 1129 | Ga0105240_10043064 | |||
| 1130 | Ga0105240_10049909 | |||
| 1131 | Ga0105240_10063542 | |||
| 1132 | Ga0105240_10084533 | |||
| 1133 | Ga0105240_10097448 | |||
| 1134 | Ga0111539_10006755 | |||
| 1135 | Ga0105245_10003428 | |||
| 1136 | Ga0105245_10116590 | |||
| 1137 | Ga0105247_10010854 | |||
| 1138 | Ga0105243_10021826 | |||
| 1139 | Ga0105241_10042237 | |||
| 1140 | Ga0105241_10076264 | |||
| 1141 | Ga0105242_10001298 | |||
| 1142 | Ga0105242_10044328 | |||
| 1143 | Ga0105248_10000429 | |||
| 1144 | Ga0105248_10005167 | |||
| 1145 | Ga0105248_10054583 | |||
| 1146 | Ga0105237_10000016 | |||
| 1147 | Ga0105237_10000388 | |||
| 1148 | Ga0105238_10000362 | |||
| 1149 | Ga0105238_10002989 | |||
| 1150 | Ga0105238_10024524 | |||
| 1151 | Ga0105238_10032850 | |||
| 1152 | Ga0105238_10072023 | |||
| 1153 | Ga0105238_10097547 | |||
| 1154 | Ga0105249_10009937 | |||
| 1155 | Ga0105030_100130 | |||
| 1156 | Ga0105239_10000063 | |||
| 1157 | Ga0105239_10007002 | |||
| 1158 | Ga0105239_10012123 | |||
| 1159 | Ga0105239_10013284 | |||
| 1160 | Ga0105239_10038848 | |||
| 1161 | Ga0105239_10069647 | |||
| 1162 | Ga0157373_10005152 | |||
| 1163 | Ga0157373_10022169 | |||
| 1164 | Ga0157371_10000487 | |||
| 1165 | Ga0157371_10002814 | |||
| 1166 | Ga0157371_10010486 | |||
| 1167 | Ga0157371_10028762 | |||
| 1168 | Ga0157370_10010813 | |||
| 1169 | Ga0157370_10013028 | |||
| 1170 | Ga0157370_10014321 | |||
| 1171 | Ga0157370_10025566 | |||
| 1172 | Ga0157369_10000027 | |||
| 1173 | Ga0157369_10002364 | |||
| 1174 | Ga0157369_10016391 | |||
| 1175 | Ga0157369_10042658 | |||
| 1176 | Ga0157374_10080245 | |||
| 1177 | Ga0157378_10000006 | |||
| 1178 | Ga0157378_10026393 | |||
| 1179 | Ga0163162_10000357 | |||
| 1180 | Ga0163162_10002734 | |||
| 1181 | Ga0163162_10031567 | |||
| 1182 | Ga0157372_10003304 | |||
| 1183 | Ga0157372_10027342 | |||
| 1184 | Ga0157372_10036984 | |||
| 1185 | Ga0157372_10053894 | |||
| 1186 | Ga0157372_10121842 | |||
| 1187 | Ga0157375_10000102 | |||
| 1188 | Ga0157375_10004302 | |||
| 1189 | Ga0157375_10055469 | |||
| 1190 | Ga0157375_10287370 | |||
| 1191 | Ga0163163_10000877 | |||
| 1192 | Ga0163163_10023588 | |||
| 1193 | Ga0182008_10000143 | |||
| 1194 | Ga0182008_10007235 | |||
| 1195 | Ga0182008_10018312 | |||
| 1196 | Ga0182008_10026014 | |||
| 1197 | Ga0157379_10000992 | |||
| 1198 | Ga0157379_10001842 | |||
| 1199 | Ga0157376_10003668 | |||
| 1200 | Ga0157376_10008252 | |||
| 1201 | Ga0157376_10206001 | |||
| 1202 | Ga0182006_1000074 | |||
| 1203 | Ga0182006_1001229 | |||
| 1204 | Ga0182006_1018348 | |||
| 1205 | Ga0182007_10000043 | |||
| 1206 | Ga0182007_10004954 | |||
| 1207 | Ga0182005_1000267 | |||
| 1208 | Ga0182005_1000326 | |||
| 1209 | Ga0182005_1001110 | |||
| 1210 | Ga0182005_1002979 | |||
| 1211 | Ga0183369_1006 | |||
| 1212 | Ga0183368_1004 | |||
| 1213 | Ga0163161_10007748 | |||
| 1214 | Ga0197907_10862894 | |||
| 1215 | Ga0197907_11474155 | |||
| 1216 | Ga0206356_10168839 | |||
| 1217 | Ga0206351_10908139 | |||
| 1218 | Ga0206353_10073144 | |||
| 1219 | Ga0209784_100013 | |||
| 1220 | Ga0209566_100544 | |||
| 1221 | Ga0209674_100026 | |||
| 1222 | Ga0209674_100062 | |||
| 1223 | Ga0209674_100974 | |||
| 1224 | Ga0209672_100007 | |||
| 1225 | Ga0209672_100017 | |||
| 1226 | Ga0209672_100743 | |||
| 1227 | Ga0209672_100839 | |||
| 1228 | Ga0209672_102291 | |||
| 1229 | Ga0209563_100131 | |||
| 1230 | Ga0207427_100021 | |||
| 1231 | Ga0207427_100073 | |||
| 1232 | Ga0207427_100289 | |||
| 1233 | Ga0207427_100306 | |||
| 1234 | Ga0209437_100012 | |||
| 1235 | Ga0209437_100039 | |||
| 1236 | Ga0209437_100087 | |||
| 1237 | Ga0209437_100129 | |||
| 1238 | Ga0209437_100159 | |||
| 1239 | Ga0209437_100637 | |||
| 1240 | Ga0209258_100017 | |||
| 1241 | Ga0209258_100019 | |||
| 1242 | Ga0209258_100206 | |||
| 1243 | Ga0209258_100213 | |||
| 1244 | Ga0209258_100594 | |||
| 1245 | Ga0209258_102146 | |||
| 1246 | Ga0207425_1000092 | |||
| 1247 | Ga0209646_1001828 | |||
| 1248 | Ga0209026_1000051 | |||
| 1249 | Ga0209026_1000079 | |||
| 1250 | Ga0209026_1000125 | |||
| 1251 | Ga0209026_1000592 | |||
| 1252 | Ga0209026_1002773 | |||
| 1253 | Ga0209677_100969 | |||
| 1254 | Ga0209148_1000001 | |||
| 1255 | Ga0209148_1000005 | |||
| 1256 | Ga0209148_1000009 | |||
| 1257 | Ga0209148_1000044 | |||
| 1258 | Ga0209148_1000176 | |||
| 1259 | Ga0209148_1000185 | |||
| 1260 | Ga0209759_1000145 | |||
| 1261 | Ga0209759_1000328 | |||
| 1262 | Ga0209759_1002334 | |||
| 1263 | Ga0209759_1005371 | |||
| 1264 | Ga0209129_1000151 | |||
| 1265 | Ga0209129_1003459 | |||
| 1266 | Ga0209129_1007561 | |||
| 1267 | Ga0209233_1000002 | |||
| 1268 | Ga0209233_1000020 | |||
| 1269 | Ga0209233_1000023 | |||
| 1270 | Ga0209233_1000090 | |||
| 1271 | Ga0209565_1000014 | |||
| 1272 | Ga0209455_1000010 | |||
| 1273 | Ga0209455_1000027 | |||
| 1274 | Ga0209455_1000032 | |||
| 1275 | Ga0209455_1000081 | |||
| 1276 | Ga0209673_1000171 | |||
| 1277 | Ga0209130_1012874 | |||
| 1278 | Ga0209675_1000011 | |||
| 1279 | Ga0209675_1016461 | |||
| 1280 | Ga0209676_1000079 | |||
| 1281 | Ga0209676_1000086 | |||
| 1282 | Ga0209676_1000092 | |||
| 1283 | Ga0209676_1002465 | |||
| 1284 | Ga0209676_1003076 | |||
| 1285 | Ga0209676_1003077 | |||
| 1286 | Ga0209676_1006826 | |||
| 1287 | Ga0209025_1000012 | |||
| 1288 | Ga0209025_1000015 | |||
| 1289 | Ga0209025_1002444 | |||
| 1290 | Ga0209025_1008928 | |||
| 1291 | Ga0209564_1000221 | |||
| 1292 | Ga0209758_1000018 | |||
| 1293 | Ga0209758_1005446 | |||
| 1294 | Ga0209758_1008116 | |||
| 1295 | Ga0209758_1015576 | |||
| 1296 | Ga0209758_1016918 | |||
| 1297 | Ga0209050_1000329 | |||
| 1298 | Ga0209050_1000415 | |||
| 1299 | Ga0209050_1000528 | |||
| 1300 | Ga0209050_1004837 | |||
| 1301 | Ga0209050_1005515 | |||
| 1302 | Ga0209256_1004521 | |||
| 1303 | Ga0209256_1018718 | |||
| 1304 | Ga0209051_1002764 | |||
| 1305 | Ga0209051_1007093 | |||
| 1306 | Ga0209051_1032538 | |||
| 1307 | Ga0209257_1000080 | |||
| 1308 | Ga0209257_1000081 | |||
| 1309 | Ga0209257_1000121 | |||
| 1310 | Ga0209257_1000145 | |||
| 1311 | Ga0209257_1002505 | |||
| 1312 | Ga0209257_1004877 | |||
| 1313 | Ga0209257_1005274 | |||
| 1314 | Ga0209257_1015664 | |||
| 1315 | Ga0207656_10001780 | |||
| 1316 | Ga0207713_1000710 | |||
| 1317 | Ga0207713_1009080 | |||
| 1318 | Ga0207710_10034415 | |||
| 1319 | Ga0207680_10000006 | |||
| 1320 | Ga0207680_10020353 | |||
| 1321 | Ga0207647_10000607 | |||
| 1322 | Ga0207647_10001539 | |||
| 1323 | Ga0207647_10002712 | |||
| 1324 | Ga0207647_10012222 | |||
| 1325 | Ga0207647_10024280 | |||
| 1326 | Ga0207645_10013275 | |||
| 1327 | Ga0207705_10000165 | |||
| 1328 | Ga0207705_10000353 | |||
| 1329 | Ga0207705_10000355 | |||
| 1330 | Ga0207705_10001403 | |||
| 1331 | Ga0207705_10008340 | |||
| 1332 | Ga0207707_10000391 | |||
| 1333 | Ga0207707_10001033 | |||
| 1334 | Ga0207707_10001308 | |||
| 1335 | Ga0207707_10010325 | |||
| 1336 | Ga0207707_10011013 | |||
| 1337 | Ga0207707_10012035 | |||
| 1338 | Ga0207707_10017065 | |||
| 1339 | Ga0207707_10046729 | |||
| 1340 | Ga0207707_10051686 | |||
| 1341 | Ga0207695_10000975 | |||
| 1342 | Ga0207695_10006463 | |||
| 1343 | Ga0207695_10007085 | |||
| 1344 | Ga0207695_10009557 | |||
| 1345 | Ga0207695_10011615 | |||
| 1346 | Ga0207695_10012347 | |||
| 1347 | Ga0207695_10031715 | |||
| 1348 | Ga0207695_10046563 | |||
| 1349 | Ga0207695_10087165 | |||
| 1350 | Ga0207671_10000137 | |||
| 1351 | Ga0207671_10003811 | |||
| 1352 | Ga0207671_10004200 | |||
| 1353 | Ga0207660_10000931 | |||
| 1354 | Ga0207660_10001391 | |||
| 1355 | Ga0207660_10003395 | |||
| 1356 | Ga0207660_10005061 | |||
| 1357 | Ga0207657_10010252 | |||
| 1358 | Ga0207657_10017203 | |||
| 1359 | Ga0207649_10005594 | |||
| 1360 | Ga0207649_10031454 | |||
| 1361 | Ga0207649_10089027 | |||
| 1362 | Ga0207652_10000030 | |||
| 1363 | Ga0207652_10001197 | |||
| 1364 | Ga0207652_10041489 | |||
| 1365 | Ga0207681_10004705 | |||
| 1366 | Ga0207694_10000563 | |||
| 1367 | Ga0207694_10004402 | |||
| 1368 | Ga0207694_10012219 | |||
| 1369 | Ga0207694_10012898 | |||
| 1370 | Ga0207694_10041831 | |||
| 1371 | Ga0207650_10044596 | |||
| 1372 | Ga0207700_10000822 | |||
| 1373 | Ga0207664_10000474 | |||
| 1374 | Ga0207664_10000584 | |||
| 1375 | Ga0207664_10000585 | |||
| 1376 | Ga0207644_10000313 | |||
| 1377 | Ga0207644_10060403 | |||
| 1378 | Ga0207690_10000443 | |||
| 1379 | Ga0207690_10001772 | |||
| 1380 | Ga0207690_10001851 | |||
| 1381 | Ga0207690_10001946 | |||
| 1382 | Ga0207690_10007510 | |||
| 1383 | Ga0207690_10008552 | |||
| 1384 | Ga0207690_10009506 | |||
| 1385 | Ga0207706_10029417 | |||
| 1386 | Ga0207709_10018744 | |||
| 1387 | Ga0207670_10005060 | |||
| 1388 | Ga0207704_10001296 | |||
| 1389 | Ga0207691_10007639 | |||
| 1390 | Ga0207711_10001015 | |||
| 1391 | Ga0207711_10004854 | |||
| 1392 | Ga0207711_10061557 | |||
| 1393 | Ga0207661_10004417 | |||
| 1394 | Ga0207667_10000250 | |||
| 1395 | Ga0207667_10000679 | |||
| 1396 | Ga0207667_10001003 | |||
| 1397 | Ga0207667_10001167 | |||
| 1398 | Ga0207667_10005715 | |||
| 1399 | Ga0207667_10016516 | |||
| 1400 | Ga0207712_10000343 | |||
| 1401 | Ga0207640_10001071 | |||
| 1402 | Ga0207640_10003830 | |||
| 1403 | Ga0207640_10005529 | |||
| 1404 | Ga0207658_10000093 | |||
| 1405 | Ga0207677_10094535 | |||
| 1406 | Ga0207639_10001634 | |||
| 1407 | Ga0207639_10002124 | |||
| 1408 | Ga0207639_10005666 | |||
| 1409 | Ga0207639_10007609 | |||
| 1410 | Ga0207678_10000433 | |||
| 1411 | Ga0207678_10005962 | |||
| 1412 | Ga0207678_10050893 | |||
| 1413 | Ga0207678_10080157 | |||
| 1414 | Ga0207702_10000943 | |||
| 1415 | Ga0207702_10003531 | |||
| 1416 | Ga0207702_10140169 | |||
| 1417 | Ga0207648_10029340 | |||
| 1418 | Ga0207674_10007214 | |||
| 1419 | Ga0207674_10019944 | |||
| 1420 | Ga0207674_10024820 | |||
| 1421 | Ga0207674_10065193 | |||
| 1422 | Ga0207674_10066528 | |||
| 1423 | Ga0207683_10025237 | |||
| 1424 | Ga0207698_10000592 | |||
| 1425 | Ga0207698_10002980 | |||
| 1426 | Ga0207698_10038811 | |||
| 1427 | Ga0209371_1000011 | |||
| 1428 | Ga0268266_10000043 | |||
| 1429 | Ga0268266_10045565 | |||
| 1430 | Ga0268265_10094964 | |||
| 1431 | Ga0268264_10022370 | |||
| 1432 | Ga0268264_10069503 | |||
| 1433 | Ga0265334_10000009 | |||
| 1434 | Ga0265338_10009730 | |||
| 1435 | Ga0268256_1000011 | |||
| 1436 | Ga0316177_1203723 | |||
| 1437 | Ga0307513_10053920 | |||
| 1438 | Ga0307408_100046420 | |||
| 1439 | Ga0265313_10007989 | |||
| 1440 | Ga0316575_10011930 | |||
| 1441 | Ga0316575_10040661 | |||
| 1442 | Ga0316578_10016352 | |||
| 1443 | Ga0307516_10001401 | |||
| 1444 | Ga0307516_10018328 | |||
| 1445 | Ga0307516_10035332 | |||
| 1446 | Ga0307405_10003809 | |||
| 1447 | Ga0316577_10009829 | |||
| 1448 | Ga0307413_10001746 | |||
| 1449 | Ga0307410_10005487 | |||
| 1450 | Ga0307407_10013528 | |||
| 1451 | Ga0307412_10006145 | |||
| 1452 | Ga0307409_100126975 | |||
| 1453 | Ga0307416_100000500 | |||
| 1454 | Ga0307414_10003986 | |||
| 1455 | Ga0307414_10017858 | |||
| 1456 | Ga0307411_10017445 | |||
| 1457 | Ga0307415_100014074 | |||
| 1458 | Ga0316583_10000626 | |||
| 1459 | Ga0316585_10000572 | |||
| 1460 | Ga0316580_10003247 | |||
| 1461 | Ga0307510_10001938 | |||
| 1462 | Ga0316574_0002354 | |||
| 1463 | Ga0316574_0008582 | |||
| 1464 | Ga0316574_0009969 | |||
| 1465 | Ga0373927_0000003 | |||
| 1466 | Ga0316582_0002212 | |||
| 1467 | Ga0316584_0002179 | |||
| 1468 | Ga0316584_0042445 | |||
| 1469 | Ga0395899_0000142 | |||
| 1470 | Ga0395899_0009818 | |||
| 1471 | Ga0395899_0016093 | |||
| 1472 | Ga0395899_0022754 | |||
| 1473 | Ga0395899_0053918 | |||
| 1474 | Ga0395899_0134478 | |||
| 1475 | Ga0395900_0000069 | |||
| 1476 | Ga0395900_0002387 | |||
| 1477 | Ga0395900_0010793 | |||
| 1478 | Ga0395900_0031124 | |||
| 1479 | Ga0395900_0082649 | |||
| 1480 | Ga0395898_0000097 | |||
| 1481 | Ga0395898_0001079 | |||
| 1482 | Ga0395898_0015073 | |||
| 1483 | Ga0395898_0025910 | |||
| 1484 | Ga0395901_0000983 | |||
| 1485 | Ga0395901_0002935 | |||
| 1486 | Ga0395901_0010713 | |||
| 1487 | Ga0395901_0149263 | |||
| 1488 | Ga0237819_00127 | |||
| 1489 | Ga0439436_0000010 | |||
| 1490 | Ga0439436_0006040 | |||
| 1491 | Ga0439465_0000123 | |||
| 1492 | Ga0439465_0003861 | |||
| 1493 | Ga0439465_0018945 | |||
| 1494 | Ga0451791_0612411 | |||
| 1495 | Ga0439433_0012744 | |||
| 1496 | Ga0439432_007320 | |||
| 1497 | Ga0439432_019438 | |||
| 1498 | Ga0439449_0000905 | |||
| 1499 | Ga0450908_000564 | |||
| 1500 | Ga0450908_000860 | |||
| 1501 | Ga0451577_0009927 | |||
| 1502 | Ga0466969_0002807 | |||
| 1503 | Ga0466969_0003343 | |||
| 1504 | Ga0466969_0004136 | |||
| 1505 | Ga0466969_0017661 | |||
| 1506 | Ga0466972_0016098 | |||
| 1507 | Ga0466989_0020182 | |||
| 1508 | Ga0466982_0000019 | |||
| 1509 | Ga0466982_0000098 | |||
| 1510 | Ga0453683_0008814 | |||
| 1511 | Ga0466965_0019349 | |||
| 1512 | Ga0466966_0020730 | |||
| 1513 | Ga0466961_0007963 | |||
| 1514 | Ga0466961_0013744 | |||
| 1515 | Ga0466961_0075758 | |||
| 1516 | Ga0466961_0091704 | |||
| 1517 | Ga0466964_0015082 | |||
| 1518 | Ga0466971_0016812 | |||
| 1519 | Ga0466968_0004448 | |||
| 1520 | Ga0466968_0030742 | |||
| 1521 | Ga0466970_0001674 | |||
| 1522 | Ga0466970_0009926 | |||
| 1523 | Ga0466970_0057341 | |||
| 1524 | Ga0466960_0031658 | |||
| 1525 | Ga0466959_0024013 | |||
| 1526 | Ga0466959_0053115 | |||
| 1527 | Ga0451576_0000821 | |||
| 1528 | Ga0451576_0072609 | |||
| 1529 | Ga0466967_0041735 | |||
| 1530 | Ga0495617_003046 | |||
| 1531 | Ga0495617_003503 | |||
| 1532 | Ga0495627_006082 | |||
| 1533 | Ga0495638_0000069 | |||
| 1534 | Ga0495638_0000122 | |||
| 1535 | Ga0495638_0001156 | |||
| 1536 | Ga0495638_0001504 | |||
| 1537 | Ga0495638_0005088 | |||
| 1538 | Ga0495650_0000209 | |||
| 1539 | Ga0495650_0003763 | |||
| 1540 | Ga0495605_0023124 | |||
| 1541 | Ga0495585_0000423 | |||
| 1542 | Ga0495585_0010514 | |||
| 1543 | Ga0495607_0000080 | |||
| 1544 | Ga0495607_0008882 | |||
| 1545 | Ga0495607_0021638 | |||
| 1546 | Ga0495607_0077432 | |||
| 1547 | Ga0495606_0000203 | |||
| 1548 | Ga0495606_0000348 | |||
| 1549 | Ga0495606_0016437 | |||
| 1550 | Ga0495610_0004716 | |||
| 1551 | Ga0495610_0043035 | |||
| 1552 | Ga0495616_0000067 | |||
| 1553 | Ga0495616_0025426 | |||
| 1554 | Ga0495620_0003391 | |||
| 1555 | Ga0495631_0003301 | |||
| 1556 | Ga0495631_0004603 | |||
| 1557 | Ga0495632_0000046 | |||
| 1558 | Ga0495637_0014700 | |||
| 1559 | Ga0495643_0001740 | |||
| 1560 | Ga0495648_0018232 | |||
| 1561 | Ga0495663_0000872 | |||
| 1562 | Ga0495663_0001432 | |||
| 1563 | Ga0495621_0003739 | |||
| 1564 | Ga0495633_0013730 | |||
| 1565 | Ga0495633_0022068 | |||
| 1566 | Ga0495668_0000804 | |||
| 1567 | Ga0495611_0000001 | |||
| 1568 | Ga0495625_0000001 | |||
| 1569 | Ga0495625_0024027 | |||
| 1570 | Ga0495625_0044660 | |||
| 1571 | Ga0495661_0004547 | |||
| 1572 | Ga0495647_0021574 | |||
| 1573 | Ga0495670_0009454 | |||
| 1574 | Ga0495671_0000875 | |||
| 1575 | Ga0495649_0012109 | |||
| 1576 | Ga0495649_0015980 | |||
| 1577 | Ga0495589_0000138 | |||
| 1578 | Ga0495660_0004009 | |||
| 1579 | Ga0495672_0000373 | |||
| 1580 | Ga0495679_000029 | |||
| 1581 | Ga0495673_0000001 | |||
| 1582 | Ga0495673_0014223 | |||
| 1583 | Ga0495686_0000043 | |||
| 1584 | Ga0495686_0085291 | |||
| 1585 | Ga0496101_0016866 | |||
| 1586 | Ga0496104_0000022 | |||
| 1587 | Ga0496104_0012882 | |||
| 1588 | Ga0496105_0000012 | |||
| 1589 | Ga0496105_0006290 | |||
| 1590 | Ga0496105_0018943 | |||
| 1591 | Ga0496105_0090311 | |||
| 1592 | Ga0496106_0009989 | |||
| 1593 | Ga0496106_0014736 | |||
| 1594 | Ga0496108_0030769 | |||
| 1595 | Ga0496109_0200161 | |||
| 1596 | Ga0496110_0005613 | |||
| 1597 | Ga0496110_0035169 | |||
| 1598 | Ga0496113_0067201 | |||
| 1599 | Ga0496114_0001917 | |||
| 1600 | Ga0496114_0046500 | |||
| 1601 | Ga0496115_0000163 | |||
| 1602 | Ga0496115_0000181 | |||
| 1603 | Ga0496115_0013485 | |||
| 1604 | Ga0496115_0020279 | |||
| 1605 | Ga0496115_0038116 | |||
| 1606 | Ga0496115_0071919 | |||
| 1607 | Ga0496116_0000005 | |||
| 1608 | Ga0496116_0017392 | |||
| 1609 | Ga0496117_0005762 | |||
| 1610 | Ga0496117_0009952 | |||
| 1611 | Ga0496117_0013593 | |||
| 1612 | Ga0496117_0015798 | |||
| 1613 | Ga0496117_0020923 | |||
| 1614 | Ga0496117_0024725 | |||
| 1615 | Ga0496117_0028315 | |||
| 1616 | Ga0496117_0057321 | |||
| 1617 | Ga0496118_0000528 | |||
| 1618 | Ga0496118_0000848 | |||
| 1619 | Ga0496118_0004154 | |||
| 1620 | Ga0496118_0005474 | |||
| 1621 | Ga0496118_0016346 | |||
| 1622 | Ga0496118_0017635 | |||
| 1623 | Ga0496118_0025548 | |||
| 1624 | Ga0496118_0029280 | |||
| 1625 | Ga0496118_0031026 | |||
| 1626 | Ga0496119_0000184 | |||
| 1627 | Ga0496119_0000659 | |||
| 1628 | Ga0496119_0001426 | |||
| 1629 | Ga0496119_0021762 | |||
| 1630 | Ga0496120_0000217 | |||
| 1631 | Ga0496120_0000307 | |||
| 1632 | Ga0496120_0001091 | |||
| 1633 | Ga0496120_0004293 | |||
| 1634 | Ga0496121_0000029 | |||
| 1635 | Ga0496121_0000045 | |||
| 1636 | Ga0496121_0004159 | |||
| 1637 | Ga0496121_0009184 | |||
| 1638 | Ga0496121_0009283 | |||
| 1639 | Ga0496121_0017494 | |||
| 1640 | Ga0496121_0029782 | |||
| 1641 | Ga0496121_0037992 | |||
| 1642 | Ga0496121_0040589 | |||
| 1643 | Ga0496122_0000267 | |||
| 1644 | Ga0496122_0001038 | |||
| 1645 | Ga0496122_0001998 | |||
| 1646 | Ga0496122_0005854 | |||
| 1647 | Ga0496122_0016541 | |||
| 1648 | Ga0496122_0019191 | |||
| 1649 | Ga0496122_0019274 | |||
| 1650 | Ga0496122_0030232 | |||
| 1651 | Ga0496123_0000161 | |||
| 1652 | Ga0496123_0000848 | |||
| 1653 | Ga0496123_0001899 | |||
| 1654 | Ga0496123_0015448 | |||
| 1655 | Ga0496123_0024797 | |||
| 1656 | Ga0496123_0026628 | |||
| 1657 | Ga0496123_0031037 | |||
| 1658 | Ga0496124_0000009 | |||
| 1659 | Ga0496124_0000734 | |||
| 1660 | Ga0496124_0001490 | |||
| 1661 | Ga0496124_0004066 | |||
| 1662 | Ga0496124_0025689 | |||
| 1663 | Ga0496124_0042962 | |||
| 1664 | Ga0496125_0000149 | |||
| 1665 | Ga0496125_0010887 | |||
| 1666 | Ga0496125_0031770 | |||
| 1667 | Ga0496125_0031902 | |||
| 1668 | Ga0496125_0036240 | |||
| 1669 | Ga0496125_0041611 | |||
| 1670 | Ga0496126_0002149 | |||
| 1671 | Ga0496126_0003384 | |||
| 1672 | Ga0496126_0004290 | |||
| 1673 | Ga0496126_0013547 | |||
| 1674 | Ga0496126_0020995 | |||
| 1675 | Ga0496126_0060008 | |||
| 1676 | Ga0496126_0060980 | |||
| 1677 | Ga0496126_0120754 | |||
| 1678 | Ga0495678_000718 | |||
| 1679 | Ga0501031_0013662 | |||
| 1680 | Ga0501031_0059928 | |||
| 1681 | Ga0501032_0027853 | |||
| 1682 | Ga0501032_0037308 | |||
| 1683 | Ga0501033_0000747 | |||
| 1684 | Ga0501033_0001508 | |||
| 1685 | Ga0501033_0005847 | |||
| 1686 | Ga0501033_0015113 | |||
| 1687 | Ga0501033_0032897 | |||
| 1688 | Ga0501033_0062985 | |||
| 1689 | Ga0501034_0000344 | |||
| 1690 | Ga0501034_0000355 | |||
| 1691 | Ga0501034_0012809 | |||
| 1692 | Ga0501034_0032668 | |||
| 1693 | Ga0501034_0055878 | |||
| 1694 | Ga0501036_0011935 | |||
| 1695 | Ga0501036_0035985 | |||
| 1696 | Ga0501036_0042201 | |||
| 1697 | Ga0501037_0005211 | |||
| 1698 | Ga0501037_0006927 | |||
| 1699 | Ga0501037_0012184 | |||
| 1700 | Ga0501037_0029467 | |||
| 1701 | Ga0501037_0033049 | |||
| 1702 | Ga0501038_0025329 | |||
| 1703 | Ga0501038_0026037 | |||
| 1704 | Ga0501038_0079480 | |||
| 1705 | Ga0501039_0007584 | |||
| 1706 | Ga0501039_0127614 | |||
| 1707 | Ga0501040_0001093 | |||
| 1708 | Ga0501040_0008567 | |||
| 1709 | Ga0501040_0009299 | |||
| 1710 | Ga0501040_0009725 | |||
| 1711 | Ga0501040_0012191 | |||
| 1712 | Ga0501041_0037583 | |||
| 1713 | Ga0501042_0004185 | |||
| 1714 | Ga0501042_0004613 | |||
| 1715 | Ga0501042_0007705 | |||
| 1716 | Ga0501042_0043650 | |||
| 1717 | Ga0501043_0002540 | |||
| 1718 | Ga0501043_0019418 | |||
| 1719 | Ga0501043_0041262 | |||
| 1720 | Ga0501046_0002537 | |||
| 1721 | Ga0501046_0012062 | |||
| 1722 | Ga0501046_0022811 | |||
| 1723 | Ga0501047_0004475 | |||
| 1724 | Ga0501047_0010659 | |||
| 1725 | Ga0501047_0015450 | |||
| 1726 | Ga0501047_0069784 | |||
| 1727 | Ga0501047_0076899 | |||
| 1728 | Ga0501047_0141866 | |||
| 1729 | Ga0501048_0013116 | |||
| 1730 | Ga0501048_0018366 | |||
| 1731 | Ga0501048_0020049 | |||
| 1732 | Ga0501048_0055113 | |||
| 1733 | Ga0501048_0069922 | |||
| 1734 | Ga0501068_0024287 | |||
| 1735 | Ga0501068_0030043 | |||
| 1736 | Ga0501069_0001683 | |||
| 1737 | Ga0501069_0023366 | |||
| 1738 | Ga0501070_0001120 | |||
| 1739 | Ga0501070_0011003 | |||
| 1740 | Ga0501070_0013738 | |||
| 1741 | Ga0501070_0018995 | |||
| 1742 | Ga0501070_0023611 | |||
| 1743 | Ga0501070_0075225 | |||
| 1744 | Ga0501071_0008278 | |||
| 1745 | Ga0501071_0033521 | |||
| 1746 | Ga0501071_0046255 | |||
| 1747 | Ga0501072_0004152 | |||
| 1748 | Ga0501072_0008841 | |||
| 1749 | Ga0501072_0019046 | |||
| 1750 | Ga0501072_0027365 | |||
| 1751 | Ga0501073_0003721 | |||
| 1752 | Ga0501073_0005507 | |||
| 1753 | Ga0501073_0010681 | |||
| 1754 | Ga0501073_0012681 | |||
| 1755 | Ga0501073_0069917 | |||
| 1756 | Ga0501073_0107067 | |||
| 1757 | Ga0501074_0004079 | |||
| 1758 | Ga0501074_0024713 | |||
| 1759 | Ga0501074_0037632 | |||
| 1760 | Ga0501075_0065660 | |||
| 1761 | Ga0501076_0002535 | |||
| 1762 | Ga0501076_0004710 | |||
| 1763 | Ga0501076_0023151 | |||
| 1764 | Ga0501077_0018306 | |||
| 1765 | Ga0501077_0103282 | |||
| 1766 | Ga0501079_0007763 | |||
| 1767 | Ga0501079_0059639 | |||
| 1768 | Ga0501079_0199192 | |||
| 1769 | Ga0501080_0004279 | |||
| 1770 | Ga0501080_0028382 | |||
| 1771 | Ga0501080_0028686 | |||
| 1772 | Ga0501080_0084412 | |||
| 1773 | Ga0501081_0004658 | |||
| 1774 | Ga0501081_0005725 | |||
| 1775 | Ga0501081_0009346 | |||
| 1776 | Ga0501081_0021742 | |||
| 1777 | Ga0501083_0012139 | |||
| 1778 | Ga0501035_0003148 | |||
| 1779 | Ga0501035_0010022 | |||
| 1780 | Ga0501035_0019320 | |||
| 1781 | Ga0501035_0022285 | |||
| 1782 | Ga0501035_0025947 | |||
| 1783 | Ga0501035_0032024 | |||
| 1784 | Ga0501035_0095280 | |||
| 1785 | Ga0501035_0141934 | |||
| 1786 | Ga0501035_0161756 | |||
| 1787 | Ga0501044_0007144 | |||
| 1788 | Ga0501044_0011428 | |||
| 1789 | Ga0501044_0029738 | |||
| 1790 | Ga0501044_0041271 | |||
| 1791 | Ga0501044_0043549 | |||
| 1792 | Ga0501044_0083293 | |||
| 1793 | Ga0501044_0121429 | |||
| 1794 | Ga0501044_0151906 | |||
| 1795 | Ga0501045_0000225 | |||
| 1796 | Ga0501045_0019176 | |||
| 1797 | nmdc:mga00v17_10476_c1 | |||
| 1798 | nmdc:mga00v17_5307_c1 | |||
| 1799 | nmdc:mga08y16_54621_c1 | |||
| 1800 | nmdc:mga0n895_17491_c1 | |||
| 1801 | nmdc:mga0rr50_152611_c1 | |||
| 1802 | nmdc:mga0a205_603_c1 | |||
| 1803 | nmdc:mga0sz30_14786_c1 | |||
| 1804 | Ga0500610_0023463 | |||
| 1805 | Ga0500643_000002 | |||
| 1806 | Ga0500643_001805 | |||
| 1807 | Ga0500651_0000088 | |||
| 1808 | Ga0500556_0000234 | |||
| 1809 | Ga0500594_0001943 | |||
| 1810 | Ga0500597_000873 | |||
| 1811 | Ga0500642_0000014 | |||
| 1812 | Ga0500634_0001229 | |||
| 1813 | Ga0500645_000395 | |||
| 1814 | Ga0500645_005302 | |||
| 1815 | Ga0501084_0014642 | |||
| 1816 | Ga0501084_0042413 | |||
| 1817 | Ga0501084_0094713 | |||
| 1818 | Ga0501084_0128527 | |||
| 1819 | Ga0500661_005416 | |||
| 1820 | Ga0501082_0009187 | |||
| 1821 | Ga0501082_0030869 | |||
| 1822 | Ga0466962_0027328 | |||
| 1823 | Ga0466962_0042936 | |||
| 1824 | Ga0530510_0004136 | |||
| 1825 | Ga0530510_0025249 | |||
| 1826 | 2512732436 | |||
| 1827 | 2524190819 | |||
| 1828 | 2525556682 | |||
| 1829 | 2538832646 | |||
| 1830 | 2547502785 | |||
| 1831 | 2578458700 | |||
| 1832 | 2587738596 | |||
| 1833 | 2595318519 | |||
| 1834 | 2595446484 | |||
| 1835 | 2595451985 | |||
| 1836 | 2630648278 | |||
| 1837 | 2643830108 | |||
| 1838 | 2643894365 | |||
| 1839 | 2643907792 | |||
| 1840 | 2643916003 | |||
| 1841 | 2644426890 | |||
| 1842 | 2644476569 | |||
| 1843 | 2673822801 | |||
| 1844 | 2687583262 | |||
| 1845 | 2721026882 | |||
| 1846 | 2735837567 | |||
| 1847 | 2739228174 | |||
| 1848 | 2739731596 | |||
| 1849 | 2748015862 | |||
| 1850 | 2765578683 | |||
| 1851 | 2816516758 | |||
| 1852 | 2819565239 | |||
| 1853 | 2819662981 | |||
| 1854 | 2842394993 | |||
| 1855 | 2842758400 | |||
| 1856 | 2842780775 | |||
| 1857 | 2842917424 | |||
| 1858 | 2842919614 | |||
| 1859 | 2852651069 | |||
| 1860 | 2852686028 | |||
| 1861 | 2857446885 | |||
| 1862 | 2857453701 | |||
| 1863 | 2864997913 | |||
| 1864 | 2874221311 | |||
| 1865 | 2884341164 | |||
| 1866 | 2884413505 | |||
| 1867 | 2889297287 | |||
| 1868 | 2894415659 | |||
| 1869 | 2895395690 | |||
| 1870 | 2904466907 | |||
| 1871 | 2919087871 | |||
| 1872 | 2919133565 | |||
| 1873 | 2919136107 | |||
| 1874 | 2919405093 | |||
| 1875 | 2919514563 | |||
| 1876 | 2919676605 | |||
| 1877 | 2923518469 | |||
| 1878 | 2928496280 | |||
| 1879 | 2928967501 | |||
| 1880 | 2929197381 | |||
| 1881 | 2931381035 | |||
| 1882 | 2937612132 | |||
| 1883 | 2939590774 | |||
| 1884 | 2939611992 | |||
| 1885 | 2939622956 | |||
| 1886 | 2939630871 | |||
| 1887 | 2941472620 | |||
| 1888 | 2941478054 | |||
| 1889 | 2953994892 | |||
| 1890 | 2961048077 | |||
| 1891 | 2961065095 | |||
| 1892 | 2971411064 | |||
| 1893 | 2974309197 | |||
| 1894 | 2977249916 | |||
| 1895 | 2980128969 | |||
| 1896 | 2981285766 | |||
| 1897 | 2981290713 | |||
| 1898 | 2981980665 | |||
| 1899 | 2981985543 | |||
| 1900 | 2984515594 | |||
| 1901 | 8002323647 | |||
| 1902 | 8002872224 | |||
| 1903 | 8003015923 | |||
| 1904 | 8021623762 | |||
| 1905 | 8021630458 | |||
| 1906 | 8021650620 | |||
| 1907 | 8046998894 | |||
| 1908 | 8054798322 | |||
| 1909 | 8056536393 | |||
| 1910 | 8057477228 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h66-assembly1.cif.gz_A | crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain | 0.8473 | 2 | 120 |
| 1xew-assembly1.cif.gz_X | structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. | 0.8441 | 2 | 120 |
| 5h67-assembly1.cif.gz_A | crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain and soaked atp | 0.8371 | 2 | 120 |
| 3kta-assembly2.cif.gz_C | structural basis for adenylate kinase activity in abc atpases | 0.8346 | 2 | 120 |
| 1xex-assembly1.cif.gz_A-2 | structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. | 0.8225 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LFS8_23_178_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.854 | 4 | 120 | 3.40.50.300 |
| 5h66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8473 | 2 | 120 | 3.40.50.300 |
| af_Q8IPT2_15_211_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8425 | 1 | 123 | 3.40.50.300 |
| af_P0A7H0_3_104_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8396 | 2 | 113 | 3.40.50.300 |
| af_A0A1D6GTS1_30_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8381 | 1 | 120 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2K5X3-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9861 | 1 | 124 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |
| AF-A0A7C2K5X3-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9783 | 1 | 124 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |
| AF-F7K175-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9766 | 442 | 542 |
GO:0005524
GO:0006281 GO:0006310 GO:0009432 GO:0043590 |
| AF-M6T6B3-F1-model_v4 | deleted | 0.9735 | 442 | 544 |
|
| AF-A0A3D5NK97-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9729 | 1 | 115 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |