F486706

General Info

Members Datasets Scaffolds Average Seq Length
955 295 954 117

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100248258|Ga0068855_1002482582
Length 134
Sequence MGPDQNDELRKKERDEMSAVKDAPTIDFAKMDGLVPGIVQDAKTGEMLMLGFLNETSYAKTLESGFVTFWSRTRQKLWMKGETSGNRLKIVSAATDCDNDALLFRVDVEGDGLVCHEGTVSCFTKPISVSAEGK

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.52
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006912 3300000546 Bacteria 1229
2 JGI24743J22301_10071283 3300001991 Bacteria 725
3 rootH2_10171401 3300003320 Bacteria 1378
4 rootH1_10203955 3300003323 Bacteria 1639
5 Ga0070658_10000121 3300005327 Bacteria 70439
6 Ga0070658_10013505 3300005327 Bacteria 6554
7 Ga0070658_10037114 3300005327 Bacteria 3927
8 Ga0070658_10038584 3300005327 Bacteria 3851
9 Ga0070658_10049430 3300005327 Bacteria 3407
10 Ga0070658_10134937 3300005327 Bacteria 2058
11 Ga0070658_10150612 3300005327 Bacteria 1947
12 Ga0070658_10341705 3300005327 Bacteria 1280
13 Ga0070658_10429461 3300005327 Bacteria 1137
14 Ga0070658_10921455 3300005327 Bacteria 760
15 Ga0070676_10229857 3300005328 Bacteria 1229
16 Ga0070683_100002041 3300005329 Bacteria 15901
17 Ga0070683_100015021 3300005329 Bacteria 6793
18 Ga0070683_100015398 3300005329 Bacteria 6717
19 Ga0070683_100028772 3300005329 Bacteria 5025
20 Ga0070683_100135740 3300005329 Bacteria 2330
21 Ga0070683_100183443 3300005329 Bacteria 1986
22 Ga0070683_100779235 3300005329 Bacteria 916
23 Ga0070683_100898533 3300005329 Bacteria 850
24 Ga0070670_100005099 3300005331 Bacteria 11055
25 Ga0068869_100002456 3300005334 Bacteria 11175
26 Ga0068869_100503734 3300005334 Bacteria 1011
27 Ga0070666_10071003 3300005335 Bacteria 2369
28 Ga0070666_10285534 3300005335 Bacteria 1173
29 Ga0070680_100007018 3300005336 Bacteria 8584
30 Ga0070680_100032000 3300005336 Bacteria 4231
31 Ga0070682_100345088 3300005337 Bacteria 1108
32 Ga0068868_100000066 3300005338 Bacteria 59945
33 Ga0068868_100030705 3300005338 Bacteria 4121
34 Ga0068868_100202417 3300005338 Bacteria 1656
35 Ga0068868_100251736 3300005338 Bacteria 1487
36 Ga0068868_100955371 3300005338 Bacteria 782
37 Ga0070660_100008313 3300005339 Bacteria 7255
38 Ga0070660_100185531 3300005339 Bacteria 1684
39 Ga0070660_101936061 3300005339 Bacteria 503
40 Ga0070691_10410588 3300005341 Bacteria 765
41 Ga0070691_10820556 3300005341 Bacteria 568
42 Ga0070661_100016527 3300005344 Bacteria 5220
43 Ga0070661_100018919 3300005344 Bacteria 4905
44 Ga0070661_100111867 3300005344 Bacteria 2040
45 Ga0070661_100112059 3300005344 Unclassified 2038
46 Ga0070661_100198292 3300005344 Bacteria 1533
47 Ga0070661_100230310 3300005344 Bacteria 1424
48 Ga0070661_100542850 3300005344 Bacteria 934
49 Ga0070661_100838680 3300005344 Bacteria 756
50 Ga0070661_101035467 3300005344 Bacteria 682
51 Ga0070661_101631218 3300005344 Bacteria 546
52 Ga0070692_10972062 3300005345 Bacteria 592
53 Ga0070668_100215320 3300005347 Bacteria 1582
54 Ga0070669_101089400 3300005353 Bacteria 688
55 Ga0070671_100000411 3300005355 Bacteria 29652
56 Ga0070671_100003123 3300005355 Bacteria 12901
57 Ga0070671_100027039 3300005355 Bacteria 4720
58 Ga0070674_100431124 3300005356 Bacteria 1084
59 Ga0070659_100004580 3300005366 Bacteria 9889
60 Ga0070659_100030029 3300005366 Bacteria 4204
61 Ga0070667_100002645 3300005367 Bacteria 15516
62 Ga0070709_10949888 3300005434 Bacteria 682
63 Ga0070709_11714150 3300005434 Bacteria 513
64 Ga0070714_100002654 3300005435 Bacteria 13178
65 Ga0070714_100099406 3300005435 Bacteria 2560
66 Ga0070713_100033702 3300005436 Bacteria 4106
67 Ga0070713_100095055 3300005436 Bacteria 2570
68 Ga0070713_100306613 3300005436 Bacteria 1463
69 Ga0070713_100374302 3300005436 Bacteria 1326
70 Ga0070713_100423960 3300005436 Bacteria 1246
71 Ga0070713_100980652 3300005436 Bacteria 815
72 Ga0070713_101505149 3300005436 Bacteria 653
73 Ga0070710_10226393 3300005437 Bacteria 1192
74 Ga0070711_100316224 3300005439 Bacteria 1246
75 Ga0070711_100547276 3300005439 Bacteria 960
76 Ga0070711_100733469 3300005439 Bacteria 834
77 Ga0070663_100019192 3300005455 Bacteria 4500
78 Ga0070663_100019345 3300005455 Bacteria 4485
79 Ga0070663_100070653 3300005455 Bacteria 2539
80 Ga0070663_100143609 3300005455 Bacteria 1824
81 Ga0070678_100854730 3300005456 Bacteria 829
82 Ga0070678_101766683 3300005456 Bacteria 583
83 Ga0070681_10001050 3300005458 Bacteria 23493
84 Ga0070681_10053249 3300005458 Bacteria 4032
85 Ga0070681_10103095 3300005458 Bacteria 2798
86 Ga0070681_10215158 3300005458 Bacteria 1838
87 Ga0070679_100000968 3300005530 Bacteria 24975
88 Ga0070679_100003993 3300005530 Bacteria 13587
89 Ga0070679_100006128 3300005530 Bacteria 11185
90 Ga0070679_100057253 3300005530 Bacteria 3885
91 Ga0070679_101944246 3300005530 Unclassified 537
92 Ga0070684_100016109 3300005535 Bacteria 6107
93 Ga0070684_100054432 3300005535 Bacteria 3487
94 Ga0070684_100184604 3300005535 Bacteria 1897
95 Ga0070684_100200183 3300005535 Bacteria 1819
96 Ga0070684_100610250 3300005535 Bacteria 1015
97 Ga0070684_100782645 3300005535 Bacteria 891
98 Ga0068853_100000222 3300005539 Bacteria 40206
99 Ga0068853_100000367 3300005539 Bacteria 31060
100 Ga0068853_100078090 3300005539 Bacteria 2893
101 Ga0068853_100178099 3300005539 Unclassified 1927
102 Ga0068853_100241876 3300005539 Bacteria 1654
103 Ga0068853_100371177 3300005539 Bacteria 1335
104 Ga0068853_100582516 3300005539 Bacteria 1062
105 Ga0068853_101323874 3300005539 Bacteria 696
106 Ga0068853_101482488 3300005539 Unclassified 657
107 Ga0070672_100006275 3300005543 Bacteria 7967
108 Ga0070672_100519923 3300005543 Bacteria 1031
109 Ga0070693_101636169 3300005547 Bacteria 506
110 Ga0070665_100044594 3300005548 Bacteria 4453
111 Ga0070665_100230859 3300005548 Bacteria 1850
112 Ga0070665_100296619 3300005548 Bacteria 1619
113 Ga0070665_100431607 3300005548 Bacteria 1326
114 Ga0070665_100538074 3300005548 Bacteria 1180
115 Ga0070665_101341878 3300005548 Bacteria 725
116 Ga0068855_100000277 3300005563 Bacteria 63213
117 Ga0068855_100002688 3300005563 Bacteria 21925
118 Ga0068855_100003653 3300005563 Bacteria 18822
119 Ga0068855_100010384 3300005563 Bacteria 11233
120 Ga0068855_100012571 3300005563 Bacteria 10218
121 Ga0068855_100022187 3300005563 Bacteria 7607
122 Ga0068855_100036038 3300005563 Bacteria 5890
123 Ga0068855_100057885 3300005563 Bacteria 4542
124 Ga0068855_100135969 3300005563 Bacteria 2804
125 Ga0068855_100248258 3300005563 Bacteria 1986
126 Ga0068855_100348240 3300005563 Bacteria 1632
127 Ga0068855_100366863 3300005563 Bacteria 1583
128 Ga0068855_100400348 3300005563 Bacteria 1504
129 Ga0068855_100442404 3300005563 Bacteria 1419
130 Ga0068855_100967794 3300005563 Bacteria 896
131 Ga0068855_101161343 3300005563 Bacteria 804
132 Ga0070664_100127912 3300005564 Bacteria 2230
133 Ga0070664_100167202 3300005564 Bacteria 1949
134 Ga0070664_100598772 3300005564 Bacteria 1022
135 Ga0070664_102051637 3300005564 Bacteria 543
136 Ga0068857_100013234 3300005577 Bacteria 7188
137 Ga0068857_100015817 3300005577 Bacteria 6601
138 Ga0068857_100016334 3300005577 Bacteria 6505
139 Ga0068857_100120350 3300005577 Bacteria 2363
140 Ga0068857_100202072 3300005577 Bacteria 1812
141 Ga0068857_100373500 3300005577 Bacteria 1323
142 Ga0068854_100000019 3300005578 Bacteria 134145
143 Ga0068854_100008770 3300005578 Bacteria 6510
144 Ga0068854_100042728 3300005578 Bacteria 3209
145 Ga0068854_100311570 3300005578 Bacteria 1277
146 Ga0068854_100422016 3300005578 Bacteria 1108
147 Ga0068856_100003529 3300005614 Bacteria 15773
148 Ga0068856_100006467 3300005614 Bacteria 11493
149 Ga0068856_100019915 3300005614 Bacteria 6512
150 Ga0068856_100028379 3300005614 Bacteria 5464
151 Ga0068856_100037527 3300005614 Bacteria 4754
152 Ga0068856_100054362 3300005614 Bacteria 3949
153 Ga0068856_100258107 3300005614 Bacteria 1758
154 Ga0068856_100702563 3300005614 Bacteria 1031
155 Ga0068856_102227158 3300005614 Bacteria 557
156 Ga0068852_100000019 3300005616 Bacteria 129021
157 Ga0068852_100000097 3300005616 Bacteria 59430
158 Ga0068852_100001535 3300005616 Bacteria 15668
159 Ga0068852_100006965 3300005616 Bacteria 8225
160 Ga0068852_100015924 3300005616 Bacteria 5850
161 Ga0068852_100027564 3300005616 Bacteria 4631
162 Ga0068852_100050084 3300005616 Bacteria 3577
163 Ga0068852_100059108 3300005616 Bacteria 3324
164 Ga0068852_100213509 3300005616 Bacteria 1832
165 Ga0068852_100241388 3300005616 Unclassified 1727
166 Ga0068852_100471619 3300005616 Bacteria 1246
167 Ga0068859_100006530 3300005617 Bacteria 11843
168 Ga0068864_100002762 3300005618 Bacteria 14478
169 Ga0068864_100012167 3300005618 Bacteria 7112
170 Ga0068864_102329345 3300005618 Bacteria 542
171 Ga0068866_10437894 3300005718 Bacteria 852
172 Ga0068851_10001766 3300005834 Bacteria 9449
173 Ga0068851_10010381 3300005834 Bacteria 4348
174 Ga0068851_10083174 3300005834 Bacteria 1674
175 Ga0068851_10139420 3300005834 Bacteria 1318
176 Ga0068863_100001753 3300005841 Bacteria 21524
177 Ga0068863_100001814 3300005841 Bacteria 21208
178 Ga0068863_100120289 3300005841 Bacteria 2503
179 Ga0068858_100003316 3300005842 Bacteria 16031
180 Ga0068858_100015914 3300005842 Bacteria 7067
181 Ga0068858_100278903 3300005842 Bacteria 1591
182 Ga0068860_100000689 3300005843 Bacteria 38878
183 Ga0070717_10011904 3300006028 Bacteria 6620
184 Ga0070717_10481961 3300006028 Bacteria 1120
185 Ga0070717_10830751 3300006028 Bacteria 841
186 Ga0070716_100189133 3300006173 Bacteria 1359
187 Ga0070716_100341836 3300006173 Bacteria 1056
188 Ga0070712_100122617 3300006175 Bacteria 1958
189 Ga0070712_101271073 3300006175 Bacteria 641
190 Ga0070712_101995940 3300006175 Bacteria 508
191 Ga0097621_100000349 3300006237 Bacteria 31779
192 Ga0097621_100048467 3300006237 Bacteria 3447
193 Ga0097621_100165375 3300006237 Bacteria 1904
194 Ga0068871_100035557 3300006358 Bacteria 3960
195 Ga0068871_100675555 3300006358 Bacteria 944
196 Ga0068865_100268881 3300006881 Bacteria 1353
197 Ga0075436_100198902 3300006914 Bacteria 1419
198 Ga0097620_100006530 3300006931 Bacteria 11843
199 Ga0099794_10444218 3300007265 Bacteria 680
200 Ga0105240_10000001 3300009093 Bacteria 2887840
201 Ga0105240_10000372 3300009093 Bacteria 84325
202 Ga0105240_10000496 3300009093 Bacteria 72575
203 Ga0105240_10001875 3300009093 Bacteria 34957
204 Ga0105240_10003485 3300009093 Bacteria 24396
205 Ga0105240_10010838 3300009093 Bacteria 12767
206 Ga0105240_10033184 3300009093 Bacteria 6673
207 Ga0105240_10034761 3300009093 Bacteria 6498
208 Ga0105240_10057886 3300009093 Bacteria 4839
209 Ga0105240_10060708 3300009093 Bacteria 4712
210 Ga0105240_10122963 3300009093 Bacteria 3123
211 Ga0105240_10234142 3300009093 Bacteria 2132
212 Ga0105240_10393531 3300009093 Bacteria 1562
213 Ga0105240_10395370 3300009093 Bacteria 1558
214 Ga0105240_10425874 3300009093 Bacteria 1490
215 Ga0105240_10714988 3300009093 Bacteria 1092
216 Ga0105240_10898876 3300009093 Bacteria 953
217 Ga0105240_11331624 3300009093 Bacteria 757
218 Ga0105240_11656657 3300009093 Bacteria 668
219 Ga0105245_10000486 3300009098 Bacteria 36378
220 Ga0105245_10146696 3300009098 Unclassified 2227
221 Ga0105245_10271912 3300009098 Bacteria 1653
222 Ga0105245_10417255 3300009098 Bacteria 1344
223 Ga0105245_11363681 3300009098 Bacteria 759
224 Ga0105245_12015127 3300009098 Bacteria 631
225 Ga0105247_10004009 3300009101 Bacteria 9473
226 Ga0105247_10012271 3300009101 Bacteria 5146
227 Ga0105247_10299210 3300009101 Bacteria 1116
228 Ga0105241_10000026 3300009174 Bacteria 132695
229 Ga0105241_10000121 3300009174 Bacteria 57041
230 Ga0105241_10002032 3300009174 Bacteria 15308
231 Ga0105241_10006994 3300009174 Bacteria 8301
232 Ga0105241_10043980 3300009174 Bacteria 3383
233 Ga0105241_10449796 3300009174 Bacteria 1139
234 Ga0105241_10454102 3300009174 Bacteria 1134
235 Ga0105241_10539986 3300009174 Bacteria 1045
236 Ga0105241_10644488 3300009174 Bacteria 961
237 Ga0105241_10790322 3300009174 Bacteria 873
238 Ga0105241_10847964 3300009174 Bacteria 845
239 Ga0105241_11499106 3300009174 Bacteria 649
240 Ga0105242_10223056 3300009176 Bacteria 1685
241 Ga0105248_10000019 3300009177 Bacteria 285766
242 Ga0105248_10007017 3300009177 Bacteria 12337
243 Ga0105248_10021944 3300009177 Bacteria 7075
244 Ga0105248_10022327 3300009177 Bacteria 7018
245 Ga0105248_10042895 3300009177 Bacteria 5072
246 Ga0105248_10293698 3300009177 Bacteria 1830
247 Ga0105248_11168149 3300009177 Bacteria 870
248 Ga0105248_11357570 3300009177 Bacteria 804
249 Ga0105237_10000590 3300009545 Bacteria 50564
250 Ga0105237_10006331 3300009545 Bacteria 13155
251 Ga0105237_10049769 3300009545 Unclassified 4211
252 Ga0105237_10352143 3300009545 Bacteria 1477
253 Ga0105237_10555839 3300009545 Bacteria 1154
254 Ga0105237_10556785 3300009545 Bacteria 1153
255 Ga0105237_10805760 3300009545 Bacteria 946
256 Ga0105237_11092793 3300009545 Bacteria 804
257 Ga0105238_10000197 3300009551 Bacteria 66637
258 Ga0105238_10000509 3300009551 Bacteria 40868
259 Ga0105238_10016125 3300009551 Bacteria 7558
260 Ga0105238_10023794 3300009551 Bacteria 6244
261 Ga0105238_10029605 3300009551 Bacteria 5576
262 Ga0105238_10051802 3300009551 Bacteria 4127
263 Ga0105238_10064831 3300009551 Bacteria 3653
264 Ga0105238_10065916 3300009551 Bacteria 3622
265 Ga0105238_10145620 3300009551 Bacteria 2345
266 Ga0105238_10485097 3300009551 Bacteria 1236
267 Ga0105238_10522005 3300009551 Bacteria 1190
268 Ga0105238_10781075 3300009551 Bacteria 970
269 Ga0105238_11877914 3300009551 Bacteria 632
270 Ga0105238_12299666 3300009551 Bacteria 574
271 Ga0105238_12957677 3300009551 Bacteria 511
272 Ga0105249_10067686 3300009553 Bacteria 3291
273 Ga0099796_10089586 3300010159 Bacteria 1142
274 Ga0105239_10001533 3300010375 Bacteria 30534
275 Ga0105239_10003046 3300010375 Bacteria 20836
276 Ga0105239_10013636 3300010375 Bacteria 9023
277 Ga0105239_10075980 3300010375 Bacteria 3694
278 Ga0105239_10336483 3300010375 Bacteria 1703
279 Ga0105239_10877344 3300010375 Bacteria 1029
280 Ga0105239_11576054 3300010375 Bacteria 759
281 Ga0105239_11893339 3300010375 Bacteria 692
282 Ga0105246_10002384 3300011119 Bacteria 11337
283 Ga0157373_10104825 3300013100 Bacteria 1989
284 Ga0157373_10219018 3300013100 Bacteria 1343
285 Ga0157373_10757558 3300013100 Bacteria 714
286 Ga0157373_10782411 3300013100 Bacteria 703
287 Ga0157371_10030600 3300013102 Bacteria 3883
288 Ga0157371_10407929 3300013102 Bacteria 995
289 Ga0157371_10778244 3300013102 Bacteria 720
290 Ga0157370_10000170 3300013104 Bacteria 80529
291 Ga0157370_10006614 3300013104 Bacteria 12739
292 Ga0157370_10010879 3300013104 Bacteria 9556
293 Ga0157370_10012988 3300013104 Bacteria 8605
294 Ga0157370_10017219 3300013104 Bacteria 7293
295 Ga0157370_10030063 3300013104 Bacteria 5324
296 Ga0157370_10090149 3300013104 Bacteria 2879
297 Ga0157370_10210145 3300013104 Bacteria 1804
298 Ga0157370_10608338 3300013104 Bacteria 1000
299 Ga0157370_11601331 3300013104 Bacteria 585
300 Ga0157369_10000085 3300013105 Bacteria 129025
301 Ga0157369_10000430 3300013105 Bacteria 55736
302 Ga0157369_10009218 3300013105 Bacteria 11289
303 Ga0157369_10010533 3300013105 Bacteria 10523
304 Ga0157369_10012659 3300013105 Bacteria 9566
305 Ga0157369_10012685 3300013105 Bacteria 9557
306 Ga0157369_10018737 3300013105 Bacteria 7760
307 Ga0157369_10021889 3300013105 Bacteria 7146
308 Ga0157369_10028989 3300013105 Bacteria 6121
309 Ga0157369_10042189 3300013105 Bacteria 4977
310 Ga0157369_10049457 3300013105 Bacteria 4558
311 Ga0157369_10051486 3300013105 Bacteria 4456
312 Ga0157369_10067688 3300013105 Bacteria 3838
313 Ga0157369_10115554 3300013105 Bacteria 2850
314 Ga0157369_10261492 3300013105 Bacteria 1805
315 Ga0157369_10416121 3300013105 Bacteria 1394
316 Ga0157369_10666779 3300013105 Bacteria 1072
317 Ga0157369_12066327 3300013105 Bacteria 578
318 Ga0157374_10005033 3300013296 Bacteria 11085
319 Ga0157374_10011606 3300013296 Bacteria 7637
320 Ga0157374_10025961 3300013296 Bacteria 5266
321 Ga0157374_10058477 3300013296 Bacteria 3603
322 Ga0157374_10177740 3300013296 Bacteria 2078
323 Ga0157374_10347322 3300013296 Bacteria 1474
324 Ga0157374_10429621 3300013296 Bacteria 1320
325 Ga0157374_10459620 3300013296 Bacteria 1275
326 Ga0157374_10497804 3300013296 Bacteria 1223
327 Ga0157374_10664257 3300013296 Bacteria 1054
328 Ga0157374_10753782 3300013296 Bacteria 988
329 Ga0157374_10850894 3300013296 Bacteria 929
330 Ga0157374_11748663 3300013296 Bacteria 647
331 Ga0157378_10003314 3300013297 Bacteria 14319
332 Ga0157378_10023973 3300013297 Bacteria 5367
333 Ga0157378_10028269 3300013297 Bacteria 4945
334 Ga0157378_10108517 3300013297 Bacteria 2541
335 Ga0157378_10307547 3300013297 Bacteria 1536
336 Ga0157378_10431981 3300013297 Bacteria 1303
337 Ga0157378_11984848 3300013297 Bacteria 632
338 Ga0163162_10027442 3300013306 Bacteria 5631
339 Ga0163162_10084767 3300013306 Bacteria 3245
340 Ga0163162_10209135 3300013306 Bacteria 2081
341 Ga0163162_13191369 3300013306 Unclassified 526
342 Ga0157372_10000217 3300013307 Bacteria 63667
343 Ga0157372_10002601 3300013307 Bacteria 19543
344 Ga0157372_10007271 3300013307 Bacteria 11791
345 Ga0157372_10010870 3300013307 Bacteria 9688
346 Ga0157372_10027828 3300013307 Bacteria 6161
347 Ga0157372_10048038 3300013307 Bacteria 4744
348 Ga0157372_10120685 3300013307 Bacteria 3010
349 Ga0157372_10265383 3300013307 Bacteria 1994
350 Ga0157372_10355994 3300013307 Bacteria 1705
351 Ga0157372_10541137 3300013307 Bacteria 1358
352 Ga0157372_11069037 3300013307 Bacteria 934
353 Ga0157372_11562612 3300013307 Bacteria 760
354 Ga0157372_11585463 3300013307 Bacteria 754
355 Ga0157375_10029487 3300013308 Bacteria 5161
356 Ga0157375_10162945 3300013308 Unclassified 2373
357 Ga0157375_10264835 3300013308 Bacteria 1880
358 Ga0157375_10753952 3300013308 Bacteria 1125
359 Ga0163163_10001161 3300014325 Bacteria 22403
360 Ga0163163_10028784 3300014325 Bacteria 5340
361 Ga0157377_10224766 3300014745 Bacteria 1204
362 Ga0157379_10002312 3300014968 Bacteria 15882
363 Ga0157379_10043255 3300014968 Bacteria 4021
364 Ga0157379_10067424 3300014968 Bacteria 3199
365 Ga0157379_10227617 3300014968 Bacteria 1690
366 Ga0157379_10393819 3300014968 Bacteria 1272
367 Ga0157379_11687805 3300014968 Bacteria 620
368 Ga0157379_12334041 3300014968 Bacteria 533
369 Ga0157376_10004372 3300014969 Bacteria 9831
370 Ga0157376_10061471 3300014969 Bacteria 3158
371 Ga0157376_10134284 3300014969 Unclassified 2212
372 Ga0157376_10240761 3300014969 Bacteria 1685
373 Ga0157376_10318257 3300014969 Bacteria 1478
374 Ga0157376_10955211 3300014969 Bacteria 878
375 Ga0157376_11119609 3300014969 Bacteria 813
376 Ga0157376_11340204 3300014969 Bacteria 746
377 Ga0182006_1055967 3300015261 Bacteria 1504
378 Ga0163161_10492088 3300017792 Bacteria 997
379 Ga0213872_10025009 3300021361 Bacteria 2746
380 Ga0213872_10062353 3300021361 Bacteria 1685
381 Ga0213872_10410650 3300021361 Bacteria 548
382 Ga0213871_10039548 3300021441 Bacteria 1262
383 Ga0224572_1045103 3300024225 Bacteria 826
384 Ga0209233_1005604 3300025261 Bacteria 4152
385 Ga0207656_10001489 3300025321 Bacteria 7754
386 Ga0207656_10008960 3300025321 Unclassified 3706
387 Ga0207656_10011691 3300025321 Bacteria 3321
388 Ga0207656_10109919 3300025321 Bacteria 1273
389 Ga0207656_10199314 3300025321 Bacteria 966
390 Ga0207642_10739637 3300025899 Bacteria 622
391 Ga0207710_10000912 3300025900 Bacteria 15813
392 Ga0207710_10032646 3300025900 Bacteria 2280
393 Ga0207710_10227618 3300025900 Bacteria 927
394 Ga0207710_10449031 3300025900 Bacteria 665
395 Ga0207680_10562814 3300025903 Bacteria 814
396 Ga0207647_10093187 3300025904 Bacteria 1795
397 Ga0207647_10130745 3300025904 Bacteria 1475
398 Ga0207699_10314431 3300025906 Bacteria 1097
399 Ga0207699_11185985 3300025906 Bacteria 565
400 Ga0207645_10075799 3300025907 Bacteria 2153
401 Ga0207705_10000021 3300025909 Bacteria 309436
402 Ga0207705_10002923 3300025909 Bacteria 13059
403 Ga0207705_10019392 3300025909 Bacteria 4862
404 Ga0207705_10031673 3300025909 Bacteria 3776
405 Ga0207705_10032002 3300025909 Bacteria 3757
406 Ga0207705_10091974 3300025909 Bacteria 2222
407 Ga0207705_10157529 3300025909 Bacteria 1704
408 Ga0207705_10301422 3300025909 Bacteria 1229
409 Ga0207705_10644617 3300025909 Bacteria 824
410 Ga0207705_11343888 3300025909 Bacteria 545
411 Ga0207654_10000054 3300025911 Bacteria 82347
412 Ga0207654_10000281 3300025911 Bacteria 30979
413 Ga0207654_10000808 3300025911 Bacteria 17242
414 Ga0207654_10086212 3300025911 Bacteria 1903
415 Ga0207654_10268477 3300025911 Bacteria 1150
416 Ga0207654_10527968 3300025911 Bacteria 836
417 Ga0207654_11084317 3300025911 Bacteria 583
418 Ga0207654_11159358 3300025911 Bacteria 563
419 Ga0207707_10003864 3300025912 Bacteria 13285
420 Ga0207707_10088884 3300025912 Bacteria 2699
421 Ga0207707_10475820 3300025912 Bacteria 1067
422 Ga0207695_10000001 3300025913 Bacteria 2888630
423 Ga0207695_10000080 3300025913 Bacteria 287868
424 Ga0207695_10000113 3300025913 Bacteria 247240
425 Ga0207695_10000167 3300025913 Bacteria 194371
426 Ga0207695_10000263 3300025913 Bacteria 132894
427 Ga0207695_10001106 3300025913 Bacteria 46871
428 Ga0207695_10001762 3300025913 Bacteria 34278
429 Ga0207695_10007109 3300025913 Bacteria 14340
430 Ga0207695_10025431 3300025913 Bacteria 6627
431 Ga0207695_10047228 3300025913 Bacteria 4558
432 Ga0207695_10050757 3300025913 Bacteria 4361
433 Ga0207695_10067630 3300025913 Bacteria 3664
434 Ga0207695_10090899 3300025913 Bacteria 3067
435 Ga0207695_10587824 3300025913 Bacteria 994
436 Ga0207695_10825204 3300025913 Bacteria 807
437 Ga0207671_10000065 3300025914 Bacteria 166743
438 Ga0207671_10000123 3300025914 Bacteria 119385
439 Ga0207671_10000139 3300025914 Bacteria 111786
440 Ga0207671_10037214 3300025914 Bacteria 3609
441 Ga0207671_10093033 3300025914 Bacteria 2274
442 Ga0207671_10101032 3300025914 Bacteria 2185
443 Ga0207671_10285240 3300025914 Bacteria 1303
444 Ga0207671_10314634 3300025914 Bacteria 1238
445 Ga0207671_10544343 3300025914 Bacteria 925
446 Ga0207671_10816103 3300025914 Bacteria 739
447 Ga0207693_10195339 3300025915 Bacteria 1592
448 Ga0207693_11218377 3300025915 Bacteria 567
449 Ga0207663_11063731 3300025916 Bacteria 650
450 Ga0207660_10034872 3300025917 Bacteria 3490
451 Ga0207660_10529731 3300025917 Bacteria 957
452 Ga0207657_10004623 3300025919 Bacteria 14538
453 Ga0207657_10019482 3300025919 Bacteria 6442
454 Ga0207657_10023308 3300025919 Bacteria 5767
455 Ga0207657_10063948 3300025919 Bacteria 3143
456 Ga0207657_10273173 3300025919 Bacteria 1343
457 Ga0207657_10516848 3300025919 Bacteria 935
458 Ga0207657_10584200 3300025919 Bacteria 872
459 Ga0207649_10009868 3300025920 Bacteria 5233
460 Ga0207649_10011442 3300025920 Bacteria 4893
461 Ga0207649_10036761 3300025920 Bacteria 2952
462 Ga0207649_10045929 3300025920 Bacteria 2680
463 Ga0207649_10051713 3300025920 Bacteria 2545
464 Ga0207649_10123143 3300025920 Bacteria 1751
465 Ga0207649_10355185 3300025920 Bacteria 1086
466 Ga0207649_11594458 3300025920 Bacteria 517
467 Ga0207652_10001535 3300025921 Bacteria 20348
468 Ga0207652_10002459 3300025921 Bacteria 15619
469 Ga0207652_10033782 3300025921 Bacteria 4308
470 Ga0207652_10045706 3300025921 Bacteria 3733
471 Ga0207652_10456639 3300025921 Bacteria 1151
472 Ga0207694_10000248 3300025924 Bacteria 51461
473 Ga0207694_10000711 3300025924 Bacteria 29920
474 Ga0207694_10007157 3300025924 Bacteria 8478
475 Ga0207694_10010664 3300025924 Bacteria 6933
476 Ga0207694_10042410 3300025924 Bacteria 3509
477 Ga0207694_10131100 3300025924 Unclassified 2009
478 Ga0207694_10277292 3300025924 Bacteria 1376
479 Ga0207694_10474030 3300025924 Bacteria 1046
480 Ga0207694_10534797 3300025924 Bacteria 983
481 Ga0207694_10924621 3300025924 Bacteria 738
482 Ga0207694_11311516 3300025924 Bacteria 612
483 Ga0207694_11564067 3300025924 Bacteria 556
484 Ga0207694_11849546 3300025924 Bacteria 507
485 Ga0207650_10003582 3300025925 Bacteria 10655
486 Ga0207659_10116300 3300025926 Unclassified 2042
487 Ga0207687_10000978 3300025927 Bacteria 19404
488 Ga0207687_10030621 3300025927 Unclassified 3629
489 Ga0207687_10086790 3300025927 Bacteria 2273
490 Ga0207687_10276493 3300025927 Bacteria 1344
491 Ga0207700_10015711 3300025928 Bacteria 5005
492 Ga0207700_10071880 3300025928 Bacteria 2665
493 Ga0207700_10159411 3300025928 Bacteria 1873
494 Ga0207700_10214980 3300025928 Bacteria 1627
495 Ga0207700_10887044 3300025928 Bacteria 798
496 Ga0207664_10068128 3300025929 Bacteria 2858
497 Ga0207664_10135073 3300025929 Bacteria 2081
498 Ga0207644_10002160 3300025931 Bacteria 12753
499 Ga0207644_10013665 3300025931 Bacteria 5418
500 Ga0207644_10075210 3300025931 Bacteria 2481
501 Ga0207644_10271224 3300025931 Bacteria 1360
502 Ga0207690_10010429 3300025932 Bacteria 5522
503 Ga0207690_10564670 3300025932 Bacteria 926
504 Ga0207706_10064710 3300025933 Unclassified 3220
505 Ga0207665_10584863 3300025939 Bacteria 870
506 Ga0207691_10075960 3300025940 Bacteria 3028
507 Ga0207691_10770386 3300025940 Bacteria 809
508 Ga0207711_10000014 3300025941 Bacteria 506753
509 Ga0207711_10004781 3300025941 Bacteria 11494
510 Ga0207711_10024659 3300025941 Bacteria 5043
511 Ga0207711_10095034 3300025941 Bacteria 2628
512 Ga0207711_10190978 3300025941 Bacteria 1866
513 Ga0207711_10305502 3300025941 Bacteria 1468
514 Ga0207711_10343779 3300025941 Bacteria 1381
515 Ga0207711_10349532 3300025941 Bacteria 1369
516 Ga0207711_11198331 3300025941 Bacteria 701
517 Ga0207711_11646135 3300025941 Bacteria 585
518 Ga0207689_10004019 3300025942 Bacteria 13370
519 Ga0207689_10051194 3300025942 Bacteria 3404
520 Ga0207689_10524464 3300025942 Bacteria 994
521 Ga0207661_10001283 3300025944 Bacteria 16799
522 Ga0207661_10010483 3300025944 Bacteria 6670
523 Ga0207661_10025842 3300025944 Bacteria 4468
524 Ga0207661_10083585 3300025944 Bacteria 2642
525 Ga0207661_10099228 3300025944 Bacteria 2442
526 Ga0207661_10105999 3300025944 Bacteria 2369
527 Ga0207661_10220368 3300025944 Bacteria 1677
528 Ga0207661_10237426 3300025944 Bacteria 1616
529 Ga0207679_10079256 3300025945 Bacteria 2504
530 Ga0207679_10175492 3300025945 Bacteria 1768
531 Ga0207679_10298874 3300025945 Bacteria 1387
532 Ga0207667_10000468 3300025949 Bacteria 53974
533 Ga0207667_10007018 3300025949 Bacteria 13604
534 Ga0207667_10007159 3300025949 Bacteria 13469
535 Ga0207667_10007633 3300025949 Bacteria 12958
536 Ga0207667_10009516 3300025949 Bacteria 11434
537 Ga0207667_10023191 3300025949 Bacteria 6835
538 Ga0207667_10028672 3300025949 Bacteria 6044
539 Ga0207667_10057558 3300025949 Bacteria 4080
540 Ga0207667_10089817 3300025949 Bacteria 3175
541 Ga0207667_10113439 3300025949 Bacteria 2794
542 Ga0207667_10118034 3300025949 Unclassified 2734
543 Ga0207667_10136268 3300025949 Bacteria 2528
544 Ga0207667_10237086 3300025949 Bacteria 1867
545 Ga0207667_10774145 3300025949 Bacteria 958
546 Ga0207712_10040395 3300025961 Bacteria 3201
547 Ga0207712_10879094 3300025961 Bacteria 791
548 Ga0207640_10000028 3300025981 Bacteria 135727
549 Ga0207640_10008642 3300025981 Bacteria 5661
550 Ga0207640_10155415 3300025981 Bacteria 1685
551 Ga0207640_10159963 3300025981 Bacteria 1665
552 Ga0207640_10555853 3300025981 Bacteria 965
553 Ga0207640_10568780 3300025981 Bacteria 955
554 Ga0207640_10722052 3300025981 Bacteria 856
555 Ga0207658_10050436 3300025986 Bacteria 3062
556 Ga0207658_10458795 3300025986 Bacteria 1129
557 Ga0207677_10000143 3300026023 Bacteria 58337
558 Ga0207677_10006547 3300026023 Bacteria 6395
559 Ga0207677_10716717 3300026023 Bacteria 889
560 Ga0207703_10011246 3300026035 Bacteria 6963
561 Ga0207703_10133597 3300026035 Bacteria 2146
562 Ga0207639_10000088 3300026041 Bacteria 78742
563 Ga0207639_10000371 3300026041 Bacteria 31074
564 Ga0207639_10014115 3300026041 Bacteria 5610
565 Ga0207639_10145334 3300026041 Bacteria 1980
566 Ga0207639_10221987 3300026041 Bacteria 1633
567 Ga0207639_10287632 3300026041 Unclassified 1448
568 Ga0207639_10320037 3300026041 Bacteria 1377
569 Ga0207639_10423579 3300026041 Bacteria 1204
570 Ga0207639_10464315 3300026041 Bacteria 1151
571 Ga0207639_10951559 3300026041 Bacteria 804
572 Ga0207678_10006398 3300026067 Bacteria 10461
573 Ga0207678_10015091 3300026067 Bacteria 6797
574 Ga0207678_10015141 3300026067 Bacteria 6784
575 Ga0207678_10036879 3300026067 Bacteria 4256
576 Ga0207678_10231765 3300026067 Bacteria 1581
577 Ga0207702_10004705 3300026078 Bacteria 12064
578 Ga0207702_10005816 3300026078 Bacteria 10726
579 Ga0207702_10036280 3300026078 Bacteria 4123
580 Ga0207702_10085078 3300026078 Bacteria 2755
581 Ga0207702_10095418 3300026078 Bacteria 2613
582 Ga0207702_10258301 3300026078 Bacteria 1639
583 Ga0207702_10401123 3300026078 Bacteria 1322
584 Ga0207702_10866328 3300026078 Bacteria 894
585 Ga0207702_10976553 3300026078 Bacteria 840
586 Ga0207702_11236913 3300026078 Bacteria 741
587 Ga0207702_11534067 3300026078 Bacteria 660
588 Ga0207702_12254025 3300026078 Bacteria 533
589 Ga0207641_10005346 3300026088 Bacteria 10965
590 Ga0207641_10021598 3300026088 Bacteria 5289
591 Ga0207641_10139167 3300026088 Bacteria 2188
592 Ga0207648_11286414 3300026089 Bacteria 687
593 Ga0207676_10002667 3300026095 Bacteria 12678
594 Ga0207676_10125439 3300026095 Bacteria 2173
595 Ga0207674_10000669 3300026116 Bacteria 44573
596 Ga0207674_10012983 3300026116 Bacteria 9285
597 Ga0207674_10120391 3300026116 Bacteria 2593
598 Ga0207674_10328801 3300026116 Bacteria 1478
599 Ga0207674_10525944 3300026116 Bacteria 1142
600 Ga0207674_10557698 3300026116 Bacteria 1107
601 Ga0207683_10028240 3300026121 Bacteria 4851
602 Ga0207683_10364041 3300026121 Bacteria 1328
603 Ga0207698_10000003 3300026142 Bacteria 321303
604 Ga0207698_10000225 3300026142 Bacteria 35169
605 Ga0207698_10003525 3300026142 Bacteria 9436
606 Ga0207698_10007959 3300026142 Bacteria 6677
607 Ga0207698_10045131 3300026142 Bacteria 3318
608 Ga0207698_10132091 3300026142 Bacteria 2135
609 Ga0207698_10165017 3300026142 Bacteria 1942
610 Ga0207698_10417287 3300026142 Bacteria 1287
611 Ga0207698_11190819 3300026142 Bacteria 776
612 Ga0268266_10005265 3300028379 Bacteria 12146
613 Ga0268266_10006399 3300028379 Bacteria 10792
614 Ga0268266_10014122 3300028379 Bacteria 6876
615 Ga0268266_10046731 3300028379 Bacteria 3706
616 Ga0268266_10173024 3300028379 Unclassified 1961
617 Ga0268266_10233875 3300028379 Bacteria 1693
618 Ga0268266_10256469 3300028379 Bacteria 1619
619 Ga0268266_10393919 3300028379 Bacteria 1308
620 Ga0268264_10000598 3300028381 Bacteria 43640
621 Ga0265319_1081737 3300028563 Bacteria 1026
622 Ga0265318_10006364 3300028577 Bacteria 5448
623 Ga0265336_10001048 3300028666 Bacteria 13512
624 Ga0265336_10005708 3300028666 Bacteria 4561
625 Ga0307517_10515974 3300028786 Bacteria 605
626 Ga0265338_10004495 3300028800 Bacteria 18805
627 Ga0265338_10009284 3300028800 Bacteria 11764
628 Ga0265338_10017734 3300028800 Bacteria 7656
629 Ga0265338_10158684 3300028800 Bacteria 1749
630 Ga0265338_10163443 3300028800 Bacteria 1717
631 Ga0265338_10259448 3300028800 Bacteria 1278
632 Ga0265338_10337026 3300028800 Bacteria 1088
633 Ga0265338_10721670 3300028800 Bacteria 687
634 Ga0265324_10137725 3300029957 Bacteria 829
635 Ga0307512_10315872 3300030522 Bacteria 715
636 Ga0265762_1176753 3300030760 Unclassified 523
637 Ga0265770_1105662 3300030878 Unclassified 578
638 Ga0265770_1122170 3300030878 Bacteria 549
639 Ga0265760_10086498 3300031090 Bacteria 976
640 Ga0265760_10141667 3300031090 Bacteria 783
641 Ga0265330_10000273 3300031235 Bacteria 38107
642 Ga0265330_10001219 3300031235 Bacteria 15180
643 Ga0265330_10013742 3300031235 Bacteria 3767
644 Ga0265330_10036360 3300031235 Bacteria 2196
645 Ga0265330_10097036 3300031235 Bacteria 1263
646 Ga0265330_10111823 3300031235 Unclassified 1166
647 Ga0265330_10245175 3300031235 Bacteria 755
648 Ga0265332_10025859 3300031238 Bacteria 2576
649 Ga0265332_10196168 3300031238 Bacteria 840
650 Ga0265328_10007521 3300031239 Bacteria 4537
651 Ga0265328_10015554 3300031239 Bacteria 2977
652 Ga0265328_10024482 3300031239 Bacteria 2280
653 Ga0265320_10003664 3300031240 Bacteria 10255
654 Ga0265320_10084221 3300031240 Bacteria 1481
655 Ga0265320_10249266 3300031240 Bacteria 788
656 Ga0265325_10000266 3300031241 Bacteria 37071
657 Ga0265325_10000695 3300031241 Bacteria 24506
658 Ga0265325_10005858 3300031241 Bacteria 7531
659 Ga0265325_10060625 3300031241 Bacteria 1921
660 Ga0265329_10003354 3300031242 Bacteria 7004
661 Ga0265340_10001072 3300031247 Bacteria 15563
662 Ga0265340_10019622 3300031247 Bacteria 3481
663 Ga0265340_10061429 3300031247 Bacteria 1797
664 Ga0265339_10000114 3300031249 Bacteria 65609
665 Ga0265339_10000124 3300031249 Bacteria 64124
666 Ga0265339_10000194 3300031249 Bacteria 50375
667 Ga0265339_10003213 3300031249 Bacteria 11471
668 Ga0265339_10005214 3300031249 Bacteria 8693
669 Ga0265339_10029804 3300031249 Bacteria 3093
670 Ga0265339_10037617 3300031249 Bacteria 2704
671 Ga0265339_10199047 3300031249 Bacteria 989
672 Ga0265339_10386727 3300031249 Bacteria 655
673 Ga0265331_10046545 3300031250 Bacteria 2090
674 Ga0265331_10094950 3300031250 Bacteria 1376
675 Ga0265331_10429126 3300031250 Bacteria 593
676 Ga0265331_10585898 3300031250 Bacteria 504
677 Ga0265327_10177457 3300031251 Bacteria 976
678 Ga0265316_10000712 3300031344 Bacteria 36687
679 Ga0265316_10003675 3300031344 Bacteria 15459
680 Ga0265316_10008382 3300031344 Bacteria 9600
681 Ga0265316_10022232 3300031344 Bacteria 5355
682 Ga0265316_10027725 3300031344 Bacteria 4683
683 Ga0265316_10048835 3300031344 Bacteria 3337
684 Ga0265316_10054568 3300031344 Bacteria 3128
685 Ga0265316_10169512 3300031344 Bacteria 1629
686 Ga0265316_10190926 3300031344 Bacteria 1522
687 Ga0265316_10192501 3300031344 Bacteria 1514
688 Ga0265316_10351036 3300031344 Bacteria 1068
689 Ga0265313_10013393 3300031595 Bacteria 4924
690 Ga0265313_10016618 3300031595 Bacteria 4223
691 Ga0265313_10018882 3300031595 Bacteria 3858
692 Ga0265313_10019581 3300031595 Bacteria 3761
693 Ga0265313_10028929 3300031595 Bacteria 2873
694 Ga0265314_10000504 3300031711 Bacteria 50376
695 Ga0265314_10002987 3300031711 Bacteria 16745
696 Ga0265314_10046866 3300031711 Bacteria 3047
697 Ga0265314_10080947 3300031711 Bacteria 2142
698 Ga0265314_10160089 3300031711 Bacteria 1371
699 Ga0265314_10288196 3300031711 Bacteria 926
700 Ga0265342_10000225 3300031712 Bacteria 63822
701 Ga0265342_10001536 3300031712 Bacteria 21355
702 Ga0265342_10004360 3300031712 Bacteria 11190
703 Ga0265342_10014131 3300031712 Bacteria 5311
704 Ga0265342_10015276 3300031712 Bacteria 5056
705 Ga0265342_10042663 3300031712 Bacteria 2740
706 Ga0265342_10113795 3300031712 Unclassified 1529
707 Ga0265342_10173752 3300031712 Bacteria 1183
708 Ga0316583_10181098 3300032133 Bacteria 733
709 Ga0307510_10010774 3300033180 Bacteria 10874
710 Ga0307510_10071804 3300033180 Bacteria 3444
711 Ga0307510_10220392 3300033180 Bacteria 1409
712 Ga0373923_0266985 3300035111 Bacteria 804
713 Ga0373936_0187261 3300035113 Bacteria 910
714 Ga0373943_0018586 3300035170 Bacteria 3195
715 Ga0373935_0251905 3300035692 Bacteria 1236
716 Ga0373927_0683844 3300035695 Bacteria 678
717 Ga0373933_0634675 3300035724 Bacteria 702
718 Ga0373947_0036325 3300035725 Bacteria 2922
719 Ga0373937_0138090 3300036401 Bacteria 2280
720 Ga0373937_0510221 3300036401 Bacteria 1142
721 Ga0373937_1742955 3300036401 Bacteria 570
722 Ga0395900_0849267 3300037418 Unclassified 839
723 Ga0395900_1361652 3300037418 Bacteria 623
724 Ga0395901_0583687 3300038443 Bacteria 1129
725 Ga0436360_0170154 3300039438 Bacteria 4187
726 Ga0436360_0361712 3300039438 Bacteria 4177
727 Ga0436360_0826850 3300039438 Bacteria 741
728 Ga0436360_0871656 3300039438 Bacteria 935
729 Ga0436360_1008743 3300039438 Bacteria 877
730 Ga0436360_1308109 3300039438 Bacteria 562
731 Ga0436361_0226605 3300039447 Bacteria 1330
732 Ga0436361_0318263 3300039447 Bacteria 10520
733 Ga0436361_0526984 3300039447 Bacteria 4268
734 Ga0436361_0585232 3300039447 Bacteria 1108
735 Ga0436361_0757992 3300039447 Bacteria 2636
736 Ga0436361_0776284 3300039447 Bacteria 1039
737 Ga0436363_0701240 3300039450 Bacteria 842
738 Ga0451839_0265344 3300041496 Bacteria 530
739 Ga0451839_0397595 3300041496 Bacteria 533
740 Ga0439448_0148476 3300042005 Bacteria 813
741 Ga0451577_0979553 3300042876 Bacteria 760
742 Ga0466969_0299729 3300044656 Bacteria 727
743 Ga0466969_0533994 3300044656 Bacteria 536
744 Ga0453683_0515345 3300044673 Bacteria 777
745 Ga0466966_0043334 3300044684 Bacteria 2885
746 Ga0466966_0201614 3300044684 Bacteria 1204
747 Ga0466961_0062967 3300044693 Bacteria 2357
748 Ga0466961_0372195 3300044693 Bacteria 868
749 Ga0466961_0499937 3300044693 Bacteria 734
750 Ga0466963_0000494 3300044694 Bacteria 18341
751 Ga0466963_0732759 3300044694 Bacteria 697
752 Ga0466957_0445001 3300044842 Bacteria 892
753 Ga0466957_0972147 3300044842 Bacteria 609
754 Ga0466959_0159618 3300045049 Bacteria 1586
755 Ga0466959_0254613 3300045049 Bacteria 1210
756 Ga0466959_1198274 3300045049 Bacteria 505
757 Ga0466958_0372077 3300045836 Bacteria 921
758 Ga0466967_0001401 3300045976 Bacteria 13938
759 Ga0466967_0226226 3300045976 Bacteria 1780
760 Ga0466967_0433944 3300045976 Unclassified 1282
761 Ga0466967_0549800 3300045976 Bacteria 1136
762 Ga0495617_242766 3300046452 Bacteria 556
763 Ga0495592_0170605 3300046454 Bacteria 1490
764 Ga0495592_0361325 3300046454 Bacteria 928
765 Ga0495592_0378286 3300046454 Bacteria 902
766 Ga0495603_0111033 3300046455 Bacteria 1599
767 Ga0495603_0122471 3300046455 Bacteria 1515
768 Ga0495629_0018026 3300046459 Bacteria 5060
769 Ga0495638_0447890 3300046460 Bacteria 660
770 Ga0495651_0015018 3300046462 Bacteria 5985
771 Ga0495651_0031839 3300046462 Bacteria 4112
772 Ga0495653_0010749 3300046463 Bacteria 7495
773 Ga0495650_0000038 3300046471 Bacteria 377530
774 Ga0495650_0008733 3300046471 Bacteria 5865
775 Ga0495580_0097351 3300046472 Bacteria 2046
776 Ga0495582_0049065 3300046473 Bacteria 2325
777 Ga0495639_0001675 3300046475 Bacteria 9836
778 Ga0495662_0005660 3300046476 Bacteria 6246
779 Ga0495664_0001348 3300046477 Bacteria 12929
780 Ga0495664_0028071 3300046477 Bacteria 3285
781 Ga0495664_0045809 3300046477 Bacteria 2594
782 Ga0495664_0209206 3300046477 Bacteria 1181
783 Ga0495585_0016774 3300046492 Bacteria 4243
784 Ga0495594_0000388 3300046499 Bacteria 22139
785 Ga0495594_0001190 3300046499 Bacteria 13614
786 Ga0495594_0881111 3300046499 Bacteria 503
787 Ga0495583_0013317 3300046506 Bacteria 4593
788 Ga0495583_0033314 3300046506 Bacteria 2478
789 Ga0495606_0077834 3300046507 Bacteria 2070
790 Ga0495606_0095370 3300046507 Bacteria 1822
791 Ga0495606_0162623 3300046507 Bacteria 1301
792 Ga0495606_0216104 3300046507 Bacteria 1083
793 Ga0495628_0007402 3300046516 Bacteria 9504
794 Ga0495628_0011061 3300046516 Bacteria 7637
795 Ga0495628_0694799 3300046516 Bacteria 719
796 Ga0495630_0264458 3300046517 Bacteria 1314
797 Ga0495631_0051109 3300046518 Bacteria 1807
798 Ga0495631_0241780 3300046518 Bacteria 770
799 Ga0495632_0301110 3300046519 Bacteria 711
800 Ga0495644_0000048 3300046523 Bacteria 57696
801 Ga0495648_0167762 3300046524 Bacteria 1128
802 Ga0495648_0207165 3300046524 Bacteria 977
803 Ga0495666_0001196 3300046526 Bacteria 12524
804 Ga0495642_0009023 3300046528 Bacteria 3816
805 Ga0495642_0389701 3300046528 Bacteria 614
806 Ga0495652_0009907 3300046529 Bacteria 8641
807 Ga0495652_0039259 3300046529 Bacteria 4093
808 Ga0495652_0448030 3300046529 Bacteria 904
809 Ga0495652_0620027 3300046529 Bacteria 736
810 Ga0495665_0001828 3300046531 Bacteria 11486
811 Ga0495665_0321308 3300046531 Bacteria 790
812 Ga0495640_0060924 3300046533 Bacteria 2565
813 Ga0495640_0096637 3300046533 Bacteria 1943
814 Ga0495586_0163121 3300046535 Bacteria 1257
815 Ga0495586_0521142 3300046535 Bacteria 686
816 Ga0495587_0008155 3300046536 Bacteria 6753
817 Ga0495609_0036518 3300046538 Bacteria 2218
818 Ga0495609_0180783 3300046538 Bacteria 888
819 Ga0495609_0326845 3300046538 Bacteria 621
820 Ga0495645_0001770 3300046543 Bacteria 14694
821 Ga0495645_0005517 3300046543 Bacteria 8694
822 Ga0495645_0007804 3300046543 Bacteria 7444
823 Ga0495645_0022284 3300046543 Bacteria 4582
824 Ga0495667_0084571 3300046559 Bacteria 2059
825 Ga0495667_0374459 3300046559 Bacteria 898
826 Ga0495668_0044535 3300046616 Bacteria 2466
827 Ga0495668_0514669 3300046616 Bacteria 660
828 Ga0495634_0006225 3300046642 Bacteria 9093
829 Ga0495611_0383414 3300046648 Bacteria 643
830 Ga0495625_0000985 3300046660 Bacteria 37750
831 Ga0495625_0007833 3300046660 Bacteria 9208
832 Ga0495625_0019175 3300046660 Bacteria 5316
833 Ga0495625_0045052 3300046660 Bacteria 3191
834 Ga0495625_0511048 3300046660 Bacteria 733
835 Ga0495635_0002836 3300046663 Bacteria 11904
836 Ga0495635_0086686 3300046663 Bacteria 2142
837 Ga0495635_0470186 3300046663 Bacteria 830
838 Ga0495659_0066790 3300046664 Bacteria 1340
839 Ga0495588_0028867 3300046674 Bacteria 2780
840 Ga0495657_0467111 3300046675 Bacteria 738
841 Ga0495599_0017587 3300046678 Bacteria 4445
842 Ga0495599_0051590 3300046678 Bacteria 2577
843 Ga0495599_0605156 3300046678 Bacteria 638
844 Ga0495623_0050948 3300046679 Bacteria 2621
845 Ga0495623_0056771 3300046679 Bacteria 2464
846 Ga0495623_0058009 3300046679 Bacteria 2435
847 Ga0495623_0082244 3300046679 Bacteria 1990
848 Ga0495646_0077284 3300046680 Bacteria 1947
849 Ga0495646_0124321 3300046680 Bacteria 1457
850 Ga0495646_0346219 3300046680 Bacteria 779
851 Ga0495646_0450865 3300046680 Bacteria 664
852 Ga0495646_0542208 3300046680 Bacteria 594
853 Ga0495669_0004252 3300046684 Bacteria 5901
854 Ga0495613_0003966 3300046689 Bacteria 11081
855 Ga0495613_0012222 3300046689 Bacteria 6380
856 Ga0495624_0007524 3300046690 Bacteria 7641
857 Ga0495670_0038859 3300046691 Bacteria 2373
858 Ga0495671_0153236 3300046692 Bacteria 1122
859 Ga0495671_0493283 3300046692 Bacteria 584
860 Ga0495649_0064738 3300046694 Bacteria 1963
861 Ga0495649_0490026 3300046694 Bacteria 612
862 Ga0495600_0002909 3300046809 Bacteria 9975
863 Ga0495600_0302730 3300046809 Bacteria 1008
864 Ga0495581_0050879 3300047315 Bacteria 2393
865 Ga0495581_0245692 3300047315 Bacteria 1046
866 Ga0495581_0366883 3300047315 Bacteria 840
867 Ga0495581_0885072 3300047315 Bacteria 510
868 Ga0495604_0002834 3300047317 Bacteria 13912
869 Ga0495604_0015522 3300047317 Bacteria 6079
870 Ga0495604_0069051 3300047317 Bacteria 2679
871 Ga0495636_0056644 3300047318 Bacteria 1651
872 Ga0495674_0014334 3300047319 Bacteria 7423
873 Ga0495674_0152317 3300047319 Bacteria 1938
874 Ga0495674_0539358 3300047319 Unclassified 930
875 Ga0495672_0030990 3300047320 Bacteria 3344
876 Ga0495676_0008961 3300047321 Bacteria 9134
877 Ga0495676_0114867 3300047321 Bacteria 1969
878 Ga0495680_0076425 3300047322 Bacteria 2539
879 Ga0495675_0003222 3300047444 Bacteria 9816
880 Ga0495675_0012790 3300047444 Bacteria 5286
881 Ga0495677_0020984 3300047445 Bacteria 2368
882 Ga0495673_0072246 3300047469 Bacteria 1449
883 Ga0495684_0049723 3300047471 Bacteria 3203
884 Ga0495684_0101338 3300047471 Bacteria 2177
885 Ga0495686_0004566 3300047472 Bacteria 11335
886 Ga0495686_0008419 3300047472 Bacteria 7568
887 Ga0495686_0012438 3300047472 Bacteria 5951
888 Ga0495686_0014007 3300047472 Bacteria 5541
889 Ga0495686_0044764 3300047472 Bacteria 2801
890 Ga0495686_0067112 3300047472 Bacteria 2215
891 Ga0495686_0187235 3300047472 Bacteria 1195
892 Ga0495593_0019638 3300047673 Bacteria 3788
893 Ga0495593_0040852 3300047673 Bacteria 2496
894 Ga0495602_0773591 3300048088 Bacteria 646
895 Ga0495614_0000972 3300048089 Bacteria 12208
896 Ga0496100_0575375 3300048903 Bacteria 873
897 Ga0496100_1034106 3300048903 Bacteria 647
898 Ga0496101_0659155 3300048904 Bacteria 827
899 Ga0496102_0777646 3300048905 Bacteria 880
900 Ga0496103_0741566 3300048906 Bacteria 621
901 Ga0496104_0000053 3300048907 Bacteria 135895
902 Ga0496104_0057613 3300048907 Bacteria 3676
903 Ga0496104_0875113 3300048907 Bacteria 804
904 Ga0496108_0111209 3300048911 Bacteria 2343
905 Ga0496112_0165026 3300048915 Bacteria 2181
906 Ga0496114_0096351 3300048917 Bacteria 2519
907 Ga0496115_0202171 3300048918 Bacteria 1641
908 Ga0496115_0301250 3300048918 Bacteria 1313
909 Ga0496120_0134276 3300048923 Bacteria 1264
910 Ga0496120_0260024 3300048923 Bacteria 811
911 Ga0496121_0492821 3300048924 Bacteria 780
912 Ga0496126_0000014 3300048929 Bacteria 686881
913 Ga0496126_0000154 3300048929 Bacteria 159983
914 Ga0496126_0739092 3300048929 Bacteria 761
915 Ga0496126_1287352 3300048929 Unclassified 533
916 Ga0495682_0041693 3300049460 Bacteria 1682
917 Ga0501031_0027688 3300049568 Bacteria 3695
918 Ga0501032_0001912 3300049569 Bacteria 16446
919 Ga0501033_0010946 3300049570 Bacteria 6952
920 Ga0501033_0045842 3300049570 Bacteria 3253
921 Ga0501034_0014111 3300049571 Bacteria 8232
922 Ga0501037_0025359 3300049573 Bacteria 4381
923 Ga0501037_0471859 3300049573 Bacteria 854
924 Ga0501038_0033174 3300049574 Bacteria 4548
925 Ga0501038_0098016 3300049574 Bacteria 2445
926 Ga0501038_0110075 3300049574 Bacteria 2283
927 Ga0501039_0154809 3300049575 Bacteria 1801
928 Ga0501043_0057147 3300049579 Bacteria 3064
929 Ga0501046_0000056 3300049580 Bacteria 129342
930 Ga0501047_0008947 3300049581 Bacteria 9454
931 Ga0501047_0017729 3300049581 Bacteria 6821
932 Ga0501070_0124247 3300049586 Bacteria 2133
933 Ga0501070_0254155 3300049586 Bacteria 1437
934 Ga0501073_0008329 3300049589 Bacteria 7690
935 Ga0501073_1108370 3300049589 Bacteria 544
936 Ga0501074_0524312 3300049590 Bacteria 839
937 Ga0501079_0275238 3300049741 Bacteria 1316
938 Ga0501080_0310054 3300049742 Bacteria 1430
939 Ga0501080_0960686 3300049742 Bacteria 743
940 Ga0501035_0086954 3300049822 Bacteria 2754
941 Ga0501035_0350448 3300049822 Bacteria 1235
942 Ga0501044_0171643 3300049823 Bacteria 2140
943 Ga0501044_0184233 3300049823 Bacteria 2053
944 nmdc:mga08x19_161497_c1 3300050514 Bacteria 1522
945 nmdc:mga08x19_164936_c1 3300050514 Bacteria 1506
946 nmdc:mga08x19_30704_c1 3300050514 Bacteria 3377
947 Ga0495612_0308136 3300053078 Bacteria 711
948 Ga0500643_028144 3300053087 Bacteria 1740
949 Ga0500644_0156516 3300053088 Bacteria 918
950 Ga0500651_0000005 3300053093 Bacteria 384761
951 Ga0500595_000004 3300053119 Bacteria 410922
952 Ga0500595_013665 3300053119 Bacteria 3105
953 Ga0500595_016226 3300053119 Bacteria 2778
954 Ga0500661_001216 3300055283 Bacteria 4809

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10753952 Ga0157375_107539522 89
2 3300046528 Ga0495642_0389701 Ga0495642_0389701_195_533 102
3 3300049568 Ga0501031_0027688 Ga0501031_0027688_2001_2399 106
4 3300049569 Ga0501032_0001912 Ga0501032_0001912_10909_11307 106
5 3300049570 Ga0501033_0010946 Ga0501033_0010946_1904_2302 106
6 3300049571 Ga0501034_0014111 Ga0501034_0014111_2568_2966 106
7 3300049573 Ga0501037_0025359 Ga0501037_0025359_683_1081 106
8 3300049574 Ga0501038_0033174 Ga0501038_0033174_2777_3175 106
9 3300049575 Ga0501039_0154809 Ga0501039_0154809_1176_1574 106
10 3300049579 Ga0501043_0057147 Ga0501043_0057147_1236_1634 106
11 3300049580 Ga0501046_0000056 Ga0501046_0000056_51109_51507 106
12 3300049581 Ga0501047_0008947 Ga0501047_0008947_810_1208 106
13 3300049589 Ga0501073_0008329 Ga0501073_0008329_6894_7292 106
14 3300049590 Ga0501074_0524312 Ga0501074_0524312_187_585 106
15 3300049741 Ga0501079_0275238 Ga0501079_0275238_207_605 106
16 3300049742 Ga0501080_0310054 Ga0501080_0310054_131_529 106
17 3300049822 Ga0501035_0086954 Ga0501035_0086954_868_1266 106
18 3300049823 Ga0501044_0184233 Ga0501044_0184233_419_817 106
19 3300003323 rootH1_10203955 rootH1_102039552 107
20 3300005327 Ga0070658_10150612 Ga0070658_101506123 107
21 3300005329 Ga0070683_100779235 Ga0070683_1007792352 107
22 3300005336 Ga0070680_100007018 Ga0070680_1000070182 107
23 3300005339 Ga0070660_100008313 Ga0070660_1000083138 107
24 3300005434 Ga0070709_11714150 Ga0070709_117141501 107
25 3300005436 Ga0070713_100095055 Ga0070713_1000950552 107
26 3300005439 Ga0070711_100547276 Ga0070711_1005472762 107
27 3300005458 Ga0070681_10001050 Ga0070681_1000105015 107
28 3300005530 Ga0070679_100006128 Ga0070679_10000612812 107
29 3300005535 Ga0070684_100782645 Ga0070684_1007826451 107
30 3300005539 Ga0068853_100178099 Ga0068853_1001780993 107
31 3300005539 Ga0068853_101323874 Ga0068853_1013238742 107
32 3300005563 Ga0068855_100022187 Ga0068855_1000221875 107
33 3300005577 Ga0068857_100013234 Ga0068857_1000132345 107
34 3300005614 Ga0068856_100028379 Ga0068856_1000283793 107
35 3300005616 Ga0068852_100001535 Ga0068852_10000153511 107
36 3300006175 Ga0070712_100122617 Ga0070712_1001226172 107
37 3300009093 Ga0105240_10001875 Ga0105240_1000187521 107
38 3300009545 Ga0105237_11092793 Ga0105237_110927932 107
39 3300009551 Ga0105238_10016125 Ga0105238_100161255 107
40 3300009553 Ga0105249_10067686 Ga0105249_100676863 107
41 3300013102 Ga0157371_10030600 Ga0157371_100306001 107
42 3300013104 Ga0157370_10210145 Ga0157370_102101451 107
43 3300013105 Ga0157369_10067688 Ga0157369_100676884 107
44 3300013296 Ga0157374_10025961 Ga0157374_100259613 107
45 3300013307 Ga0157372_10007271 Ga0157372_1000727110 107
46 3300014968 Ga0157379_10043255 Ga0157379_100432554 107
47 3300014968 Ga0157379_10393819 Ga0157379_103938192 107
48 3300025906 Ga0207699_11185985 Ga0207699_111859851 107
49 3300025909 Ga0207705_10031673 Ga0207705_100316733 107
50 3300025912 Ga0207707_10003864 Ga0207707_1000386414 107
51 3300025913 Ga0207695_10001762 Ga0207695_1000176224 107
52 3300025915 Ga0207693_10195339 Ga0207693_101953392 107
53 3300025917 Ga0207660_10529731 Ga0207660_105297311 107
54 3300025919 Ga0207657_10004623 Ga0207657_100046236 107
55 3300025920 Ga0207649_11594458 Ga0207649_115944581 107
56 3300025921 Ga0207652_10001535 Ga0207652_1000153514 107
57 3300025924 Ga0207694_10042410 Ga0207694_100424102 107
58 3300025928 Ga0207700_10159411 Ga0207700_101594112 107
59 3300025944 Ga0207661_10220368 Ga0207661_102203682 107
60 3300025949 Ga0207667_10000468 Ga0207667_100004687 107
61 3300025961 Ga0207712_10040395 Ga0207712_100403953 107
62 3300026041 Ga0207639_10287632 Ga0207639_102876322 107
63 3300026142 Ga0207698_10003525 Ga0207698_1000352511 107
64 3300028563 Ga0265319_1081737 Ga0265319_10817372 107
65 3300028577 Ga0265318_10006364 Ga0265318_100063645 107
66 3300028666 Ga0265336_10001048 Ga0265336_1000104812 107
67 3300028666 Ga0265336_10005708 Ga0265336_100057086 107
68 3300028800 Ga0265338_10009284 Ga0265338_1000928411 107
69 3300028800 Ga0265338_10017734 Ga0265338_100177349 107
70 3300029957 Ga0265324_10137725 Ga0265324_101377252 107
71 3300031235 Ga0265330_10001219 Ga0265330_1000121911 107
72 3300031235 Ga0265330_10111823 Ga0265330_101118231 107
73 3300031238 Ga0265332_10025859 Ga0265332_100258593 107
74 3300031239 Ga0265328_10007521 Ga0265328_100075213 107
75 3300031239 Ga0265328_10024482 Ga0265328_100244822 107
76 3300031240 Ga0265320_10003664 Ga0265320_100036643 107
77 3300031241 Ga0265325_10000695 Ga0265325_100006958 107
78 3300031242 Ga0265329_10003354 Ga0265329_100033545 107
79 3300031247 Ga0265340_10001072 Ga0265340_100010725 107
80 3300031249 Ga0265339_10000114 Ga0265339_1000011461 107
81 3300031249 Ga0265339_10000124 Ga0265339_1000012413 107
82 3300031249 Ga0265339_10003213 Ga0265339_100032138 107
83 3300031250 Ga0265331_10094950 Ga0265331_100949502 107
84 3300031251 Ga0265327_10177457 Ga0265327_101774572 107
85 3300031344 Ga0265316_10000712 Ga0265316_1000071229 107
86 3300031344 Ga0265316_10054568 Ga0265316_100545683 107
87 3300031595 Ga0265313_10013393 Ga0265313_100133933 107
88 3300031711 Ga0265314_10000504 Ga0265314_100005048 107
89 3300031711 Ga0265314_10002987 Ga0265314_1000298713 107
90 3300031712 Ga0265342_10004360 Ga0265342_100043603 107
91 3300031712 Ga0265342_10042663 Ga0265342_100426633 107
92 3300036401 Ga0373937_0138090 Ga0373937_0138090_1587_1940 107
93 3300037418 Ga0395900_0849267 Ga0395900_0849267_247_600 107
94 3300038443 Ga0395901_0583687 Ga0395901_0583687_73_426 107
95 3300042876 Ga0451577_0979553 Ga0451577_0979553_265_618 107
96 3300044673 Ga0453683_0515345 Ga0453683_0515345_124_477 107
97 3300047472 Ga0495686_0004566 Ga0495686_0004566_6522_6854 107
98 3300048907 Ga0496104_0000053 Ga0496104_0000053_121504_121839 107
99 3300003320 rootH2_10171401 rootH2_101714014 108
100 3300005329 Ga0070683_100015398 Ga0070683_1000153986 108
101 3300005436 Ga0070713_100423960 Ga0070713_1004239601 108
102 3300005535 Ga0070684_100016109 Ga0070684_1000161096 108
103 3300005563 Ga0068855_100057885 Ga0068855_1000578852 108
104 3300005616 Ga0068852_100027564 Ga0068852_1000275641 108
105 3300006028 Ga0070717_10011904 Ga0070717_100119042 108
106 3300006175 Ga0070712_101995940 Ga0070712_1019959401 108
107 3300006914 Ga0075436_100198902 Ga0075436_1001989022 108
108 3300009551 Ga0105238_10145620 Ga0105238_101456202 108
109 3300013104 Ga0157370_10010879 Ga0157370_100108792 108
110 3300013105 Ga0157369_10010533 Ga0157369_1001053315 108
111 3300013105 Ga0157369_10042189 Ga0157369_100421892 108
112 3300013296 Ga0157374_10664257 Ga0157374_106642571 108
113 3300013307 Ga0157372_10048038 Ga0157372_100480382 108
114 3300025924 Ga0207694_10924621 Ga0207694_109246212 108
115 3300025928 Ga0207700_10214980 Ga0207700_102149802 108
116 3300025929 Ga0207664_10068128 Ga0207664_100681282 108
117 3300025944 Ga0207661_10010483 Ga0207661_100104833 108
118 3300025949 Ga0207667_10774145 Ga0207667_107741452 108
119 3300026078 Ga0207702_10401123 Ga0207702_104011231 108
120 3300026078 Ga0207702_11534067 Ga0207702_115340672 108
121 3300028800 Ga0265338_10004495 Ga0265338_100044955 108
122 3300031235 Ga0265330_10036360 Ga0265330_100363601 108
123 3300031235 Ga0265330_10245175 Ga0265330_102451751 108
124 3300031240 Ga0265320_10084221 Ga0265320_100842212 108
125 3300031249 Ga0265339_10037617 Ga0265339_100376173 108
126 3300031249 Ga0265339_10199047 Ga0265339_101990472 108
127 3300031249 Ga0265339_10386727 Ga0265339_103867271 108
128 3300031250 Ga0265331_10046545 Ga0265331_100465452 108
129 3300031344 Ga0265316_10169512 Ga0265316_101695122 108
130 3300031595 Ga0265313_10016618 Ga0265313_100166183 108
131 3300031595 Ga0265313_10019581 Ga0265313_100195811 108
132 3300031712 Ga0265342_10173752 Ga0265342_101737521 108
133 3300035170 Ga0373943_0018586 Ga0373943_0018586_641_1048 108
134 3300035692 Ga0373935_0251905 Ga0373935_0251905_255_662 108
135 3300035725 Ga0373947_0036325 Ga0373947_0036325_520_927 108
136 3300039447 Ga0436361_0585232 Ga0436361_0585232_461_802 108
137 3300039450 Ga0436363_0701240 Ga0436363_0701240_370_717 108
138 3300041496 Ga0451839_0265344 Ga0451839_0265344_97_453 108
139 3300044656 Ga0466969_0299729 Ga0466969_0299729_35_376 108
140 3300044684 Ga0466966_0201614 Ga0466966_0201614_14_361 108
141 3300044693 Ga0466961_0062967 Ga0466961_0062967_467_814 108
142 3300044693 Ga0466961_0372195 Ga0466961_0372195_222_569 108
143 3300044693 Ga0466961_0499937 Ga0466961_0499937_184_525 108
144 3300044842 Ga0466957_0972147 Ga0466957_0972147_131_478 108
145 3300045049 Ga0466959_0159618 Ga0466959_0159618_194_541 108
146 3300045049 Ga0466959_1198274 Ga0466959_1198274_28_375 108
147 3300045976 Ga0466967_0433944 Ga0466967_0433944_698_1045 108
148 3300045976 Ga0466967_0549800 Ga0466967_0549800_689_1036 108
149 3300046477 Ga0495664_0028071 Ga0495664_0028071_1115_1462 108
150 3300046499 Ga0495594_0881111 Ga0495594_0881111_64_405 108
151 3300046529 Ga0495652_0620027 Ga0495652_0620027_108_455 108
152 3300046535 Ga0495586_0521142 Ga0495586_0521142_286_627 108
153 3300046543 Ga0495645_0005517 Ga0495645_0005517_7778_8125 108
154 3300046663 Ga0495635_0470186 Ga0495635_0470186_416_763 108
155 3300046679 Ga0495623_0058009 Ga0495623_0058009_2012_2359 108
156 3300046680 Ga0495646_0346219 Ga0495646_0346219_22_369 108
157 3300047315 Ga0495581_0050879 Ga0495581_0050879_1005_1352 108
158 3300047315 Ga0495581_0885072 Ga0495581_0885072_67_408 108
159 3300047319 Ga0495674_0539358 Ga0495674_0539358_315_656 108
160 3300047444 Ga0495675_0012790 Ga0495675_0012790_3835_4182 108
161 3300047472 Ga0495686_0012438 Ga0495686_0012438_2693_3028 108
162 3300047472 Ga0495686_0044764 Ga0495686_0044764_2340_2699 108
163 3300047472 Ga0495686_0187235 Ga0495686_0187235_569_904 108
164 3300048923 Ga0496120_0260024 Ga0496120_0260024_59_478 108
165 3300050514 nmdc:mga08x19_161497_c1 nmdc:mga08x19_161497_c1_618_965 108
166 3300050514 nmdc:mga08x19_164936_c1 nmdc:mga08x19_164936_c1_508_855 108
167 3300050514 nmdc:mga08x19_30704_c1 nmdc:mga08x19_30704_c1_1469_1816 108
168 3300005366 Ga0070659_100004580 Ga0070659_1000045805 109
169 3300005455 Ga0070663_100019345 Ga0070663_1000193454 109
170 3300005539 Ga0068853_100000367 Ga0068853_10000036728 109
171 3300005548 Ga0070665_100431607 Ga0070665_1004316072 109
172 3300005548 Ga0070665_101341878 Ga0070665_1013418782 109
173 3300005578 Ga0068854_100000019 Ga0068854_100000019100 109
174 3300005842 Ga0068858_100015914 Ga0068858_1000159144 109
175 3300009093 Ga0105240_10010838 Ga0105240_1001083810 109
176 3300009093 Ga0105240_10714988 Ga0105240_107149882 109
177 3300009177 Ga0105248_11168149 Ga0105248_111681492 109
178 3300009551 Ga0105238_10051802 Ga0105238_100518024 109
179 3300013104 Ga0157370_10012988 Ga0157370_100129886 109
180 3300013104 Ga0157370_11601331 Ga0157370_116013312 109
181 3300013306 Ga0163162_13191369 Ga0163162_131913691 109
182 3300013307 Ga0157372_11069037 Ga0157372_110690371 109
183 3300013308 Ga0157375_10264835 Ga0157375_102648353 109
184 3300021361 Ga0213872_10025009 Ga0213872_100250093 109
185 3300021361 Ga0213872_10062353 Ga0213872_100623532 109
186 3300021361 Ga0213872_10410650 Ga0213872_104106501 109
187 3300021441 Ga0213871_10039548 Ga0213871_100395482 109
188 3300025913 Ga0207695_10050757 Ga0207695_100507572 109
189 3300025914 Ga0207671_10285240 Ga0207671_102852402 109
190 3300025919 Ga0207657_10019482 Ga0207657_100194826 109
191 3300025924 Ga0207694_10007157 Ga0207694_100071576 109
192 3300025932 Ga0207690_10010429 Ga0207690_100104295 109
193 3300025981 Ga0207640_10000028 Ga0207640_1000002816 109
194 3300026035 Ga0207703_10133597 Ga0207703_101335972 109
195 3300026041 Ga0207639_10000371 Ga0207639_100003717 109
196 3300026067 Ga0207678_10036879 Ga0207678_100368794 109
197 3300028379 Ga0268266_10393919 Ga0268266_103939191 109
198 3300036401 Ga0373937_1742955 Ga0373937_1742955_50_409 109
199 3300039438 Ga0436360_0170154 Ga0436360_0170154_3678_4043 109
200 3300039438 Ga0436360_0361712 Ga0436360_0361712_3618_3983 109
201 3300039438 Ga0436360_0826850 Ga0436360_0826850_232_597 109
202 3300039438 Ga0436360_0871656 Ga0436360_0871656_21_386 109
203 3300039438 Ga0436360_1008743 Ga0436360_1008743_181_555 109
204 3300039438 Ga0436360_1308109 Ga0436360_1308109_100_459 109
205 3300039447 Ga0436361_0226605 Ga0436361_0226605_235_600 109
206 3300039447 Ga0436361_0318263 Ga0436361_0318263_129_494 109
207 3300039447 Ga0436361_0526984 Ga0436361_0526984_287_652 109
208 3300039447 Ga0436361_0757992 Ga0436361_0757992_454_819 109
209 3300039447 Ga0436361_0776284 Ga0436361_0776284_295_660 109
210 3300046660 Ga0495625_0045052 Ga0495625_0045052_2070_2408 109
211 3300047472 Ga0495686_0008419 Ga0495686_0008419_6375_6722 109
212 3300048911 Ga0496108_0111209 Ga0496108_0111209_544_906 109
213 3300048918 Ga0496115_0301250 Ga0496115_0301250_262_624 109
214 3300053119 Ga0500595_000004 Ga0500595_000004_244876_245229 109
215 3300000546 LJNas_1006912 LJNas_10069122 110
216 3300001991 JGI24743J22301_10071283 JGI24743J22301_100712832 110
217 3300005327 Ga0070658_10000121 Ga0070658_1000012112 110
218 3300005327 Ga0070658_10013505 Ga0070658_100135055 110
219 3300005327 Ga0070658_10037114 Ga0070658_100371144 110
220 3300005327 Ga0070658_10038584 Ga0070658_100385846 110
221 3300005327 Ga0070658_10049430 Ga0070658_100494304 110
222 3300005327 Ga0070658_10134937 Ga0070658_101349373 110
223 3300005327 Ga0070658_10341705 Ga0070658_103417052 110
224 3300005327 Ga0070658_10429461 Ga0070658_104294611 110
225 3300005327 Ga0070658_10921455 Ga0070658_109214552 110
226 3300005328 Ga0070676_10229857 Ga0070676_102298571 110
227 3300005329 Ga0070683_100002041 Ga0070683_10000204114 110
228 3300005329 Ga0070683_100015021 Ga0070683_1000150213 110
229 3300005329 Ga0070683_100028772 Ga0070683_1000287722 110
230 3300005329 Ga0070683_100135740 Ga0070683_1001357402 110
231 3300005329 Ga0070683_100183443 Ga0070683_1001834432 110
232 3300005329 Ga0070683_100898533 Ga0070683_1008985332 110
233 3300005331 Ga0070670_100005099 Ga0070670_1000050995 110
234 3300005334 Ga0068869_100002456 Ga0068869_1000024566 110
235 3300005334 Ga0068869_100503734 Ga0068869_1005037342 110
236 3300005335 Ga0070666_10071003 Ga0070666_100710033 110
237 3300005335 Ga0070666_10285534 Ga0070666_102855342 110
238 3300005336 Ga0070680_100032000 Ga0070680_1000320002 110
239 3300005337 Ga0070682_100345088 Ga0070682_1003450881 110
240 3300005338 Ga0068868_100000066 Ga0068868_10000006632 110
241 3300005338 Ga0068868_100030705 Ga0068868_1000307055 110
242 3300005338 Ga0068868_100202417 Ga0068868_1002024172 110
243 3300005338 Ga0068868_100251736 Ga0068868_1002517362 110
244 3300005338 Ga0068868_100955371 Ga0068868_1009553712 110
245 3300005339 Ga0070660_100185531 Ga0070660_1001855312 110
246 3300005339 Ga0070660_101936061 Ga0070660_1019360611 110
247 3300005341 Ga0070691_10410588 Ga0070691_104105881 110
248 3300005341 Ga0070691_10820556 Ga0070691_108205561 110
249 3300005344 Ga0070661_100016527 Ga0070661_1000165271 110
250 3300005344 Ga0070661_100018919 Ga0070661_1000189193 110
251 3300005344 Ga0070661_100111867 Ga0070661_1001118672 110
252 3300005344 Ga0070661_100112059 Ga0070661_1001120592 110
253 3300005344 Ga0070661_100198292 Ga0070661_1001982922 110
254 3300005344 Ga0070661_100230310 Ga0070661_1002303102 110
255 3300005344 Ga0070661_100542850 Ga0070661_1005428502 110
256 3300005344 Ga0070661_100838680 Ga0070661_1008386801 110
257 3300005344 Ga0070661_101035467 Ga0070661_1010354671 110
258 3300005344 Ga0070661_101631218 Ga0070661_1016312181 110
259 3300005345 Ga0070692_10972062 Ga0070692_109720622 110
260 3300005347 Ga0070668_100215320 Ga0070668_1002153202 110
261 3300005353 Ga0070669_101089400 Ga0070669_1010894001 110
262 3300005355 Ga0070671_100000411 Ga0070671_10000041126 110
263 3300005355 Ga0070671_100003123 Ga0070671_1000031236 110
264 3300005355 Ga0070671_100027039 Ga0070671_1000270393 110
265 3300005356 Ga0070674_100431124 Ga0070674_1004311242 110
266 3300005366 Ga0070659_100030029 Ga0070659_1000300294 110
267 3300005367 Ga0070667_100002645 Ga0070667_10000264510 110
268 3300005434 Ga0070709_10949888 Ga0070709_109498882 110
269 3300005435 Ga0070714_100002654 Ga0070714_1000026544 110
270 3300005435 Ga0070714_100099406 Ga0070714_1000994062 110
271 3300005436 Ga0070713_100033702 Ga0070713_1000337022 110
272 3300005436 Ga0070713_100306613 Ga0070713_1003066132 110
273 3300005436 Ga0070713_100374302 Ga0070713_1003743021 110
274 3300005436 Ga0070713_100980652 Ga0070713_1009806522 110
275 3300005436 Ga0070713_101505149 Ga0070713_1015051491 110
276 3300005437 Ga0070710_10226393 Ga0070710_102263931 110
277 3300005439 Ga0070711_100316224 Ga0070711_1003162242 110
278 3300005439 Ga0070711_100733469 Ga0070711_1007334692 110
279 3300005455 Ga0070663_100019192 Ga0070663_1000191921 110
280 3300005455 Ga0070663_100070653 Ga0070663_1000706531 110
281 3300005455 Ga0070663_100143609 Ga0070663_1001436091 110
282 3300005456 Ga0070678_100854730 Ga0070678_1008547302 110
283 3300005456 Ga0070678_101766683 Ga0070678_1017666831 110
284 3300005458 Ga0070681_10053249 Ga0070681_100532494 110
285 3300005458 Ga0070681_10103095 Ga0070681_101030953 110
286 3300005458 Ga0070681_10215158 Ga0070681_102151582 110
287 3300005530 Ga0070679_100000968 Ga0070679_1000009685 110
288 3300005530 Ga0070679_100003993 Ga0070679_1000039937 110
289 3300005530 Ga0070679_100057253 Ga0070679_1000572532 110
290 3300005530 Ga0070679_101944246 Ga0070679_1019442461 110
291 3300005535 Ga0070684_100054432 Ga0070684_1000544322 110
292 3300005535 Ga0070684_100184604 Ga0070684_1001846041 110
293 3300005535 Ga0070684_100200183 Ga0070684_1002001831 110
294 3300005535 Ga0070684_100610250 Ga0070684_1006102502 110
295 3300005539 Ga0068853_100000222 Ga0068853_10000022221 110
296 3300005539 Ga0068853_100078090 Ga0068853_1000780905 110
297 3300005539 Ga0068853_100241876 Ga0068853_1002418762 110
298 3300005539 Ga0068853_100371177 Ga0068853_1003711771 110
299 3300005539 Ga0068853_100582516 Ga0068853_1005825162 110
300 3300005539 Ga0068853_101482488 Ga0068853_1014824882 110
301 3300005543 Ga0070672_100006275 Ga0070672_1000062755 110
302 3300005543 Ga0070672_100519923 Ga0070672_1005199232 110
303 3300005547 Ga0070693_101636169 Ga0070693_1016361691 110
304 3300005548 Ga0070665_100044594 Ga0070665_1000445942 110
305 3300005548 Ga0070665_100230859 Ga0070665_1002308592 110
306 3300005548 Ga0070665_100296619 Ga0070665_1002966191 110
307 3300005548 Ga0070665_100538074 Ga0070665_1005380742 110
308 3300005563 Ga0068855_100000277 Ga0068855_10000027732 110
309 3300005563 Ga0068855_100002688 Ga0068855_10000268818 110
310 3300005563 Ga0068855_100003653 Ga0068855_10000365311 110
311 3300005563 Ga0068855_100010384 Ga0068855_10001038415 110
312 3300005563 Ga0068855_100012571 Ga0068855_1000125719 110
313 3300005563 Ga0068855_100036038 Ga0068855_1000360383 110
314 3300005563 Ga0068855_100135969 Ga0068855_1001359693 110
315 3300005563 Ga0068855_100248258 Ga0068855_1002482582 110
316 3300005563 Ga0068855_100348240 Ga0068855_1003482402 110
317 3300005563 Ga0068855_100366863 Ga0068855_1003668632 110
318 3300005563 Ga0068855_100400348 Ga0068855_1004003482 110
319 3300005563 Ga0068855_100442404 Ga0068855_1004424043 110
320 3300005563 Ga0068855_100967794 Ga0068855_1009677941 110
321 3300005563 Ga0068855_101161343 Ga0068855_1011613432 110
322 3300005564 Ga0070664_100127912 Ga0070664_1001279123 110
323 3300005564 Ga0070664_100167202 Ga0070664_1001672022 110
324 3300005564 Ga0070664_100598772 Ga0070664_1005987722 110
325 3300005564 Ga0070664_102051637 Ga0070664_1020516371 110
326 3300005577 Ga0068857_100015817 Ga0068857_1000158177 110
327 3300005577 Ga0068857_100016334 Ga0068857_1000163342 110
328 3300005577 Ga0068857_100120350 Ga0068857_1001203502 110
329 3300005577 Ga0068857_100202072 Ga0068857_1002020723 110
330 3300005577 Ga0068857_100373500 Ga0068857_1003735002 110
331 3300005578 Ga0068854_100008770 Ga0068854_1000087703 110
332 3300005578 Ga0068854_100042728 Ga0068854_1000427282 110
333 3300005578 Ga0068854_100311570 Ga0068854_1003115702 110
334 3300005578 Ga0068854_100422016 Ga0068854_1004220162 110
335 3300005614 Ga0068856_100003529 Ga0068856_1000035292 110
336 3300005614 Ga0068856_100006467 Ga0068856_1000064672 110
337 3300005614 Ga0068856_100019915 Ga0068856_1000199155 110
338 3300005614 Ga0068856_100037527 Ga0068856_1000375271 110
339 3300005614 Ga0068856_100054362 Ga0068856_1000543623 110
340 3300005614 Ga0068856_100258107 Ga0068856_1002581072 110
341 3300005614 Ga0068856_100702563 Ga0068856_1007025632 110
342 3300005614 Ga0068856_102227158 Ga0068856_1022271582 110
343 3300005616 Ga0068852_100000019 Ga0068852_10000001974 110
344 3300005616 Ga0068852_100000097 Ga0068852_10000009725 110
345 3300005616 Ga0068852_100006965 Ga0068852_1000069654 110
346 3300005616 Ga0068852_100015924 Ga0068852_1000159241 110
347 3300005616 Ga0068852_100050084 Ga0068852_1000500843 110
348 3300005616 Ga0068852_100059108 Ga0068852_1000591082 110
349 3300005616 Ga0068852_100213509 Ga0068852_1002135092 110
350 3300005616 Ga0068852_100241388 Ga0068852_1002413881 110
351 3300005616 Ga0068852_100471619 Ga0068852_1004716192 110
352 3300005617 Ga0068859_100006530 Ga0068859_1000065306 110
353 3300005618 Ga0068864_100002762 Ga0068864_1000027628 110
354 3300005618 Ga0068864_100012167 Ga0068864_1000121676 110
355 3300005618 Ga0068864_102329345 Ga0068864_1023293451 110
356 3300005718 Ga0068866_10437894 Ga0068866_104378942 110
357 3300005834 Ga0068851_10001766 Ga0068851_100017667 110
358 3300005834 Ga0068851_10010381 Ga0068851_100103813 110
359 3300005834 Ga0068851_10083174 Ga0068851_100831743 110
360 3300005834 Ga0068851_10139420 Ga0068851_101394201 110
361 3300005841 Ga0068863_100001753 Ga0068863_10000175316 110
362 3300005841 Ga0068863_100001814 Ga0068863_10000181415 110
363 3300005841 Ga0068863_100120289 Ga0068863_1001202892 110
364 3300005842 Ga0068858_100003316 Ga0068858_1000033163 110
365 3300005842 Ga0068858_100278903 Ga0068858_1002789032 110
366 3300005843 Ga0068860_100000689 Ga0068860_10000068916 110
367 3300006028 Ga0070717_10481961 Ga0070717_104819612 110
368 3300006028 Ga0070717_10830751 Ga0070717_108307512 110
369 3300006173 Ga0070716_100189133 Ga0070716_1001891332 110
370 3300006173 Ga0070716_100341836 Ga0070716_1003418362 110
371 3300006175 Ga0070712_101271073 Ga0070712_1012710731 110
372 3300006237 Ga0097621_100000349 Ga0097621_10000034922 110
373 3300006237 Ga0097621_100048467 Ga0097621_1000484674 110
374 3300006237 Ga0097621_100165375 Ga0097621_1001653752 110
375 3300006358 Ga0068871_100035557 Ga0068871_1000355573 110
376 3300006358 Ga0068871_100675555 Ga0068871_1006755552 110
377 3300006881 Ga0068865_100268881 Ga0068865_1002688811 110
378 3300006931 Ga0097620_100006530 Ga0097620_1000065304 110
379 3300007265 Ga0099794_10444218 Ga0099794_104442182 110
380 3300009093 Ga0105240_10000001 Ga0105240_100000011932 110
381 3300009093 Ga0105240_10000372 Ga0105240_1000037266 110
382 3300009093 Ga0105240_10000496 Ga0105240_1000049651 110
383 3300009093 Ga0105240_10003485 Ga0105240_100034854 110
384 3300009093 Ga0105240_10033184 Ga0105240_100331844 110
385 3300009093 Ga0105240_10034761 Ga0105240_100347614 110
386 3300009093 Ga0105240_10057886 Ga0105240_100578863 110
387 3300009093 Ga0105240_10060708 Ga0105240_100607084 110
388 3300009093 Ga0105240_10122963 Ga0105240_101229634 110
389 3300009093 Ga0105240_10234142 Ga0105240_102341421 110
390 3300009093 Ga0105240_10393531 Ga0105240_103935314 110
391 3300009093 Ga0105240_10395370 Ga0105240_103953703 110
392 3300009093 Ga0105240_10425874 Ga0105240_104258741 110
393 3300009093 Ga0105240_10898876 Ga0105240_108988762 110
394 3300009093 Ga0105240_11331624 Ga0105240_113316241 110
395 3300009093 Ga0105240_11656657 Ga0105240_116566572 110
396 3300009098 Ga0105245_10000486 Ga0105245_1000048633 110
397 3300009098 Ga0105245_10146696 Ga0105245_101466963 110
398 3300009098 Ga0105245_10271912 Ga0105245_102719123 110
399 3300009098 Ga0105245_10417255 Ga0105245_104172552 110
400 3300009098 Ga0105245_11363681 Ga0105245_113636812 110
401 3300009098 Ga0105245_12015127 Ga0105245_120151272 110
402 3300009101 Ga0105247_10004009 Ga0105247_100040093 110
403 3300009101 Ga0105247_10012271 Ga0105247_100122713 110
404 3300009101 Ga0105247_10299210 Ga0105247_102992102 110
405 3300009174 Ga0105241_10000026 Ga0105241_1000002630 110
406 3300009174 Ga0105241_10000121 Ga0105241_1000012119 110
407 3300009174 Ga0105241_10002032 Ga0105241_100020329 110
408 3300009174 Ga0105241_10006994 Ga0105241_100069942 110
409 3300009174 Ga0105241_10043980 Ga0105241_100439802 110
410 3300009174 Ga0105241_10449796 Ga0105241_104497962 110
411 3300009174 Ga0105241_10454102 Ga0105241_104541022 110
412 3300009174 Ga0105241_10539986 Ga0105241_105399862 110
413 3300009174 Ga0105241_10644488 Ga0105241_106444882 110
414 3300009174 Ga0105241_10790322 Ga0105241_107903221 110
415 3300009174 Ga0105241_10847964 Ga0105241_108479642 110
416 3300009174 Ga0105241_11499106 Ga0105241_114991061 110
417 3300009176 Ga0105242_10223056 Ga0105242_102230562 110
418 3300009177 Ga0105248_10000019 Ga0105248_1000001911 110
419 3300009177 Ga0105248_10007017 Ga0105248_100070176 110
420 3300009177 Ga0105248_10021944 Ga0105248_100219443 110
421 3300009177 Ga0105248_10022327 Ga0105248_100223274 110
422 3300009177 Ga0105248_10042895 Ga0105248_100428951 110
423 3300009177 Ga0105248_10293698 Ga0105248_102936981 110
424 3300009177 Ga0105248_11357570 Ga0105248_113575702 110
425 3300009545 Ga0105237_10000590 Ga0105237_1000059014 110
426 3300009545 Ga0105237_10006331 Ga0105237_100063315 110
427 3300009545 Ga0105237_10049769 Ga0105237_100497693 110
428 3300009545 Ga0105237_10352143 Ga0105237_103521432 110
429 3300009545 Ga0105237_10555839 Ga0105237_105558392 110
430 3300009545 Ga0105237_10556785 Ga0105237_105567852 110
431 3300009545 Ga0105237_10805760 Ga0105237_108057602 110
432 3300009551 Ga0105238_10000197 Ga0105238_1000019731 110
433 3300009551 Ga0105238_10000509 Ga0105238_1000050932 110
434 3300009551 Ga0105238_10023794 Ga0105238_100237946 110
435 3300009551 Ga0105238_10029605 Ga0105238_100296054 110
436 3300009551 Ga0105238_10064831 Ga0105238_100648313 110
437 3300009551 Ga0105238_10065916 Ga0105238_100659165 110
438 3300009551 Ga0105238_10485097 Ga0105238_104850971 110
439 3300009551 Ga0105238_10522005 Ga0105238_105220052 110
440 3300009551 Ga0105238_10781075 Ga0105238_107810752 110
441 3300009551 Ga0105238_11877914 Ga0105238_118779141 110
442 3300009551 Ga0105238_12299666 Ga0105238_122996661 110
443 3300009551 Ga0105238_12957677 Ga0105238_129576771 110
444 3300010159 Ga0099796_10089586 Ga0099796_100895862 110
445 3300010375 Ga0105239_10001533 Ga0105239_1000153319 110
446 3300010375 Ga0105239_10003046 Ga0105239_1000304613 110
447 3300010375 Ga0105239_10013636 Ga0105239_100136364 110
448 3300010375 Ga0105239_10075980 Ga0105239_100759803 110
449 3300010375 Ga0105239_10336483 Ga0105239_103364832 110
450 3300010375 Ga0105239_10877344 Ga0105239_108773441 110
451 3300010375 Ga0105239_11576054 Ga0105239_115760542 110
452 3300010375 Ga0105239_11893339 Ga0105239_118933392 110
453 3300011119 Ga0105246_10002384 Ga0105246_100023848 110
454 3300013100 Ga0157373_10104825 Ga0157373_101048252 110
455 3300013100 Ga0157373_10219018 Ga0157373_102190182 110
456 3300013100 Ga0157373_10757558 Ga0157373_107575582 110
457 3300013100 Ga0157373_10782411 Ga0157373_107824112 110
458 3300013102 Ga0157371_10407929 Ga0157371_104079292 110
459 3300013102 Ga0157371_10778244 Ga0157371_107782442 110
460 3300013104 Ga0157370_10000170 Ga0157370_1000017073 110
461 3300013104 Ga0157370_10006614 Ga0157370_100066149 110
462 3300013104 Ga0157370_10017219 Ga0157370_100172194 110
463 3300013104 Ga0157370_10030063 Ga0157370_100300636 110
464 3300013104 Ga0157370_10090149 Ga0157370_100901492 110
465 3300013104 Ga0157370_10608338 Ga0157370_106083382 110
466 3300013105 Ga0157369_10000085 Ga0157369_1000008573 110
467 3300013105 Ga0157369_10000430 Ga0157369_1000043023 110
468 3300013105 Ga0157369_10009218 Ga0157369_100092182 110
469 3300013105 Ga0157369_10012659 Ga0157369_100126599 110
470 3300013105 Ga0157369_10012685 Ga0157369_100126856 110
471 3300013105 Ga0157369_10018737 Ga0157369_100187371 110
472 3300013105 Ga0157369_10021889 Ga0157369_100218894 110
473 3300013105 Ga0157369_10028989 Ga0157369_100289896 110
474 3300013105 Ga0157369_10049457 Ga0157369_100494574 110
475 3300013105 Ga0157369_10051486 Ga0157369_100514863 110
476 3300013105 Ga0157369_10115554 Ga0157369_101155542 110
477 3300013105 Ga0157369_10261492 Ga0157369_102614922 110
478 3300013105 Ga0157369_10416121 Ga0157369_104161212 110
479 3300013105 Ga0157369_10666779 Ga0157369_106667792 110
480 3300013105 Ga0157369_12066327 Ga0157369_120663271 110
481 3300013296 Ga0157374_10005033 Ga0157374_100050332 110
482 3300013296 Ga0157374_10011606 Ga0157374_100116064 110
483 3300013296 Ga0157374_10058477 Ga0157374_100584773 110
484 3300013296 Ga0157374_10177740 Ga0157374_101777403 110
485 3300013296 Ga0157374_10347322 Ga0157374_103473222 110
486 3300013296 Ga0157374_10429621 Ga0157374_104296213 110
487 3300013296 Ga0157374_10459620 Ga0157374_104596202 110
488 3300013296 Ga0157374_10497804 Ga0157374_104978042 110
489 3300013296 Ga0157374_10753782 Ga0157374_107537822 110
490 3300013296 Ga0157374_10850894 Ga0157374_108508941 110
491 3300013296 Ga0157374_11748663 Ga0157374_117486632 110
492 3300013297 Ga0157378_10003314 Ga0157378_100033148 110
493 3300013297 Ga0157378_10023973 Ga0157378_100239732 110
494 3300013297 Ga0157378_10028269 Ga0157378_100282692 110
495 3300013297 Ga0157378_10108517 Ga0157378_101085173 110
496 3300013297 Ga0157378_10307547 Ga0157378_103075472 110
497 3300013297 Ga0157378_10431981 Ga0157378_104319811 110
498 3300013297 Ga0157378_11984848 Ga0157378_119848482 110
499 3300013306 Ga0163162_10027442 Ga0163162_100274422 110
500 3300013306 Ga0163162_10084767 Ga0163162_100847672 110
501 3300013306 Ga0163162_10209135 Ga0163162_102091353 110
502 3300013307 Ga0157372_10000217 Ga0157372_1000021742 110
503 3300013307 Ga0157372_10002601 Ga0157372_1000260110 110
504 3300013307 Ga0157372_10010870 Ga0157372_100108705 110
505 3300013307 Ga0157372_10027828 Ga0157372_100278282 110
506 3300013307 Ga0157372_10120685 Ga0157372_101206852 110
507 3300013307 Ga0157372_10265383 Ga0157372_102653832 110
508 3300013307 Ga0157372_10355994 Ga0157372_103559943 110
509 3300013307 Ga0157372_10541137 Ga0157372_105411372 110
510 3300013307 Ga0157372_11562612 Ga0157372_115626121 110
511 3300013307 Ga0157372_11585463 Ga0157372_115854631 110
512 3300013308 Ga0157375_10029487 Ga0157375_100294873 110
513 3300013308 Ga0157375_10162945 Ga0157375_101629452 110
514 3300014325 Ga0163163_10001161 Ga0163163_1000116114 110
515 3300014325 Ga0163163_10028784 Ga0163163_100287842 110
516 3300014745 Ga0157377_10224766 Ga0157377_102247664 110
517 3300014968 Ga0157379_10002312 Ga0157379_1000231213 110
518 3300014968 Ga0157379_10067424 Ga0157379_100674243 110
519 3300014968 Ga0157379_10227617 Ga0157379_102276172 110
520 3300014968 Ga0157379_11687805 Ga0157379_116878052 110
521 3300014968 Ga0157379_12334041 Ga0157379_123340411 110
522 3300014969 Ga0157376_10004372 Ga0157376_100043724 110
523 3300014969 Ga0157376_10061471 Ga0157376_100614711 110
524 3300014969 Ga0157376_10134284 Ga0157376_101342843 110
525 3300014969 Ga0157376_10240761 Ga0157376_102407612 110
526 3300014969 Ga0157376_10318257 Ga0157376_103182573 110
527 3300014969 Ga0157376_10955211 Ga0157376_109552112 110
528 3300014969 Ga0157376_11119609 Ga0157376_111196092 110
529 3300014969 Ga0157376_11340204 Ga0157376_113402042 110
530 3300015261 Ga0182006_1055967 Ga0182006_10559672 110
531 3300017792 Ga0163161_10492088 Ga0163161_104920882 110
532 3300024225 Ga0224572_1045103 Ga0224572_10451032 110
533 3300025261 Ga0209233_1005604 Ga0209233_10056045 110
534 3300025321 Ga0207656_10001489 Ga0207656_100014895 110
535 3300025321 Ga0207656_10008960 Ga0207656_100089603 110
536 3300025321 Ga0207656_10011691 Ga0207656_100116912 110
537 3300025321 Ga0207656_10109919 Ga0207656_101099192 110
538 3300025321 Ga0207656_10199314 Ga0207656_101993142 110
539 3300025899 Ga0207642_10739637 Ga0207642_107396372 110
540 3300025900 Ga0207710_10000912 Ga0207710_100009125 110
541 3300025900 Ga0207710_10032646 Ga0207710_100326461 110
542 3300025900 Ga0207710_10227618 Ga0207710_102276182 110
543 3300025900 Ga0207710_10449031 Ga0207710_104490311 110
544 3300025903 Ga0207680_10562814 Ga0207680_105628142 110
545 3300025904 Ga0207647_10093187 Ga0207647_100931872 110
546 3300025904 Ga0207647_10130745 Ga0207647_101307452 110
547 3300025906 Ga0207699_10314431 Ga0207699_103144311 110
548 3300025907 Ga0207645_10075799 Ga0207645_100757992 110
549 3300025909 Ga0207705_10000021 Ga0207705_10000021230 110
550 3300025909 Ga0207705_10002923 Ga0207705_100029239 110
551 3300025909 Ga0207705_10019392 Ga0207705_100193924 110
552 3300025909 Ga0207705_10032002 Ga0207705_100320021 110
553 3300025909 Ga0207705_10091974 Ga0207705_100919741 110
554 3300025909 Ga0207705_10157529 Ga0207705_101575291 110
555 3300025909 Ga0207705_10301422 Ga0207705_103014222 110
556 3300025909 Ga0207705_10644617 Ga0207705_106446171 110
557 3300025909 Ga0207705_11343888 Ga0207705_113438882 110
558 3300025911 Ga0207654_10000054 Ga0207654_1000005463 110
559 3300025911 Ga0207654_10000281 Ga0207654_100002816 110
560 3300025911 Ga0207654_10000808 Ga0207654_100008088 110
561 3300025911 Ga0207654_10086212 Ga0207654_100862123 110
562 3300025911 Ga0207654_10268477 Ga0207654_102684771 110
563 3300025911 Ga0207654_10527968 Ga0207654_105279681 110
564 3300025911 Ga0207654_11084317 Ga0207654_110843172 110
565 3300025911 Ga0207654_11159358 Ga0207654_111593581 110
566 3300025912 Ga0207707_10088884 Ga0207707_100888843 110
567 3300025912 Ga0207707_10475820 Ga0207707_104758202 110
568 3300025913 Ga0207695_10000001 Ga0207695_100000011935 110
569 3300025913 Ga0207695_10000080 Ga0207695_10000080194 110
570 3300025913 Ga0207695_10000113 Ga0207695_10000113152 110
571 3300025913 Ga0207695_10000167 Ga0207695_10000167114 110
572 3300025913 Ga0207695_10000263 Ga0207695_1000026313 110
573 3300025913 Ga0207695_10001106 Ga0207695_1000110633 110
574 3300025913 Ga0207695_10007109 Ga0207695_100071094 110
575 3300025913 Ga0207695_10025431 Ga0207695_100254313 110
576 3300025913 Ga0207695_10047228 Ga0207695_100472282 110
577 3300025913 Ga0207695_10067630 Ga0207695_100676303 110
578 3300025913 Ga0207695_10090899 Ga0207695_100908992 110
579 3300025913 Ga0207695_10587824 Ga0207695_105878242 110
580 3300025913 Ga0207695_10825204 Ga0207695_108252042 110
581 3300025914 Ga0207671_10000065 Ga0207671_1000006568 110
582 3300025914 Ga0207671_10000123 Ga0207671_1000012382 110
583 3300025914 Ga0207671_10000139 Ga0207671_1000013965 110
584 3300025914 Ga0207671_10037214 Ga0207671_100372144 110
585 3300025914 Ga0207671_10093033 Ga0207671_100930332 110
586 3300025914 Ga0207671_10101032 Ga0207671_101010322 110
587 3300025914 Ga0207671_10314634 Ga0207671_103146342 110
588 3300025914 Ga0207671_10544343 Ga0207671_105443431 110
589 3300025914 Ga0207671_10816103 Ga0207671_108161032 110
590 3300025915 Ga0207693_11218377 Ga0207693_112183772 110
591 3300025916 Ga0207663_11063731 Ga0207663_110637311 110
592 3300025917 Ga0207660_10034872 Ga0207660_100348724 110
593 3300025919 Ga0207657_10023308 Ga0207657_100233082 110
594 3300025919 Ga0207657_10063948 Ga0207657_100639482 110
595 3300025919 Ga0207657_10273173 Ga0207657_102731732 110
596 3300025919 Ga0207657_10516848 Ga0207657_105168482 110
597 3300025919 Ga0207657_10584200 Ga0207657_105842002 110
598 3300025920 Ga0207649_10009868 Ga0207649_100098683 110
599 3300025920 Ga0207649_10011442 Ga0207649_100114424 110
600 3300025920 Ga0207649_10036761 Ga0207649_100367612 110
601 3300025920 Ga0207649_10045929 Ga0207649_100459292 110
602 3300025920 Ga0207649_10051713 Ga0207649_100517133 110
603 3300025920 Ga0207649_10123143 Ga0207649_101231433 110
604 3300025920 Ga0207649_10355185 Ga0207649_103551851 110
605 3300025921 Ga0207652_10002459 Ga0207652_100024595 110
606 3300025921 Ga0207652_10033782 Ga0207652_100337824 110
607 3300025921 Ga0207652_10045706 Ga0207652_100457064 110
608 3300025921 Ga0207652_10456639 Ga0207652_104566392 110
609 3300025924 Ga0207694_10000248 Ga0207694_1000024823 110
610 3300025924 Ga0207694_10000711 Ga0207694_100007119 110
611 3300025924 Ga0207694_10010664 Ga0207694_100106646 110
612 3300025924 Ga0207694_10131100 Ga0207694_101311002 110
613 3300025924 Ga0207694_10277292 Ga0207694_102772921 110
614 3300025924 Ga0207694_10474030 Ga0207694_104740302 110
615 3300025924 Ga0207694_10534797 Ga0207694_105347972 110
616 3300025924 Ga0207694_11311516 Ga0207694_113115162 110
617 3300025924 Ga0207694_11564067 Ga0207694_115640671 110
618 3300025924 Ga0207694_11849546 Ga0207694_118495461 110
619 3300025925 Ga0207650_10003582 Ga0207650_100035825 110
620 3300025926 Ga0207659_10116300 Ga0207659_101163003 110
621 3300025927 Ga0207687_10000978 Ga0207687_1000097819 110
622 3300025927 Ga0207687_10030621 Ga0207687_100306214 110
623 3300025927 Ga0207687_10086790 Ga0207687_100867902 110
624 3300025927 Ga0207687_10276493 Ga0207687_102764932 110
625 3300025928 Ga0207700_10015711 Ga0207700_100157112 110
626 3300025928 Ga0207700_10071880 Ga0207700_100718803 110
627 3300025928 Ga0207700_10887044 Ga0207700_108870442 110
628 3300025929 Ga0207664_10135073 Ga0207664_101350733 110
629 3300025931 Ga0207644_10002160 Ga0207644_100021607 110
630 3300025931 Ga0207644_10013665 Ga0207644_100136655 110
631 3300025931 Ga0207644_10075210 Ga0207644_100752103 110
632 3300025931 Ga0207644_10271224 Ga0207644_102712242 110
633 3300025932 Ga0207690_10564670 Ga0207690_105646702 110
634 3300025933 Ga0207706_10064710 Ga0207706_100647103 110
635 3300025939 Ga0207665_10584863 Ga0207665_105848631 110
636 3300025940 Ga0207691_10075960 Ga0207691_100759602 110
637 3300025940 Ga0207691_10770386 Ga0207691_107703862 110
638 3300025941 Ga0207711_10000014 Ga0207711_10000014425 110
639 3300025941 Ga0207711_10004781 Ga0207711_100047816 110
640 3300025941 Ga0207711_10024659 Ga0207711_100246593 110
641 3300025941 Ga0207711_10095034 Ga0207711_100950343 110
642 3300025941 Ga0207711_10190978 Ga0207711_101909782 110
643 3300025941 Ga0207711_10305502 Ga0207711_103055021 110
644 3300025941 Ga0207711_10343779 Ga0207711_103437792 110
645 3300025941 Ga0207711_10349532 Ga0207711_103495322 110
646 3300025941 Ga0207711_11198331 Ga0207711_111983312 110
647 3300025941 Ga0207711_11646135 Ga0207711_116461352 110
648 3300025942 Ga0207689_10004019 Ga0207689_100040194 110
649 3300025942 Ga0207689_10051194 Ga0207689_100511941 110
650 3300025942 Ga0207689_10524464 Ga0207689_105244642 110
651 3300025944 Ga0207661_10001283 Ga0207661_100012832 110
652 3300025944 Ga0207661_10025842 Ga0207661_100258423 110
653 3300025944 Ga0207661_10083585 Ga0207661_100835852 110
654 3300025944 Ga0207661_10099228 Ga0207661_100992282 110
655 3300025944 Ga0207661_10105999 Ga0207661_101059992 110
656 3300025944 Ga0207661_10237426 Ga0207661_102374263 110
657 3300025945 Ga0207679_10079256 Ga0207679_100792564 110
658 3300025945 Ga0207679_10175492 Ga0207679_101754922 110
659 3300025945 Ga0207679_10298874 Ga0207679_102988741 110
660 3300025949 Ga0207667_10007018 Ga0207667_1000701811 110
661 3300025949 Ga0207667_10007159 Ga0207667_1000715914 110
662 3300025949 Ga0207667_10007633 Ga0207667_100076336 110
663 3300025949 Ga0207667_10009516 Ga0207667_100095164 110
664 3300025949 Ga0207667_10023191 Ga0207667_100231915 110
665 3300025949 Ga0207667_10028672 Ga0207667_100286724 110
666 3300025949 Ga0207667_10057558 Ga0207667_100575583 110
667 3300025949 Ga0207667_10089817 Ga0207667_100898173 110
668 3300025949 Ga0207667_10113439 Ga0207667_101134392 110
669 3300025949 Ga0207667_10118034 Ga0207667_101180343 110
670 3300025949 Ga0207667_10136268 Ga0207667_101362682 110
671 3300025949 Ga0207667_10237086 Ga0207667_102370862 110
672 3300025961 Ga0207712_10879094 Ga0207712_108790943 110
673 3300025981 Ga0207640_10008642 Ga0207640_100086423 110
674 3300025981 Ga0207640_10155415 Ga0207640_101554152 110
675 3300025981 Ga0207640_10159963 Ga0207640_101599632 110
676 3300025981 Ga0207640_10555853 Ga0207640_105558532 110
677 3300025981 Ga0207640_10568780 Ga0207640_105687801 110
678 3300025981 Ga0207640_10722052 Ga0207640_107220522 110
679 3300025986 Ga0207658_10050436 Ga0207658_100504363 110
680 3300025986 Ga0207658_10458795 Ga0207658_104587952 110
681 3300026023 Ga0207677_10000143 Ga0207677_1000014318 110
682 3300026023 Ga0207677_10006547 Ga0207677_100065475 110
683 3300026023 Ga0207677_10716717 Ga0207677_107167172 110
684 3300026035 Ga0207703_10011246 Ga0207703_100112463 110
685 3300026041 Ga0207639_10000088 Ga0207639_1000008822 110
686 3300026041 Ga0207639_10014115 Ga0207639_100141156 110
687 3300026041 Ga0207639_10145334 Ga0207639_101453342 110
688 3300026041 Ga0207639_10221987 Ga0207639_102219871 110
689 3300026041 Ga0207639_10320037 Ga0207639_103200372 110
690 3300026041 Ga0207639_10423579 Ga0207639_104235792 110
691 3300026041 Ga0207639_10464315 Ga0207639_104643152 110
692 3300026041 Ga0207639_10951559 Ga0207639_109515592 110
693 3300026067 Ga0207678_10006398 Ga0207678_100063987 110
694 3300026067 Ga0207678_10015091 Ga0207678_100150913 110
695 3300026067 Ga0207678_10015141 Ga0207678_100151414 110
696 3300026067 Ga0207678_10231765 Ga0207678_102317652 110
697 3300026078 Ga0207702_10004705 Ga0207702_100047056 110
698 3300026078 Ga0207702_10005816 Ga0207702_100058167 110
699 3300026078 Ga0207702_10036280 Ga0207702_100362803 110
700 3300026078 Ga0207702_10085078 Ga0207702_100850781 110
701 3300026078 Ga0207702_10095418 Ga0207702_100954182 110
702 3300026078 Ga0207702_10258301 Ga0207702_102583012 110
703 3300026078 Ga0207702_10866328 Ga0207702_108663281 110
704 3300026078 Ga0207702_10976553 Ga0207702_109765531 110
705 3300026078 Ga0207702_11236913 Ga0207702_112369131 110
706 3300026078 Ga0207702_12254025 Ga0207702_122540251 110
707 3300026088 Ga0207641_10005346 Ga0207641_100053465 110
708 3300026088 Ga0207641_10021598 Ga0207641_100215985 110
709 3300026088 Ga0207641_10139167 Ga0207641_101391672 110
710 3300026089 Ga0207648_11286414 Ga0207648_112864141 110
711 3300026095 Ga0207676_10002667 Ga0207676_100026678 110
712 3300026095 Ga0207676_10125439 Ga0207676_101254393 110
713 3300026116 Ga0207674_10000669 Ga0207674_100006697 110
714 3300026116 Ga0207674_10012983 Ga0207674_100129835 110
715 3300026116 Ga0207674_10120391 Ga0207674_101203913 110
716 3300026116 Ga0207674_10328801 Ga0207674_103288012 110
717 3300026116 Ga0207674_10525944 Ga0207674_105259441 110
718 3300026116 Ga0207674_10557698 Ga0207674_105576982 110
719 3300026121 Ga0207683_10028240 Ga0207683_100282406 110
720 3300026121 Ga0207683_10364041 Ga0207683_103640412 110
721 3300026142 Ga0207698_10000003 Ga0207698_10000003241 110
722 3300026142 Ga0207698_10000225 Ga0207698_100002254 110
723 3300026142 Ga0207698_10007959 Ga0207698_100079594 110
724 3300026142 Ga0207698_10045131 Ga0207698_100451314 110
725 3300026142 Ga0207698_10132091 Ga0207698_101320913 110
726 3300026142 Ga0207698_10165017 Ga0207698_101650172 110
727 3300026142 Ga0207698_10417287 Ga0207698_104172872 110
728 3300026142 Ga0207698_11190819 Ga0207698_111908191 110
729 3300028379 Ga0268266_10005265 Ga0268266_100052654 110
730 3300028379 Ga0268266_10006399 Ga0268266_1000639911 110
731 3300028379 Ga0268266_10014122 Ga0268266_100141223 110
732 3300028379 Ga0268266_10046731 Ga0268266_100467312 110
733 3300028379 Ga0268266_10173024 Ga0268266_101730241 110
734 3300028379 Ga0268266_10233875 Ga0268266_102338752 110
735 3300028379 Ga0268266_10256469 Ga0268266_102564693 110
736 3300028381 Ga0268264_10000598 Ga0268264_1000059815 110
737 3300028786 Ga0307517_10515974 Ga0307517_105159742 110
738 3300028800 Ga0265338_10158684 Ga0265338_101586842 110
739 3300028800 Ga0265338_10163443 Ga0265338_101634433 110
740 3300028800 Ga0265338_10259448 Ga0265338_102594481 110
741 3300028800 Ga0265338_10337026 Ga0265338_103370262 110
742 3300028800 Ga0265338_10721670 Ga0265338_107216702 110
743 3300030522 Ga0307512_10315872 Ga0307512_103158721 110
744 3300030760 Ga0265762_1176753 Ga0265762_11767531 110
745 3300030878 Ga0265770_1105662 Ga0265770_11056622 110
746 3300030878 Ga0265770_1122170 Ga0265770_11221701 110
747 3300031090 Ga0265760_10086498 Ga0265760_100864982 110
748 3300031090 Ga0265760_10141667 Ga0265760_101416672 110
749 3300031235 Ga0265330_10000273 Ga0265330_1000027320 110
750 3300031235 Ga0265330_10013742 Ga0265330_100137423 110
751 3300031235 Ga0265330_10097036 Ga0265330_100970362 110
752 3300031238 Ga0265332_10196168 Ga0265332_101961682 110
753 3300031239 Ga0265328_10015554 Ga0265328_100155541 110
754 3300031240 Ga0265320_10249266 Ga0265320_102492662 110
755 3300031241 Ga0265325_10000266 Ga0265325_1000026618 110
756 3300031241 Ga0265325_10005858 Ga0265325_100058584 110
757 3300031241 Ga0265325_10060625 Ga0265325_100606253 110
758 3300031247 Ga0265340_10019622 Ga0265340_100196224 110
759 3300031247 Ga0265340_10061429 Ga0265340_100614293 110
760 3300031249 Ga0265339_10000194 Ga0265339_1000019421 110
761 3300031249 Ga0265339_10005214 Ga0265339_100052142 110
762 3300031249 Ga0265339_10029804 Ga0265339_100298044 110
763 3300031250 Ga0265331_10429126 Ga0265331_104291262 110
764 3300031250 Ga0265331_10585898 Ga0265331_105858982 110
765 3300031344 Ga0265316_10003675 Ga0265316_1000367515 110
766 3300031344 Ga0265316_10008382 Ga0265316_100083829 110
767 3300031344 Ga0265316_10022232 Ga0265316_100222323 110
768 3300031344 Ga0265316_10027725 Ga0265316_100277254 110
769 3300031344 Ga0265316_10048835 Ga0265316_100488353 110
770 3300031344 Ga0265316_10190926 Ga0265316_101909262 110
771 3300031344 Ga0265316_10192501 Ga0265316_101925012 110
772 3300031344 Ga0265316_10351036 Ga0265316_103510362 110
773 3300031595 Ga0265313_10018882 Ga0265313_100188823 110
774 3300031595 Ga0265313_10028929 Ga0265313_100289293 110
775 3300031711 Ga0265314_10046866 Ga0265314_100468662 110
776 3300031711 Ga0265314_10080947 Ga0265314_100809472 110
777 3300031711 Ga0265314_10160089 Ga0265314_101600892 110
778 3300031711 Ga0265314_10288196 Ga0265314_102881961 110
779 3300031712 Ga0265342_10000225 Ga0265342_1000022538 110
780 3300031712 Ga0265342_10001536 Ga0265342_100015361 110
781 3300031712 Ga0265342_10014131 Ga0265342_100141314 110
782 3300031712 Ga0265342_10015276 Ga0265342_100152762 110
783 3300031712 Ga0265342_10113795 Ga0265342_101137952 110
784 3300032133 Ga0316583_10181098 Ga0316583_101810982 110
785 3300033180 Ga0307510_10010774 Ga0307510_100107744 110
786 3300033180 Ga0307510_10071804 Ga0307510_100718043 110
787 3300033180 Ga0307510_10220392 Ga0307510_102203922 110
788 3300035111 Ga0373923_0266985 Ga0373923_0266985_276_656 110
789 3300035113 Ga0373936_0187261 Ga0373936_0187261_357_725 110
790 3300035695 Ga0373927_0683844 Ga0373927_0683844_43_411 110
791 3300035724 Ga0373933_0634675 Ga0373933_0634675_76_456 110
792 3300036401 Ga0373937_0510221 Ga0373937_0510221_547_927 110
793 3300037418 Ga0395900_1361652 Ga0395900_1361652_100_438 110
794 3300041496 Ga0451839_0397595 Ga0451839_0397595_97_459 110
795 3300042005 Ga0439448_0148476 Ga0439448_0148476_195_554 110
796 3300044656 Ga0466969_0533994 Ga0466969_0533994_160_504 110
797 3300044684 Ga0466966_0043334 Ga0466966_0043334_1069_1413 110
798 3300044694 Ga0466963_0000494 Ga0466963_0000494_16495_16851 110
799 3300044694 Ga0466963_0732759 Ga0466963_0732759_260_604 110
800 3300044842 Ga0466957_0445001 Ga0466957_0445001_112_468 110
801 3300045049 Ga0466959_0254613 Ga0466959_0254613_699_1052 110
802 3300045836 Ga0466958_0372077 Ga0466958_0372077_323_676 110
803 3300045976 Ga0466967_0001401 Ga0466967_0001401_3532_3888 110
804 3300045976 Ga0466967_0226226 Ga0466967_0226226_1422_1766 110
805 3300046452 Ga0495617_242766 Ga0495617_242766_126_467 110
806 3300046454 Ga0495592_0170605 Ga0495592_0170605_88_429 110
807 3300046454 Ga0495592_0361325 Ga0495592_0361325_537_917 110
808 3300046454 Ga0495592_0378286 Ga0495592_0378286_31_372 110
809 3300046455 Ga0495603_0111033 Ga0495603_0111033_1043_1384 110
810 3300046455 Ga0495603_0122471 Ga0495603_0122471_740_1081 110
811 3300046459 Ga0495629_0018026 Ga0495629_0018026_3190_3531 110
812 3300046460 Ga0495638_0447890 Ga0495638_0447890_258_599 110
813 3300046462 Ga0495651_0015018 Ga0495651_0015018_1195_1575 110
814 3300046462 Ga0495651_0031839 Ga0495651_0031839_170_511 110
815 3300046463 Ga0495653_0010749 Ga0495653_0010749_6313_6654 110
816 3300046471 Ga0495650_0000038 Ga0495650_0000038_180120_180461 110
817 3300046471 Ga0495650_0008733 Ga0495650_0008733_5352_5693 110
818 3300046472 Ga0495580_0097351 Ga0495580_0097351_1142_1483 110
819 3300046473 Ga0495582_0049065 Ga0495582_0049065_803_1144 110
820 3300046475 Ga0495639_0001675 Ga0495639_0001675_7911_8252 110
821 3300046476 Ga0495662_0005660 Ga0495662_0005660_4619_4960 110
822 3300046477 Ga0495664_0001348 Ga0495664_0001348_12565_12906 110
823 3300046477 Ga0495664_0045809 Ga0495664_0045809_1576_1917 110
824 3300046477 Ga0495664_0209206 Ga0495664_0209206_224_604 110
825 3300046492 Ga0495585_0016774 Ga0495585_0016774_1619_1960 110
826 3300046499 Ga0495594_0000388 Ga0495594_0000388_5053_5394 110
827 3300046499 Ga0495594_0001190 Ga0495594_0001190_582_923 110
828 3300046506 Ga0495583_0013317 Ga0495583_0013317_891_1253 110
829 3300046506 Ga0495583_0033314 Ga0495583_0033314_1919_2260 110
830 3300046507 Ga0495606_0077834 Ga0495606_0077834_672_1013 110
831 3300046507 Ga0495606_0095370 Ga0495606_0095370_874_1215 110
832 3300046507 Ga0495606_0162623 Ga0495606_0162623_460_822 110
833 3300046507 Ga0495606_0216104 Ga0495606_0216104_388_729 110
834 3300046516 Ga0495628_0007402 Ga0495628_0007402_7289_7630 110
835 3300046516 Ga0495628_0011061 Ga0495628_0011061_2493_2873 110
836 3300046516 Ga0495628_0694799 Ga0495628_0694799_157_513 110
837 3300046517 Ga0495630_0264458 Ga0495630_0264458_901_1242 110
838 3300046518 Ga0495631_0051109 Ga0495631_0051109_799_1140 110
839 3300046518 Ga0495631_0241780 Ga0495631_0241780_172_534 110
840 3300046519 Ga0495632_0301110 Ga0495632_0301110_245_586 110
841 3300046523 Ga0495644_0000048 Ga0495644_0000048_30459_30800 110
842 3300046524 Ga0495648_0167762 Ga0495648_0167762_512_853 110
843 3300046524 Ga0495648_0207165 Ga0495648_0207165_444_806 110
844 3300046526 Ga0495666_0001196 Ga0495666_0001196_4766_5107 110
845 3300046528 Ga0495642_0009023 Ga0495642_0009023_2305_2646 110
846 3300046529 Ga0495652_0009907 Ga0495652_0009907_3258_3638 110
847 3300046529 Ga0495652_0039259 Ga0495652_0039259_2298_2639 110
848 3300046529 Ga0495652_0448030 Ga0495652_0448030_519_875 110
849 3300046531 Ga0495665_0001828 Ga0495665_0001828_5966_6307 110
850 3300046531 Ga0495665_0321308 Ga0495665_0321308_375_716 110
851 3300046533 Ga0495640_0060924 Ga0495640_0060924_350_691 110
852 3300046533 Ga0495640_0096637 Ga0495640_0096637_21_362 110
853 3300046535 Ga0495586_0163121 Ga0495586_0163121_211_552 110
854 3300046536 Ga0495587_0008155 Ga0495587_0008155_1961_2341 110
855 3300046538 Ga0495609_0036518 Ga0495609_0036518_1170_1511 110
856 3300046538 Ga0495609_0180783 Ga0495609_0180783_91_432 110
857 3300046538 Ga0495609_0326845 Ga0495609_0326845_36_398 110
858 3300046543 Ga0495645_0001770 Ga0495645_0001770_10651_11031 110
859 3300046543 Ga0495645_0007804 Ga0495645_0007804_5692_6033 110
860 3300046543 Ga0495645_0022284 Ga0495645_0022284_3498_3854 110
861 3300046559 Ga0495667_0084571 Ga0495667_0084571_960_1301 110
862 3300046559 Ga0495667_0374459 Ga0495667_0374459_44_424 110
863 3300046616 Ga0495668_0044535 Ga0495668_0044535_321_662 110
864 3300046616 Ga0495668_0514669 Ga0495668_0514669_11_373 110
865 3300046642 Ga0495634_0006225 Ga0495634_0006225_386_727 110
866 3300046648 Ga0495611_0383414 Ga0495611_0383414_253_594 110
867 3300046660 Ga0495625_0000985 Ga0495625_0000985_22332_22673 110
868 3300046660 Ga0495625_0007833 Ga0495625_0007833_4014_4367 110
869 3300046660 Ga0495625_0019175 Ga0495625_0019175_1868_2230 110
870 3300046660 Ga0495625_0511048 Ga0495625_0511048_152_493 110
871 3300046663 Ga0495635_0002836 Ga0495635_0002836_87_428 110
872 3300046663 Ga0495635_0086686 Ga0495635_0086686_282_623 110
873 3300046664 Ga0495659_0066790 Ga0495659_0066790_604_945 110
874 3300046674 Ga0495588_0028867 Ga0495588_0028867_1361_1702 110
875 3300046675 Ga0495657_0467111 Ga0495657_0467111_212_553 110
876 3300046678 Ga0495599_0017587 Ga0495599_0017587_1530_1871 110
877 3300046678 Ga0495599_0051590 Ga0495599_0051590_1749_2129 110
878 3300046678 Ga0495599_0605156 Ga0495599_0605156_76_432 110
879 3300046679 Ga0495623_0050948 Ga0495623_0050948_2041_2421 110
880 3300046679 Ga0495623_0056771 Ga0495623_0056771_240_581 110
881 3300046679 Ga0495623_0082244 Ga0495623_0082244_176_517 110
882 3300046680 Ga0495646_0077284 Ga0495646_0077284_1583_1924 110
883 3300046680 Ga0495646_0124321 Ga0495646_0124321_1030_1410 110
884 3300046680 Ga0495646_0450865 Ga0495646_0450865_25_381 110
885 3300046680 Ga0495646_0542208 Ga0495646_0542208_24_365 110
886 3300046684 Ga0495669_0004252 Ga0495669_0004252_40_381 110
887 3300046689 Ga0495613_0003966 Ga0495613_0003966_1405_1746 110
888 3300046689 Ga0495613_0012222 Ga0495613_0012222_4475_4816 110
889 3300046690 Ga0495624_0007524 Ga0495624_0007524_6460_6801 110
890 3300046691 Ga0495670_0038859 Ga0495670_0038859_1752_2093 110
891 3300046692 Ga0495671_0153236 Ga0495671_0153236_628_969 110
892 3300046692 Ga0495671_0493283 Ga0495671_0493283_67_429 110
893 3300046694 Ga0495649_0064738 Ga0495649_0064738_184_534 110
894 3300046694 Ga0495649_0490026 Ga0495649_0490026_144_485 110
895 3300046809 Ga0495600_0002909 Ga0495600_0002909_1562_1903 110
896 3300046809 Ga0495600_0302730 Ga0495600_0302730_23_364 110
897 3300047315 Ga0495581_0245692 Ga0495581_0245692_466_807 110
898 3300047315 Ga0495581_0366883 Ga0495581_0366883_12_353 110
899 3300047317 Ga0495604_0002834 Ga0495604_0002834_8056_8397 110
900 3300047317 Ga0495604_0015522 Ga0495604_0015522_1705_2085 110
901 3300047317 Ga0495604_0069051 Ga0495604_0069051_1997_2338 110
902 3300047318 Ga0495636_0056644 Ga0495636_0056644_210_551 110
903 3300047319 Ga0495674_0014334 Ga0495674_0014334_7059_7400 110
904 3300047319 Ga0495674_0152317 Ga0495674_0152317_1574_1915 110
905 3300047320 Ga0495672_0030990 Ga0495672_0030990_2408_2749 110
906 3300047321 Ga0495676_0008961 Ga0495676_0008961_67_408 110
907 3300047321 Ga0495676_0114867 Ga0495676_0114867_275_616 110
908 3300047322 Ga0495680_0076425 Ga0495680_0076425_2134_2475 110
909 3300047444 Ga0495675_0003222 Ga0495675_0003222_1399_1740 110
910 3300047445 Ga0495677_0020984 Ga0495677_0020984_1816_2157 110
911 3300047469 Ga0495673_0072246 Ga0495673_0072246_595_957 110
912 3300047471 Ga0495684_0049723 Ga0495684_0049723_922_1302 110
913 3300047471 Ga0495684_0101338 Ga0495684_0101338_1813_2154 110
914 3300047472 Ga0495686_0014007 Ga0495686_0014007_2493_2840 110
915 3300047472 Ga0495686_0067112 Ga0495686_0067112_385_729 110
916 3300047673 Ga0495593_0019638 Ga0495593_0019638_3383_3724 110
917 3300047673 Ga0495593_0040852 Ga0495593_0040852_676_1017 110
918 3300048088 Ga0495602_0773591 Ga0495602_0773591_14_355 110
919 3300048089 Ga0495614_0000972 Ga0495614_0000972_1456_1797 110
920 3300048903 Ga0496100_0575375 Ga0496100_0575375_442_783 110
921 3300048903 Ga0496100_1034106 Ga0496100_1034106_119_481 110
922 3300048904 Ga0496101_0659155 Ga0496101_0659155_225_566 110
923 3300048905 Ga0496102_0777646 Ga0496102_0777646_279_620 110
924 3300048906 Ga0496103_0741566 Ga0496103_0741566_219_578 110
925 3300048907 Ga0496104_0057613 Ga0496104_0057613_1607_1948 110
926 3300048907 Ga0496104_0875113 Ga0496104_0875113_272_634 110
927 3300048915 Ga0496112_0165026 Ga0496112_0165026_777_1118 110
928 3300048917 Ga0496114_0096351 Ga0496114_0096351_1155_1496 110
929 3300048918 Ga0496115_0202171 Ga0496115_0202171_697_1056 110
930 3300048923 Ga0496120_0134276 Ga0496120_0134276_629_982 110
931 3300048924 Ga0496121_0492821 Ga0496121_0492821_343_684 110
932 3300048929 Ga0496126_0000014 Ga0496126_0000014_614198_614581 110
933 3300048929 Ga0496126_0000154 Ga0496126_0000154_117020_117373 110
934 3300048929 Ga0496126_0739092 Ga0496126_0739092_231_572 110
935 3300048929 Ga0496126_1287352 Ga0496126_1287352_125_523 110
936 3300049460 Ga0495682_0041693 Ga0495682_0041693_636_998 110
937 3300049570 Ga0501033_0045842 Ga0501033_0045842_2483_2872 110
938 3300049573 Ga0501037_0471859 Ga0501037_0471859_310_699 110
939 3300049574 Ga0501038_0098016 Ga0501038_0098016_1202_1591 110
940 3300049574 Ga0501038_0110075 Ga0501038_0110075_1080_1433 110
941 3300049581 Ga0501047_0017729 Ga0501047_0017729_1450_1839 110
942 3300049586 Ga0501070_0124247 Ga0501070_0124247_1748_2089 110
943 3300049586 Ga0501070_0254155 Ga0501070_0254155_861_1250 110
944 3300049589 Ga0501073_1108370 Ga0501073_1108370_37_390 110
945 3300049742 Ga0501080_0960686 Ga0501080_0960686_225_614 110
946 3300049822 Ga0501035_0350448 Ga0501035_0350448_100_444 110
947 3300049823 Ga0501044_0171643 Ga0501044_0171643_437_826 110
948 3300053078 Ga0495612_0308136 Ga0495612_0308136_294_674 110
949 3300053087 Ga0500643_028144 Ga0500643_028144_675_1016 110
950 3300053088 Ga0500644_0156516 Ga0500644_0156516_290_652 110
951 3300053093 Ga0500651_0000005 Ga0500651_0000005_179128_179484 110
952 3300053119 Ga0500595_013665 Ga0500595_013665_1633_1983 110
953 3300053119 Ga0500595_016226 Ga0500595_016226_320_682 110
954 3300055283 Ga0500661_001216 Ga0500661_001216_3817_4158 110
955 iso_pu_bacteria 2884215851 2884217794 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

49

124

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9431 12 101
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9186 4 105
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9167 4 105
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9088 4 105
7bgm-assembly1.cif.gz_A crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.904 2 105
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9591 2 88 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9462 12 93 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.925 2 93 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9081 2 88 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.887 4 93 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A3M1DQ05-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.965 1 94 GO:0000105
GO:0004635
AF-A0A1I6L727-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.962 2 107 GO:0000105
GO:0004635
AF-A0A841JW93-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9612 3 110 GO:0000105
GO:0004635
AF-A0A6A7L9V1-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9607 4 105 GO:0000105
GO:0004635
AF-A0A382RME8-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) 0.9602 3 105 GO:0000105
GO:0004635
GO:0005737

Feature Viewer

pLDDT pTM Quality
90.95 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map