F486722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 955 | 382 | 955 | 62 |
Family's Representative Sequence
| Representative Sequence | 3300042436|Ga0439435_0066814|Ga0439435_0066814_793_1020 |
| Length | 75 |
| Sequence | MPLLVRGSWENSMSAVDPRLLEILVCPLCKGKLVYRKPAAELVCKADRLAYPVKDGIPVMLEDEARKLPPEEEVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 180 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 181 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 182 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 192 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 193 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 236 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 240 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 241 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 242 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 243 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 244 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 245 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 246 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 247 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 252 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 253 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 254 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 255 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 256 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 257 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 258 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 261 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 262 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 94.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1031541 | 3300002073 | Bacteria | 640 |
| 2 | JGI24742J22300_10057076 | 3300002244 | Bacteria | 714 |
| 3 | Ga0065712_10248395 | 3300005290 | Bacteria | 966 |
| 4 | Ga0065715_10422296 | 3300005293 | Bacteria | 856 |
| 5 | Ga0065707_10739179 | 3300005295 | Bacteria | 623 |
| 6 | Ga0070676_10089431 | 3300005328 | Bacteria | 1884 |
| 7 | Ga0070683_101879960 | 3300005329 | Bacteria | 575 |
| 8 | Ga0070690_100000172 | 3300005330 | Bacteria | 33180 |
| 9 | Ga0070690_100000525 | 3300005330 | Bacteria | 19252 |
| 10 | Ga0070690_101481321 | 3300005330 | Bacteria | 548 |
| 11 | Ga0068869_100004583 | 3300005334 | Bacteria | 8612 |
| 12 | Ga0068869_100009815 | 3300005334 | Bacteria | 6218 |
| 13 | Ga0068869_100075172 | 3300005334 | Bacteria | 2509 |
| 14 | Ga0068869_101525096 | 3300005334 | Bacteria | 594 |
| 15 | Ga0070666_10169576 | 3300005335 | Bacteria | 1528 |
| 16 | Ga0070680_100000230 | 3300005336 | Bacteria | 36894 |
| 17 | Ga0070680_100062718 | 3300005336 | Bacteria | 3044 |
| 18 | Ga0070680_100577203 | 3300005336 | Bacteria | 964 |
| 19 | Ga0070682_100026535 | 3300005337 | Bacteria | 3469 |
| 20 | Ga0068868_100001075 | 3300005338 | Bacteria | 18741 |
| 21 | Ga0070689_100000288 | 3300005340 | Bacteria | 29270 |
| 22 | Ga0070689_100001034 | 3300005340 | Bacteria | 17460 |
| 23 | Ga0070689_100030972 | 3300005340 | Bacteria | 4063 |
| 24 | Ga0070689_100102156 | 3300005340 | Bacteria | 2271 |
| 25 | Ga0070689_100270512 | 3300005340 | Bacteria | 1407 |
| 26 | Ga0070691_10000935 | 3300005341 | Bacteria | 11861 |
| 27 | Ga0070691_10013263 | 3300005341 | Bacteria | 3775 |
| 28 | Ga0070687_100000141 | 3300005343 | Bacteria | 25042 |
| 29 | Ga0070687_100270003 | 3300005343 | Bacteria | 1066 |
| 30 | Ga0070687_100767646 | 3300005343 | Bacteria | 680 |
| 31 | Ga0070661_100937074 | 3300005344 | Bacteria | 716 |
| 32 | Ga0070692_10002703 | 3300005345 | Bacteria | 6951 |
| 33 | Ga0070692_10034765 | 3300005345 | Bacteria | 2548 |
| 34 | Ga0070692_10086335 | 3300005345 | Bacteria | 1698 |
| 35 | Ga0070692_11167486 | 3300005345 | Bacteria | 547 |
| 36 | Ga0070669_100410539 | 3300005353 | Bacteria | 1110 |
| 37 | Ga0070669_100844585 | 3300005353 | Bacteria | 780 |
| 38 | Ga0070671_100978099 | 3300005355 | Bacteria | 741 |
| 39 | Ga0070671_101093023 | 3300005355 | Bacteria | 700 |
| 40 | Ga0070674_100264274 | 3300005356 | Bacteria | 1357 |
| 41 | Ga0070673_100408725 | 3300005364 | Bacteria | 1215 |
| 42 | Ga0070688_100094524 | 3300005365 | Bacteria | 1960 |
| 43 | Ga0070688_100144227 | 3300005365 | Bacteria | 1621 |
| 44 | Ga0070688_101078215 | 3300005365 | Bacteria | 641 |
| 45 | Ga0070688_101670264 | 3300005365 | Bacteria | 521 |
| 46 | Ga0070703_10004405 | 3300005406 | Bacteria | 3962 |
| 47 | Ga0070703_10523304 | 3300005406 | Bacteria | 537 |
| 48 | Ga0070709_10648673 | 3300005434 | Bacteria | 817 |
| 49 | Ga0070709_10870496 | 3300005434 | Bacteria | 711 |
| 50 | Ga0070713_101165032 | 3300005436 | Bacteria | 746 |
| 51 | Ga0070713_101707603 | 3300005436 | Unclassified | 611 |
| 52 | Ga0070710_10025335 | 3300005437 | Bacteria | 3141 |
| 53 | Ga0070710_10551529 | 3300005437 | Bacteria | 796 |
| 54 | Ga0070710_10717286 | 3300005437 | Bacteria | 707 |
| 55 | Ga0070710_10760521 | 3300005437 | Bacteria | 689 |
| 56 | Ga0070701_10004016 | 3300005438 | Bacteria | 5896 |
| 57 | Ga0070701_10043338 | 3300005438 | Bacteria | 2301 |
| 58 | Ga0070701_10195837 | 3300005438 | Bacteria | 1191 |
| 59 | Ga0070701_10526600 | 3300005438 | Bacteria | 771 |
| 60 | Ga0070701_11332969 | 3300005438 | Bacteria | 514 |
| 61 | Ga0070705_100001001 | 3300005440 | Bacteria | 15736 |
| 62 | Ga0070705_100006101 | 3300005440 | Bacteria | 5899 |
| 63 | Ga0070705_100024264 | 3300005440 | Bacteria | 3271 |
| 64 | Ga0070705_100201953 | 3300005440 | Bacteria | 1363 |
| 65 | Ga0070705_100226425 | 3300005440 | Bacteria | 1298 |
| 66 | Ga0070705_100554213 | 3300005440 | Bacteria | 882 |
| 67 | Ga0070705_100760892 | 3300005440 | Bacteria | 767 |
| 68 | Ga0070705_100980900 | 3300005440 | Bacteria | 685 |
| 69 | Ga0070700_100000241 | 3300005441 | Bacteria | 30113 |
| 70 | Ga0070700_100000591 | 3300005441 | Bacteria | 18135 |
| 71 | Ga0070700_100821890 | 3300005441 | Bacteria | 750 |
| 72 | Ga0070700_101195529 | 3300005441 | Bacteria | 635 |
| 73 | Ga0070700_101236123 | 3300005441 | Bacteria | 625 |
| 74 | Ga0070694_100001923 | 3300005444 | Bacteria | 12299 |
| 75 | Ga0070694_100040371 | 3300005444 | Bacteria | 3111 |
| 76 | Ga0070694_100048516 | 3300005444 | Bacteria | 2857 |
| 77 | Ga0070694_100108029 | 3300005444 | Bacteria | 1978 |
| 78 | Ga0070694_100163989 | 3300005444 | Bacteria | 1633 |
| 79 | Ga0070694_100234204 | 3300005444 | Bacteria | 1383 |
| 80 | Ga0070694_100235915 | 3300005444 | Bacteria | 1378 |
| 81 | Ga0070694_101373747 | 3300005444 | Bacteria | 595 |
| 82 | Ga0070708_100428923 | 3300005445 | Bacteria | 1247 |
| 83 | Ga0070678_100314014 | 3300005456 | Bacteria | 1336 |
| 84 | Ga0070678_100420398 | 3300005456 | Bacteria | 1165 |
| 85 | Ga0070662_101274901 | 3300005457 | Bacteria | 632 |
| 86 | Ga0070681_10002547 | 3300005458 | Bacteria | 16723 |
| 87 | Ga0070681_10073138 | 3300005458 | Bacteria | 3390 |
| 88 | Ga0070681_10796294 | 3300005458 | Bacteria | 862 |
| 89 | Ga0068867_100000487 | 3300005459 | Bacteria | 26508 |
| 90 | Ga0068867_100011581 | 3300005459 | Bacteria | 6226 |
| 91 | Ga0070685_11163709 | 3300005466 | Bacteria | 585 |
| 92 | Ga0070706_100152546 | 3300005467 | Bacteria | 2157 |
| 93 | Ga0070698_101224571 | 3300005471 | Bacteria | 700 |
| 94 | Ga0070699_100093440 | 3300005518 | Bacteria | 2632 |
| 95 | Ga0070699_101021991 | 3300005518 | Bacteria | 758 |
| 96 | Ga0070679_100002377 | 3300005530 | Bacteria | 17058 |
| 97 | Ga0070679_100022031 | 3300005530 | Bacteria | 6225 |
| 98 | Ga0070679_101651013 | 3300005530 | Bacteria | 589 |
| 99 | Ga0070679_101940598 | 3300005530 | Bacteria | 538 |
| 100 | Ga0070684_100936328 | 3300005535 | Bacteria | 812 |
| 101 | Ga0070684_101073665 | 3300005535 | Bacteria | 756 |
| 102 | Ga0070697_100001057 | 3300005536 | Bacteria | 20812 |
| 103 | Ga0070697_100004435 | 3300005536 | Bacteria | 10779 |
| 104 | Ga0070697_100310424 | 3300005536 | Bacteria | 1357 |
| 105 | Ga0070697_100869690 | 3300005536 | Bacteria | 799 |
| 106 | Ga0070697_101067084 | 3300005536 | Bacteria | 719 |
| 107 | Ga0070697_102100337 | 3300005536 | Bacteria | 506 |
| 108 | Ga0070686_100000527 | 3300005544 | Bacteria | 22925 |
| 109 | Ga0070686_100006108 | 3300005544 | Bacteria | 6688 |
| 110 | Ga0070686_100117866 | 3300005544 | Bacteria | 1819 |
| 111 | Ga0070695_100000298 | 3300005545 | Bacteria | 25019 |
| 112 | Ga0070695_100000498 | 3300005545 | Bacteria | 20517 |
| 113 | Ga0070695_100352582 | 3300005545 | Bacteria | 1103 |
| 114 | Ga0070695_100482188 | 3300005545 | Bacteria | 956 |
| 115 | Ga0070695_100666429 | 3300005545 | Bacteria | 823 |
| 116 | Ga0070695_101360760 | 3300005545 | Bacteria | 588 |
| 117 | Ga0070696_100000061 | 3300005546 | Bacteria | 52371 |
| 118 | Ga0070696_100002472 | 3300005546 | Bacteria | 12245 |
| 119 | Ga0070696_100008068 | 3300005546 | Bacteria | 7037 |
| 120 | Ga0070696_100032452 | 3300005546 | Bacteria | 3583 |
| 121 | Ga0070696_100081100 | 3300005546 | Bacteria | 2298 |
| 122 | Ga0070696_100269062 | 3300005546 | Bacteria | 1295 |
| 123 | Ga0070696_101200717 | 3300005546 | Bacteria | 641 |
| 124 | Ga0070696_101275852 | 3300005546 | Bacteria | 623 |
| 125 | Ga0070696_101430200 | 3300005546 | Bacteria | 590 |
| 126 | Ga0070693_100000016 | 3300005547 | Bacteria | 63019 |
| 127 | Ga0070693_100149468 | 3300005547 | Bacteria | 1478 |
| 128 | Ga0070693_100981859 | 3300005547 | Bacteria | 638 |
| 129 | Ga0070693_101142245 | 3300005547 | Bacteria | 596 |
| 130 | Ga0070693_101532506 | 3300005547 | Bacteria | 522 |
| 131 | Ga0070704_100000246 | 3300005549 | Bacteria | 23326 |
| 132 | Ga0070704_100014320 | 3300005549 | Bacteria | 4952 |
| 133 | Ga0070704_100386245 | 3300005549 | Bacteria | 1191 |
| 134 | Ga0070704_100498078 | 3300005549 | Bacteria | 1057 |
| 135 | Ga0070704_100758248 | 3300005549 | Bacteria | 864 |
| 136 | Ga0070704_100783944 | 3300005549 | Bacteria | 851 |
| 137 | Ga0068855_100000975 | 3300005563 | Bacteria | 35626 |
| 138 | Ga0068857_101464189 | 3300005577 | Bacteria | 665 |
| 139 | Ga0068854_100000366 | 3300005578 | Bacteria | 28906 |
| 140 | Ga0068854_100345651 | 3300005578 | Bacteria | 1216 |
| 141 | Ga0068854_101262291 | 3300005578 | Bacteria | 664 |
| 142 | Ga0068856_100497566 | 3300005614 | Bacteria | 1240 |
| 143 | Ga0070702_100000485 | 3300005615 | Bacteria | 14291 |
| 144 | Ga0070702_100074788 | 3300005615 | Bacteria | 2011 |
| 145 | Ga0070702_100288871 | 3300005615 | Bacteria | 1129 |
| 146 | Ga0068852_100314752 | 3300005616 | Bacteria | 1518 |
| 147 | Ga0068859_100001619 | 3300005617 | Bacteria | 23020 |
| 148 | Ga0068859_100014820 | 3300005617 | Bacteria | 7829 |
| 149 | Ga0068859_102524061 | 3300005617 | Bacteria | 566 |
| 150 | Ga0068864_100015369 | 3300005618 | Bacteria | 6364 |
| 151 | Ga0068864_100725880 | 3300005618 | Bacteria | 972 |
| 152 | Ga0068866_10000176 | 3300005718 | Bacteria | 29873 |
| 153 | Ga0068866_10000528 | 3300005718 | Bacteria | 17593 |
| 154 | Ga0068861_100000423 | 3300005719 | Bacteria | 24534 |
| 155 | Ga0068861_100001699 | 3300005719 | Bacteria | 14134 |
| 156 | Ga0068861_100130189 | 3300005719 | Bacteria | 2042 |
| 157 | Ga0068861_101963443 | 3300005719 | Bacteria | 583 |
| 158 | Ga0068870_10178339 | 3300005840 | Bacteria | 1273 |
| 159 | Ga0068870_10201290 | 3300005840 | Bacteria | 1208 |
| 160 | Ga0068870_10283346 | 3300005840 | Bacteria | 1040 |
| 161 | Ga0068863_100812686 | 3300005841 | Bacteria | 933 |
| 162 | Ga0068863_100854926 | 3300005841 | Bacteria | 909 |
| 163 | Ga0068858_100000619 | 3300005842 | Bacteria | 37094 |
| 164 | Ga0068858_100005846 | 3300005842 | Bacteria | 12017 |
| 165 | Ga0068860_100002570 | 3300005843 | Bacteria | 18998 |
| 166 | Ga0068860_100030340 | 3300005843 | Bacteria | 5201 |
| 167 | Ga0068862_100003412 | 3300005844 | Bacteria | 13698 |
| 168 | Ga0068862_100017845 | 3300005844 | Bacteria | 5908 |
| 169 | Ga0068862_101293506 | 3300005844 | Unclassified | 730 |
| 170 | Ga0081539_10001364 | 3300005985 | Bacteria | 42295 |
| 171 | Ga0070715_10468134 | 3300006163 | Bacteria | 715 |
| 172 | Ga0070716_100032456 | 3300006173 | Bacteria | 2848 |
| 173 | Ga0070712_101997504 | 3300006175 | Bacteria | 508 |
| 174 | Ga0075366_10832887 | 3300006195 | Bacteria | 574 |
| 175 | Ga0097621_100001153 | 3300006237 | Bacteria | 18360 |
| 176 | Ga0097621_100001255 | 3300006237 | Bacteria | 17539 |
| 177 | Ga0097621_101002611 | 3300006237 | Bacteria | 781 |
| 178 | Ga0068871_100003554 | 3300006358 | Bacteria | 10726 |
| 179 | Ga0068871_100189883 | 3300006358 | Bacteria | 1769 |
| 180 | Ga0075428_100000532 | 3300006844 | Bacteria | 38828 |
| 181 | Ga0075428_100001527 | 3300006844 | Bacteria | 24754 |
| 182 | Ga0075428_100044919 | 3300006844 | Bacteria | 4855 |
| 183 | Ga0075428_100233663 | 3300006844 | Bacteria | 1984 |
| 184 | Ga0075428_100589625 | 3300006844 | Bacteria | 1187 |
| 185 | Ga0075428_102460801 | 3300006844 | Unclassified | 534 |
| 186 | Ga0075430_100001203 | 3300006846 | Bacteria | 20788 |
| 187 | Ga0075430_100012906 | 3300006846 | Bacteria | 7120 |
| 188 | Ga0075430_100452115 | 3300006846 | Bacteria | 1060 |
| 189 | Ga0075431_100006916 | 3300006847 | Bacteria | 11276 |
| 190 | Ga0075431_100034541 | 3300006847 | Bacteria | 5209 |
| 191 | Ga0075431_100182411 | 3300006847 | Bacteria | 2154 |
| 192 | Ga0075431_100210289 | 3300006847 | Bacteria | 1987 |
| 193 | Ga0075431_100423176 | 3300006847 | Bacteria | 1331 |
| 194 | Ga0075431_100911482 | 3300006847 | Bacteria | 848 |
| 195 | Ga0075433_10059938 | 3300006852 | Bacteria | 3331 |
| 196 | Ga0075433_10969767 | 3300006852 | Bacteria | 741 |
| 197 | Ga0075433_11501679 | 3300006852 | Bacteria | 582 |
| 198 | Ga0075433_11670364 | 3300006852 | Bacteria | 549 |
| 199 | Ga0075434_100011723 | 3300006871 | Bacteria | 8279 |
| 200 | Ga0075434_100069507 | 3300006871 | Bacteria | 3511 |
| 201 | Ga0075434_100867554 | 3300006871 | Bacteria | 918 |
| 202 | Ga0075434_101003556 | 3300006871 | Bacteria | 849 |
| 203 | Ga0075434_101247897 | 3300006871 | Bacteria | 755 |
| 204 | Ga0075434_102226237 | 3300006871 | Bacteria | 552 |
| 205 | Ga0075429_100000324 | 3300006880 | Bacteria | 34389 |
| 206 | Ga0075429_100007581 | 3300006880 | Bacteria | 9425 |
| 207 | Ga0075429_100111915 | 3300006880 | Bacteria | 2386 |
| 208 | Ga0075429_100154145 | 3300006880 | Bacteria | 2012 |
| 209 | Ga0075429_100276506 | 3300006880 | Bacteria | 1470 |
| 210 | Ga0075429_100282434 | 3300006880 | Bacteria | 1454 |
| 211 | Ga0075429_100691106 | 3300006880 | Bacteria | 894 |
| 212 | Ga0075429_101847963 | 3300006880 | Bacteria | 524 |
| 213 | Ga0068865_100000262 | 3300006881 | Bacteria | 28966 |
| 214 | Ga0068865_100000385 | 3300006881 | Bacteria | 24479 |
| 215 | Ga0075436_100027479 | 3300006914 | Bacteria | 3916 |
| 216 | Ga0075436_100067227 | 3300006914 | Bacteria | 2477 |
| 217 | Ga0075436_100074204 | 3300006914 | Bacteria | 2355 |
| 218 | Ga0075436_100188264 | 3300006914 | Bacteria | 1460 |
| 219 | Ga0075436_100686426 | 3300006914 | Bacteria | 758 |
| 220 | Ga0075436_101029358 | 3300006914 | Bacteria | 618 |
| 221 | Ga0075436_101330338 | 3300006914 | Bacteria | 544 |
| 222 | Ga0097620_100001619 | 3300006931 | Bacteria | 23020 |
| 223 | Ga0097620_100014822 | 3300006931 | Bacteria | 7829 |
| 224 | Ga0097620_102524397 | 3300006931 | Bacteria | 566 |
| 225 | Ga0075435_100000887 | 3300007076 | Bacteria | 18792 |
| 226 | Ga0075435_100207814 | 3300007076 | Bacteria | 1660 |
| 227 | Ga0075435_100351811 | 3300007076 | Bacteria | 1263 |
| 228 | Ga0075435_100861506 | 3300007076 | Bacteria | 790 |
| 229 | Ga0075435_101387526 | 3300007076 | Bacteria | 616 |
| 230 | Ga0099794_10010376 | 3300007265 | Bacteria | 3954 |
| 231 | Ga0099794_10042383 | 3300007265 | Bacteria | 2170 |
| 232 | Ga0099794_10093204 | 3300007265 | Bacteria | 1497 |
| 233 | Ga0099794_10407602 | 3300007265 | Bacteria | 710 |
| 234 | Ga0099795_10060495 | 3300007788 | Bacteria | 1404 |
| 235 | Ga0105250_10033278 | 3300009092 | Bacteria | 2069 |
| 236 | Ga0105240_10393433 | 3300009093 | Bacteria | 1563 |
| 237 | Ga0105240_12347077 | 3300009093 | Bacteria | 552 |
| 238 | Ga0111539_10006721 | 3300009094 | Bacteria | 14808 |
| 239 | Ga0111539_10019692 | 3300009094 | Bacteria | 8323 |
| 240 | Ga0111539_10080009 | 3300009094 | Bacteria | 3844 |
| 241 | Ga0111539_10086922 | 3300009094 | Bacteria | 3674 |
| 242 | Ga0111539_11142438 | 3300009094 | Bacteria | 905 |
| 243 | Ga0111539_11707936 | 3300009094 | Bacteria | 730 |
| 244 | Ga0111539_13061241 | 3300009094 | Bacteria | 540 |
| 245 | Ga0105245_10000178 | 3300009098 | Bacteria | 60846 |
| 246 | Ga0105245_10000515 | 3300009098 | Bacteria | 35472 |
| 247 | Ga0114129_10014186 | 3300009147 | Bacteria | 11354 |
| 248 | Ga0114129_10178816 | 3300009147 | Bacteria | 2888 |
| 249 | Ga0114129_10602307 | 3300009147 | Bacteria | 1423 |
| 250 | Ga0114129_10877299 | 3300009147 | Bacteria | 1138 |
| 251 | Ga0114129_11000204 | 3300009147 | Bacteria | 1053 |
| 252 | Ga0114129_13142443 | 3300009147 | Bacteria | 539 |
| 253 | Ga0105243_10000270 | 3300009148 | Bacteria | 58296 |
| 254 | Ga0105243_10006067 | 3300009148 | Bacteria | 9343 |
| 255 | Ga0105241_10087687 | 3300009174 | Bacteria | 2450 |
| 256 | Ga0105241_12191693 | 3300009174 | Bacteria | 548 |
| 257 | Ga0105242_10000409 | 3300009176 | Bacteria | 34163 |
| 258 | Ga0105242_10001066 | 3300009176 | Bacteria | 21546 |
| 259 | Ga0105248_10266766 | 3300009177 | Bacteria | 1927 |
| 260 | Ga0105248_10319008 | 3300009177 | Bacteria | 1750 |
| 261 | Ga0105248_10665880 | 3300009177 | Bacteria | 1174 |
| 262 | Ga0105248_13057425 | 3300009177 | Bacteria | 533 |
| 263 | Ga0105237_12105200 | 3300009545 | Unclassified | 573 |
| 264 | Ga0105237_12435979 | 3300009545 | Bacteria | 534 |
| 265 | Ga0105238_12749690 | 3300009551 | Bacteria | 528 |
| 266 | Ga0105249_10012264 | 3300009553 | Bacteria | 7552 |
| 267 | Ga0105249_10031943 | 3300009553 | Bacteria | 4763 |
| 268 | Ga0105249_12616062 | 3300009553 | Unclassified | 577 |
| 269 | Ga0099796_10382424 | 3300010159 | Bacteria | 613 |
| 270 | Ga0105239_10992784 | 3300010375 | Bacteria | 965 |
| 271 | Ga0105239_11021185 | 3300010375 | Bacteria | 951 |
| 272 | Ga0105246_10449128 | 3300011119 | Bacteria | 1083 |
| 273 | Ga0105246_11145808 | 3300011119 | Bacteria | 713 |
| 274 | Ga0157327_1073375 | 3300012512 | Bacteria | 536 |
| 275 | Ga0157369_10495602 | 3300013105 | Bacteria | 1264 |
| 276 | Ga0157369_12101250 | 3300013105 | Unclassified | 573 |
| 277 | Ga0157374_10000104 | 3300013296 | Bacteria | 78523 |
| 278 | Ga0157378_10000340 | 3300013297 | Bacteria | 46001 |
| 279 | Ga0157378_10000746 | 3300013297 | Bacteria | 30487 |
| 280 | Ga0157378_10973027 | 3300013297 | Bacteria | 882 |
| 281 | Ga0163162_10997548 | 3300013306 | Bacteria | 947 |
| 282 | Ga0163162_11663976 | 3300013306 | Bacteria | 728 |
| 283 | Ga0163162_11774116 | 3300013306 | Bacteria | 705 |
| 284 | Ga0163162_12670458 | 3300013306 | Bacteria | 575 |
| 285 | Ga0157372_10457782 | 3300013307 | Bacteria | 1487 |
| 286 | Ga0157372_10654974 | 3300013307 | Bacteria | 1223 |
| 287 | Ga0157375_10300376 | 3300013308 | Bacteria | 1769 |
| 288 | Ga0157375_12315930 | 3300013308 | Bacteria | 640 |
| 289 | Ga0157375_12625771 | 3300013308 | Bacteria | 602 |
| 290 | Ga0157380_10009920 | 3300014326 | Bacteria | 6836 |
| 291 | Ga0157380_10015130 | 3300014326 | Bacteria | 5662 |
| 292 | Ga0157380_10387978 | 3300014326 | Bacteria | 1320 |
| 293 | Ga0157380_12480175 | 3300014326 | Bacteria | 584 |
| 294 | Ga0157380_12923155 | 3300014326 | Unclassified | 544 |
| 295 | Ga0157377_10033972 | 3300014745 | Bacteria | 2788 |
| 296 | Ga0157379_10136925 | 3300014968 | Bacteria | 2206 |
| 297 | Ga0157379_11809351 | 3300014968 | Unclassified | 600 |
| 298 | Ga0157376_10008044 | 3300014969 | Bacteria | 7574 |
| 299 | Ga0163161_10704586 | 3300017792 | Bacteria | 841 |
| 300 | Ga0213871_10261613 | 3300021441 | Bacteria | 551 |
| 301 | Ga0207696_1164737 | 3300025711 | Bacteria | 589 |
| 302 | Ga0207653_10007033 | 3300025885 | Bacteria | 3513 |
| 303 | Ga0207692_10169754 | 3300025898 | Bacteria | 1263 |
| 304 | Ga0207692_10200537 | 3300025898 | Bacteria | 1173 |
| 305 | Ga0207692_11093516 | 3300025898 | Bacteria | 528 |
| 306 | Ga0207642_10002060 | 3300025899 | Bacteria | 6206 |
| 307 | Ga0207688_10199128 | 3300025901 | Bacteria | 1200 |
| 308 | Ga0207688_10428585 | 3300025901 | Bacteria | 823 |
| 309 | Ga0207680_10410608 | 3300025903 | Bacteria | 958 |
| 310 | Ga0207647_10277986 | 3300025904 | Bacteria | 956 |
| 311 | Ga0207685_10040579 | 3300025905 | Bacteria | 1735 |
| 312 | Ga0207685_10118032 | 3300025905 | Bacteria | 1160 |
| 313 | Ga0207685_10610367 | 3300025905 | Bacteria | 586 |
| 314 | Ga0207699_10430940 | 3300025906 | Bacteria | 943 |
| 315 | Ga0207643_10029146 | 3300025908 | Bacteria | 3070 |
| 316 | Ga0207643_10430303 | 3300025908 | Bacteria | 837 |
| 317 | Ga0207684_11534192 | 3300025910 | Bacteria | 541 |
| 318 | Ga0207654_10421479 | 3300025911 | Bacteria | 931 |
| 319 | Ga0207707_10005405 | 3300025912 | Bacteria | 11169 |
| 320 | Ga0207695_10428229 | 3300025913 | Bacteria | 1207 |
| 321 | Ga0207663_10630391 | 3300025916 | Bacteria | 845 |
| 322 | Ga0207663_11663604 | 3300025916 | Bacteria | 514 |
| 323 | Ga0207660_10002634 | 3300025917 | Bacteria | 11770 |
| 324 | Ga0207660_10059649 | 3300025917 | Bacteria | 2740 |
| 325 | Ga0207660_10743023 | 3300025917 | Bacteria | 801 |
| 326 | Ga0207662_10000047 | 3300025918 | Bacteria | 52763 |
| 327 | Ga0207662_10039411 | 3300025918 | Bacteria | 2772 |
| 328 | Ga0207662_10194985 | 3300025918 | Bacteria | 1308 |
| 329 | Ga0207652_10015482 | 3300025921 | Bacteria | 6200 |
| 330 | Ga0207652_10027972 | 3300025921 | Bacteria | 4702 |
| 331 | Ga0207646_10170746 | 3300025922 | Bacteria | 1964 |
| 332 | Ga0207646_10515524 | 3300025922 | Bacteria | 1076 |
| 333 | Ga0207681_10107719 | 3300025923 | Bacteria | 2022 |
| 334 | Ga0207687_10001597 | 3300025927 | Bacteria | 15607 |
| 335 | Ga0207700_11356640 | 3300025928 | Unclassified | 633 |
| 336 | Ga0207700_11886261 | 3300025928 | Bacteria | 524 |
| 337 | Ga0207664_10080713 | 3300025929 | Bacteria | 2645 |
| 338 | Ga0207644_10762143 | 3300025931 | Bacteria | 809 |
| 339 | Ga0207706_10819868 | 3300025933 | Bacteria | 789 |
| 340 | Ga0207686_10000446 | 3300025934 | Bacteria | 27472 |
| 341 | Ga0207686_10976435 | 3300025934 | Bacteria | 686 |
| 342 | Ga0207709_10002410 | 3300025935 | Bacteria | 11759 |
| 343 | Ga0207670_10000462 | 3300025936 | Bacteria | 22646 |
| 344 | Ga0207670_11492561 | 3300025936 | Bacteria | 574 |
| 345 | Ga0207704_10000290 | 3300025938 | Bacteria | 23770 |
| 346 | Ga0207665_10066961 | 3300025939 | Bacteria | 2445 |
| 347 | Ga0207665_10101182 | 3300025939 | Bacteria | 2012 |
| 348 | Ga0207665_10895308 | 3300025939 | Bacteria | 704 |
| 349 | Ga0207691_10687266 | 3300025940 | Unclassified | 863 |
| 350 | Ga0207711_10524885 | 3300025941 | Bacteria | 1104 |
| 351 | Ga0207711_10542996 | 3300025941 | Bacteria | 1084 |
| 352 | Ga0207689_10000148 | 3300025942 | Bacteria | 60276 |
| 353 | Ga0207689_10719676 | 3300025942 | Bacteria | 842 |
| 354 | Ga0207667_10004155 | 3300025949 | Bacteria | 17792 |
| 355 | Ga0207651_10448678 | 3300025960 | Bacteria | 1106 |
| 356 | Ga0207651_12011099 | 3300025960 | Bacteria | 519 |
| 357 | Ga0207712_10012530 | 3300025961 | Bacteria | 5418 |
| 358 | Ga0207640_10005645 | 3300025981 | Bacteria | 6822 |
| 359 | Ga0207677_10002010 | 3300026023 | Bacteria | 10724 |
| 360 | Ga0207677_12143414 | 3300026023 | Bacteria | 520 |
| 361 | Ga0207703_10001208 | 3300026035 | Bacteria | 24188 |
| 362 | Ga0207639_10360987 | 3300026041 | Bacteria | 1300 |
| 363 | Ga0207708_10000676 | 3300026075 | Bacteria | 26062 |
| 364 | Ga0207708_10452827 | 3300026075 | Bacteria | 1069 |
| 365 | Ga0207708_11167397 | 3300026075 | Bacteria | 673 |
| 366 | Ga0207702_10076459 | 3300026078 | Bacteria | 2894 |
| 367 | Ga0207702_11999002 | 3300026078 | Unclassified | 570 |
| 368 | Ga0207641_10294804 | 3300026088 | Bacteria | 1530 |
| 369 | Ga0207641_11083642 | 3300026088 | Bacteria | 799 |
| 370 | Ga0207648_10000018 | 3300026089 | Bacteria | 148157 |
| 371 | Ga0207676_10490959 | 3300026095 | Bacteria | 1164 |
| 372 | Ga0207674_10549673 | 3300026116 | Bacteria | 1115 |
| 373 | Ga0207675_100000170 | 3300026118 | Bacteria | 58303 |
| 374 | Ga0207675_101224058 | 3300026118 | Bacteria | 771 |
| 375 | Ga0207698_10098960 | 3300026142 | Bacteria | 2411 |
| 376 | Ga0209969_1018522 | 3300027360 | Bacteria | 1029 |
| 377 | Ga0209967_1025342 | 3300027364 | Bacteria | 878 |
| 378 | Ga0209981_1008520 | 3300027378 | Bacteria | 1394 |
| 379 | Ga0209996_1047224 | 3300027395 | Bacteria | 648 |
| 380 | Ga0209984_1070459 | 3300027424 | Bacteria | 522 |
| 381 | Ga0210000_1000974 | 3300027462 | Bacteria | 4006 |
| 382 | Ga0210000_1007252 | 3300027462 | Bacteria | 1621 |
| 383 | Ga0210000_1015320 | 3300027462 | Bacteria | 1154 |
| 384 | Ga0209995_1050754 | 3300027471 | Bacteria | 704 |
| 385 | Ga0209968_1005686 | 3300027526 | Bacteria | 1872 |
| 386 | Ga0209968_1038970 | 3300027526 | Bacteria | 809 |
| 387 | Ga0209968_1099133 | 3300027526 | Bacteria | 531 |
| 388 | Ga0209999_1011110 | 3300027543 | Bacteria | 1628 |
| 389 | Ga0209999_1012664 | 3300027543 | Bacteria | 1529 |
| 390 | Ga0209970_1061591 | 3300027614 | Bacteria | 689 |
| 391 | Ga0209983_1052966 | 3300027665 | Bacteria | 889 |
| 392 | Ga0209983_1058729 | 3300027665 | Bacteria | 848 |
| 393 | Ga0209588_1052779 | 3300027671 | Bacteria | 1315 |
| 394 | Ga0209971_1002798 | 3300027682 | Bacteria | 4168 |
| 395 | Ga0209971_1030717 | 3300027682 | Bacteria | 1287 |
| 396 | Ga0209966_1002048 | 3300027695 | Bacteria | 3365 |
| 397 | Ga0209998_10023646 | 3300027717 | Bacteria | 1330 |
| 398 | Ga0209998_10129134 | 3300027717 | Bacteria | 641 |
| 399 | Ga0209974_10090429 | 3300027876 | Bacteria | 1061 |
| 400 | Ga0207428_10000835 | 3300027907 | Bacteria | 34652 |
| 401 | Ga0207428_10963435 | 3300027907 | Bacteria | 601 |
| 402 | Ga0268265_10001514 | 3300028380 | Bacteria | 19411 |
| 403 | Ga0268265_10345993 | 3300028380 | Bacteria | 1356 |
| 404 | Ga0268265_11860337 | 3300028380 | Bacteria | 609 |
| 405 | Ga0268264_10001414 | 3300028381 | Bacteria | 22435 |
| 406 | Ga0268264_10292650 | 3300028381 | Bacteria | 1530 |
| 407 | Ga0268264_12011008 | 3300028381 | Bacteria | 587 |
| 408 | Ga0268264_12487117 | 3300028381 | Bacteria | 523 |
| 409 | Ga0307408_100166145 | 3300031548 | Bacteria | 1758 |
| 410 | Ga0307408_100220521 | 3300031548 | Bacteria | 1547 |
| 411 | Ga0307408_100318043 | 3300031548 | Bacteria | 1310 |
| 412 | Ga0307408_100428070 | 3300031548 | Bacteria | 1143 |
| 413 | Ga0307408_100668803 | 3300031548 | Bacteria | 930 |
| 414 | Ga0316575_10083667 | 3300031665 | Bacteria | 1288 |
| 415 | Ga0316579_10001744 | 3300031691 | Bacteria | 7995 |
| 416 | Ga0316579_10050697 | 3300031691 | Bacteria | 1941 |
| 417 | Ga0316576_10580389 | 3300031727 | Bacteria | 819 |
| 418 | Ga0316578_10236666 | 3300031728 | Bacteria | 1096 |
| 419 | Ga0316578_10240239 | 3300031728 | Bacteria | 1087 |
| 420 | Ga0307405_10316537 | 3300031731 | Bacteria | 1190 |
| 421 | Ga0307405_10367349 | 3300031731 | Bacteria | 1116 |
| 422 | Ga0307405_10682704 | 3300031731 | Bacteria | 848 |
| 423 | Ga0307405_10775875 | 3300031731 | Bacteria | 801 |
| 424 | Ga0307405_11352031 | 3300031731 | Bacteria | 621 |
| 425 | Ga0307413_11442274 | 3300031824 | Bacteria | 607 |
| 426 | Ga0307406_11556118 | 3300031901 | Bacteria | 583 |
| 427 | Ga0307406_11720110 | 3300031901 | Bacteria | 556 |
| 428 | Ga0307407_11558851 | 3300031903 | Bacteria | 523 |
| 429 | Ga0307412_10136384 | 3300031911 | Bacteria | 1791 |
| 430 | Ga0307412_11185843 | 3300031911 | Bacteria | 683 |
| 431 | Ga0307409_100353208 | 3300031995 | Bacteria | 1388 |
| 432 | Ga0307409_101530511 | 3300031995 | Bacteria | 695 |
| 433 | Ga0307409_102682971 | 3300031995 | Bacteria | 526 |
| 434 | Ga0307416_100162947 | 3300032002 | Bacteria | 2064 |
| 435 | Ga0307416_100296502 | 3300032002 | Bacteria | 1604 |
| 436 | Ga0307416_101210470 | 3300032002 | Bacteria | 861 |
| 437 | Ga0307416_101795864 | 3300032002 | Bacteria | 717 |
| 438 | Ga0307416_101861216 | 3300032002 | Bacteria | 705 |
| 439 | Ga0307416_102224058 | 3300032002 | Bacteria | 649 |
| 440 | Ga0307416_102566382 | 3300032002 | Bacteria | 608 |
| 441 | Ga0307416_103002130 | 3300032002 | Bacteria | 564 |
| 442 | Ga0307416_103098345 | 3300032002 | Bacteria | 556 |
| 443 | Ga0307411_10791963 | 3300032005 | Bacteria | 834 |
| 444 | Ga0307411_11513296 | 3300032005 | Bacteria | 617 |
| 445 | Ga0307411_12057127 | 3300032005 | Bacteria | 534 |
| 446 | Ga0316583_10000604 | 3300032133 | Bacteria | 10925 |
| 447 | Ga0316580_10035005 | 3300032139 | Bacteria | 1554 |
| 448 | Ga0316580_10047105 | 3300032139 | Bacteria | 1329 |
| 449 | Ga0316593_10221454 | 3300032168 | Bacteria | 703 |
| 450 | Ga0316592_1156036 | 3300033524 | Bacteria | 540 |
| 451 | Ga0316596_1001064 | 3300033541 | Bacteria | 5326 |
| 452 | Ga0373930_0108413 | 3300034816 | Bacteria | 666 |
| 453 | Ga0373948_0065305 | 3300034817 | Bacteria | 806 |
| 454 | Ga0373950_0067147 | 3300034818 | Bacteria | 729 |
| 455 | Ga0373950_0131504 | 3300034818 | Unclassified | 561 |
| 456 | Ga0373958_0012755 | 3300034819 | Bacteria | 1443 |
| 457 | Ga0373958_0185747 | 3300034819 | Bacteria | 538 |
| 458 | Ga0373959_0144219 | 3300034820 | Bacteria | 598 |
| 459 | Ga0373926_0011387 | 3300035083 | Bacteria | 2992 |
| 460 | Ga0373926_0019898 | 3300035083 | Bacteria | 2316 |
| 461 | Ga0373926_0055845 | 3300035083 | Bacteria | 1432 |
| 462 | Ga0373926_0199620 | 3300035083 | Bacteria | 769 |
| 463 | Ga0373928_0064479 | 3300035084 | Bacteria | 893 |
| 464 | Ga0373928_0096512 | 3300035084 | Bacteria | 765 |
| 465 | Ga0373929_0009025 | 3300035085 | Bacteria | 1843 |
| 466 | Ga0373929_0057483 | 3300035085 | Bacteria | 903 |
| 467 | Ga0373934_0002385 | 3300035086 | Bacteria | 6916 |
| 468 | Ga0373934_0032500 | 3300035086 | Bacteria | 2046 |
| 469 | Ga0373934_0458947 | 3300035086 | Bacteria | 534 |
| 470 | Ga0373940_0004143 | 3300035088 | Bacteria | 3039 |
| 471 | Ga0373940_0087995 | 3300035088 | Bacteria | 927 |
| 472 | Ga0373944_0156253 | 3300035089 | Bacteria | 806 |
| 473 | Ga0373949_0015962 | 3300035090 | Bacteria | 1681 |
| 474 | Ga0373949_0097427 | 3300035090 | Bacteria | 802 |
| 475 | Ga0373951_0091522 | 3300035091 | Bacteria | 799 |
| 476 | Ga0373952_0070289 | 3300035092 | Bacteria | 874 |
| 477 | Ga0373952_0114563 | 3300035092 | Bacteria | 725 |
| 478 | Ga0373923_0016921 | 3300035111 | Bacteria | 2780 |
| 479 | Ga0373923_0145426 | 3300035111 | Bacteria | 1073 |
| 480 | Ga0373923_0221620 | 3300035111 | Bacteria | 879 |
| 481 | Ga0373932_0004155 | 3300035112 | Bacteria | 3439 |
| 482 | Ga0373932_0015106 | 3300035112 | Bacteria | 1953 |
| 483 | Ga0373932_0104604 | 3300035112 | Bacteria | 925 |
| 484 | Ga0373936_0010448 | 3300035113 | Bacteria | 3502 |
| 485 | Ga0373936_0036352 | 3300035113 | Bacteria | 1963 |
| 486 | Ga0373936_0151947 | 3300035113 | Bacteria | 1004 |
| 487 | Ga0373939_0006398 | 3300035114 | Bacteria | 2836 |
| 488 | Ga0373941_0003680 | 3300035115 | Bacteria | 3490 |
| 489 | Ga0373945_0081013 | 3300035116 | Bacteria | 1244 |
| 490 | Ga0373945_0098308 | 3300035116 | Bacteria | 1142 |
| 491 | Ga0373953_0000451 | 3300035117 | Bacteria | 11279 |
| 492 | Ga0373953_0002689 | 3300035117 | Bacteria | 5391 |
| 493 | Ga0373953_0153525 | 3300035117 | Bacteria | 988 |
| 494 | Ga0373954_0010828 | 3300035118 | Bacteria | 4031 |
| 495 | Ga0373954_0039752 | 3300035118 | Bacteria | 2190 |
| 496 | Ga0373954_0062678 | 3300035118 | Bacteria | 1757 |
| 497 | Ga0373954_0450385 | 3300035118 | Bacteria | 637 |
| 498 | Ga0373956_0002041 | 3300035119 | Bacteria | 8361 |
| 499 | Ga0373956_0057980 | 3300035119 | Bacteria | 1750 |
| 500 | Ga0373956_0228536 | 3300035119 | Bacteria | 883 |
| 501 | Ga0373956_0647372 | 3300035119 | Bacteria | 504 |
| 502 | Ga0373957_0000922 | 3300035120 | Bacteria | 7704 |
| 503 | Ga0373957_0024880 | 3300035120 | Bacteria | 2153 |
| 504 | Ga0373957_0087551 | 3300035120 | Bacteria | 1235 |
| 505 | Ga0373960_0007720 | 3300035121 | Bacteria | 2557 |
| 506 | Ga0373960_0263211 | 3300035121 | Bacteria | 630 |
| 507 | Ga0373943_0011379 | 3300035170 | Bacteria | 4003 |
| 508 | Ga0373943_0103603 | 3300035170 | Bacteria | 1492 |
| 509 | Ga0373946_0023521 | 3300035171 | Bacteria | 2408 |
| 510 | Ga0373946_0030062 | 3300035171 | Bacteria | 2166 |
| 511 | Ga0373946_0030581 | 3300035171 | Bacteria | 2150 |
| 512 | Ga0373946_0698890 | 3300035171 | Bacteria | 530 |
| 513 | Ga0373955_0018664 | 3300035172 | Bacteria | 3454 |
| 514 | Ga0373955_0036421 | 3300035172 | Bacteria | 2610 |
| 515 | Ga0373955_0339955 | 3300035172 | Bacteria | 908 |
| 516 | Ga0373955_0575118 | 3300035172 | Bacteria | 689 |
| 517 | Ga0373955_0586566 | 3300035172 | Bacteria | 682 |
| 518 | Ga0373942_0025923 | 3300035207 | Bacteria | 1514 |
| 519 | Ga0373942_0049660 | 3300035207 | Bacteria | 1172 |
| 520 | Ga0373961_0129313 | 3300035241 | Bacteria | 844 |
| 521 | Ga0373961_0275045 | 3300035241 | Bacteria | 616 |
| 522 | Ga0373962_0006162 | 3300035242 | Bacteria | 2899 |
| 523 | Ga0373962_0044564 | 3300035242 | Bacteria | 1260 |
| 524 | Ga0316574_0060496 | 3300035398 | Bacteria | 2378 |
| 525 | Ga0316574_0884697 | 3300035398 | Bacteria | 541 |
| 526 | Ga0373924_0002270 | 3300035410 | Bacteria | 6451 |
| 527 | Ga0373924_0177152 | 3300035410 | Bacteria | 938 |
| 528 | Ga0373924_0364446 | 3300035410 | Bacteria | 644 |
| 529 | Ga0373931_0003435 | 3300035691 | Bacteria | 7113 |
| 530 | Ga0373931_0016082 | 3300035691 | Bacteria | 3678 |
| 531 | Ga0373931_0111710 | 3300035691 | Bacteria | 1551 |
| 532 | Ga0373931_0576443 | 3300035691 | Bacteria | 733 |
| 533 | Ga0373931_0866343 | 3300035691 | Bacteria | 605 |
| 534 | Ga0373935_0008830 | 3300035692 | Bacteria | 6033 |
| 535 | Ga0373935_0062223 | 3300035692 | Bacteria | 2390 |
| 536 | Ga0373935_0461452 | 3300035692 | Bacteria | 919 |
| 537 | Ga0373935_0869174 | 3300035692 | Bacteria | 667 |
| 538 | Ga0373927_0008181 | 3300035695 | Bacteria | 7048 |
| 539 | Ga0373927_0247669 | 3300035695 | Bacteria | 1171 |
| 540 | Ga0373927_0444094 | 3300035695 | Bacteria | 856 |
| 541 | Ga0373927_1161960 | 3300035695 | Bacteria | 509 |
| 542 | Ga0373933_0001285 | 3300035724 | Bacteria | 14780 |
| 543 | Ga0373933_0003737 | 3300035724 | Bacteria | 8413 |
| 544 | Ga0373933_0009986 | 3300035724 | Bacteria | 5198 |
| 545 | Ga0373933_0835692 | 3300035724 | Bacteria | 606 |
| 546 | Ga0373947_0015033 | 3300035725 | Bacteria | 4443 |
| 547 | Ga0373947_0426491 | 3300035725 | Bacteria | 896 |
| 548 | Ga0373947_0547921 | 3300035725 | Bacteria | 787 |
| 549 | Ga0373947_0595387 | 3300035725 | Bacteria | 753 |
| 550 | Ga0373937_0032065 | 3300036401 | Bacteria | 4764 |
| 551 | Ga0373937_0203663 | 3300036401 | Bacteria | 1860 |
| 552 | Ga0373937_0486637 | 3300036401 | Bacteria | 1172 |
| 553 | Ga0373937_1764266 | 3300036401 | Bacteria | 565 |
| 554 | Ga0316582_0005132 | 3300036647 | Bacteria | 6700 |
| 555 | Ga0316582_0038482 | 3300036647 | Bacteria | 2973 |
| 556 | Ga0316584_0001608 | 3300036712 | Bacteria | 13744 |
| 557 | Ga0316584_0107814 | 3300036712 | Bacteria | 2084 |
| 558 | Ga0373925_0042552 | 3300037068 | Bacteria | 3369 |
| 559 | Ga0373925_0223844 | 3300037068 | Bacteria | 1502 |
| 560 | Ga0373925_0435145 | 3300037068 | Bacteria | 1073 |
| 561 | Ga0373925_0511106 | 3300037068 | Bacteria | 986 |
| 562 | Ga0395905_0883615 | 3300037471 | Bacteria | 797 |
| 563 | Ga0395905_1588208 | 3300037471 | Bacteria | 559 |
| 564 | Ga0316581_0004172 | 3300037588 | Bacteria | 3662 |
| 565 | Ga0400484_43813 | 3300038725 | Bacteria | 4326 |
| 566 | Ga0400490_04650 | 3300038726 | Bacteria | 33929 |
| 567 | Ga0400490_31977 | 3300038726 | Bacteria | 1792 |
| 568 | Ga0400490_46408 | 3300038726 | Bacteria | 2178 |
| 569 | Ga0400490_53470 | 3300038726 | Bacteria | 21187 |
| 570 | Ga0400485_01281 | 3300038735 | Bacteria | 7687 |
| 571 | Ga0400488_03774 | 3300038741 | Bacteria | 4675 |
| 572 | Ga0400488_23211 | 3300038741 | Unclassified | 1604 |
| 573 | Ga0400488_29591 | 3300038741 | Bacteria | 8917 |
| 574 | Ga0400488_40428 | 3300038741 | Bacteria | 1334 |
| 575 | Ga0400488_56483 | 3300038741 | Bacteria | 3221 |
| 576 | Ga0400486_15244 | 3300038742 | Bacteria | 1529 |
| 577 | Ga0400486_15329 | 3300038742 | Bacteria | 24403 |
| 578 | Ga0400486_16341 | 3300038742 | Bacteria | 13135 |
| 579 | Ga0400486_17930 | 3300038742 | Bacteria | 3096 |
| 580 | Ga0400486_23238 | 3300038742 | Bacteria | 24429 |
| 581 | Ga0400486_26120 | 3300038742 | Bacteria | 6005 |
| 582 | Ga0400486_29541 | 3300038742 | Unclassified | 1321 |
| 583 | Ga0400483_070153 | 3300039062 | Bacteria | 9786 |
| 584 | Ga0400483_100355 | 3300039062 | Bacteria | 15183 |
| 585 | Ga0400483_144743 | 3300039062 | Bacteria | 3479 |
| 586 | Ga0400483_152336 | 3300039062 | Bacteria | 12601 |
| 587 | Ga0400483_153077 | 3300039062 | Bacteria | 11242 |
| 588 | Ga0400483_276135 | 3300039062 | Bacteria | 2906 |
| 589 | Ga0400489_05416 | 3300039093 | Bacteria | 1657 |
| 590 | Ga0400489_42426 | 3300039093 | Bacteria | 1916 |
| 591 | Ga0400489_48881 | 3300039093 | Bacteria | 33119 |
| 592 | Ga0400489_70731 | 3300039093 | Bacteria | 1001 |
| 593 | Ga0400489_84991 | 3300039093 | Bacteria | 1276 |
| 594 | Ga0400489_86670 | 3300039093 | Bacteria | 1128 |
| 595 | Ga0400487_18239 | 3300039110 | Bacteria | 18844 |
| 596 | Ga0400487_20435 | 3300039110 | Bacteria | 4564 |
| 597 | Ga0400487_38077 | 3300039110 | Bacteria | 1374 |
| 598 | Ga0436365_0301302 | 3300039437 | Bacteria | 585 |
| 599 | Ga0436360_1277711 | 3300039438 | Bacteria | 1697 |
| 600 | Ga0451793_1390847 | 3300041452 | Bacteria | 511 |
| 601 | Ga0451793_1552121 | 3300041452 | Bacteria | 703 |
| 602 | Ga0451847_0059918 | 3300041503 | Unclassified | 611 |
| 603 | Ga0451855_0214715 | 3300041511 | Bacteria | 830 |
| 604 | Ga0439441_000373 | 3300042001 | Bacteria | 4628 |
| 605 | Ga0439441_006192 | 3300042001 | Bacteria | 1888 |
| 606 | Ga0439441_048398 | 3300042001 | Bacteria | 870 |
| 607 | Ga0439443_026787 | 3300042003 | Unclassified | 934 |
| 608 | Ga0439450_074715 | 3300042008 | Unclassified | 836 |
| 609 | Ga0439451_020599 | 3300042009 | Bacteria | 1329 |
| 610 | Ga0439462_0231930 | 3300042015 | Bacteria | 529 |
| 611 | Ga0450896_056548 | 3300042133 | Bacteria | 633 |
| 612 | Ga0439435_0000244 | 3300042436 | Bacteria | 7823 |
| 613 | Ga0439435_0000802 | 3300042436 | Bacteria | 5320 |
| 614 | Ga0439435_0066814 | 3300042436 | Bacteria | 1058 |
| 615 | Ga0439435_0370400 | 3300042436 | Bacteria | 500 |
| 616 | Ga0439444_0000403 | 3300042437 | Bacteria | 4748 |
| 617 | Ga0439444_0001242 | 3300042437 | Bacteria | 3240 |
| 618 | Ga0439444_0191307 | 3300042437 | Bacteria | 512 |
| 619 | Ga0439460_0001871 | 3300042461 | Bacteria | 5017 |
| 620 | Ga0450893_0029174 | 3300042532 | Bacteria | 978 |
| 621 | Ga0451577_0828954 | 3300042876 | Bacteria | 835 |
| 622 | Ga0451577_2013956 | 3300042876 | Bacteria | 505 |
| 623 | Ga0466964_0210609 | 3300044706 | Bacteria | 939 |
| 624 | Ga0466960_0977279 | 3300044901 | Bacteria | 519 |
| 625 | Ga0451576_0041328 | 3300045051 | Bacteria | 4875 |
| 626 | Ga0451576_0178889 | 3300045051 | Bacteria | 2214 |
| 627 | Ga0451576_0276893 | 3300045051 | Bacteria | 1754 |
| 628 | Ga0451576_1334450 | 3300045051 | Bacteria | 747 |
| 629 | Ga0495592_0005638 | 3300046454 | Bacteria | 9255 |
| 630 | Ga0495592_0028405 | 3300046454 | Bacteria | 4237 |
| 631 | Ga0495592_0057907 | 3300046454 | Bacteria | 2859 |
| 632 | Ga0495592_0206503 | 3300046454 | Bacteria | 1322 |
| 633 | Ga0495592_0863280 | 3300046454 | Bacteria | 534 |
| 634 | Ga0495603_0070331 | 3300046455 | Bacteria | 2057 |
| 635 | Ga0495603_0629509 | 3300046455 | Bacteria | 614 |
| 636 | Ga0495629_0088991 | 3300046459 | Bacteria | 2154 |
| 637 | Ga0495629_0169630 | 3300046459 | Bacteria | 1515 |
| 638 | Ga0495641_0011057 | 3300046461 | Bacteria | 5170 |
| 639 | Ga0495651_0003964 | 3300046462 | Bacteria | 11326 |
| 640 | Ga0495651_0004143 | 3300046462 | Bacteria | 11106 |
| 641 | Ga0495651_0161671 | 3300046462 | Bacteria | 1604 |
| 642 | Ga0495653_0094012 | 3300046463 | Bacteria | 2185 |
| 643 | Ga0495653_0390478 | 3300046463 | Bacteria | 887 |
| 644 | Ga0495580_0036842 | 3300046472 | Bacteria | 3511 |
| 645 | Ga0495580_0053320 | 3300046472 | Bacteria | 2854 |
| 646 | Ga0495580_0346732 | 3300046472 | Bacteria | 1006 |
| 647 | Ga0495582_0018344 | 3300046473 | Bacteria | 3828 |
| 648 | Ga0495582_0118839 | 3300046473 | Bacteria | 1488 |
| 649 | Ga0495639_0011815 | 3300046475 | Bacteria | 3765 |
| 650 | Ga0495639_0029838 | 3300046475 | Bacteria | 2421 |
| 651 | Ga0495639_0478615 | 3300046475 | Bacteria | 634 |
| 652 | Ga0495662_0005450 | 3300046476 | Bacteria | 6370 |
| 653 | Ga0495662_0241369 | 3300046476 | Bacteria | 890 |
| 654 | Ga0495664_0003933 | 3300046477 | Bacteria | 8107 |
| 655 | Ga0495594_0045584 | 3300046499 | Bacteria | 2407 |
| 656 | Ga0495594_0294827 | 3300046499 | Bacteria | 924 |
| 657 | Ga0495594_0863824 | 3300046499 | Bacteria | 509 |
| 658 | Ga0495608_0007931 | 3300046511 | Bacteria | 7461 |
| 659 | Ga0495608_0162952 | 3300046511 | Bacteria | 1417 |
| 660 | Ga0495618_0632336 | 3300046514 | Bacteria | 634 |
| 661 | Ga0495628_0036325 | 3300046516 | Bacteria | 3955 |
| 662 | Ga0495628_0055686 | 3300046516 | Bacteria | 3114 |
| 663 | Ga0495628_0099200 | 3300046516 | Bacteria | 2249 |
| 664 | Ga0495628_0254377 | 3300046516 | Bacteria | 1310 |
| 665 | Ga0495630_0008815 | 3300046517 | Bacteria | 7241 |
| 666 | Ga0495630_0085122 | 3300046517 | Bacteria | 2387 |
| 667 | Ga0495630_0514800 | 3300046517 | Bacteria | 917 |
| 668 | Ga0495644_0081670 | 3300046523 | Bacteria | 1219 |
| 669 | Ga0495644_0357483 | 3300046523 | Bacteria | 575 |
| 670 | Ga0495663_0373144 | 3300046525 | Bacteria | 522 |
| 671 | Ga0495666_0003346 | 3300046526 | Bacteria | 8092 |
| 672 | Ga0495642_0031663 | 3300046528 | Bacteria | 2121 |
| 673 | Ga0495642_0224820 | 3300046528 | Bacteria | 820 |
| 674 | Ga0495652_0005494 | 3300046529 | Bacteria | 11936 |
| 675 | Ga0495652_0142088 | 3300046529 | Bacteria | 1887 |
| 676 | Ga0495652_0309349 | 3300046529 | Bacteria | 1145 |
| 677 | Ga0495652_0343127 | 3300046529 | Bacteria | 1072 |
| 678 | Ga0495652_0466951 | 3300046529 | Bacteria | 881 |
| 679 | Ga0495665_0016354 | 3300046531 | Bacteria | 3998 |
| 680 | Ga0495665_0153336 | 3300046531 | Bacteria | 1202 |
| 681 | Ga0495665_0279099 | 3300046531 | Bacteria | 857 |
| 682 | Ga0495640_0014075 | 3300046533 | Bacteria | 6066 |
| 683 | Ga0495640_0185666 | 3300046533 | Bacteria | 1323 |
| 684 | Ga0495640_0422074 | 3300046533 | Bacteria | 817 |
| 685 | Ga0495586_0003635 | 3300046535 | Bacteria | 8263 |
| 686 | Ga0495586_0012798 | 3300046535 | Bacteria | 4446 |
| 687 | Ga0495586_0415695 | 3300046535 | Bacteria | 774 |
| 688 | Ga0495587_0002077 | 3300046536 | Bacteria | 13382 |
| 689 | Ga0495598_0066406 | 3300046537 | Bacteria | 1125 |
| 690 | Ga0495598_0099675 | 3300046537 | Bacteria | 959 |
| 691 | Ga0495598_0312795 | 3300046537 | Bacteria | 597 |
| 692 | Ga0495621_0465641 | 3300046539 | Bacteria | 542 |
| 693 | Ga0495645_0009908 | 3300046543 | Bacteria | 6669 |
| 694 | Ga0495645_0605853 | 3300046543 | Bacteria | 673 |
| 695 | Ga0495622_0129908 | 3300046557 | Bacteria | 1148 |
| 696 | Ga0495667_0008752 | 3300046559 | Bacteria | 6878 |
| 697 | Ga0495667_0086457 | 3300046559 | Bacteria | 2033 |
| 698 | Ga0495667_0144445 | 3300046559 | Bacteria | 1533 |
| 699 | Ga0495667_0249257 | 3300046559 | Bacteria | 1130 |
| 700 | Ga0495667_0291268 | 3300046559 | Bacteria | 1035 |
| 701 | Ga0495656_0159494 | 3300046615 | Bacteria | 1095 |
| 702 | Ga0495634_0048416 | 3300046642 | Bacteria | 2861 |
| 703 | Ga0495634_0230055 | 3300046642 | Bacteria | 1141 |
| 704 | Ga0495635_0120013 | 3300046663 | Bacteria | 1794 |
| 705 | Ga0495635_0873269 | 3300046663 | Bacteria | 577 |
| 706 | Ga0495659_0136821 | 3300046664 | Bacteria | 975 |
| 707 | Ga0495588_0176427 | 3300046674 | Bacteria | 1129 |
| 708 | Ga0495657_0098049 | 3300046675 | Bacteria | 1871 |
| 709 | Ga0495657_0170512 | 3300046675 | Bacteria | 1340 |
| 710 | Ga0495657_0194229 | 3300046675 | Bacteria | 1239 |
| 711 | Ga0495599_0005317 | 3300046678 | Bacteria | 7682 |
| 712 | Ga0495599_0032803 | 3300046678 | Bacteria | 3260 |
| 713 | Ga0495599_0107212 | 3300046678 | Bacteria | 1741 |
| 714 | Ga0495599_0230772 | 3300046678 | Bacteria | 1130 |
| 715 | Ga0495623_0534291 | 3300046679 | Bacteria | 616 |
| 716 | Ga0495646_0621989 | 3300046680 | Bacteria | 547 |
| 717 | Ga0495647_0165323 | 3300046681 | Bacteria | 955 |
| 718 | Ga0495647_0342503 | 3300046681 | Bacteria | 679 |
| 719 | Ga0495658_0006591 | 3300046683 | Bacteria | 5703 |
| 720 | Ga0495658_0107496 | 3300046683 | Bacteria | 1673 |
| 721 | Ga0495669_0014591 | 3300046684 | Bacteria | 3358 |
| 722 | Ga0495669_0138507 | 3300046684 | Bacteria | 1148 |
| 723 | Ga0495669_0562850 | 3300046684 | Bacteria | 555 |
| 724 | Ga0495613_0080743 | 3300046689 | Bacteria | 2363 |
| 725 | Ga0495624_0045558 | 3300046690 | Bacteria | 2791 |
| 726 | Ga0495624_0250837 | 3300046690 | Bacteria | 1070 |
| 727 | Ga0495670_0321599 | 3300046691 | Bacteria | 831 |
| 728 | Ga0495600_0074913 | 3300046809 | Bacteria | 2210 |
| 729 | Ga0495600_0132846 | 3300046809 | Bacteria | 1618 |
| 730 | Ga0495600_0379195 | 3300046809 | Bacteria | 882 |
| 731 | Ga0495581_0275574 | 3300047315 | Bacteria | 983 |
| 732 | Ga0495581_0464384 | 3300047315 | Bacteria | 737 |
| 733 | Ga0495604_0006828 | 3300047317 | Bacteria | 9045 |
| 734 | Ga0495604_0208304 | 3300047317 | Bacteria | 1352 |
| 735 | Ga0495604_0395128 | 3300047317 | Bacteria | 911 |
| 736 | Ga0495636_0359066 | 3300047318 | Bacteria | 689 |
| 737 | Ga0495674_0005220 | 3300047319 | Bacteria | 12468 |
| 738 | Ga0495674_0072245 | 3300047319 | Bacteria | 2976 |
| 739 | Ga0495674_1409804 | 3300047319 | Bacteria | 519 |
| 740 | Ga0495680_0011364 | 3300047322 | Bacteria | 7884 |
| 741 | Ga0495680_0020117 | 3300047322 | Bacteria | 5624 |
| 742 | Ga0495680_0140126 | 3300047322 | Bacteria | 1770 |
| 743 | Ga0495675_0018560 | 3300047444 | Bacteria | 4416 |
| 744 | Ga0495677_0204707 | 3300047445 | Bacteria | 767 |
| 745 | Ga0495677_0371655 | 3300047445 | Bacteria | 565 |
| 746 | Ga0495684_0012445 | 3300047471 | Bacteria | 6558 |
| 747 | Ga0495684_0071170 | 3300047471 | Bacteria | 2643 |
| 748 | Ga0495684_0540081 | 3300047471 | Bacteria | 795 |
| 749 | Ga0495593_0068347 | 3300047673 | Bacteria | 1849 |
| 750 | Ga0495593_0157612 | 3300047673 | Bacteria | 1147 |
| 751 | Ga0495614_0088704 | 3300048089 | Bacteria | 1344 |
| 752 | Ga0496101_0850233 | 3300048904 | Bacteria | 719 |
| 753 | Ga0496106_0292863 | 3300048909 | Bacteria | 1305 |
| 754 | Ga0496106_1437399 | 3300048909 | Bacteria | 532 |
| 755 | Ga0496108_0815914 | 3300048911 | Bacteria | 804 |
| 756 | Ga0496109_0141848 | 3300048912 | Bacteria | 2247 |
| 757 | Ga0496114_0418917 | 3300048917 | Bacteria | 1186 |
| 758 | Ga0496114_0838062 | 3300048917 | Bacteria | 799 |
| 759 | Ga0501298_057465 | 3300049521 | Bacteria | 818 |
| 760 | Ga0501031_0265715 | 3300049568 | Bacteria | 1114 |
| 761 | Ga0501031_0354837 | 3300049568 | Bacteria | 949 |
| 762 | Ga0501031_0410465 | 3300049568 | Bacteria | 876 |
| 763 | Ga0501031_0592929 | 3300049568 | Bacteria | 713 |
| 764 | Ga0501033_0020853 | 3300049570 | Bacteria | 4947 |
| 765 | Ga0501033_0085137 | 3300049570 | Bacteria | 2316 |
| 766 | Ga0501033_0352324 | 3300049570 | Bacteria | 1031 |
| 767 | Ga0501033_0563576 | 3300049570 | Bacteria | 784 |
| 768 | Ga0501034_0353295 | 3300049571 | Bacteria | 1398 |
| 769 | Ga0501036_0002322 | 3300049572 | Bacteria | 14872 |
| 770 | Ga0501036_0166127 | 3300049572 | Bacteria | 1860 |
| 771 | Ga0501036_0320712 | 3300049572 | Bacteria | 1295 |
| 772 | Ga0501036_0383962 | 3300049572 | Bacteria | 1172 |
| 773 | Ga0501036_0676094 | 3300049572 | Bacteria | 854 |
| 774 | Ga0501036_0981828 | 3300049572 | Bacteria | 692 |
| 775 | Ga0501036_1408520 | 3300049572 | Bacteria | 565 |
| 776 | Ga0501037_0014951 | 3300049573 | Bacteria | 5709 |
| 777 | Ga0501037_0397562 | 3300049573 | Bacteria | 945 |
| 778 | Ga0501038_0000897 | 3300049574 | Bacteria | 26352 |
| 779 | Ga0501038_0051781 | 3300049574 | Bacteria | 3541 |
| 780 | Ga0501038_1101436 | 3300049574 | Bacteria | 580 |
| 781 | Ga0501038_1355395 | 3300049574 | Bacteria | 512 |
| 782 | Ga0501039_0008885 | 3300049575 | Bacteria | 7655 |
| 783 | Ga0501039_0030832 | 3300049575 | Bacteria | 4135 |
| 784 | Ga0501039_0072656 | 3300049575 | Bacteria | 2673 |
| 785 | Ga0501039_0148698 | 3300049575 | Bacteria | 1840 |
| 786 | Ga0501039_0372960 | 3300049575 | Bacteria | 1121 |
| 787 | Ga0501040_0005353 | 3300049576 | Bacteria | 8299 |
| 788 | Ga0501040_0009124 | 3300049576 | Bacteria | 6458 |
| 789 | Ga0501040_0023931 | 3300049576 | Bacteria | 4096 |
| 790 | Ga0501040_0045658 | 3300049576 | Bacteria | 2989 |
| 791 | Ga0501040_0420810 | 3300049576 | Bacteria | 960 |
| 792 | Ga0501040_1295159 | 3300049576 | Bacteria | 529 |
| 793 | Ga0501041_0001118 | 3300049577 | Bacteria | 14698 |
| 794 | Ga0501041_0022456 | 3300049577 | Bacteria | 3778 |
| 795 | Ga0501041_0024383 | 3300049577 | Bacteria | 3631 |
| 796 | Ga0501041_0025733 | 3300049577 | Bacteria | 3537 |
| 797 | Ga0501041_0186183 | 3300049577 | Bacteria | 1300 |
| 798 | Ga0501041_0195319 | 3300049577 | Bacteria | 1268 |
| 799 | Ga0501041_0437333 | 3300049577 | Bacteria | 830 |
| 800 | Ga0501041_1104931 | 3300049577 | Bacteria | 511 |
| 801 | Ga0501042_0009920 | 3300049578 | Bacteria | 6363 |
| 802 | Ga0501042_0023776 | 3300049578 | Bacteria | 4292 |
| 803 | Ga0501042_0151239 | 3300049578 | Bacteria | 1674 |
| 804 | Ga0501042_0294664 | 3300049578 | Bacteria | 1172 |
| 805 | Ga0501042_0382640 | 3300049578 | Bacteria | 1019 |
| 806 | Ga0501042_1125266 | 3300049578 | Bacteria | 572 |
| 807 | Ga0501043_0053084 | 3300049579 | Bacteria | 3183 |
| 808 | Ga0501043_0141342 | 3300049579 | Bacteria | 1885 |
| 809 | Ga0501043_1086691 | 3300049579 | Bacteria | 566 |
| 810 | Ga0501046_0004895 | 3300049580 | Bacteria | 12057 |
| 811 | Ga0501046_0050466 | 3300049580 | Bacteria | 3287 |
| 812 | Ga0501046_0083967 | 3300049580 | Bacteria | 2457 |
| 813 | Ga0501046_0151977 | 3300049580 | Bacteria | 1746 |
| 814 | Ga0501046_1072919 | 3300049580 | Bacteria | 557 |
| 815 | Ga0501047_0360909 | 3300049581 | Bacteria | 1289 |
| 816 | Ga0501048_0000253 | 3300049582 | Bacteria | 35754 |
| 817 | Ga0501048_0011732 | 3300049582 | Bacteria | 6535 |
| 818 | Ga0501048_0300665 | 3300049582 | Bacteria | 1142 |
| 819 | Ga0501048_0484440 | 3300049582 | Bacteria | 887 |
| 820 | Ga0501048_1061073 | 3300049582 | Bacteria | 583 |
| 821 | Ga0501067_0395672 | 3300049583 | Bacteria | 770 |
| 822 | Ga0501068_0044693 | 3300049584 | Bacteria | 2667 |
| 823 | Ga0501068_0168606 | 3300049584 | Bacteria | 1381 |
| 824 | Ga0501068_1206579 | 3300049584 | Bacteria | 501 |
| 825 | Ga0501069_0984083 | 3300049585 | Bacteria | 515 |
| 826 | Ga0501070_0022910 | 3300049586 | Bacteria | 5228 |
| 827 | Ga0501071_0016865 | 3300049587 | Bacteria | 5025 |
| 828 | Ga0501071_0075648 | 3300049587 | Bacteria | 2458 |
| 829 | Ga0501071_0094598 | 3300049587 | Bacteria | 2198 |
| 830 | Ga0501071_0717474 | 3300049587 | Bacteria | 770 |
| 831 | Ga0501071_0722109 | 3300049587 | Bacteria | 767 |
| 832 | Ga0501071_1388188 | 3300049587 | Bacteria | 542 |
| 833 | Ga0501072_0004517 | 3300049588 | Bacteria | 10579 |
| 834 | Ga0501072_0088238 | 3300049588 | Bacteria | 2461 |
| 835 | Ga0501072_0237773 | 3300049588 | Bacteria | 1451 |
| 836 | Ga0501072_0286288 | 3300049588 | Bacteria | 1310 |
| 837 | Ga0501072_0403966 | 3300049588 | Bacteria | 1083 |
| 838 | Ga0501074_0014632 | 3300049590 | Bacteria | 5706 |
| 839 | Ga0501074_0382514 | 3300049590 | Bacteria | 998 |
| 840 | Ga0501074_1136978 | 3300049590 | Bacteria | 548 |
| 841 | Ga0501075_0000905 | 3300049591 | Bacteria | 18762 |
| 842 | Ga0501075_0010458 | 3300049591 | Bacteria | 6518 |
| 843 | Ga0501075_0063617 | 3300049591 | Bacteria | 2782 |
| 844 | Ga0501076_0000285 | 3300049592 | Bacteria | 31507 |
| 845 | Ga0501076_0015115 | 3300049592 | Bacteria | 5828 |
| 846 | Ga0501076_0440805 | 3300049592 | Bacteria | 1072 |
| 847 | Ga0501077_0007740 | 3300049593 | Bacteria | 6631 |
| 848 | Ga0501225_0106669 | 3300049705 | Bacteria | 822 |
| 849 | Ga0501079_0000672 | 3300049741 | Bacteria | 22946 |
| 850 | Ga0501079_0002449 | 3300049741 | Bacteria | 13481 |
| 851 | Ga0501079_0141741 | 3300049741 | Bacteria | 1872 |
| 852 | Ga0501079_0371832 | 3300049741 | Bacteria | 1121 |
| 853 | Ga0501079_0743924 | 3300049741 | Bacteria | 772 |
| 854 | Ga0501079_1439279 | 3300049741 | Bacteria | 542 |
| 855 | Ga0501080_0133779 | 3300049742 | Bacteria | 2295 |
| 856 | Ga0501080_1628257 | 3300049742 | Bacteria | 546 |
| 857 | Ga0501081_0000506 | 3300049743 | Bacteria | 21904 |
| 858 | Ga0501081_0028038 | 3300049743 | Bacteria | 3798 |
| 859 | Ga0501081_0039700 | 3300049743 | Bacteria | 3222 |
| 860 | Ga0501081_0366773 | 3300049743 | Bacteria | 1063 |
| 861 | Ga0501081_1123763 | 3300049743 | Bacteria | 595 |
| 862 | Ga0501081_1308510 | 3300049743 | Bacteria | 550 |
| 863 | Ga0501083_0228712 | 3300049744 | Bacteria | 1211 |
| 864 | Ga0501283_028531 | 3300049779 | Bacteria | 927 |
| 865 | Ga0501035_0040463 | 3300049822 | Bacteria | 4212 |
| 866 | Ga0501035_0171240 | 3300049822 | Bacteria | 1876 |
| 867 | Ga0501044_0416042 | 3300049823 | Bacteria | 1255 |
| 868 | Ga0501045_0006856 | 3300049824 | Bacteria | 7890 |
| 869 | Ga0501045_0020545 | 3300049824 | Bacteria | 4719 |
| 870 | Ga0501045_0067205 | 3300049824 | Bacteria | 2632 |
| 871 | Ga0501045_0133444 | 3300049824 | Bacteria | 1846 |
| 872 | Ga0501045_0195308 | 3300049824 | Bacteria | 1508 |
| 873 | Ga0501045_0341473 | 3300049824 | Bacteria | 1115 |
| 874 | Ga0501045_0390563 | 3300049824 | Bacteria | 1036 |
| 875 | Ga0501045_0451688 | 3300049824 | Bacteria | 955 |
| 876 | Ga0501045_0714374 | 3300049824 | Bacteria | 739 |
| 877 | nmdc:mga03683_237294_c1 | 3300050489 | Bacteria | 844 |
| 878 | nmdc:mga05p37_1126_c1 | 3300050507 | Bacteria | 30703 |
| 879 | nmdc:mga05p37_1420047_c1 | 3300050507 | Bacteria | 697 |
| 880 | nmdc:mga05p37_2024549_c1 | 3300050507 | Bacteria | 543 |
| 881 | nmdc:mga05p37_257817_c1 | 3300050507 | Bacteria | 2089 |
| 882 | nmdc:mga05p37_573091_c1 | 3300050507 | Bacteria | 1280 |
| 883 | nmdc:mga09592_1294054_c1 | 3300050508 | Bacteria | 600 |
| 884 | nmdc:mga09592_146278_c1 | 3300050508 | Bacteria | 2038 |
| 885 | nmdc:mga09592_1655_c1 | 3300050508 | Bacteria | 17927 |
| 886 | nmdc:mga09592_254698_c1 | 3300050508 | Bacteria | 1521 |
| 887 | nmdc:mga09592_31385_c1 | 3300050508 | Bacteria | 4427 |
| 888 | nmdc:mga09592_382050_c1 | 3300050508 | Bacteria | 1218 |
| 889 | nmdc:mga09592_558727_c1 | 3300050508 | Bacteria | 983 |
| 890 | nmdc:mga0qj67_1518541_c1 | 3300050509 | Bacteria | 515 |
| 891 | nmdc:mga0qj67_1548429_c1 | 3300050509 | Bacteria | 509 |
| 892 | nmdc:mga0qj67_319931_c1 | 3300050509 | Bacteria | 1256 |
| 893 | nmdc:mga0qj67_35741_c1 | 3300050509 | Bacteria | 3886 |
| 894 | nmdc:mga0qj67_648_c1 | 3300050509 | Bacteria | 23982 |
| 895 | nmdc:mga06r32_1200468_c1 | 3300050510 | Bacteria | 705 |
| 896 | nmdc:mga06r32_134302_c1 | 3300050510 | Bacteria | 2449 |
| 897 | nmdc:mga06r32_18886_c1 | 3300050510 | Bacteria | 6320 |
| 898 | nmdc:mga06r32_217415_c1 | 3300050510 | Bacteria | 1899 |
| 899 | nmdc:mga06r32_490113_c1 | 3300050510 | Bacteria | 1207 |
| 900 | nmdc:mga06r32_610756_c1 | 3300050510 | Bacteria | 1061 |
| 901 | nmdc:mga06r32_730038_c1 | 3300050510 | Bacteria | 955 |
| 902 | nmdc:mga06r32_877268_c1 | 3300050510 | Bacteria | 855 |
| 903 | nmdc:mga08y16_115926_c1 | 3300050511 | Bacteria | 2789 |
| 904 | nmdc:mga08y16_1331314_c1 | 3300050511 | Bacteria | 684 |
| 905 | nmdc:mga08y16_4849_c1 | 3300050511 | Bacteria | 14041 |
| 906 | nmdc:mga08y16_48972_c1 | 3300050511 | Bacteria | 4422 |
| 907 | nmdc:mga08y16_515000_c1 | 3300050511 | Bacteria | 1214 |
| 908 | nmdc:mga08y16_54458_c1 | 3300050511 | Bacteria | 4180 |
| 909 | nmdc:mga0n895_107701_c1 | 3300050512 | Bacteria | 2801 |
| 910 | nmdc:mga0n895_1403553_c1 | 3300050512 | Bacteria | 667 |
| 911 | nmdc:mga0n895_1506760_c1 | 3300050512 | Bacteria | 639 |
| 912 | nmdc:mga0n895_491896_c1 | 3300050512 | Bacteria | 1236 |
| 913 | nmdc:mga0n895_754560_c1 | 3300050512 | Bacteria | 966 |
| 914 | nmdc:mga0n895_87725_c1 | 3300050512 | Bacteria | 3110 |
| 915 | nmdc:mga0n895_914882_c1 | 3300050512 | Bacteria | 862 |
| 916 | nmdc:mga0rr50_1605105_c1 | 3300050513 | Bacteria | 549 |
| 917 | nmdc:mga0rr50_1816_c1 | 3300050513 | Bacteria | 11807 |
| 918 | nmdc:mga0rr50_217129_c1 | 3300050513 | Bacteria | 1578 |
| 919 | nmdc:mga0rr50_288186_c1 | 3300050513 | Bacteria | 1371 |
| 920 | nmdc:mga0rr50_836208_c1 | 3300050513 | Bacteria | 785 |
| 921 | nmdc:mga08x19_132992_c1 | 3300050514 | Bacteria | 1675 |
| 922 | nmdc:mga08x19_271649_c1 | 3300050514 | Bacteria | 1173 |
| 923 | nmdc:mga08x19_31181_c1 | 3300050514 | Bacteria | 3352 |
| 924 | nmdc:mga08x19_3563_c1 | 3300050514 | Bacteria | 9267 |
| 925 | nmdc:mga08x19_41359_c1 | 3300050514 | Bacteria | 2935 |
| 926 | nmdc:mga08x19_8158_c1 | 3300050514 | Bacteria | 6223 |
| 927 | nmdc:mga08x19_932484_c1 | 3300050514 | Bacteria | 617 |
| 928 | nmdc:mga0a205_1274417_c1 | 3300050515 | Bacteria | 583 |
| 929 | nmdc:mga0a205_156644_c1 | 3300050515 | Bacteria | 2176 |
| 930 | nmdc:mga0a205_3207_c1 | 3300050515 | Bacteria | 14532 |
| 931 | nmdc:mga0a205_624755_c1 | 3300050515 | Bacteria | 929 |
| 932 | Ga0495601_0002901 | 3300053077 | Bacteria | 9754 |
| 933 | Ga0495601_0268996 | 3300053077 | Bacteria | 1112 |
| 934 | Ga0495601_0343214 | 3300053077 | Bacteria | 971 |
| 935 | Ga0495601_0379335 | 3300053077 | Bacteria | 918 |
| 936 | Ga0495601_0393287 | 3300053077 | Bacteria | 899 |
| 937 | Ga0495612_0090242 | 3300053078 | Bacteria | 1296 |
| 938 | Ga0495612_0233774 | 3300053078 | Bacteria | 815 |
| 939 | Ga0495595_0001331 | 3300053084 | Bacteria | 9608 |
| 940 | Ga0495619_0004232 | 3300053085 | Bacteria | 9147 |
| 941 | Ga0495619_0723068 | 3300053085 | Bacteria | 676 |
| 942 | Ga0500566_0131688 | 3300053094 | Bacteria | 1337 |
| 943 | Ga0501084_0001838 | 3300054114 | Bacteria | 16928 |
| 944 | Ga0501084_0035548 | 3300054114 | Bacteria | 4165 |
| 945 | Ga0501084_0404933 | 3300054114 | Bacteria | 1153 |
| 946 | Ga0590071_212572 | 3300059421 | Bacteria | 510 |
| 947 | Ga0590075_027962 | 3300059424 | Bacteria | 1424 |
| 948 | Ga0590077_025958 | 3300059426 | Bacteria | 1264 |
| 949 | Ga0501082_0018673 | 3300060353 | Bacteria | 5973 |
| 950 | Ga0501082_0033197 | 3300060353 | Bacteria | 4452 |
| 951 | Ga0501082_0364383 | 3300060353 | Bacteria | 1260 |
| 952 | Ga0501082_0769349 | 3300060353 | Bacteria | 843 |
| 953 | Ga0501082_1204234 | 3300060353 | Bacteria | 662 |
| 954 | Ga0530510_0000091 | 3300061734 | Bacteria | 48589 |
| 955 | Ga0530510_0000518 | 3300061734 | Bacteria | 24630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10089431 | Ga0070676_100894311 | 59 |
| 2 | 3300005330 | Ga0070690_100000525 | Ga0070690_1000005254 | 59 |
| 3 | 3300005334 | Ga0068869_100009815 | Ga0068869_1000098155 | 59 |
| 4 | 3300005334 | Ga0068869_101525096 | Ga0068869_1015250962 | 59 |
| 5 | 3300005336 | Ga0070680_100062718 | Ga0070680_1000627184 | 59 |
| 6 | 3300005340 | Ga0070689_100000288 | Ga0070689_10000028820 | 59 |
| 7 | 3300005341 | Ga0070691_10013263 | Ga0070691_100132632 | 59 |
| 8 | 3300005345 | Ga0070692_10086335 | Ga0070692_100863352 | 59 |
| 9 | 3300005356 | Ga0070674_100264274 | Ga0070674_1002642742 | 59 |
| 10 | 3300005365 | Ga0070688_100144227 | Ga0070688_1001442273 | 59 |
| 11 | 3300005365 | Ga0070688_101078215 | Ga0070688_1010782152 | 59 |
| 12 | 3300005438 | Ga0070701_10043338 | Ga0070701_100433382 | 59 |
| 13 | 3300005440 | Ga0070705_100024264 | Ga0070705_1000242644 | 59 |
| 14 | 3300005441 | Ga0070700_100000241 | Ga0070700_1000002418 | 59 |
| 15 | 3300005441 | Ga0070700_101236123 | Ga0070700_1012361231 | 59 |
| 16 | 3300005444 | Ga0070694_100163989 | Ga0070694_1001639892 | 59 |
| 17 | 3300005444 | Ga0070694_100234204 | Ga0070694_1002342042 | 59 |
| 18 | 3300005444 | Ga0070694_100235915 | Ga0070694_1002359152 | 59 |
| 19 | 3300005456 | Ga0070678_100314014 | Ga0070678_1003140142 | 59 |
| 20 | 3300005456 | Ga0070678_100420398 | Ga0070678_1004203981 | 59 |
| 21 | 3300005458 | Ga0070681_10796294 | Ga0070681_107962942 | 59 |
| 22 | 3300005459 | Ga0068867_100011581 | Ga0068867_1000115815 | 59 |
| 23 | 3300005466 | Ga0070685_11163709 | Ga0070685_111637091 | 59 |
| 24 | 3300005530 | Ga0070679_101940598 | Ga0070679_1019405981 | 59 |
| 25 | 3300005535 | Ga0070684_101073665 | Ga0070684_1010736652 | 59 |
| 26 | 3300005544 | Ga0070686_100006108 | Ga0070686_1000061085 | 59 |
| 27 | 3300005545 | Ga0070695_100352582 | Ga0070695_1003525821 | 59 |
| 28 | 3300005546 | Ga0070696_100032452 | Ga0070696_1000324525 | 59 |
| 29 | 3300005546 | Ga0070696_100269062 | Ga0070696_1002690622 | 59 |
| 30 | 3300005546 | Ga0070696_101430200 | Ga0070696_1014302002 | 59 |
| 31 | 3300005547 | Ga0070693_100149468 | Ga0070693_1001494682 | 59 |
| 32 | 3300005549 | Ga0070704_100758248 | Ga0070704_1007582482 | 59 |
| 33 | 3300005577 | Ga0068857_101464189 | Ga0068857_1014641891 | 59 |
| 34 | 3300005578 | Ga0068854_100345651 | Ga0068854_1003456512 | 59 |
| 35 | 3300005615 | Ga0070702_100074788 | Ga0070702_1000747883 | 59 |
| 36 | 3300005617 | Ga0068859_100001619 | Ga0068859_10000161922 | 59 |
| 37 | 3300005618 | Ga0068864_100725880 | Ga0068864_1007258802 | 59 |
| 38 | 3300005718 | Ga0068866_10000528 | Ga0068866_1000052815 | 59 |
| 39 | 3300005719 | Ga0068861_100000423 | Ga0068861_10000042322 | 59 |
| 40 | 3300005840 | Ga0068870_10178339 | Ga0068870_101783392 | 59 |
| 41 | 3300005841 | Ga0068863_100854926 | Ga0068863_1008549262 | 59 |
| 42 | 3300005842 | Ga0068858_100005846 | Ga0068858_10000584610 | 59 |
| 43 | 3300005843 | Ga0068860_100030340 | Ga0068860_1000303403 | 59 |
| 44 | 3300005844 | Ga0068862_100017845 | Ga0068862_1000178453 | 59 |
| 45 | 3300006237 | Ga0097621_100001153 | Ga0097621_10000115313 | 59 |
| 46 | 3300006358 | Ga0068871_100189883 | Ga0068871_1001898832 | 59 |
| 47 | 3300006844 | Ga0075428_100001527 | Ga0075428_1000015279 | 59 |
| 48 | 3300006844 | Ga0075428_102460801 | Ga0075428_1024608011 | 59 |
| 49 | 3300006852 | Ga0075433_11501679 | Ga0075433_115016791 | 59 |
| 50 | 3300006880 | Ga0075429_100007581 | Ga0075429_1000075816 | 59 |
| 51 | 3300006881 | Ga0068865_100000385 | Ga0068865_10000038524 | 59 |
| 52 | 3300006931 | Ga0097620_100001619 | Ga0097620_1000016192 | 59 |
| 53 | 3300009094 | Ga0111539_10006721 | Ga0111539_100067214 | 59 |
| 54 | 3300009094 | Ga0111539_11707936 | Ga0111539_117079362 | 59 |
| 55 | 3300009098 | Ga0105245_10000515 | Ga0105245_1000051528 | 59 |
| 56 | 3300009147 | Ga0114129_10877299 | Ga0114129_108772991 | 59 |
| 57 | 3300009148 | Ga0105243_10006067 | Ga0105243_100060677 | 59 |
| 58 | 3300009176 | Ga0105242_10001066 | Ga0105242_1000106617 | 59 |
| 59 | 3300009177 | Ga0105248_10266766 | Ga0105248_102667663 | 59 |
| 60 | 3300009177 | Ga0105248_10319008 | Ga0105248_103190082 | 59 |
| 61 | 3300009551 | Ga0105238_12749690 | Ga0105238_127496901 | 59 |
| 62 | 3300009553 | Ga0105249_10031943 | Ga0105249_100319434 | 59 |
| 63 | 3300011119 | Ga0105246_11145808 | Ga0105246_111458082 | 59 |
| 64 | 3300013297 | Ga0157378_10000746 | Ga0157378_100007469 | 59 |
| 65 | 3300013306 | Ga0163162_11663976 | Ga0163162_116639762 | 59 |
| 66 | 3300013306 | Ga0163162_12670458 | Ga0163162_126704582 | 59 |
| 67 | 3300013308 | Ga0157375_10300376 | Ga0157375_103003763 | 59 |
| 68 | 3300013308 | Ga0157375_12625771 | Ga0157375_126257712 | 59 |
| 69 | 3300014326 | Ga0157380_10015130 | Ga0157380_100151304 | 59 |
| 70 | 3300014968 | Ga0157379_10136925 | Ga0157379_101369252 | 59 |
| 71 | 3300035090 | Ga0373949_0097427 | Ga0373949_0097427_193_375 | 59 |
| 72 | 3300005290 | Ga0065712_10248395 | Ga0065712_102483951 | 60 |
| 73 | 3300005293 | Ga0065715_10422296 | Ga0065715_104222961 | 60 |
| 74 | 3300005329 | Ga0070683_101879960 | Ga0070683_1018799602 | 60 |
| 75 | 3300005441 | Ga0070700_100821890 | Ga0070700_1008218901 | 60 |
| 76 | 3300005444 | Ga0070694_100108029 | Ga0070694_1001080291 | 60 |
| 77 | 3300005471 | Ga0070698_101224571 | Ga0070698_1012245712 | 60 |
| 78 | 3300005719 | Ga0068861_101963443 | Ga0068861_1019634432 | 60 |
| 79 | 3300006195 | Ga0075366_10832887 | Ga0075366_108328871 | 60 |
| 80 | 3300006846 | Ga0075430_100012906 | Ga0075430_1000129064 | 60 |
| 81 | 3300006847 | Ga0075431_100006916 | Ga0075431_1000069164 | 60 |
| 82 | 3300006880 | Ga0075429_100111915 | Ga0075429_1001119153 | 60 |
| 83 | 3300009093 | Ga0105240_12347077 | Ga0105240_123470772 | 60 |
| 84 | 3300009094 | Ga0111539_10086922 | Ga0111539_100869221 | 60 |
| 85 | 3300009094 | Ga0111539_11142438 | Ga0111539_111424381 | 60 |
| 86 | 3300009094 | Ga0111539_13061241 | Ga0111539_130612411 | 60 |
| 87 | 3300009545 | Ga0105237_12105200 | Ga0105237_121052002 | 60 |
| 88 | 3300010375 | Ga0105239_10992784 | Ga0105239_109927842 | 60 |
| 89 | 3300013296 | Ga0157374_10000104 | Ga0157374_1000010474 | 60 |
| 90 | 3300013297 | Ga0157378_10973027 | Ga0157378_109730271 | 60 |
| 91 | 3300013306 | Ga0163162_11774116 | Ga0163162_117741162 | 60 |
| 92 | 3300025901 | Ga0207688_10428585 | Ga0207688_104285853 | 60 |
| 93 | 3300025931 | Ga0207644_10762143 | Ga0207644_107621432 | 60 |
| 94 | 3300026075 | Ga0207708_10452827 | Ga0207708_104528272 | 60 |
| 95 | 3300026075 | Ga0207708_11167397 | Ga0207708_111673971 | 60 |
| 96 | 3300031691 | Ga0316579_10050697 | Ga0316579_100506972 | 60 |
| 97 | 3300031727 | Ga0316576_10580389 | Ga0316576_105803892 | 60 |
| 98 | 3300031728 | Ga0316578_10236666 | Ga0316578_102366662 | 60 |
| 99 | 3300032002 | Ga0307416_101210470 | Ga0307416_1012104702 | 60 |
| 100 | 3300032139 | Ga0316580_10035005 | Ga0316580_100350052 | 60 |
| 101 | 3300032168 | Ga0316593_10221454 | Ga0316593_102214542 | 60 |
| 102 | 3300033524 | Ga0316592_1156036 | Ga0316592_11560362 | 60 |
| 103 | 3300033541 | Ga0316596_1001064 | Ga0316596_10010649 | 60 |
| 104 | 3300035083 | Ga0373926_0055845 | Ga0373926_0055845_1123_1308 | 60 |
| 105 | 3300035083 | Ga0373926_0199620 | Ga0373926_0199620_411_596 | 60 |
| 106 | 3300035086 | Ga0373934_0002385 | Ga0373934_0002385_4117_4302 | 60 |
| 107 | 3300035086 | Ga0373934_0032500 | Ga0373934_0032500_386_571 | 60 |
| 108 | 3300035088 | Ga0373940_0087995 | Ga0373940_0087995_124_306 | 60 |
| 109 | 3300035111 | Ga0373923_0145426 | Ga0373923_0145426_177_362 | 60 |
| 110 | 3300035113 | Ga0373936_0010448 | Ga0373936_0010448_1560_1745 | 60 |
| 111 | 3300035116 | Ga0373945_0081013 | Ga0373945_0081013_770_955 | 60 |
| 112 | 3300035117 | Ga0373953_0000451 | Ga0373953_0000451_9256_9441 | 60 |
| 113 | 3300035118 | Ga0373954_0010828 | Ga0373954_0010828_3695_3880 | 60 |
| 114 | 3300035118 | Ga0373954_0039752 | Ga0373954_0039752_1033_1218 | 60 |
| 115 | 3300035119 | Ga0373956_0002041 | Ga0373956_0002041_972_1157 | 60 |
| 116 | 3300035119 | Ga0373956_0057980 | Ga0373956_0057980_102_287 | 60 |
| 117 | 3300035119 | Ga0373956_0647372 | Ga0373956_0647372_108_293 | 60 |
| 118 | 3300035120 | Ga0373957_0000922 | Ga0373957_0000922_7260_7445 | 60 |
| 119 | 3300035120 | Ga0373957_0024880 | Ga0373957_0024880_1467_1652 | 60 |
| 120 | 3300035170 | Ga0373943_0103603 | Ga0373943_0103603_1022_1207 | 60 |
| 121 | 3300035171 | Ga0373946_0023521 | Ga0373946_0023521_2182_2367 | 60 |
| 122 | 3300035171 | Ga0373946_0698890 | Ga0373946_0698890_60_245 | 60 |
| 123 | 3300035172 | Ga0373955_0036421 | Ga0373955_0036421_669_854 | 60 |
| 124 | 3300035172 | Ga0373955_0339955 | Ga0373955_0339955_186_371 | 60 |
| 125 | 3300035172 | Ga0373955_0575118 | Ga0373955_0575118_108_293 | 60 |
| 126 | 3300035398 | Ga0316574_0060496 | Ga0316574_0060496_1126_1314 | 60 |
| 127 | 3300035410 | Ga0373924_0002270 | Ga0373924_0002270_4949_5134 | 60 |
| 128 | 3300035691 | Ga0373931_0866343 | Ga0373931_0866343_277_459 | 60 |
| 129 | 3300035692 | Ga0373935_0008830 | Ga0373935_0008830_2260_2445 | 60 |
| 130 | 3300035695 | Ga0373927_0247669 | Ga0373927_0247669_459_644 | 60 |
| 131 | 3300035724 | Ga0373933_0001285 | Ga0373933_0001285_7429_7614 | 60 |
| 132 | 3300035724 | Ga0373933_0003737 | Ga0373933_0003737_1194_1379 | 60 |
| 133 | 3300035725 | Ga0373947_0595387 | Ga0373947_0595387_433_618 | 60 |
| 134 | 3300036401 | Ga0373937_0203663 | Ga0373937_0203663_212_397 | 60 |
| 135 | 3300036401 | Ga0373937_1764266 | Ga0373937_1764266_328_513 | 60 |
| 136 | 3300036647 | Ga0316582_0038482 | Ga0316582_0038482_2314_2502 | 60 |
| 137 | 3300036712 | Ga0316584_0001608 | Ga0316584_0001608_22_210 | 60 |
| 138 | 3300037068 | Ga0373925_0223844 | Ga0373925_0223844_1106_1291 | 60 |
| 139 | 3300038725 | Ga0400484_43813 | Ga0400484_43813_1830_2018 | 60 |
| 140 | 3300038726 | Ga0400490_04650 | Ga0400490_04650_23547_23735 | 60 |
| 141 | 3300038726 | Ga0400490_31977 | Ga0400490_31977_138_320 | 60 |
| 142 | 3300038726 | Ga0400490_46408 | Ga0400490_46408_18_200 | 60 |
| 143 | 3300038726 | Ga0400490_53470 | Ga0400490_53470_7602_7790 | 60 |
| 144 | 3300038735 | Ga0400485_01281 | Ga0400485_01281_10_198 | 60 |
| 145 | 3300038741 | Ga0400488_03774 | Ga0400488_03774_2036_2224 | 60 |
| 146 | 3300038741 | Ga0400488_23211 | Ga0400488_23211_751_939 | 60 |
| 147 | 3300038741 | Ga0400488_29591 | Ga0400488_29591_1073_1261 | 60 |
| 148 | 3300038741 | Ga0400488_56483 | Ga0400488_56483_1557_1754 | 60 |
| 149 | 3300038742 | Ga0400486_15244 | Ga0400486_15244_1118_1303 | 60 |
| 150 | 3300038742 | Ga0400486_16341 | Ga0400486_16341_6762_6950 | 60 |
| 151 | 3300038742 | Ga0400486_17930 | Ga0400486_17930_365_547 | 60 |
| 152 | 3300038742 | Ga0400486_23238 | Ga0400486_23238_18481_18669 | 60 |
| 153 | 3300038742 | Ga0400486_26120 | Ga0400486_26120_205_402 | 60 |
| 154 | 3300038742 | Ga0400486_29541 | Ga0400486_29541_613_801 | 60 |
| 155 | 3300039062 | Ga0400483_100355 | Ga0400483_100355_3295_3483 | 60 |
| 156 | 3300039062 | Ga0400483_144743 | Ga0400483_144743_125_313 | 60 |
| 157 | 3300039062 | Ga0400483_152336 | Ga0400483_152336_804_1001 | 60 |
| 158 | 3300039062 | Ga0400483_153077 | Ga0400483_153077_1426_1614 | 60 |
| 159 | 3300039062 | Ga0400483_276135 | Ga0400483_276135_321_503 | 60 |
| 160 | 3300039093 | Ga0400489_05416 | Ga0400489_05416_80_268 | 60 |
| 161 | 3300039093 | Ga0400489_42426 | Ga0400489_42426_530_712 | 60 |
| 162 | 3300039093 | Ga0400489_48881 | Ga0400489_48881_24996_25184 | 60 |
| 163 | 3300039093 | Ga0400489_70731 | Ga0400489_70731_617_814 | 60 |
| 164 | 3300039093 | Ga0400489_84991 | Ga0400489_84991_740_928 | 60 |
| 165 | 3300039093 | Ga0400489_86670 | Ga0400489_86670_138_320 | 60 |
| 166 | 3300039110 | Ga0400487_18239 | Ga0400487_18239_11032_11220 | 60 |
| 167 | 3300039110 | Ga0400487_38077 | Ga0400487_38077_1098_1286 | 60 |
| 168 | 3300041452 | Ga0451793_1390847 | Ga0451793_1390847_160_342 | 60 |
| 169 | 3300041503 | Ga0451847_0059918 | Ga0451847_0059918_129_311 | 60 |
| 170 | 3300045051 | Ga0451576_1334450 | Ga0451576_1334450_110_292 | 60 |
| 171 | 3300046454 | Ga0495592_0005638 | Ga0495592_0005638_5596_5781 | 60 |
| 172 | 3300046454 | Ga0495592_0028405 | Ga0495592_0028405_3738_3923 | 60 |
| 173 | 3300046454 | Ga0495592_0057907 | Ga0495592_0057907_999_1184 | 60 |
| 174 | 3300046454 | Ga0495592_0206503 | Ga0495592_0206503_577_762 | 60 |
| 175 | 3300046455 | Ga0495603_0629509 | Ga0495603_0629509_395_580 | 60 |
| 176 | 3300046459 | Ga0495629_0169630 | Ga0495629_0169630_555_740 | 60 |
| 177 | 3300046461 | Ga0495641_0011057 | Ga0495641_0011057_668_853 | 60 |
| 178 | 3300046462 | Ga0495651_0003964 | Ga0495651_0003964_9494_9679 | 60 |
| 179 | 3300046462 | Ga0495651_0004143 | Ga0495651_0004143_1840_2025 | 60 |
| 180 | 3300046463 | Ga0495653_0094012 | Ga0495653_0094012_1476_1661 | 60 |
| 181 | 3300046472 | Ga0495580_0053320 | Ga0495580_0053320_1893_2078 | 60 |
| 182 | 3300046473 | Ga0495582_0118839 | Ga0495582_0118839_1021_1206 | 60 |
| 183 | 3300046475 | Ga0495639_0029838 | Ga0495639_0029838_1968_2153 | 60 |
| 184 | 3300046476 | Ga0495662_0005450 | Ga0495662_0005450_2491_2676 | 60 |
| 185 | 3300046477 | Ga0495664_0003933 | Ga0495664_0003933_816_1001 | 60 |
| 186 | 3300046499 | Ga0495594_0045584 | Ga0495594_0045584_1573_1758 | 60 |
| 187 | 3300046499 | Ga0495594_0863824 | Ga0495594_0863824_195_380 | 60 |
| 188 | 3300046511 | Ga0495608_0007931 | Ga0495608_0007931_1607_1792 | 60 |
| 189 | 3300046511 | Ga0495608_0162952 | Ga0495608_0162952_249_434 | 60 |
| 190 | 3300046514 | Ga0495618_0632336 | Ga0495618_0632336_134_319 | 60 |
| 191 | 3300046516 | Ga0495628_0036325 | Ga0495628_0036325_1863_2048 | 60 |
| 192 | 3300046516 | Ga0495628_0055686 | Ga0495628_0055686_420_605 | 60 |
| 193 | 3300046516 | Ga0495628_0099200 | Ga0495628_0099200_649_834 | 60 |
| 194 | 3300046517 | Ga0495630_0008815 | Ga0495630_0008815_1445_1630 | 60 |
| 195 | 3300046526 | Ga0495666_0003346 | Ga0495666_0003346_6828_7013 | 60 |
| 196 | 3300046529 | Ga0495652_0005494 | Ga0495652_0005494_2070_2255 | 60 |
| 197 | 3300046529 | Ga0495652_0309349 | Ga0495652_0309349_663_848 | 60 |
| 198 | 3300046529 | Ga0495652_0343127 | Ga0495652_0343127_394_579 | 60 |
| 199 | 3300046531 | Ga0495665_0016354 | Ga0495665_0016354_1343_1528 | 60 |
| 200 | 3300046533 | Ga0495640_0014075 | Ga0495640_0014075_4816_5001 | 60 |
| 201 | 3300046533 | Ga0495640_0422074 | Ga0495640_0422074_119_304 | 60 |
| 202 | 3300046535 | Ga0495586_0003635 | Ga0495586_0003635_6909_7094 | 60 |
| 203 | 3300046536 | Ga0495587_0002077 | Ga0495587_0002077_4775_4960 | 60 |
| 204 | 3300046543 | Ga0495645_0009908 | Ga0495645_0009908_6052_6237 | 60 |
| 205 | 3300046557 | Ga0495622_0129908 | Ga0495622_0129908_520_705 | 60 |
| 206 | 3300046559 | Ga0495667_0008752 | Ga0495667_0008752_6153_6338 | 60 |
| 207 | 3300046559 | Ga0495667_0086457 | Ga0495667_0086457_1788_1973 | 60 |
| 208 | 3300046559 | Ga0495667_0291268 | Ga0495667_0291268_532_717 | 60 |
| 209 | 3300046642 | Ga0495634_0048416 | Ga0495634_0048416_1455_1640 | 60 |
| 210 | 3300046675 | Ga0495657_0170512 | Ga0495657_0170512_660_845 | 60 |
| 211 | 3300046675 | Ga0495657_0194229 | Ga0495657_0194229_514_699 | 60 |
| 212 | 3300046678 | Ga0495599_0005317 | Ga0495599_0005317_6030_6215 | 60 |
| 213 | 3300046678 | Ga0495599_0032803 | Ga0495599_0032803_1631_1816 | 60 |
| 214 | 3300046678 | Ga0495599_0230772 | Ga0495599_0230772_672_857 | 60 |
| 215 | 3300046679 | Ga0495623_0534291 | Ga0495623_0534291_120_305 | 60 |
| 216 | 3300046680 | Ga0495646_0621989 | Ga0495646_0621989_116_301 | 60 |
| 217 | 3300046681 | Ga0495647_0165323 | Ga0495647_0165323_270_455 | 60 |
| 218 | 3300046683 | Ga0495658_0107496 | Ga0495658_0107496_1222_1407 | 60 |
| 219 | 3300046689 | Ga0495613_0080743 | Ga0495613_0080743_1113_1298 | 60 |
| 220 | 3300046690 | Ga0495624_0045558 | Ga0495624_0045558_1358_1543 | 60 |
| 221 | 3300046809 | Ga0495600_0074913 | Ga0495600_0074913_281_466 | 60 |
| 222 | 3300047315 | Ga0495581_0275574 | Ga0495581_0275574_109_294 | 60 |
| 223 | 3300047317 | Ga0495604_0006828 | Ga0495604_0006828_1074_1259 | 60 |
| 224 | 3300047317 | Ga0495604_0395128 | Ga0495604_0395128_109_294 | 60 |
| 225 | 3300047319 | Ga0495674_0005220 | Ga0495674_0005220_9849_10034 | 60 |
| 226 | 3300047322 | Ga0495680_0011364 | Ga0495680_0011364_2519_2704 | 60 |
| 227 | 3300047322 | Ga0495680_0140126 | Ga0495680_0140126_559_744 | 60 |
| 228 | 3300047444 | Ga0495675_0018560 | Ga0495675_0018560_3755_3940 | 60 |
| 229 | 3300047471 | Ga0495684_0012445 | Ga0495684_0012445_1193_1378 | 60 |
| 230 | 3300047673 | Ga0495593_0068347 | Ga0495593_0068347_596_781 | 60 |
| 231 | 3300048089 | Ga0495614_0088704 | Ga0495614_0088704_656_841 | 60 |
| 232 | 3300048909 | Ga0496106_0292863 | Ga0496106_0292863_38_220 | 60 |
| 233 | 3300048909 | Ga0496106_1437399 | Ga0496106_1437399_186_368 | 60 |
| 234 | 3300048911 | Ga0496108_0815914 | Ga0496108_0815914_51_233 | 60 |
| 235 | 3300048912 | Ga0496109_0141848 | Ga0496109_0141848_1179_1361 | 60 |
| 236 | 3300048917 | Ga0496114_0418917 | Ga0496114_0418917_72_254 | 60 |
| 237 | 3300049572 | Ga0501036_0676094 | Ga0501036_0676094_654_836 | 60 |
| 238 | 3300049592 | Ga0501076_0440805 | Ga0501076_0440805_666_848 | 60 |
| 239 | 3300049741 | Ga0501079_0743924 | Ga0501079_0743924_375_557 | 60 |
| 240 | 3300049824 | Ga0501045_0341473 | Ga0501045_0341473_718_906 | 60 |
| 241 | 3300050508 | nmdc:mga09592_31385_c1 | nmdc:mga09592_31385_c1_3193_3375 | 60 |
| 242 | 3300050509 | nmdc:mga0qj67_319931_c1 | nmdc:mga0qj67_319931_c1_341_523 | 60 |
| 243 | 3300050510 | nmdc:mga06r32_18886_c1 | nmdc:mga06r32_18886_c1_3063_3245 | 60 |
| 244 | 3300050511 | nmdc:mga08y16_515000_c1 | nmdc:mga08y16_515000_c1_211_393 | 60 |
| 245 | 3300050512 | nmdc:mga0n895_1403553_c1 | nmdc:mga0n895_1403553_c1_140_322 | 60 |
| 246 | 3300053077 | Ga0495601_0002901 | Ga0495601_0002901_4796_4981 | 60 |
| 247 | 3300053077 | Ga0495601_0268996 | Ga0495601_0268996_342_527 | 60 |
| 248 | 3300053077 | Ga0495601_0343214 | Ga0495601_0343214_668_853 | 60 |
| 249 | 3300053078 | Ga0495612_0090242 | Ga0495612_0090242_683_868 | 60 |
| 250 | 3300053084 | Ga0495595_0001331 | Ga0495595_0001331_7360_7545 | 60 |
| 251 | 3300053085 | Ga0495619_0004232 | Ga0495619_0004232_2041_2226 | 60 |
| 252 | 3300053085 | Ga0495619_0723068 | Ga0495619_0723068_221_406 | 60 |
| 253 | 3300053094 | Ga0500566_0131688 | Ga0500566_0131688_1134_1319 | 60 |
| 254 | 3300005343 | Ga0070687_100270003 | Ga0070687_1002700032 | 61 |
| 255 | 3300005353 | Ga0070669_100410539 | Ga0070669_1004105392 | 61 |
| 256 | 3300005438 | Ga0070701_10195837 | Ga0070701_101958372 | 61 |
| 257 | 3300005440 | Ga0070705_100980900 | Ga0070705_1009809001 | 61 |
| 258 | 3300005547 | Ga0070693_100981859 | Ga0070693_1009818592 | 61 |
| 259 | 3300005549 | Ga0070704_100783944 | Ga0070704_1007839442 | 61 |
| 260 | 3300005578 | Ga0068854_101262291 | Ga0068854_1012622912 | 61 |
| 261 | 3300005719 | Ga0068861_100130189 | Ga0068861_1001301892 | 61 |
| 262 | 3300005840 | Ga0068870_10201290 | Ga0068870_102012902 | 61 |
| 263 | 3300005840 | Ga0068870_10283346 | Ga0068870_102833461 | 61 |
| 264 | 3300006847 | Ga0075431_100911482 | Ga0075431_1009114822 | 61 |
| 265 | 3300014326 | Ga0157380_12923155 | Ga0157380_129231552 | 61 |
| 266 | 3300025908 | Ga0207643_10029146 | Ga0207643_100291464 | 61 |
| 267 | 3300025918 | Ga0207662_10039411 | Ga0207662_100394112 | 61 |
| 268 | 3300025923 | Ga0207681_10107719 | Ga0207681_101077192 | 61 |
| 269 | 3300025934 | Ga0207686_10976435 | Ga0207686_109764352 | 61 |
| 270 | 3300026116 | Ga0207674_10549673 | Ga0207674_105496733 | 61 |
| 271 | 3300026118 | Ga0207675_101224058 | Ga0207675_1012240582 | 61 |
| 272 | 3300027395 | Ga0209996_1047224 | Ga0209996_10472242 | 61 |
| 273 | 3300027462 | Ga0210000_1007252 | Ga0210000_10072523 | 61 |
| 274 | 3300027526 | Ga0209968_1038970 | Ga0209968_10389703 | 61 |
| 275 | 3300031548 | Ga0307408_100220521 | Ga0307408_1002205212 | 61 |
| 276 | 3300031548 | Ga0307408_100428070 | Ga0307408_1004280703 | 61 |
| 277 | 3300031731 | Ga0307405_10316537 | Ga0307405_103165371 | 61 |
| 278 | 3300031731 | Ga0307405_10682704 | Ga0307405_106827042 | 61 |
| 279 | 3300031824 | Ga0307413_11442274 | Ga0307413_114422742 | 61 |
| 280 | 3300031901 | Ga0307406_11556118 | Ga0307406_115561182 | 61 |
| 281 | 3300031903 | Ga0307407_11558851 | Ga0307407_115588512 | 61 |
| 282 | 3300031911 | Ga0307412_10136384 | Ga0307412_101363843 | 61 |
| 283 | 3300031995 | Ga0307409_101530511 | Ga0307409_1015305112 | 61 |
| 284 | 3300032002 | Ga0307416_100296502 | Ga0307416_1002965022 | 61 |
| 285 | 3300032002 | Ga0307416_101861216 | Ga0307416_1018612162 | 61 |
| 286 | 3300032005 | Ga0307411_11513296 | Ga0307411_115132962 | 61 |
| 287 | 3300038741 | Ga0400488_40428 | Ga0400488_40428_192_392 | 61 |
| 288 | 3300038742 | Ga0400486_15329 | Ga0400486_15329_7026_7226 | 61 |
| 289 | 3300039062 | Ga0400483_070153 | Ga0400483_070153_2932_3132 | 61 |
| 290 | 3300039110 | Ga0400487_20435 | Ga0400487_20435_3803_4003 | 61 |
| 291 | 3300042133 | Ga0450896_056548 | Ga0450896_056548_284_469 | 61 |
| 292 | 3300042436 | Ga0439435_0370400 | Ga0439435_0370400_242_427 | 61 |
| 293 | 3300046523 | Ga0495644_0081670 | Ga0495644_0081670_89_274 | 61 |
| 294 | 3300046537 | Ga0495598_0066406 | Ga0495598_0066406_546_731 | 61 |
| 295 | 3300046684 | Ga0495669_0138507 | Ga0495669_0138507_826_1011 | 61 |
| 296 | 3300049521 | Ga0501298_057465 | Ga0501298_057465_38_223 | 61 |
| 297 | 3300049705 | Ga0501225_0106669 | Ga0501225_0106669_232_417 | 61 |
| 298 | 3300049779 | Ga0501283_028531 | Ga0501283_028531_222_407 | 61 |
| 299 | 3300050508 | nmdc:mga09592_146278_c1 | nmdc:mga09592_146278_c1_428_613 | 61 |
| 300 | 3300050508 | nmdc:mga09592_558727_c1 | nmdc:mga09592_558727_c1_165_350 | 61 |
| 301 | 3300050509 | nmdc:mga0qj67_35741_c1 | nmdc:mga0qj67_35741_c1_2319_2504 | 61 |
| 302 | 3300050510 | nmdc:mga06r32_217415_c1 | nmdc:mga06r32_217415_c1_625_810 | 61 |
| 303 | 3300050510 | nmdc:mga06r32_610756_c1 | nmdc:mga06r32_610756_c1_322_507 | 61 |
| 304 | 3300050511 | nmdc:mga08y16_115926_c1 | nmdc:mga08y16_115926_c1_1444_1629 | 61 |
| 305 | 3300005434 | Ga0070709_10648673 | Ga0070709_106486732 | 62 |
| 306 | 3300005437 | Ga0070710_10551529 | Ga0070710_105515292 | 62 |
| 307 | 3300027471 | Ga0209995_1050754 | Ga0209995_10507542 | 62 |
| 308 | 3300032002 | Ga0307416_102566382 | Ga0307416_1025663822 | 62 |
| 309 | 3300032005 | Ga0307411_10791963 | Ga0307411_107919632 | 62 |
| 310 | 3300049568 | Ga0501031_0265715 | Ga0501031_0265715_200_388 | 62 |
| 311 | 3300049570 | Ga0501033_0020853 | Ga0501033_0020853_3224_3412 | 62 |
| 312 | 3300049571 | Ga0501034_0353295 | Ga0501034_0353295_287_475 | 62 |
| 313 | 3300049572 | Ga0501036_0002322 | Ga0501036_0002322_10101_10289 | 62 |
| 314 | 3300049573 | Ga0501037_0014951 | Ga0501037_0014951_1043_1231 | 62 |
| 315 | 3300049574 | Ga0501038_0000897 | Ga0501038_0000897_9848_10036 | 62 |
| 316 | 3300049575 | Ga0501039_0008885 | Ga0501039_0008885_2138_2326 | 62 |
| 317 | 3300049576 | Ga0501040_0023931 | Ga0501040_0023931_729_917 | 62 |
| 318 | 3300049577 | Ga0501041_0001118 | Ga0501041_0001118_12946_13134 | 62 |
| 319 | 3300049578 | Ga0501042_0009920 | Ga0501042_0009920_4141_4329 | 62 |
| 320 | 3300049578 | Ga0501042_0151239 | Ga0501042_0151239_1064_1252 | 62 |
| 321 | 3300049579 | Ga0501043_0053084 | Ga0501043_0053084_1013_1201 | 62 |
| 322 | 3300049580 | Ga0501046_0004895 | Ga0501046_0004895_9847_10035 | 62 |
| 323 | 3300049581 | Ga0501047_0360909 | Ga0501047_0360909_373_561 | 62 |
| 324 | 3300049582 | Ga0501048_0000253 | Ga0501048_0000253_25878_26066 | 62 |
| 325 | 3300049584 | Ga0501068_0044693 | Ga0501068_0044693_447_635 | 62 |
| 326 | 3300049586 | Ga0501070_0022910 | Ga0501070_0022910_1806_1994 | 62 |
| 327 | 3300049587 | Ga0501071_0016865 | Ga0501071_0016865_1387_1575 | 62 |
| 328 | 3300049588 | Ga0501072_0403966 | Ga0501072_0403966_633_821 | 62 |
| 329 | 3300049590 | Ga0501074_0014632 | Ga0501074_0014632_4447_4635 | 62 |
| 330 | 3300049591 | Ga0501075_0000905 | Ga0501075_0000905_17597_17785 | 62 |
| 331 | 3300049592 | Ga0501076_0015115 | Ga0501076_0015115_5127_5315 | 62 |
| 332 | 3300049593 | Ga0501077_0007740 | Ga0501077_0007740_4465_4653 | 62 |
| 333 | 3300049741 | Ga0501079_0000672 | Ga0501079_0000672_17381_17569 | 62 |
| 334 | 3300049742 | Ga0501080_0133779 | Ga0501080_0133779_1646_1834 | 62 |
| 335 | 3300049743 | Ga0501081_0000506 | Ga0501081_0000506_4255_4443 | 62 |
| 336 | 3300049743 | Ga0501081_1123763 | Ga0501081_1123763_75_263 | 62 |
| 337 | 3300049744 | Ga0501083_0228712 | Ga0501083_0228712_708_896 | 62 |
| 338 | 3300049822 | Ga0501035_0040463 | Ga0501035_0040463_1223_1411 | 62 |
| 339 | 3300049823 | Ga0501044_0416042 | Ga0501044_0416042_210_398 | 62 |
| 340 | 3300049824 | Ga0501045_0006856 | Ga0501045_0006856_4815_5003 | 62 |
| 341 | 3300049824 | Ga0501045_0390563 | Ga0501045_0390563_643_831 | 62 |
| 342 | 3300053077 | Ga0495601_0379335 | Ga0495601_0379335_22_210 | 62 |
| 343 | 3300054114 | Ga0501084_0001838 | Ga0501084_0001838_7486_7674 | 62 |
| 344 | 3300059424 | Ga0590075_027962 | Ga0590075_027962_670_858 | 62 |
| 345 | 3300059426 | Ga0590077_025958 | Ga0590077_025958_103_291 | 62 |
| 346 | 3300060353 | Ga0501082_0033197 | Ga0501082_0033197_2700_2888 | 62 |
| 347 | 3300060353 | Ga0501082_0769349 | Ga0501082_0769349_147_335 | 62 |
| 348 | 3300061734 | Ga0530510_0000518 | Ga0530510_0000518_2016_2204 | 62 |
| 349 | 3300002073 | JGI24745J21846_1031541 | JGI24745J21846_10315412 | 63 |
| 350 | 3300002244 | JGI24742J22300_10057076 | JGI24742J22300_100570762 | 63 |
| 351 | 3300005295 | Ga0065707_10739179 | Ga0065707_107391791 | 63 |
| 352 | 3300005330 | Ga0070690_100000172 | Ga0070690_10000017226 | 63 |
| 353 | 3300005330 | Ga0070690_101481321 | Ga0070690_1014813212 | 63 |
| 354 | 3300005334 | Ga0068869_100004583 | Ga0068869_1000045834 | 63 |
| 355 | 3300005334 | Ga0068869_100075172 | Ga0068869_1000751724 | 63 |
| 356 | 3300005335 | Ga0070666_10169576 | Ga0070666_101695762 | 63 |
| 357 | 3300005336 | Ga0070680_100000230 | Ga0070680_1000002309 | 63 |
| 358 | 3300005336 | Ga0070680_100577203 | Ga0070680_1005772032 | 63 |
| 359 | 3300005337 | Ga0070682_100026535 | Ga0070682_1000265354 | 63 |
| 360 | 3300005338 | Ga0068868_100001075 | Ga0068868_10000107515 | 63 |
| 361 | 3300005340 | Ga0070689_100001034 | Ga0070689_1000010344 | 63 |
| 362 | 3300005340 | Ga0070689_100030972 | Ga0070689_1000309724 | 63 |
| 363 | 3300005340 | Ga0070689_100102156 | Ga0070689_1001021564 | 63 |
| 364 | 3300005340 | Ga0070689_100270512 | Ga0070689_1002705123 | 63 |
| 365 | 3300005341 | Ga0070691_10000935 | Ga0070691_1000093513 | 63 |
| 366 | 3300005343 | Ga0070687_100000141 | Ga0070687_1000001419 | 63 |
| 367 | 3300005343 | Ga0070687_100767646 | Ga0070687_1007676462 | 63 |
| 368 | 3300005344 | Ga0070661_100937074 | Ga0070661_1009370742 | 63 |
| 369 | 3300005345 | Ga0070692_10002703 | Ga0070692_100027038 | 63 |
| 370 | 3300005345 | Ga0070692_10034765 | Ga0070692_100347653 | 63 |
| 371 | 3300005345 | Ga0070692_11167486 | Ga0070692_111674862 | 63 |
| 372 | 3300005353 | Ga0070669_100844585 | Ga0070669_1008445852 | 63 |
| 373 | 3300005355 | Ga0070671_100978099 | Ga0070671_1009780992 | 63 |
| 374 | 3300005355 | Ga0070671_101093023 | Ga0070671_1010930232 | 63 |
| 375 | 3300005364 | Ga0070673_100408725 | Ga0070673_1004087252 | 63 |
| 376 | 3300005365 | Ga0070688_100094524 | Ga0070688_1000945242 | 63 |
| 377 | 3300005365 | Ga0070688_101670264 | Ga0070688_1016702642 | 63 |
| 378 | 3300005406 | Ga0070703_10004405 | Ga0070703_100044054 | 63 |
| 379 | 3300005406 | Ga0070703_10523304 | Ga0070703_105233042 | 63 |
| 380 | 3300005434 | Ga0070709_10870496 | Ga0070709_108704962 | 63 |
| 381 | 3300005436 | Ga0070713_101165032 | Ga0070713_1011650322 | 63 |
| 382 | 3300005436 | Ga0070713_101707603 | Ga0070713_1017076031 | 63 |
| 383 | 3300005437 | Ga0070710_10025335 | Ga0070710_100253354 | 63 |
| 384 | 3300005437 | Ga0070710_10717286 | Ga0070710_107172862 | 63 |
| 385 | 3300005437 | Ga0070710_10760521 | Ga0070710_107605212 | 63 |
| 386 | 3300005438 | Ga0070701_10004016 | Ga0070701_100040164 | 63 |
| 387 | 3300005438 | Ga0070701_10526600 | Ga0070701_105266002 | 63 |
| 388 | 3300005438 | Ga0070701_11332969 | Ga0070701_113329691 | 63 |
| 389 | 3300005440 | Ga0070705_100001001 | Ga0070705_10000100115 | 63 |
| 390 | 3300005440 | Ga0070705_100006101 | Ga0070705_1000061017 | 63 |
| 391 | 3300005440 | Ga0070705_100201953 | Ga0070705_1002019532 | 63 |
| 392 | 3300005440 | Ga0070705_100226425 | Ga0070705_1002264252 | 63 |
| 393 | 3300005440 | Ga0070705_100554213 | Ga0070705_1005542132 | 63 |
| 394 | 3300005440 | Ga0070705_100760892 | Ga0070705_1007608922 | 63 |
| 395 | 3300005441 | Ga0070700_100000591 | Ga0070700_10000059115 | 63 |
| 396 | 3300005441 | Ga0070700_101195529 | Ga0070700_1011955292 | 63 |
| 397 | 3300005444 | Ga0070694_100001923 | Ga0070694_10000192315 | 63 |
| 398 | 3300005444 | Ga0070694_100040371 | Ga0070694_1000403714 | 63 |
| 399 | 3300005444 | Ga0070694_100048516 | Ga0070694_1000485162 | 63 |
| 400 | 3300005444 | Ga0070694_101373747 | Ga0070694_1013737472 | 63 |
| 401 | 3300005445 | Ga0070708_100428923 | Ga0070708_1004289233 | 63 |
| 402 | 3300005457 | Ga0070662_101274901 | Ga0070662_1012749012 | 63 |
| 403 | 3300005458 | Ga0070681_10002547 | Ga0070681_100025478 | 63 |
| 404 | 3300005458 | Ga0070681_10073138 | Ga0070681_100731384 | 63 |
| 405 | 3300005459 | Ga0068867_100000487 | Ga0068867_1000004879 | 63 |
| 406 | 3300005467 | Ga0070706_100152546 | Ga0070706_1001525462 | 63 |
| 407 | 3300005518 | Ga0070699_100093440 | Ga0070699_1000934402 | 63 |
| 408 | 3300005518 | Ga0070699_101021991 | Ga0070699_1010219912 | 63 |
| 409 | 3300005530 | Ga0070679_100002377 | Ga0070679_1000023775 | 63 |
| 410 | 3300005530 | Ga0070679_100022031 | Ga0070679_1000220315 | 63 |
| 411 | 3300005530 | Ga0070679_101651013 | Ga0070679_1016510132 | 63 |
| 412 | 3300005535 | Ga0070684_100936328 | Ga0070684_1009363282 | 63 |
| 413 | 3300005536 | Ga0070697_100001057 | Ga0070697_1000010575 | 63 |
| 414 | 3300005536 | Ga0070697_100004435 | Ga0070697_10000443514 | 63 |
| 415 | 3300005536 | Ga0070697_100310424 | Ga0070697_1003104243 | 63 |
| 416 | 3300005536 | Ga0070697_100869690 | Ga0070697_1008696901 | 63 |
| 417 | 3300005536 | Ga0070697_101067084 | Ga0070697_1010670842 | 63 |
| 418 | 3300005536 | Ga0070697_102100337 | Ga0070697_1021003372 | 63 |
| 419 | 3300005544 | Ga0070686_100000527 | Ga0070686_10000052726 | 63 |
| 420 | 3300005544 | Ga0070686_100117866 | Ga0070686_1001178662 | 63 |
| 421 | 3300005545 | Ga0070695_100000298 | Ga0070695_10000029827 | 63 |
| 422 | 3300005545 | Ga0070695_100000498 | Ga0070695_10000049818 | 63 |
| 423 | 3300005545 | Ga0070695_100482188 | Ga0070695_1004821882 | 63 |
| 424 | 3300005545 | Ga0070695_100666429 | Ga0070695_1006664292 | 63 |
| 425 | 3300005545 | Ga0070695_101360760 | Ga0070695_1013607602 | 63 |
| 426 | 3300005546 | Ga0070696_100000061 | Ga0070696_10000006144 | 63 |
| 427 | 3300005546 | Ga0070696_100002472 | Ga0070696_1000024725 | 63 |
| 428 | 3300005546 | Ga0070696_100008068 | Ga0070696_1000080684 | 63 |
| 429 | 3300005546 | Ga0070696_100081100 | Ga0070696_1000811004 | 63 |
| 430 | 3300005546 | Ga0070696_101200717 | Ga0070696_1012007172 | 63 |
| 431 | 3300005546 | Ga0070696_101275852 | Ga0070696_1012758522 | 63 |
| 432 | 3300005547 | Ga0070693_100000016 | Ga0070693_10000001626 | 63 |
| 433 | 3300005547 | Ga0070693_101142245 | Ga0070693_1011422452 | 63 |
| 434 | 3300005547 | Ga0070693_101532506 | Ga0070693_1015325061 | 63 |
| 435 | 3300005549 | Ga0070704_100000246 | Ga0070704_10000024624 | 63 |
| 436 | 3300005549 | Ga0070704_100014320 | Ga0070704_1000143202 | 63 |
| 437 | 3300005549 | Ga0070704_100386245 | Ga0070704_1003862452 | 63 |
| 438 | 3300005549 | Ga0070704_100498078 | Ga0070704_1004980782 | 63 |
| 439 | 3300005563 | Ga0068855_100000975 | Ga0068855_10000097524 | 63 |
| 440 | 3300005578 | Ga0068854_100000366 | Ga0068854_1000003669 | 63 |
| 441 | 3300005614 | Ga0068856_100497566 | Ga0068856_1004975662 | 63 |
| 442 | 3300005615 | Ga0070702_100000485 | Ga0070702_1000004857 | 63 |
| 443 | 3300005615 | Ga0070702_100288871 | Ga0070702_1002888713 | 63 |
| 444 | 3300005616 | Ga0068852_100314752 | Ga0068852_1003147522 | 63 |
| 445 | 3300005617 | Ga0068859_100014820 | Ga0068859_1000148207 | 63 |
| 446 | 3300005617 | Ga0068859_102524061 | Ga0068859_1025240612 | 63 |
| 447 | 3300005618 | Ga0068864_100015369 | Ga0068864_1000153699 | 63 |
| 448 | 3300005718 | Ga0068866_10000176 | Ga0068866_1000017627 | 63 |
| 449 | 3300005719 | Ga0068861_100001699 | Ga0068861_10000169918 | 63 |
| 450 | 3300005841 | Ga0068863_100812686 | Ga0068863_1008126862 | 63 |
| 451 | 3300005842 | Ga0068858_100000619 | Ga0068858_10000061921 | 63 |
| 452 | 3300005843 | Ga0068860_100002570 | Ga0068860_1000025708 | 63 |
| 453 | 3300005844 | Ga0068862_100003412 | Ga0068862_10000341218 | 63 |
| 454 | 3300005844 | Ga0068862_101293506 | Ga0068862_1012935062 | 63 |
| 455 | 3300005985 | Ga0081539_10001364 | Ga0081539_100013649 | 63 |
| 456 | 3300006163 | Ga0070715_10468134 | Ga0070715_104681342 | 63 |
| 457 | 3300006173 | Ga0070716_100032456 | Ga0070716_1000324564 | 63 |
| 458 | 3300006175 | Ga0070712_101997504 | Ga0070712_1019975042 | 63 |
| 459 | 3300006237 | Ga0097621_100001255 | Ga0097621_1000012552 | 63 |
| 460 | 3300006237 | Ga0097621_101002611 | Ga0097621_1010026112 | 63 |
| 461 | 3300006358 | Ga0068871_100003554 | Ga0068871_1000035543 | 63 |
| 462 | 3300006844 | Ga0075428_100000532 | Ga0075428_10000053230 | 63 |
| 463 | 3300006844 | Ga0075428_100044919 | Ga0075428_1000449193 | 63 |
| 464 | 3300006844 | Ga0075428_100233663 | Ga0075428_1002336634 | 63 |
| 465 | 3300006844 | Ga0075428_100589625 | Ga0075428_1005896251 | 63 |
| 466 | 3300006846 | Ga0075430_100001203 | Ga0075430_10000120312 | 63 |
| 467 | 3300006846 | Ga0075430_100452115 | Ga0075430_1004521151 | 63 |
| 468 | 3300006847 | Ga0075431_100034541 | Ga0075431_1000345412 | 63 |
| 469 | 3300006847 | Ga0075431_100182411 | Ga0075431_1001824114 | 63 |
| 470 | 3300006847 | Ga0075431_100210289 | Ga0075431_1002102894 | 63 |
| 471 | 3300006847 | Ga0075431_100423176 | Ga0075431_1004231762 | 63 |
| 472 | 3300006852 | Ga0075433_10059938 | Ga0075433_100599384 | 63 |
| 473 | 3300006852 | Ga0075433_10969767 | Ga0075433_109697672 | 63 |
| 474 | 3300006852 | Ga0075433_11670364 | Ga0075433_116703642 | 63 |
| 475 | 3300006871 | Ga0075434_100011723 | Ga0075434_1000117235 | 63 |
| 476 | 3300006871 | Ga0075434_100069507 | Ga0075434_1000695072 | 63 |
| 477 | 3300006871 | Ga0075434_100867554 | Ga0075434_1008675542 | 63 |
| 478 | 3300006871 | Ga0075434_101003556 | Ga0075434_1010035562 | 63 |
| 479 | 3300006871 | Ga0075434_101247897 | Ga0075434_1012478972 | 63 |
| 480 | 3300006871 | Ga0075434_102226237 | Ga0075434_1022262372 | 63 |
| 481 | 3300006880 | Ga0075429_100000324 | Ga0075429_10000032414 | 63 |
| 482 | 3300006880 | Ga0075429_100154145 | Ga0075429_1001541452 | 63 |
| 483 | 3300006880 | Ga0075429_100276506 | Ga0075429_1002765063 | 63 |
| 484 | 3300006880 | Ga0075429_100282434 | Ga0075429_1002824342 | 63 |
| 485 | 3300006880 | Ga0075429_100691106 | Ga0075429_1006911062 | 63 |
| 486 | 3300006880 | Ga0075429_101847963 | Ga0075429_1018479632 | 63 |
| 487 | 3300006881 | Ga0068865_100000262 | Ga0068865_10000026212 | 63 |
| 488 | 3300006914 | Ga0075436_100027479 | Ga0075436_1000274794 | 63 |
| 489 | 3300006914 | Ga0075436_100067227 | Ga0075436_1000672273 | 63 |
| 490 | 3300006914 | Ga0075436_100074204 | Ga0075436_1000742042 | 63 |
| 491 | 3300006914 | Ga0075436_100188264 | Ga0075436_1001882642 | 63 |
| 492 | 3300006914 | Ga0075436_100686426 | Ga0075436_1006864261 | 63 |
| 493 | 3300006914 | Ga0075436_101029358 | Ga0075436_1010293582 | 63 |
| 494 | 3300006914 | Ga0075436_101330338 | Ga0075436_1013303382 | 63 |
| 495 | 3300006931 | Ga0097620_100014822 | Ga0097620_1000148227 | 63 |
| 496 | 3300006931 | Ga0097620_102524397 | Ga0097620_1025243972 | 63 |
| 497 | 3300007076 | Ga0075435_100000887 | Ga0075435_1000008875 | 63 |
| 498 | 3300007076 | Ga0075435_100207814 | Ga0075435_1002078144 | 63 |
| 499 | 3300007076 | Ga0075435_100351811 | Ga0075435_1003518112 | 63 |
| 500 | 3300007076 | Ga0075435_100861506 | Ga0075435_1008615062 | 63 |
| 501 | 3300007076 | Ga0075435_101387526 | Ga0075435_1013875261 | 63 |
| 502 | 3300007265 | Ga0099794_10010376 | Ga0099794_100103763 | 63 |
| 503 | 3300007265 | Ga0099794_10042383 | Ga0099794_100423831 | 63 |
| 504 | 3300007265 | Ga0099794_10093204 | Ga0099794_100932042 | 63 |
| 505 | 3300007265 | Ga0099794_10407602 | Ga0099794_104076022 | 63 |
| 506 | 3300007788 | Ga0099795_10060495 | Ga0099795_100604952 | 63 |
| 507 | 3300009092 | Ga0105250_10033278 | Ga0105250_100332783 | 63 |
| 508 | 3300009093 | Ga0105240_10393433 | Ga0105240_103934332 | 63 |
| 509 | 3300009094 | Ga0111539_10019692 | Ga0111539_100196929 | 63 |
| 510 | 3300009094 | Ga0111539_10080009 | Ga0111539_100800094 | 63 |
| 511 | 3300009098 | Ga0105245_10000178 | Ga0105245_1000017844 | 63 |
| 512 | 3300009147 | Ga0114129_10014186 | Ga0114129_1001418614 | 63 |
| 513 | 3300009147 | Ga0114129_10178816 | Ga0114129_101788165 | 63 |
| 514 | 3300009147 | Ga0114129_10602307 | Ga0114129_106023072 | 63 |
| 515 | 3300009147 | Ga0114129_11000204 | Ga0114129_110002042 | 63 |
| 516 | 3300009147 | Ga0114129_13142443 | Ga0114129_131424432 | 63 |
| 517 | 3300009148 | Ga0105243_10000270 | Ga0105243_1000027040 | 63 |
| 518 | 3300009174 | Ga0105241_10087687 | Ga0105241_100876872 | 63 |
| 519 | 3300009174 | Ga0105241_12191693 | Ga0105241_121916932 | 63 |
| 520 | 3300009176 | Ga0105242_10000409 | Ga0105242_1000040925 | 63 |
| 521 | 3300009177 | Ga0105248_10665880 | Ga0105248_106658802 | 63 |
| 522 | 3300009177 | Ga0105248_13057425 | Ga0105248_130574251 | 63 |
| 523 | 3300009545 | Ga0105237_12435979 | Ga0105237_124359792 | 63 |
| 524 | 3300009553 | Ga0105249_10012264 | Ga0105249_100122649 | 63 |
| 525 | 3300009553 | Ga0105249_12616062 | Ga0105249_126160622 | 63 |
| 526 | 3300010159 | Ga0099796_10382424 | Ga0099796_103824242 | 63 |
| 527 | 3300010375 | Ga0105239_11021185 | Ga0105239_110211852 | 63 |
| 528 | 3300011119 | Ga0105246_10449128 | Ga0105246_104491281 | 63 |
| 529 | 3300012512 | Ga0157327_1073375 | Ga0157327_10733752 | 63 |
| 530 | 3300013105 | Ga0157369_10495602 | Ga0157369_104956022 | 63 |
| 531 | 3300013105 | Ga0157369_12101250 | Ga0157369_121012502 | 63 |
| 532 | 3300013297 | Ga0157378_10000340 | Ga0157378_1000034027 | 63 |
| 533 | 3300013306 | Ga0163162_10997548 | Ga0163162_109975482 | 63 |
| 534 | 3300013307 | Ga0157372_10457782 | Ga0157372_104577822 | 63 |
| 535 | 3300013307 | Ga0157372_10654974 | Ga0157372_106549742 | 63 |
| 536 | 3300013308 | Ga0157375_12315930 | Ga0157375_123159302 | 63 |
| 537 | 3300014326 | Ga0157380_10009920 | Ga0157380_100099203 | 63 |
| 538 | 3300014326 | Ga0157380_10387978 | Ga0157380_103879783 | 63 |
| 539 | 3300014326 | Ga0157380_12480175 | Ga0157380_124801752 | 63 |
| 540 | 3300014745 | Ga0157377_10033972 | Ga0157377_100339724 | 63 |
| 541 | 3300014968 | Ga0157379_11809351 | Ga0157379_118093512 | 63 |
| 542 | 3300014969 | Ga0157376_10008044 | Ga0157376_100080444 | 63 |
| 543 | 3300017792 | Ga0163161_10704586 | Ga0163161_107045862 | 63 |
| 544 | 3300021441 | Ga0213871_10261613 | Ga0213871_102616132 | 63 |
| 545 | 3300025711 | Ga0207696_1164737 | Ga0207696_11647372 | 63 |
| 546 | 3300025885 | Ga0207653_10007033 | Ga0207653_100070334 | 63 |
| 547 | 3300025898 | Ga0207692_10169754 | Ga0207692_101697542 | 63 |
| 548 | 3300025898 | Ga0207692_10200537 | Ga0207692_102005372 | 63 |
| 549 | 3300025898 | Ga0207692_11093516 | Ga0207692_110935162 | 63 |
| 550 | 3300025899 | Ga0207642_10002060 | Ga0207642_100020606 | 63 |
| 551 | 3300025901 | Ga0207688_10199128 | Ga0207688_101991282 | 63 |
| 552 | 3300025903 | Ga0207680_10410608 | Ga0207680_104106082 | 63 |
| 553 | 3300025904 | Ga0207647_10277986 | Ga0207647_102779862 | 63 |
| 554 | 3300025905 | Ga0207685_10040579 | Ga0207685_100405792 | 63 |
| 555 | 3300025905 | Ga0207685_10118032 | Ga0207685_101180322 | 63 |
| 556 | 3300025905 | Ga0207685_10610367 | Ga0207685_106103672 | 63 |
| 557 | 3300025906 | Ga0207699_10430940 | Ga0207699_104309402 | 63 |
| 558 | 3300025908 | Ga0207643_10430303 | Ga0207643_104303032 | 63 |
| 559 | 3300025910 | Ga0207684_11534192 | Ga0207684_115341922 | 63 |
| 560 | 3300025911 | Ga0207654_10421479 | Ga0207654_104214792 | 63 |
| 561 | 3300025912 | Ga0207707_10005405 | Ga0207707_1000540511 | 63 |
| 562 | 3300025913 | Ga0207695_10428229 | Ga0207695_104282292 | 63 |
| 563 | 3300025916 | Ga0207663_10630391 | Ga0207663_106303912 | 63 |
| 564 | 3300025916 | Ga0207663_11663604 | Ga0207663_116636042 | 63 |
| 565 | 3300025917 | Ga0207660_10002634 | Ga0207660_100026348 | 63 |
| 566 | 3300025917 | Ga0207660_10059649 | Ga0207660_100596494 | 63 |
| 567 | 3300025917 | Ga0207660_10743023 | Ga0207660_107430232 | 63 |
| 568 | 3300025918 | Ga0207662_10000047 | Ga0207662_1000004727 | 63 |
| 569 | 3300025918 | Ga0207662_10194985 | Ga0207662_101949852 | 63 |
| 570 | 3300025921 | Ga0207652_10015482 | Ga0207652_100154824 | 63 |
| 571 | 3300025921 | Ga0207652_10027972 | Ga0207652_100279726 | 63 |
| 572 | 3300025922 | Ga0207646_10170746 | Ga0207646_101707464 | 63 |
| 573 | 3300025922 | Ga0207646_10515524 | Ga0207646_105155242 | 63 |
| 574 | 3300025927 | Ga0207687_10001597 | Ga0207687_100015976 | 63 |
| 575 | 3300025928 | Ga0207700_11356640 | Ga0207700_113566401 | 63 |
| 576 | 3300025928 | Ga0207700_11886261 | Ga0207700_118862612 | 63 |
| 577 | 3300025929 | Ga0207664_10080713 | Ga0207664_100807134 | 63 |
| 578 | 3300025933 | Ga0207706_10819868 | Ga0207706_108198682 | 63 |
| 579 | 3300025934 | Ga0207686_10000446 | Ga0207686_1000044627 | 63 |
| 580 | 3300025935 | Ga0207709_10002410 | Ga0207709_1000241012 | 63 |
| 581 | 3300025936 | Ga0207670_10000462 | Ga0207670_100004628 | 63 |
| 582 | 3300025936 | Ga0207670_11492561 | Ga0207670_114925612 | 63 |
| 583 | 3300025938 | Ga0207704_10000290 | Ga0207704_100002906 | 63 |
| 584 | 3300025939 | Ga0207665_10066961 | Ga0207665_100669612 | 63 |
| 585 | 3300025939 | Ga0207665_10101182 | Ga0207665_101011822 | 63 |
| 586 | 3300025939 | Ga0207665_10895308 | Ga0207665_108953081 | 63 |
| 587 | 3300025940 | Ga0207691_10687266 | Ga0207691_106872662 | 63 |
| 588 | 3300025941 | Ga0207711_10524885 | Ga0207711_105248852 | 63 |
| 589 | 3300025941 | Ga0207711_10542996 | Ga0207711_105429962 | 63 |
| 590 | 3300025942 | Ga0207689_10000148 | Ga0207689_1000014841 | 63 |
| 591 | 3300025942 | Ga0207689_10719676 | Ga0207689_107196762 | 63 |
| 592 | 3300025949 | Ga0207667_10004155 | Ga0207667_1000415514 | 63 |
| 593 | 3300025960 | Ga0207651_10448678 | Ga0207651_104486782 | 63 |
| 594 | 3300025960 | Ga0207651_12011099 | Ga0207651_120110992 | 63 |
| 595 | 3300025961 | Ga0207712_10012530 | Ga0207712_100125302 | 63 |
| 596 | 3300025981 | Ga0207640_10005645 | Ga0207640_100056457 | 63 |
| 597 | 3300026023 | Ga0207677_10002010 | Ga0207677_100020102 | 63 |
| 598 | 3300026023 | Ga0207677_12143414 | Ga0207677_121434142 | 63 |
| 599 | 3300026035 | Ga0207703_10001208 | Ga0207703_1000120820 | 63 |
| 600 | 3300026041 | Ga0207639_10360987 | Ga0207639_103609871 | 63 |
| 601 | 3300026075 | Ga0207708_10000676 | Ga0207708_100006764 | 63 |
| 602 | 3300026078 | Ga0207702_10076459 | Ga0207702_100764594 | 63 |
| 603 | 3300026078 | Ga0207702_11999002 | Ga0207702_119990021 | 63 |
| 604 | 3300026088 | Ga0207641_10294804 | Ga0207641_102948042 | 63 |
| 605 | 3300026088 | Ga0207641_11083642 | Ga0207641_110836421 | 63 |
| 606 | 3300026089 | Ga0207648_10000018 | Ga0207648_10000018116 | 63 |
| 607 | 3300026095 | Ga0207676_10490959 | Ga0207676_104909592 | 63 |
| 608 | 3300026118 | Ga0207675_100000170 | Ga0207675_10000017041 | 63 |
| 609 | 3300026142 | Ga0207698_10098960 | Ga0207698_100989602 | 63 |
| 610 | 3300027360 | Ga0209969_1018522 | Ga0209969_10185222 | 63 |
| 611 | 3300027364 | Ga0209967_1025342 | Ga0209967_10253422 | 63 |
| 612 | 3300027378 | Ga0209981_1008520 | Ga0209981_10085202 | 63 |
| 613 | 3300027424 | Ga0209984_1070459 | Ga0209984_10704592 | 63 |
| 614 | 3300027462 | Ga0210000_1000974 | Ga0210000_10009742 | 63 |
| 615 | 3300027462 | Ga0210000_1015320 | Ga0210000_10153202 | 63 |
| 616 | 3300027526 | Ga0209968_1005686 | Ga0209968_10056861 | 63 |
| 617 | 3300027526 | Ga0209968_1099133 | Ga0209968_10991332 | 63 |
| 618 | 3300027543 | Ga0209999_1011110 | Ga0209999_10111102 | 63 |
| 619 | 3300027543 | Ga0209999_1012664 | Ga0209999_10126642 | 63 |
| 620 | 3300027614 | Ga0209970_1061591 | Ga0209970_10615912 | 63 |
| 621 | 3300027665 | Ga0209983_1052966 | Ga0209983_10529662 | 63 |
| 622 | 3300027665 | Ga0209983_1058729 | Ga0209983_10587292 | 63 |
| 623 | 3300027671 | Ga0209588_1052779 | Ga0209588_10527792 | 63 |
| 624 | 3300027682 | Ga0209971_1002798 | Ga0209971_10027984 | 63 |
| 625 | 3300027682 | Ga0209971_1030717 | Ga0209971_10307173 | 63 |
| 626 | 3300027695 | Ga0209966_1002048 | Ga0209966_10020484 | 63 |
| 627 | 3300027717 | Ga0209998_10023646 | Ga0209998_100236463 | 63 |
| 628 | 3300027717 | Ga0209998_10129134 | Ga0209998_101291342 | 63 |
| 629 | 3300027876 | Ga0209974_10090429 | Ga0209974_100904292 | 63 |
| 630 | 3300027907 | Ga0207428_10000835 | Ga0207428_1000083513 | 63 |
| 631 | 3300027907 | Ga0207428_10963435 | Ga0207428_109634352 | 63 |
| 632 | 3300028380 | Ga0268265_10001514 | Ga0268265_1000151416 | 63 |
| 633 | 3300028380 | Ga0268265_10345993 | Ga0268265_103459933 | 63 |
| 634 | 3300028380 | Ga0268265_11860337 | Ga0268265_118603372 | 63 |
| 635 | 3300028381 | Ga0268264_10001414 | Ga0268264_1000141414 | 63 |
| 636 | 3300028381 | Ga0268264_10292650 | Ga0268264_102926503 | 63 |
| 637 | 3300028381 | Ga0268264_12011008 | Ga0268264_120110082 | 63 |
| 638 | 3300028381 | Ga0268264_12487117 | Ga0268264_124871172 | 63 |
| 639 | 3300031548 | Ga0307408_100166145 | Ga0307408_1001661451 | 63 |
| 640 | 3300031548 | Ga0307408_100318043 | Ga0307408_1003180433 | 63 |
| 641 | 3300031548 | Ga0307408_100668803 | Ga0307408_1006688031 | 63 |
| 642 | 3300031665 | Ga0316575_10083667 | Ga0316575_100836672 | 63 |
| 643 | 3300031691 | Ga0316579_10001744 | Ga0316579_100017447 | 63 |
| 644 | 3300031728 | Ga0316578_10240239 | Ga0316578_102402392 | 63 |
| 645 | 3300031731 | Ga0307405_10367349 | Ga0307405_103673492 | 63 |
| 646 | 3300031731 | Ga0307405_10775875 | Ga0307405_107758751 | 63 |
| 647 | 3300031731 | Ga0307405_11352031 | Ga0307405_113520312 | 63 |
| 648 | 3300031901 | Ga0307406_11720110 | Ga0307406_117201102 | 63 |
| 649 | 3300031911 | Ga0307412_11185843 | Ga0307412_111858432 | 63 |
| 650 | 3300031995 | Ga0307409_100353208 | Ga0307409_1003532082 | 63 |
| 651 | 3300031995 | Ga0307409_102682971 | Ga0307409_1026829711 | 63 |
| 652 | 3300032002 | Ga0307416_100162947 | Ga0307416_1001629473 | 63 |
| 653 | 3300032002 | Ga0307416_101795864 | Ga0307416_1017958642 | 63 |
| 654 | 3300032002 | Ga0307416_102224058 | Ga0307416_1022240582 | 63 |
| 655 | 3300032002 | Ga0307416_103002130 | Ga0307416_1030021302 | 63 |
| 656 | 3300032002 | Ga0307416_103098345 | Ga0307416_1030983452 | 63 |
| 657 | 3300032005 | Ga0307411_12057127 | Ga0307411_120571272 | 63 |
| 658 | 3300032133 | Ga0316583_10000604 | Ga0316583_100006048 | 63 |
| 659 | 3300032139 | Ga0316580_10047105 | Ga0316580_100471052 | 63 |
| 660 | 3300034816 | Ga0373930_0108413 | Ga0373930_0108413_204_395 | 63 |
| 661 | 3300034817 | Ga0373948_0065305 | Ga0373948_0065305_275_466 | 63 |
| 662 | 3300034818 | Ga0373950_0067147 | Ga0373950_0067147_359_550 | 63 |
| 663 | 3300034818 | Ga0373950_0131504 | Ga0373950_0131504_272_463 | 63 |
| 664 | 3300034819 | Ga0373958_0012755 | Ga0373958_0012755_1075_1266 | 63 |
| 665 | 3300034819 | Ga0373958_0185747 | Ga0373958_0185747_249_440 | 63 |
| 666 | 3300034820 | Ga0373959_0144219 | Ga0373959_0144219_348_539 | 63 |
| 667 | 3300035083 | Ga0373926_0011387 | Ga0373926_0011387_2649_2840 | 63 |
| 668 | 3300035083 | Ga0373926_0019898 | Ga0373926_0019898_854_1045 | 63 |
| 669 | 3300035084 | Ga0373928_0064479 | Ga0373928_0064479_138_329 | 63 |
| 670 | 3300035084 | Ga0373928_0096512 | Ga0373928_0096512_345_536 | 63 |
| 671 | 3300035085 | Ga0373929_0009025 | Ga0373929_0009025_1382_1573 | 63 |
| 672 | 3300035085 | Ga0373929_0057483 | Ga0373929_0057483_213_404 | 63 |
| 673 | 3300035086 | Ga0373934_0458947 | Ga0373934_0458947_94_285 | 63 |
| 674 | 3300035088 | Ga0373940_0004143 | Ga0373940_0004143_551_742 | 63 |
| 675 | 3300035089 | Ga0373944_0156253 | Ga0373944_0156253_270_461 | 63 |
| 676 | 3300035090 | Ga0373949_0015962 | Ga0373949_0015962_318_509 | 63 |
| 677 | 3300035091 | Ga0373951_0091522 | Ga0373951_0091522_52_243 | 63 |
| 678 | 3300035092 | Ga0373952_0070289 | Ga0373952_0070289_204_395 | 63 |
| 679 | 3300035092 | Ga0373952_0114563 | Ga0373952_0114563_127_318 | 63 |
| 680 | 3300035111 | Ga0373923_0016921 | Ga0373923_0016921_1001_1192 | 63 |
| 681 | 3300035111 | Ga0373923_0221620 | Ga0373923_0221620_606_797 | 63 |
| 682 | 3300035112 | Ga0373932_0004155 | Ga0373932_0004155_1385_1576 | 63 |
| 683 | 3300035112 | Ga0373932_0015106 | Ga0373932_0015106_1013_1204 | 63 |
| 684 | 3300035112 | Ga0373932_0104604 | Ga0373932_0104604_640_831 | 63 |
| 685 | 3300035113 | Ga0373936_0036352 | Ga0373936_0036352_91_282 | 63 |
| 686 | 3300035113 | Ga0373936_0151947 | Ga0373936_0151947_531_731 | 63 |
| 687 | 3300035114 | Ga0373939_0006398 | Ga0373939_0006398_1265_1456 | 63 |
| 688 | 3300035115 | Ga0373941_0003680 | Ga0373941_0003680_92_283 | 63 |
| 689 | 3300035116 | Ga0373945_0098308 | Ga0373945_0098308_546_737 | 63 |
| 690 | 3300035117 | Ga0373953_0002689 | Ga0373953_0002689_3066_3257 | 63 |
| 691 | 3300035117 | Ga0373953_0153525 | Ga0373953_0153525_708_899 | 63 |
| 692 | 3300035118 | Ga0373954_0062678 | Ga0373954_0062678_939_1130 | 63 |
| 693 | 3300035118 | Ga0373954_0450385 | Ga0373954_0450385_248_439 | 63 |
| 694 | 3300035119 | Ga0373956_0228536 | Ga0373956_0228536_511_702 | 63 |
| 695 | 3300035120 | Ga0373957_0087551 | Ga0373957_0087551_287_478 | 63 |
| 696 | 3300035121 | Ga0373960_0007720 | Ga0373960_0007720_918_1109 | 63 |
| 697 | 3300035121 | Ga0373960_0263211 | Ga0373960_0263211_253_444 | 63 |
| 698 | 3300035170 | Ga0373943_0011379 | Ga0373943_0011379_3262_3453 | 63 |
| 699 | 3300035171 | Ga0373946_0030062 | Ga0373946_0030062_1636_1827 | 63 |
| 700 | 3300035171 | Ga0373946_0030581 | Ga0373946_0030581_53_244 | 63 |
| 701 | 3300035172 | Ga0373955_0018664 | Ga0373955_0018664_1797_1988 | 63 |
| 702 | 3300035172 | Ga0373955_0586566 | Ga0373955_0586566_228_419 | 63 |
| 703 | 3300035207 | Ga0373942_0025923 | Ga0373942_0025923_1014_1205 | 63 |
| 704 | 3300035207 | Ga0373942_0049660 | Ga0373942_0049660_760_951 | 63 |
| 705 | 3300035241 | Ga0373961_0129313 | Ga0373961_0129313_198_389 | 63 |
| 706 | 3300035241 | Ga0373961_0275045 | Ga0373961_0275045_257_448 | 63 |
| 707 | 3300035242 | Ga0373962_0006162 | Ga0373962_0006162_682_873 | 63 |
| 708 | 3300035242 | Ga0373962_0044564 | Ga0373962_0044564_738_929 | 63 |
| 709 | 3300035398 | Ga0316574_0884697 | Ga0316574_0884697_142_339 | 63 |
| 710 | 3300035410 | Ga0373924_0177152 | Ga0373924_0177152_312_512 | 63 |
| 711 | 3300035410 | Ga0373924_0364446 | Ga0373924_0364446_324_515 | 63 |
| 712 | 3300035691 | Ga0373931_0003435 | Ga0373931_0003435_1879_2070 | 63 |
| 713 | 3300035691 | Ga0373931_0016082 | Ga0373931_0016082_2111_2302 | 63 |
| 714 | 3300035691 | Ga0373931_0111710 | Ga0373931_0111710_337_528 | 63 |
| 715 | 3300035691 | Ga0373931_0576443 | Ga0373931_0576443_445_636 | 63 |
| 716 | 3300035692 | Ga0373935_0062223 | Ga0373935_0062223_1137_1328 | 63 |
| 717 | 3300035692 | Ga0373935_0461452 | Ga0373935_0461452_574_765 | 63 |
| 718 | 3300035692 | Ga0373935_0869174 | Ga0373935_0869174_255_446 | 63 |
| 719 | 3300035695 | Ga0373927_0008181 | Ga0373927_0008181_3864_4055 | 63 |
| 720 | 3300035695 | Ga0373927_0444094 | Ga0373927_0444094_625_816 | 63 |
| 721 | 3300035695 | Ga0373927_1161960 | Ga0373927_1161960_55_246 | 63 |
| 722 | 3300035724 | Ga0373933_0009986 | Ga0373933_0009986_1087_1278 | 63 |
| 723 | 3300035724 | Ga0373933_0835692 | Ga0373933_0835692_396_587 | 63 |
| 724 | 3300035725 | Ga0373947_0015033 | Ga0373947_0015033_138_329 | 63 |
| 725 | 3300035725 | Ga0373947_0426491 | Ga0373947_0426491_598_789 | 63 |
| 726 | 3300035725 | Ga0373947_0547921 | Ga0373947_0547921_409_600 | 63 |
| 727 | 3300036401 | Ga0373937_0032065 | Ga0373937_0032065_559_750 | 63 |
| 728 | 3300036401 | Ga0373937_0486637 | Ga0373937_0486637_386_577 | 63 |
| 729 | 3300036647 | Ga0316582_0005132 | Ga0316582_0005132_3411_3608 | 63 |
| 730 | 3300036712 | Ga0316584_0107814 | Ga0316584_0107814_1306_1503 | 63 |
| 731 | 3300037068 | Ga0373925_0042552 | Ga0373925_0042552_1554_1745 | 63 |
| 732 | 3300037068 | Ga0373925_0435145 | Ga0373925_0435145_381_572 | 63 |
| 733 | 3300037068 | Ga0373925_0511106 | Ga0373925_0511106_67_258 | 63 |
| 734 | 3300037471 | Ga0395905_0883615 | Ga0395905_0883615_346_537 | 63 |
| 735 | 3300037471 | Ga0395905_1588208 | Ga0395905_1588208_65_256 | 63 |
| 736 | 3300037588 | Ga0316581_0004172 | Ga0316581_0004172_3351_3548 | 63 |
| 737 | 3300039437 | Ga0436365_0301302 | Ga0436365_0301302_123_314 | 63 |
| 738 | 3300039438 | Ga0436360_1277711 | Ga0436360_1277711_963_1154 | 63 |
| 739 | 3300041452 | Ga0451793_1552121 | Ga0451793_1552121_87_278 | 63 |
| 740 | 3300041511 | Ga0451855_0214715 | Ga0451855_0214715_624_815 | 63 |
| 741 | 3300042001 | Ga0439441_000373 | Ga0439441_000373_3849_4043 | 63 |
| 742 | 3300042001 | Ga0439441_006192 | Ga0439441_006192_838_1029 | 63 |
| 743 | 3300042001 | Ga0439441_048398 | Ga0439441_048398_547_738 | 63 |
| 744 | 3300042003 | Ga0439443_026787 | Ga0439443_026787_388_579 | 63 |
| 745 | 3300042008 | Ga0439450_074715 | Ga0439450_074715_342_533 | 63 |
| 746 | 3300042009 | Ga0439451_020599 | Ga0439451_020599_427_618 | 63 |
| 747 | 3300042015 | Ga0439462_0231930 | Ga0439462_0231930_148_339 | 63 |
| 748 | 3300042436 | Ga0439435_0000244 | Ga0439435_0000244_5176_5367 | 63 |
| 749 | 3300042436 | Ga0439435_0000802 | Ga0439435_0000802_3849_4043 | 63 |
| 750 | 3300042436 | Ga0439435_0066814 | Ga0439435_0066814_793_1020 | 63 |
| 751 | 3300042437 | Ga0439444_0000403 | Ga0439444_0000403_3277_3471 | 63 |
| 752 | 3300042437 | Ga0439444_0001242 | Ga0439444_0001242_2811_3002 | 63 |
| 753 | 3300042437 | Ga0439444_0191307 | Ga0439444_0191307_271_462 | 63 |
| 754 | 3300042461 | Ga0439460_0001871 | Ga0439460_0001871_963_1154 | 63 |
| 755 | 3300042532 | Ga0450893_0029174 | Ga0450893_0029174_626_817 | 63 |
| 756 | 3300042876 | Ga0451577_0828954 | Ga0451577_0828954_82_273 | 63 |
| 757 | 3300042876 | Ga0451577_2013956 | Ga0451577_2013956_195_386 | 63 |
| 758 | 3300044706 | Ga0466964_0210609 | Ga0466964_0210609_498_692 | 63 |
| 759 | 3300044901 | Ga0466960_0977279 | Ga0466960_0977279_87_278 | 63 |
| 760 | 3300045051 | Ga0451576_0041328 | Ga0451576_0041328_647_838 | 63 |
| 761 | 3300045051 | Ga0451576_0178889 | Ga0451576_0178889_1346_1537 | 63 |
| 762 | 3300045051 | Ga0451576_0276893 | Ga0451576_0276893_349_540 | 63 |
| 763 | 3300046454 | Ga0495592_0863280 | Ga0495592_0863280_234_425 | 63 |
| 764 | 3300046455 | Ga0495603_0070331 | Ga0495603_0070331_1607_1798 | 63 |
| 765 | 3300046459 | Ga0495629_0088991 | Ga0495629_0088991_1277_1477 | 63 |
| 766 | 3300046462 | Ga0495651_0161671 | Ga0495651_0161671_370_561 | 63 |
| 767 | 3300046463 | Ga0495653_0390478 | Ga0495653_0390478_10_201 | 63 |
| 768 | 3300046472 | Ga0495580_0036842 | Ga0495580_0036842_2345_2536 | 63 |
| 769 | 3300046472 | Ga0495580_0346732 | Ga0495580_0346732_173_364 | 63 |
| 770 | 3300046473 | Ga0495582_0018344 | Ga0495582_0018344_95_286 | 63 |
| 771 | 3300046475 | Ga0495639_0011815 | Ga0495639_0011815_648_839 | 63 |
| 772 | 3300046475 | Ga0495639_0478615 | Ga0495639_0478615_260_460 | 63 |
| 773 | 3300046476 | Ga0495662_0241369 | Ga0495662_0241369_387_587 | 63 |
| 774 | 3300046499 | Ga0495594_0294827 | Ga0495594_0294827_296_487 | 63 |
| 775 | 3300046516 | Ga0495628_0254377 | Ga0495628_0254377_607_807 | 63 |
| 776 | 3300046517 | Ga0495630_0085122 | Ga0495630_0085122_1694_1894 | 63 |
| 777 | 3300046517 | Ga0495630_0514800 | Ga0495630_0514800_436_627 | 63 |
| 778 | 3300046523 | Ga0495644_0357483 | Ga0495644_0357483_175_366 | 63 |
| 779 | 3300046525 | Ga0495663_0373144 | Ga0495663_0373144_44_235 | 63 |
| 780 | 3300046528 | Ga0495642_0031663 | Ga0495642_0031663_1352_1543 | 63 |
| 781 | 3300046528 | Ga0495642_0224820 | Ga0495642_0224820_456_650 | 63 |
| 782 | 3300046529 | Ga0495652_0142088 | Ga0495652_0142088_167_358 | 63 |
| 783 | 3300046529 | Ga0495652_0466951 | Ga0495652_0466951_29_220 | 63 |
| 784 | 3300046531 | Ga0495665_0153336 | Ga0495665_0153336_285_476 | 63 |
| 785 | 3300046531 | Ga0495665_0279099 | Ga0495665_0279099_155_355 | 63 |
| 786 | 3300046533 | Ga0495640_0185666 | Ga0495640_0185666_291_491 | 63 |
| 787 | 3300046535 | Ga0495586_0012798 | Ga0495586_0012798_3160_3351 | 63 |
| 788 | 3300046535 | Ga0495586_0415695 | Ga0495586_0415695_548_748 | 63 |
| 789 | 3300046537 | Ga0495598_0099675 | Ga0495598_0099675_380_571 | 63 |
| 790 | 3300046537 | Ga0495598_0312795 | Ga0495598_0312795_35_229 | 63 |
| 791 | 3300046539 | Ga0495621_0465641 | Ga0495621_0465641_327_518 | 63 |
| 792 | 3300046543 | Ga0495645_0605853 | Ga0495645_0605853_124_315 | 63 |
| 793 | 3300046559 | Ga0495667_0144445 | Ga0495667_0144445_603_794 | 63 |
| 794 | 3300046559 | Ga0495667_0249257 | Ga0495667_0249257_690_881 | 63 |
| 795 | 3300046615 | Ga0495656_0159494 | Ga0495656_0159494_765_956 | 63 |
| 796 | 3300046642 | Ga0495634_0230055 | Ga0495634_0230055_61_261 | 63 |
| 797 | 3300046663 | Ga0495635_0120013 | Ga0495635_0120013_1073_1264 | 63 |
| 798 | 3300046663 | Ga0495635_0873269 | Ga0495635_0873269_239_430 | 63 |
| 799 | 3300046664 | Ga0495659_0136821 | Ga0495659_0136821_420_611 | 63 |
| 800 | 3300046674 | Ga0495588_0176427 | Ga0495588_0176427_319_510 | 63 |
| 801 | 3300046675 | Ga0495657_0098049 | Ga0495657_0098049_399_590 | 63 |
| 802 | 3300046678 | Ga0495599_0107212 | Ga0495599_0107212_610_801 | 63 |
| 803 | 3300046681 | Ga0495647_0342503 | Ga0495647_0342503_393_584 | 63 |
| 804 | 3300046683 | Ga0495658_0006591 | Ga0495658_0006591_2648_2839 | 63 |
| 805 | 3300046684 | Ga0495669_0014591 | Ga0495669_0014591_256_447 | 63 |
| 806 | 3300046684 | Ga0495669_0562850 | Ga0495669_0562850_159_350 | 63 |
| 807 | 3300046690 | Ga0495624_0250837 | Ga0495624_0250837_263_463 | 63 |
| 808 | 3300046691 | Ga0495670_0321599 | Ga0495670_0321599_129_320 | 63 |
| 809 | 3300046809 | Ga0495600_0132846 | Ga0495600_0132846_358_549 | 63 |
| 810 | 3300046809 | Ga0495600_0379195 | Ga0495600_0379195_433_624 | 63 |
| 811 | 3300047315 | Ga0495581_0464384 | Ga0495581_0464384_478_678 | 63 |
| 812 | 3300047317 | Ga0495604_0208304 | Ga0495604_0208304_662_862 | 63 |
| 813 | 3300047318 | Ga0495636_0359066 | Ga0495636_0359066_430_621 | 63 |
| 814 | 3300047319 | Ga0495674_0072245 | Ga0495674_0072245_1995_2195 | 63 |
| 815 | 3300047319 | Ga0495674_1409804 | Ga0495674_1409804_14_205 | 63 |
| 816 | 3300047322 | Ga0495680_0020117 | Ga0495680_0020117_3022_3213 | 63 |
| 817 | 3300047445 | Ga0495677_0204707 | Ga0495677_0204707_306_497 | 63 |
| 818 | 3300047445 | Ga0495677_0371655 | Ga0495677_0371655_202_393 | 63 |
| 819 | 3300047471 | Ga0495684_0071170 | Ga0495684_0071170_2189_2380 | 63 |
| 820 | 3300047471 | Ga0495684_0540081 | Ga0495684_0540081_465_665 | 63 |
| 821 | 3300047673 | Ga0495593_0157612 | Ga0495593_0157612_260_451 | 63 |
| 822 | 3300048904 | Ga0496101_0850233 | Ga0496101_0850233_399_590 | 63 |
| 823 | 3300048917 | Ga0496114_0838062 | Ga0496114_0838062_248_439 | 63 |
| 824 | 3300049568 | Ga0501031_0354837 | Ga0501031_0354837_406_597 | 63 |
| 825 | 3300049568 | Ga0501031_0410465 | Ga0501031_0410465_537_728 | 63 |
| 826 | 3300049568 | Ga0501031_0592929 | Ga0501031_0592929_59_250 | 63 |
| 827 | 3300049570 | Ga0501033_0085137 | Ga0501033_0085137_11_202 | 63 |
| 828 | 3300049570 | Ga0501033_0352324 | Ga0501033_0352324_399_590 | 63 |
| 829 | 3300049570 | Ga0501033_0563576 | Ga0501033_0563576_27_218 | 63 |
| 830 | 3300049572 | Ga0501036_0166127 | Ga0501036_0166127_1346_1537 | 63 |
| 831 | 3300049572 | Ga0501036_0320712 | Ga0501036_0320712_71_262 | 63 |
| 832 | 3300049572 | Ga0501036_0383962 | Ga0501036_0383962_917_1111 | 63 |
| 833 | 3300049572 | Ga0501036_0981828 | Ga0501036_0981828_483_674 | 63 |
| 834 | 3300049572 | Ga0501036_1408520 | Ga0501036_1408520_44_235 | 63 |
| 835 | 3300049573 | Ga0501037_0397562 | Ga0501037_0397562_740_931 | 63 |
| 836 | 3300049574 | Ga0501038_0051781 | Ga0501038_0051781_1367_1558 | 63 |
| 837 | 3300049574 | Ga0501038_1101436 | Ga0501038_1101436_275_466 | 63 |
| 838 | 3300049574 | Ga0501038_1355395 | Ga0501038_1355395_17_208 | 63 |
| 839 | 3300049575 | Ga0501039_0030832 | Ga0501039_0030832_2090_2281 | 63 |
| 840 | 3300049575 | Ga0501039_0072656 | Ga0501039_0072656_286_477 | 63 |
| 841 | 3300049575 | Ga0501039_0148698 | Ga0501039_0148698_691_882 | 63 |
| 842 | 3300049575 | Ga0501039_0372960 | Ga0501039_0372960_360_551 | 63 |
| 843 | 3300049576 | Ga0501040_0005353 | Ga0501040_0005353_4776_4967 | 63 |
| 844 | 3300049576 | Ga0501040_0009124 | Ga0501040_0009124_6198_6389 | 63 |
| 845 | 3300049576 | Ga0501040_0045658 | Ga0501040_0045658_1930_2121 | 63 |
| 846 | 3300049576 | Ga0501040_0420810 | Ga0501040_0420810_490_681 | 63 |
| 847 | 3300049576 | Ga0501040_1295159 | Ga0501040_1295159_246_437 | 63 |
| 848 | 3300049577 | Ga0501041_0022456 | Ga0501041_0022456_2703_2894 | 63 |
| 849 | 3300049577 | Ga0501041_0024383 | Ga0501041_0024383_565_756 | 63 |
| 850 | 3300049577 | Ga0501041_0025733 | Ga0501041_0025733_2017_2208 | 63 |
| 851 | 3300049577 | Ga0501041_0186183 | Ga0501041_0186183_168_359 | 63 |
| 852 | 3300049577 | Ga0501041_0195319 | Ga0501041_0195319_32_223 | 63 |
| 853 | 3300049577 | Ga0501041_0437333 | Ga0501041_0437333_435_626 | 63 |
| 854 | 3300049577 | Ga0501041_1104931 | Ga0501041_1104931_225_416 | 63 |
| 855 | 3300049578 | Ga0501042_0023776 | Ga0501042_0023776_1807_1998 | 63 |
| 856 | 3300049578 | Ga0501042_0294664 | Ga0501042_0294664_209_400 | 63 |
| 857 | 3300049578 | Ga0501042_0382640 | Ga0501042_0382640_541_732 | 63 |
| 858 | 3300049578 | Ga0501042_1125266 | Ga0501042_1125266_357_548 | 63 |
| 859 | 3300049579 | Ga0501043_0141342 | Ga0501043_0141342_714_905 | 63 |
| 860 | 3300049579 | Ga0501043_1086691 | Ga0501043_1086691_355_546 | 63 |
| 861 | 3300049580 | Ga0501046_0050466 | Ga0501046_0050466_1294_1485 | 63 |
| 862 | 3300049580 | Ga0501046_0083967 | Ga0501046_0083967_468_659 | 63 |
| 863 | 3300049580 | Ga0501046_0151977 | Ga0501046_0151977_727_918 | 63 |
| 864 | 3300049580 | Ga0501046_1072919 | Ga0501046_1072919_312_503 | 63 |
| 865 | 3300049582 | Ga0501048_0011732 | Ga0501048_0011732_5098_5289 | 63 |
| 866 | 3300049582 | Ga0501048_0300665 | Ga0501048_0300665_732_923 | 63 |
| 867 | 3300049582 | Ga0501048_0484440 | Ga0501048_0484440_279_470 | 63 |
| 868 | 3300049582 | Ga0501048_1061073 | Ga0501048_1061073_222_413 | 63 |
| 869 | 3300049583 | Ga0501067_0395672 | Ga0501067_0395672_361_552 | 63 |
| 870 | 3300049584 | Ga0501068_0168606 | Ga0501068_0168606_211_402 | 63 |
| 871 | 3300049584 | Ga0501068_1206579 | Ga0501068_1206579_126_320 | 63 |
| 872 | 3300049585 | Ga0501069_0984083 | Ga0501069_0984083_162_353 | 63 |
| 873 | 3300049587 | Ga0501071_0075648 | Ga0501071_0075648_472_663 | 63 |
| 874 | 3300049587 | Ga0501071_0094598 | Ga0501071_0094598_1721_1912 | 63 |
| 875 | 3300049587 | Ga0501071_0717474 | Ga0501071_0717474_504_695 | 63 |
| 876 | 3300049587 | Ga0501071_0722109 | Ga0501071_0722109_476_667 | 63 |
| 877 | 3300049587 | Ga0501071_1388188 | Ga0501071_1388188_61_252 | 63 |
| 878 | 3300049588 | Ga0501072_0004517 | Ga0501072_0004517_9262_9453 | 63 |
| 879 | 3300049588 | Ga0501072_0088238 | Ga0501072_0088238_1114_1317 | 63 |
| 880 | 3300049588 | Ga0501072_0237773 | Ga0501072_0237773_398_589 | 63 |
| 881 | 3300049588 | Ga0501072_0286288 | Ga0501072_0286288_867_1058 | 63 |
| 882 | 3300049590 | Ga0501074_0382514 | Ga0501074_0382514_549_740 | 63 |
| 883 | 3300049590 | Ga0501074_1136978 | Ga0501074_1136978_275_466 | 63 |
| 884 | 3300049591 | Ga0501075_0010458 | Ga0501075_0010458_357_548 | 63 |
| 885 | 3300049591 | Ga0501075_0063617 | Ga0501075_0063617_515_706 | 63 |
| 886 | 3300049592 | Ga0501076_0000285 | Ga0501076_0000285_1959_2150 | 63 |
| 887 | 3300049741 | Ga0501079_0002449 | Ga0501079_0002449_2003_2194 | 63 |
| 888 | 3300049741 | Ga0501079_0141741 | Ga0501079_0141741_850_1041 | 63 |
| 889 | 3300049741 | Ga0501079_0371832 | Ga0501079_0371832_833_1024 | 63 |
| 890 | 3300049741 | Ga0501079_1439279 | Ga0501079_1439279_309_500 | 63 |
| 891 | 3300049742 | Ga0501080_1628257 | Ga0501080_1628257_161_352 | 63 |
| 892 | 3300049743 | Ga0501081_0028038 | Ga0501081_0028038_827_1018 | 63 |
| 893 | 3300049743 | Ga0501081_0039700 | Ga0501081_0039700_2631_2822 | 63 |
| 894 | 3300049743 | Ga0501081_0366773 | Ga0501081_0366773_785_976 | 63 |
| 895 | 3300049743 | Ga0501081_1308510 | Ga0501081_1308510_96_287 | 63 |
| 896 | 3300049822 | Ga0501035_0171240 | Ga0501035_0171240_239_430 | 63 |
| 897 | 3300049824 | Ga0501045_0020545 | Ga0501045_0020545_859_1050 | 63 |
| 898 | 3300049824 | Ga0501045_0067205 | Ga0501045_0067205_755_946 | 63 |
| 899 | 3300049824 | Ga0501045_0133444 | Ga0501045_0133444_787_978 | 63 |
| 900 | 3300049824 | Ga0501045_0195308 | Ga0501045_0195308_298_489 | 63 |
| 901 | 3300049824 | Ga0501045_0451688 | Ga0501045_0451688_563_757 | 63 |
| 902 | 3300049824 | Ga0501045_0714374 | Ga0501045_0714374_140_331 | 63 |
| 903 | 3300050489 | nmdc:mga03683_237294_c1 | nmdc:mga03683_237294_c1_298_489 | 63 |
| 904 | 3300050507 | nmdc:mga05p37_1126_c1 | nmdc:mga05p37_1126_c1_29618_29809 | 63 |
| 905 | 3300050507 | nmdc:mga05p37_1420047_c1 | nmdc:mga05p37_1420047_c1_342_533 | 63 |
| 906 | 3300050507 | nmdc:mga05p37_2024549_c1 | nmdc:mga05p37_2024549_c1_76_270 | 63 |
| 907 | 3300050507 | nmdc:mga05p37_257817_c1 | nmdc:mga05p37_257817_c1_1247_1441 | 63 |
| 908 | 3300050507 | nmdc:mga05p37_573091_c1 | nmdc:mga05p37_573091_c1_893_1087 | 63 |
| 909 | 3300050508 | nmdc:mga09592_1294054_c1 | nmdc:mga09592_1294054_c1_186_380 | 63 |
| 910 | 3300050508 | nmdc:mga09592_1655_c1 | nmdc:mga09592_1655_c1_2481_2672 | 63 |
| 911 | 3300050508 | nmdc:mga09592_254698_c1 | nmdc:mga09592_254698_c1_594_785 | 63 |
| 912 | 3300050508 | nmdc:mga09592_382050_c1 | nmdc:mga09592_382050_c1_600_794 | 63 |
| 913 | 3300050509 | nmdc:mga0qj67_1518541_c1 | nmdc:mga0qj67_1518541_c1_74_268 | 63 |
| 914 | 3300050509 | nmdc:mga0qj67_1548429_c1 | nmdc:mga0qj67_1548429_c1_81_272 | 63 |
| 915 | 3300050509 | nmdc:mga0qj67_648_c1 | nmdc:mga0qj67_648_c1_1137_1328 | 63 |
| 916 | 3300050510 | nmdc:mga06r32_1200468_c1 | nmdc:mga06r32_1200468_c1_135_326 | 63 |
| 917 | 3300050510 | nmdc:mga06r32_134302_c1 | nmdc:mga06r32_134302_c1_1459_1653 | 63 |
| 918 | 3300050510 | nmdc:mga06r32_490113_c1 | nmdc:mga06r32_490113_c1_487_678 | 63 |
| 919 | 3300050510 | nmdc:mga06r32_730038_c1 | nmdc:mga06r32_730038_c1_537_728 | 63 |
| 920 | 3300050510 | nmdc:mga06r32_877268_c1 | nmdc:mga06r32_877268_c1_285_479 | 63 |
| 921 | 3300050511 | nmdc:mga08y16_1331314_c1 | nmdc:mga08y16_1331314_c1_471_662 | 63 |
| 922 | 3300050511 | nmdc:mga08y16_4849_c1 | nmdc:mga08y16_4849_c1_4401_4592 | 63 |
| 923 | 3300050511 | nmdc:mga08y16_48972_c1 | nmdc:mga08y16_48972_c1_138_329 | 63 |
| 924 | 3300050511 | nmdc:mga08y16_54458_c1 | nmdc:mga08y16_54458_c1_2450_2641 | 63 |
| 925 | 3300050512 | nmdc:mga0n895_107701_c1 | nmdc:mga0n895_107701_c1_237_428 | 63 |
| 926 | 3300050512 | nmdc:mga0n895_1506760_c1 | nmdc:mga0n895_1506760_c1_30_221 | 63 |
| 927 | 3300050512 | nmdc:mga0n895_491896_c1 | nmdc:mga0n895_491896_c1_162_353 | 63 |
| 928 | 3300050512 | nmdc:mga0n895_754560_c1 | nmdc:mga0n895_754560_c1_538_729 | 63 |
| 929 | 3300050512 | nmdc:mga0n895_87725_c1 | nmdc:mga0n895_87725_c1_381_572 | 63 |
| 930 | 3300050512 | nmdc:mga0n895_914882_c1 | nmdc:mga0n895_914882_c1_21_215 | 63 |
| 931 | 3300050513 | nmdc:mga0rr50_1605105_c1 | nmdc:mga0rr50_1605105_c1_61_255 | 63 |
| 932 | 3300050513 | nmdc:mga0rr50_1816_c1 | nmdc:mga0rr50_1816_c1_10091_10282 | 63 |
| 933 | 3300050513 | nmdc:mga0rr50_217129_c1 | nmdc:mga0rr50_217129_c1_100_291 | 63 |
| 934 | 3300050513 | nmdc:mga0rr50_288186_c1 | nmdc:mga0rr50_288186_c1_844_1038 | 63 |
| 935 | 3300050513 | nmdc:mga0rr50_836208_c1 | nmdc:mga0rr50_836208_c1_582_773 | 63 |
| 936 | 3300050514 | nmdc:mga08x19_132992_c1 | nmdc:mga08x19_132992_c1_874_1068 | 63 |
| 937 | 3300050514 | nmdc:mga08x19_271649_c1 | nmdc:mga08x19_271649_c1_432_623 | 63 |
| 938 | 3300050514 | nmdc:mga08x19_31181_c1 | nmdc:mga08x19_31181_c1_3009_3203 | 63 |
| 939 | 3300050514 | nmdc:mga08x19_3563_c1 | nmdc:mga08x19_3563_c1_5357_5548 | 63 |
| 940 | 3300050514 | nmdc:mga08x19_41359_c1 | nmdc:mga08x19_41359_c1_2271_2462 | 63 |
| 941 | 3300050514 | nmdc:mga08x19_8158_c1 | nmdc:mga08x19_8158_c1_1233_1427 | 63 |
| 942 | 3300050514 | nmdc:mga08x19_932484_c1 | nmdc:mga08x19_932484_c1_400_594 | 63 |
| 943 | 3300050515 | nmdc:mga0a205_1274417_c1 | nmdc:mga0a205_1274417_c1_67_258 | 63 |
| 944 | 3300050515 | nmdc:mga0a205_156644_c1 | nmdc:mga0a205_156644_c1_47_238 | 63 |
| 945 | 3300050515 | nmdc:mga0a205_3207_c1 | nmdc:mga0a205_3207_c1_12440_12631 | 63 |
| 946 | 3300050515 | nmdc:mga0a205_624755_c1 | nmdc:mga0a205_624755_c1_229_429 | 63 |
| 947 | 3300053077 | Ga0495601_0393287 | Ga0495601_0393287_627_827 | 63 |
| 948 | 3300053078 | Ga0495612_0233774 | Ga0495612_0233774_148_348 | 63 |
| 949 | 3300054114 | Ga0501084_0035548 | Ga0501084_0035548_488_679 | 63 |
| 950 | 3300054114 | Ga0501084_0404933 | Ga0501084_0404933_91_282 | 63 |
| 951 | 3300059421 | Ga0590071_212572 | Ga0590071_212572_232_423 | 63 |
| 952 | 3300060353 | Ga0501082_0018673 | Ga0501082_0018673_3404_3595 | 63 |
| 953 | 3300060353 | Ga0501082_0364383 | Ga0501082_0364383_370_561 | 63 |
| 954 | 3300060353 | Ga0501082_1204234 | Ga0501082_1204234_306_497 | 63 |
| 955 | 3300061734 | Ga0530510_0000091 | Ga0530510_0000091_37395_37586 | 63 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgs-assembly1.cif.gz_B | crystal structure of arsenite oxidase from alcaligenes faecalis (af aio) bound to antimony oxyanion | 0.9514 | 13 | 41 |
| 1g8j-assembly1.cif.gz_B | crystal structure analysis of arsenite oxidase from alcaligenes faecalis | 0.9501 | 13 | 40 |
| 1g8k-assembly1.cif.gz_B | crystal structure analysis of arsenite oxidase from alcaligenes faecalis | 0.9487 | 13 | 41 |
| 2pk7-assembly1.cif.gz_B | crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 | 0.9157 | 8 | 59 |
| 2pk7-assembly1.cif.gz_A | crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 | 0.9088 | 8 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5U1Z8_55_112_2.20.25.10 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9844 | 12 | 56 | 2.20.25.10 |
| 2hf1B01 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.949 | 12 | 59 | 2.20.25.10 |
| 1g8kF00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9465 | 13 | 40 | 2.102.10.10 |
| af_Q8LG27_23_76_2.20.25.10 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9434 | 12 | 59 | 2.20.25.10 |
| af_O33186_9_68_2.20.25.10 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9149 | 12 | 58 | 2.20.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1R4I215-F1-model_v4 | UPF0434 protein CZ787_11875 | 1.001 | 12 | 58 |
GO:0005829
|
| AF-A0A521GYE5-F1-model_v4 | UPF0434 protein EYC62_03595 | 0.9984 | 3 | 56 |
GO:0005829
|
| AF-A0A2A5BFY4-F1-model_v4 | UPF0434 protein COA93_12405 | 0.9977 | 3 | 57 |
GO:0005829
|
| AF-A0A2E7PIZ8-F1-model_v4 | UPF0434 protein CMM26_04985 | 0.9976 | 3 | 56 |
GO:0005829
|
| AF-A0A7Z9K2R0-F1-model_v4 | UPF0434 protein EYO23_09205 | 0.9961 | 5 | 58 |
GO:0005829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar