F486722

General Info

Members Datasets Scaffolds Average Seq Length
955 382 955 62

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0066814|Ga0439435_0066814_793_1020
Length 75
Sequence MPLLVRGSWENSMSAVDPRLLEILVCPLCKGKLVYRKPAAELVCKADRLAYPVKDGIPVMLEDEARKLPPEEEVV

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
192 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
193 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
236 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
240 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
241 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
242 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
243 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
244 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
245 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
246 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
247 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
252 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
255 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
256 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.94
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1031541 3300002073 Bacteria 640
2 JGI24742J22300_10057076 3300002244 Bacteria 714
3 Ga0065712_10248395 3300005290 Bacteria 966
4 Ga0065715_10422296 3300005293 Bacteria 856
5 Ga0065707_10739179 3300005295 Bacteria 623
6 Ga0070676_10089431 3300005328 Bacteria 1884
7 Ga0070683_101879960 3300005329 Bacteria 575
8 Ga0070690_100000172 3300005330 Bacteria 33180
9 Ga0070690_100000525 3300005330 Bacteria 19252
10 Ga0070690_101481321 3300005330 Bacteria 548
11 Ga0068869_100004583 3300005334 Bacteria 8612
12 Ga0068869_100009815 3300005334 Bacteria 6218
13 Ga0068869_100075172 3300005334 Bacteria 2509
14 Ga0068869_101525096 3300005334 Bacteria 594
15 Ga0070666_10169576 3300005335 Bacteria 1528
16 Ga0070680_100000230 3300005336 Bacteria 36894
17 Ga0070680_100062718 3300005336 Bacteria 3044
18 Ga0070680_100577203 3300005336 Bacteria 964
19 Ga0070682_100026535 3300005337 Bacteria 3469
20 Ga0068868_100001075 3300005338 Bacteria 18741
21 Ga0070689_100000288 3300005340 Bacteria 29270
22 Ga0070689_100001034 3300005340 Bacteria 17460
23 Ga0070689_100030972 3300005340 Bacteria 4063
24 Ga0070689_100102156 3300005340 Bacteria 2271
25 Ga0070689_100270512 3300005340 Bacteria 1407
26 Ga0070691_10000935 3300005341 Bacteria 11861
27 Ga0070691_10013263 3300005341 Bacteria 3775
28 Ga0070687_100000141 3300005343 Bacteria 25042
29 Ga0070687_100270003 3300005343 Bacteria 1066
30 Ga0070687_100767646 3300005343 Bacteria 680
31 Ga0070661_100937074 3300005344 Bacteria 716
32 Ga0070692_10002703 3300005345 Bacteria 6951
33 Ga0070692_10034765 3300005345 Bacteria 2548
34 Ga0070692_10086335 3300005345 Bacteria 1698
35 Ga0070692_11167486 3300005345 Bacteria 547
36 Ga0070669_100410539 3300005353 Bacteria 1110
37 Ga0070669_100844585 3300005353 Bacteria 780
38 Ga0070671_100978099 3300005355 Bacteria 741
39 Ga0070671_101093023 3300005355 Bacteria 700
40 Ga0070674_100264274 3300005356 Bacteria 1357
41 Ga0070673_100408725 3300005364 Bacteria 1215
42 Ga0070688_100094524 3300005365 Bacteria 1960
43 Ga0070688_100144227 3300005365 Bacteria 1621
44 Ga0070688_101078215 3300005365 Bacteria 641
45 Ga0070688_101670264 3300005365 Bacteria 521
46 Ga0070703_10004405 3300005406 Bacteria 3962
47 Ga0070703_10523304 3300005406 Bacteria 537
48 Ga0070709_10648673 3300005434 Bacteria 817
49 Ga0070709_10870496 3300005434 Bacteria 711
50 Ga0070713_101165032 3300005436 Bacteria 746
51 Ga0070713_101707603 3300005436 Unclassified 611
52 Ga0070710_10025335 3300005437 Bacteria 3141
53 Ga0070710_10551529 3300005437 Bacteria 796
54 Ga0070710_10717286 3300005437 Bacteria 707
55 Ga0070710_10760521 3300005437 Bacteria 689
56 Ga0070701_10004016 3300005438 Bacteria 5896
57 Ga0070701_10043338 3300005438 Bacteria 2301
58 Ga0070701_10195837 3300005438 Bacteria 1191
59 Ga0070701_10526600 3300005438 Bacteria 771
60 Ga0070701_11332969 3300005438 Bacteria 514
61 Ga0070705_100001001 3300005440 Bacteria 15736
62 Ga0070705_100006101 3300005440 Bacteria 5899
63 Ga0070705_100024264 3300005440 Bacteria 3271
64 Ga0070705_100201953 3300005440 Bacteria 1363
65 Ga0070705_100226425 3300005440 Bacteria 1298
66 Ga0070705_100554213 3300005440 Bacteria 882
67 Ga0070705_100760892 3300005440 Bacteria 767
68 Ga0070705_100980900 3300005440 Bacteria 685
69 Ga0070700_100000241 3300005441 Bacteria 30113
70 Ga0070700_100000591 3300005441 Bacteria 18135
71 Ga0070700_100821890 3300005441 Bacteria 750
72 Ga0070700_101195529 3300005441 Bacteria 635
73 Ga0070700_101236123 3300005441 Bacteria 625
74 Ga0070694_100001923 3300005444 Bacteria 12299
75 Ga0070694_100040371 3300005444 Bacteria 3111
76 Ga0070694_100048516 3300005444 Bacteria 2857
77 Ga0070694_100108029 3300005444 Bacteria 1978
78 Ga0070694_100163989 3300005444 Bacteria 1633
79 Ga0070694_100234204 3300005444 Bacteria 1383
80 Ga0070694_100235915 3300005444 Bacteria 1378
81 Ga0070694_101373747 3300005444 Bacteria 595
82 Ga0070708_100428923 3300005445 Bacteria 1247
83 Ga0070678_100314014 3300005456 Bacteria 1336
84 Ga0070678_100420398 3300005456 Bacteria 1165
85 Ga0070662_101274901 3300005457 Bacteria 632
86 Ga0070681_10002547 3300005458 Bacteria 16723
87 Ga0070681_10073138 3300005458 Bacteria 3390
88 Ga0070681_10796294 3300005458 Bacteria 862
89 Ga0068867_100000487 3300005459 Bacteria 26508
90 Ga0068867_100011581 3300005459 Bacteria 6226
91 Ga0070685_11163709 3300005466 Bacteria 585
92 Ga0070706_100152546 3300005467 Bacteria 2157
93 Ga0070698_101224571 3300005471 Bacteria 700
94 Ga0070699_100093440 3300005518 Bacteria 2632
95 Ga0070699_101021991 3300005518 Bacteria 758
96 Ga0070679_100002377 3300005530 Bacteria 17058
97 Ga0070679_100022031 3300005530 Bacteria 6225
98 Ga0070679_101651013 3300005530 Bacteria 589
99 Ga0070679_101940598 3300005530 Bacteria 538
100 Ga0070684_100936328 3300005535 Bacteria 812
101 Ga0070684_101073665 3300005535 Bacteria 756
102 Ga0070697_100001057 3300005536 Bacteria 20812
103 Ga0070697_100004435 3300005536 Bacteria 10779
104 Ga0070697_100310424 3300005536 Bacteria 1357
105 Ga0070697_100869690 3300005536 Bacteria 799
106 Ga0070697_101067084 3300005536 Bacteria 719
107 Ga0070697_102100337 3300005536 Bacteria 506
108 Ga0070686_100000527 3300005544 Bacteria 22925
109 Ga0070686_100006108 3300005544 Bacteria 6688
110 Ga0070686_100117866 3300005544 Bacteria 1819
111 Ga0070695_100000298 3300005545 Bacteria 25019
112 Ga0070695_100000498 3300005545 Bacteria 20517
113 Ga0070695_100352582 3300005545 Bacteria 1103
114 Ga0070695_100482188 3300005545 Bacteria 956
115 Ga0070695_100666429 3300005545 Bacteria 823
116 Ga0070695_101360760 3300005545 Bacteria 588
117 Ga0070696_100000061 3300005546 Bacteria 52371
118 Ga0070696_100002472 3300005546 Bacteria 12245
119 Ga0070696_100008068 3300005546 Bacteria 7037
120 Ga0070696_100032452 3300005546 Bacteria 3583
121 Ga0070696_100081100 3300005546 Bacteria 2298
122 Ga0070696_100269062 3300005546 Bacteria 1295
123 Ga0070696_101200717 3300005546 Bacteria 641
124 Ga0070696_101275852 3300005546 Bacteria 623
125 Ga0070696_101430200 3300005546 Bacteria 590
126 Ga0070693_100000016 3300005547 Bacteria 63019
127 Ga0070693_100149468 3300005547 Bacteria 1478
128 Ga0070693_100981859 3300005547 Bacteria 638
129 Ga0070693_101142245 3300005547 Bacteria 596
130 Ga0070693_101532506 3300005547 Bacteria 522
131 Ga0070704_100000246 3300005549 Bacteria 23326
132 Ga0070704_100014320 3300005549 Bacteria 4952
133 Ga0070704_100386245 3300005549 Bacteria 1191
134 Ga0070704_100498078 3300005549 Bacteria 1057
135 Ga0070704_100758248 3300005549 Bacteria 864
136 Ga0070704_100783944 3300005549 Bacteria 851
137 Ga0068855_100000975 3300005563 Bacteria 35626
138 Ga0068857_101464189 3300005577 Bacteria 665
139 Ga0068854_100000366 3300005578 Bacteria 28906
140 Ga0068854_100345651 3300005578 Bacteria 1216
141 Ga0068854_101262291 3300005578 Bacteria 664
142 Ga0068856_100497566 3300005614 Bacteria 1240
143 Ga0070702_100000485 3300005615 Bacteria 14291
144 Ga0070702_100074788 3300005615 Bacteria 2011
145 Ga0070702_100288871 3300005615 Bacteria 1129
146 Ga0068852_100314752 3300005616 Bacteria 1518
147 Ga0068859_100001619 3300005617 Bacteria 23020
148 Ga0068859_100014820 3300005617 Bacteria 7829
149 Ga0068859_102524061 3300005617 Bacteria 566
150 Ga0068864_100015369 3300005618 Bacteria 6364
151 Ga0068864_100725880 3300005618 Bacteria 972
152 Ga0068866_10000176 3300005718 Bacteria 29873
153 Ga0068866_10000528 3300005718 Bacteria 17593
154 Ga0068861_100000423 3300005719 Bacteria 24534
155 Ga0068861_100001699 3300005719 Bacteria 14134
156 Ga0068861_100130189 3300005719 Bacteria 2042
157 Ga0068861_101963443 3300005719 Bacteria 583
158 Ga0068870_10178339 3300005840 Bacteria 1273
159 Ga0068870_10201290 3300005840 Bacteria 1208
160 Ga0068870_10283346 3300005840 Bacteria 1040
161 Ga0068863_100812686 3300005841 Bacteria 933
162 Ga0068863_100854926 3300005841 Bacteria 909
163 Ga0068858_100000619 3300005842 Bacteria 37094
164 Ga0068858_100005846 3300005842 Bacteria 12017
165 Ga0068860_100002570 3300005843 Bacteria 18998
166 Ga0068860_100030340 3300005843 Bacteria 5201
167 Ga0068862_100003412 3300005844 Bacteria 13698
168 Ga0068862_100017845 3300005844 Bacteria 5908
169 Ga0068862_101293506 3300005844 Unclassified 730
170 Ga0081539_10001364 3300005985 Bacteria 42295
171 Ga0070715_10468134 3300006163 Bacteria 715
172 Ga0070716_100032456 3300006173 Bacteria 2848
173 Ga0070712_101997504 3300006175 Bacteria 508
174 Ga0075366_10832887 3300006195 Bacteria 574
175 Ga0097621_100001153 3300006237 Bacteria 18360
176 Ga0097621_100001255 3300006237 Bacteria 17539
177 Ga0097621_101002611 3300006237 Bacteria 781
178 Ga0068871_100003554 3300006358 Bacteria 10726
179 Ga0068871_100189883 3300006358 Bacteria 1769
180 Ga0075428_100000532 3300006844 Bacteria 38828
181 Ga0075428_100001527 3300006844 Bacteria 24754
182 Ga0075428_100044919 3300006844 Bacteria 4855
183 Ga0075428_100233663 3300006844 Bacteria 1984
184 Ga0075428_100589625 3300006844 Bacteria 1187
185 Ga0075428_102460801 3300006844 Unclassified 534
186 Ga0075430_100001203 3300006846 Bacteria 20788
187 Ga0075430_100012906 3300006846 Bacteria 7120
188 Ga0075430_100452115 3300006846 Bacteria 1060
189 Ga0075431_100006916 3300006847 Bacteria 11276
190 Ga0075431_100034541 3300006847 Bacteria 5209
191 Ga0075431_100182411 3300006847 Bacteria 2154
192 Ga0075431_100210289 3300006847 Bacteria 1987
193 Ga0075431_100423176 3300006847 Bacteria 1331
194 Ga0075431_100911482 3300006847 Bacteria 848
195 Ga0075433_10059938 3300006852 Bacteria 3331
196 Ga0075433_10969767 3300006852 Bacteria 741
197 Ga0075433_11501679 3300006852 Bacteria 582
198 Ga0075433_11670364 3300006852 Bacteria 549
199 Ga0075434_100011723 3300006871 Bacteria 8279
200 Ga0075434_100069507 3300006871 Bacteria 3511
201 Ga0075434_100867554 3300006871 Bacteria 918
202 Ga0075434_101003556 3300006871 Bacteria 849
203 Ga0075434_101247897 3300006871 Bacteria 755
204 Ga0075434_102226237 3300006871 Bacteria 552
205 Ga0075429_100000324 3300006880 Bacteria 34389
206 Ga0075429_100007581 3300006880 Bacteria 9425
207 Ga0075429_100111915 3300006880 Bacteria 2386
208 Ga0075429_100154145 3300006880 Bacteria 2012
209 Ga0075429_100276506 3300006880 Bacteria 1470
210 Ga0075429_100282434 3300006880 Bacteria 1454
211 Ga0075429_100691106 3300006880 Bacteria 894
212 Ga0075429_101847963 3300006880 Bacteria 524
213 Ga0068865_100000262 3300006881 Bacteria 28966
214 Ga0068865_100000385 3300006881 Bacteria 24479
215 Ga0075436_100027479 3300006914 Bacteria 3916
216 Ga0075436_100067227 3300006914 Bacteria 2477
217 Ga0075436_100074204 3300006914 Bacteria 2355
218 Ga0075436_100188264 3300006914 Bacteria 1460
219 Ga0075436_100686426 3300006914 Bacteria 758
220 Ga0075436_101029358 3300006914 Bacteria 618
221 Ga0075436_101330338 3300006914 Bacteria 544
222 Ga0097620_100001619 3300006931 Bacteria 23020
223 Ga0097620_100014822 3300006931 Bacteria 7829
224 Ga0097620_102524397 3300006931 Bacteria 566
225 Ga0075435_100000887 3300007076 Bacteria 18792
226 Ga0075435_100207814 3300007076 Bacteria 1660
227 Ga0075435_100351811 3300007076 Bacteria 1263
228 Ga0075435_100861506 3300007076 Bacteria 790
229 Ga0075435_101387526 3300007076 Bacteria 616
230 Ga0099794_10010376 3300007265 Bacteria 3954
231 Ga0099794_10042383 3300007265 Bacteria 2170
232 Ga0099794_10093204 3300007265 Bacteria 1497
233 Ga0099794_10407602 3300007265 Bacteria 710
234 Ga0099795_10060495 3300007788 Bacteria 1404
235 Ga0105250_10033278 3300009092 Bacteria 2069
236 Ga0105240_10393433 3300009093 Bacteria 1563
237 Ga0105240_12347077 3300009093 Bacteria 552
238 Ga0111539_10006721 3300009094 Bacteria 14808
239 Ga0111539_10019692 3300009094 Bacteria 8323
240 Ga0111539_10080009 3300009094 Bacteria 3844
241 Ga0111539_10086922 3300009094 Bacteria 3674
242 Ga0111539_11142438 3300009094 Bacteria 905
243 Ga0111539_11707936 3300009094 Bacteria 730
244 Ga0111539_13061241 3300009094 Bacteria 540
245 Ga0105245_10000178 3300009098 Bacteria 60846
246 Ga0105245_10000515 3300009098 Bacteria 35472
247 Ga0114129_10014186 3300009147 Bacteria 11354
248 Ga0114129_10178816 3300009147 Bacteria 2888
249 Ga0114129_10602307 3300009147 Bacteria 1423
250 Ga0114129_10877299 3300009147 Bacteria 1138
251 Ga0114129_11000204 3300009147 Bacteria 1053
252 Ga0114129_13142443 3300009147 Bacteria 539
253 Ga0105243_10000270 3300009148 Bacteria 58296
254 Ga0105243_10006067 3300009148 Bacteria 9343
255 Ga0105241_10087687 3300009174 Bacteria 2450
256 Ga0105241_12191693 3300009174 Bacteria 548
257 Ga0105242_10000409 3300009176 Bacteria 34163
258 Ga0105242_10001066 3300009176 Bacteria 21546
259 Ga0105248_10266766 3300009177 Bacteria 1927
260 Ga0105248_10319008 3300009177 Bacteria 1750
261 Ga0105248_10665880 3300009177 Bacteria 1174
262 Ga0105248_13057425 3300009177 Bacteria 533
263 Ga0105237_12105200 3300009545 Unclassified 573
264 Ga0105237_12435979 3300009545 Bacteria 534
265 Ga0105238_12749690 3300009551 Bacteria 528
266 Ga0105249_10012264 3300009553 Bacteria 7552
267 Ga0105249_10031943 3300009553 Bacteria 4763
268 Ga0105249_12616062 3300009553 Unclassified 577
269 Ga0099796_10382424 3300010159 Bacteria 613
270 Ga0105239_10992784 3300010375 Bacteria 965
271 Ga0105239_11021185 3300010375 Bacteria 951
272 Ga0105246_10449128 3300011119 Bacteria 1083
273 Ga0105246_11145808 3300011119 Bacteria 713
274 Ga0157327_1073375 3300012512 Bacteria 536
275 Ga0157369_10495602 3300013105 Bacteria 1264
276 Ga0157369_12101250 3300013105 Unclassified 573
277 Ga0157374_10000104 3300013296 Bacteria 78523
278 Ga0157378_10000340 3300013297 Bacteria 46001
279 Ga0157378_10000746 3300013297 Bacteria 30487
280 Ga0157378_10973027 3300013297 Bacteria 882
281 Ga0163162_10997548 3300013306 Bacteria 947
282 Ga0163162_11663976 3300013306 Bacteria 728
283 Ga0163162_11774116 3300013306 Bacteria 705
284 Ga0163162_12670458 3300013306 Bacteria 575
285 Ga0157372_10457782 3300013307 Bacteria 1487
286 Ga0157372_10654974 3300013307 Bacteria 1223
287 Ga0157375_10300376 3300013308 Bacteria 1769
288 Ga0157375_12315930 3300013308 Bacteria 640
289 Ga0157375_12625771 3300013308 Bacteria 602
290 Ga0157380_10009920 3300014326 Bacteria 6836
291 Ga0157380_10015130 3300014326 Bacteria 5662
292 Ga0157380_10387978 3300014326 Bacteria 1320
293 Ga0157380_12480175 3300014326 Bacteria 584
294 Ga0157380_12923155 3300014326 Unclassified 544
295 Ga0157377_10033972 3300014745 Bacteria 2788
296 Ga0157379_10136925 3300014968 Bacteria 2206
297 Ga0157379_11809351 3300014968 Unclassified 600
298 Ga0157376_10008044 3300014969 Bacteria 7574
299 Ga0163161_10704586 3300017792 Bacteria 841
300 Ga0213871_10261613 3300021441 Bacteria 551
301 Ga0207696_1164737 3300025711 Bacteria 589
302 Ga0207653_10007033 3300025885 Bacteria 3513
303 Ga0207692_10169754 3300025898 Bacteria 1263
304 Ga0207692_10200537 3300025898 Bacteria 1173
305 Ga0207692_11093516 3300025898 Bacteria 528
306 Ga0207642_10002060 3300025899 Bacteria 6206
307 Ga0207688_10199128 3300025901 Bacteria 1200
308 Ga0207688_10428585 3300025901 Bacteria 823
309 Ga0207680_10410608 3300025903 Bacteria 958
310 Ga0207647_10277986 3300025904 Bacteria 956
311 Ga0207685_10040579 3300025905 Bacteria 1735
312 Ga0207685_10118032 3300025905 Bacteria 1160
313 Ga0207685_10610367 3300025905 Bacteria 586
314 Ga0207699_10430940 3300025906 Bacteria 943
315 Ga0207643_10029146 3300025908 Bacteria 3070
316 Ga0207643_10430303 3300025908 Bacteria 837
317 Ga0207684_11534192 3300025910 Bacteria 541
318 Ga0207654_10421479 3300025911 Bacteria 931
319 Ga0207707_10005405 3300025912 Bacteria 11169
320 Ga0207695_10428229 3300025913 Bacteria 1207
321 Ga0207663_10630391 3300025916 Bacteria 845
322 Ga0207663_11663604 3300025916 Bacteria 514
323 Ga0207660_10002634 3300025917 Bacteria 11770
324 Ga0207660_10059649 3300025917 Bacteria 2740
325 Ga0207660_10743023 3300025917 Bacteria 801
326 Ga0207662_10000047 3300025918 Bacteria 52763
327 Ga0207662_10039411 3300025918 Bacteria 2772
328 Ga0207662_10194985 3300025918 Bacteria 1308
329 Ga0207652_10015482 3300025921 Bacteria 6200
330 Ga0207652_10027972 3300025921 Bacteria 4702
331 Ga0207646_10170746 3300025922 Bacteria 1964
332 Ga0207646_10515524 3300025922 Bacteria 1076
333 Ga0207681_10107719 3300025923 Bacteria 2022
334 Ga0207687_10001597 3300025927 Bacteria 15607
335 Ga0207700_11356640 3300025928 Unclassified 633
336 Ga0207700_11886261 3300025928 Bacteria 524
337 Ga0207664_10080713 3300025929 Bacteria 2645
338 Ga0207644_10762143 3300025931 Bacteria 809
339 Ga0207706_10819868 3300025933 Bacteria 789
340 Ga0207686_10000446 3300025934 Bacteria 27472
341 Ga0207686_10976435 3300025934 Bacteria 686
342 Ga0207709_10002410 3300025935 Bacteria 11759
343 Ga0207670_10000462 3300025936 Bacteria 22646
344 Ga0207670_11492561 3300025936 Bacteria 574
345 Ga0207704_10000290 3300025938 Bacteria 23770
346 Ga0207665_10066961 3300025939 Bacteria 2445
347 Ga0207665_10101182 3300025939 Bacteria 2012
348 Ga0207665_10895308 3300025939 Bacteria 704
349 Ga0207691_10687266 3300025940 Unclassified 863
350 Ga0207711_10524885 3300025941 Bacteria 1104
351 Ga0207711_10542996 3300025941 Bacteria 1084
352 Ga0207689_10000148 3300025942 Bacteria 60276
353 Ga0207689_10719676 3300025942 Bacteria 842
354 Ga0207667_10004155 3300025949 Bacteria 17792
355 Ga0207651_10448678 3300025960 Bacteria 1106
356 Ga0207651_12011099 3300025960 Bacteria 519
357 Ga0207712_10012530 3300025961 Bacteria 5418
358 Ga0207640_10005645 3300025981 Bacteria 6822
359 Ga0207677_10002010 3300026023 Bacteria 10724
360 Ga0207677_12143414 3300026023 Bacteria 520
361 Ga0207703_10001208 3300026035 Bacteria 24188
362 Ga0207639_10360987 3300026041 Bacteria 1300
363 Ga0207708_10000676 3300026075 Bacteria 26062
364 Ga0207708_10452827 3300026075 Bacteria 1069
365 Ga0207708_11167397 3300026075 Bacteria 673
366 Ga0207702_10076459 3300026078 Bacteria 2894
367 Ga0207702_11999002 3300026078 Unclassified 570
368 Ga0207641_10294804 3300026088 Bacteria 1530
369 Ga0207641_11083642 3300026088 Bacteria 799
370 Ga0207648_10000018 3300026089 Bacteria 148157
371 Ga0207676_10490959 3300026095 Bacteria 1164
372 Ga0207674_10549673 3300026116 Bacteria 1115
373 Ga0207675_100000170 3300026118 Bacteria 58303
374 Ga0207675_101224058 3300026118 Bacteria 771
375 Ga0207698_10098960 3300026142 Bacteria 2411
376 Ga0209969_1018522 3300027360 Bacteria 1029
377 Ga0209967_1025342 3300027364 Bacteria 878
378 Ga0209981_1008520 3300027378 Bacteria 1394
379 Ga0209996_1047224 3300027395 Bacteria 648
380 Ga0209984_1070459 3300027424 Bacteria 522
381 Ga0210000_1000974 3300027462 Bacteria 4006
382 Ga0210000_1007252 3300027462 Bacteria 1621
383 Ga0210000_1015320 3300027462 Bacteria 1154
384 Ga0209995_1050754 3300027471 Bacteria 704
385 Ga0209968_1005686 3300027526 Bacteria 1872
386 Ga0209968_1038970 3300027526 Bacteria 809
387 Ga0209968_1099133 3300027526 Bacteria 531
388 Ga0209999_1011110 3300027543 Bacteria 1628
389 Ga0209999_1012664 3300027543 Bacteria 1529
390 Ga0209970_1061591 3300027614 Bacteria 689
391 Ga0209983_1052966 3300027665 Bacteria 889
392 Ga0209983_1058729 3300027665 Bacteria 848
393 Ga0209588_1052779 3300027671 Bacteria 1315
394 Ga0209971_1002798 3300027682 Bacteria 4168
395 Ga0209971_1030717 3300027682 Bacteria 1287
396 Ga0209966_1002048 3300027695 Bacteria 3365
397 Ga0209998_10023646 3300027717 Bacteria 1330
398 Ga0209998_10129134 3300027717 Bacteria 641
399 Ga0209974_10090429 3300027876 Bacteria 1061
400 Ga0207428_10000835 3300027907 Bacteria 34652
401 Ga0207428_10963435 3300027907 Bacteria 601
402 Ga0268265_10001514 3300028380 Bacteria 19411
403 Ga0268265_10345993 3300028380 Bacteria 1356
404 Ga0268265_11860337 3300028380 Bacteria 609
405 Ga0268264_10001414 3300028381 Bacteria 22435
406 Ga0268264_10292650 3300028381 Bacteria 1530
407 Ga0268264_12011008 3300028381 Bacteria 587
408 Ga0268264_12487117 3300028381 Bacteria 523
409 Ga0307408_100166145 3300031548 Bacteria 1758
410 Ga0307408_100220521 3300031548 Bacteria 1547
411 Ga0307408_100318043 3300031548 Bacteria 1310
412 Ga0307408_100428070 3300031548 Bacteria 1143
413 Ga0307408_100668803 3300031548 Bacteria 930
414 Ga0316575_10083667 3300031665 Bacteria 1288
415 Ga0316579_10001744 3300031691 Bacteria 7995
416 Ga0316579_10050697 3300031691 Bacteria 1941
417 Ga0316576_10580389 3300031727 Bacteria 819
418 Ga0316578_10236666 3300031728 Bacteria 1096
419 Ga0316578_10240239 3300031728 Bacteria 1087
420 Ga0307405_10316537 3300031731 Bacteria 1190
421 Ga0307405_10367349 3300031731 Bacteria 1116
422 Ga0307405_10682704 3300031731 Bacteria 848
423 Ga0307405_10775875 3300031731 Bacteria 801
424 Ga0307405_11352031 3300031731 Bacteria 621
425 Ga0307413_11442274 3300031824 Bacteria 607
426 Ga0307406_11556118 3300031901 Bacteria 583
427 Ga0307406_11720110 3300031901 Bacteria 556
428 Ga0307407_11558851 3300031903 Bacteria 523
429 Ga0307412_10136384 3300031911 Bacteria 1791
430 Ga0307412_11185843 3300031911 Bacteria 683
431 Ga0307409_100353208 3300031995 Bacteria 1388
432 Ga0307409_101530511 3300031995 Bacteria 695
433 Ga0307409_102682971 3300031995 Bacteria 526
434 Ga0307416_100162947 3300032002 Bacteria 2064
435 Ga0307416_100296502 3300032002 Bacteria 1604
436 Ga0307416_101210470 3300032002 Bacteria 861
437 Ga0307416_101795864 3300032002 Bacteria 717
438 Ga0307416_101861216 3300032002 Bacteria 705
439 Ga0307416_102224058 3300032002 Bacteria 649
440 Ga0307416_102566382 3300032002 Bacteria 608
441 Ga0307416_103002130 3300032002 Bacteria 564
442 Ga0307416_103098345 3300032002 Bacteria 556
443 Ga0307411_10791963 3300032005 Bacteria 834
444 Ga0307411_11513296 3300032005 Bacteria 617
445 Ga0307411_12057127 3300032005 Bacteria 534
446 Ga0316583_10000604 3300032133 Bacteria 10925
447 Ga0316580_10035005 3300032139 Bacteria 1554
448 Ga0316580_10047105 3300032139 Bacteria 1329
449 Ga0316593_10221454 3300032168 Bacteria 703
450 Ga0316592_1156036 3300033524 Bacteria 540
451 Ga0316596_1001064 3300033541 Bacteria 5326
452 Ga0373930_0108413 3300034816 Bacteria 666
453 Ga0373948_0065305 3300034817 Bacteria 806
454 Ga0373950_0067147 3300034818 Bacteria 729
455 Ga0373950_0131504 3300034818 Unclassified 561
456 Ga0373958_0012755 3300034819 Bacteria 1443
457 Ga0373958_0185747 3300034819 Bacteria 538
458 Ga0373959_0144219 3300034820 Bacteria 598
459 Ga0373926_0011387 3300035083 Bacteria 2992
460 Ga0373926_0019898 3300035083 Bacteria 2316
461 Ga0373926_0055845 3300035083 Bacteria 1432
462 Ga0373926_0199620 3300035083 Bacteria 769
463 Ga0373928_0064479 3300035084 Bacteria 893
464 Ga0373928_0096512 3300035084 Bacteria 765
465 Ga0373929_0009025 3300035085 Bacteria 1843
466 Ga0373929_0057483 3300035085 Bacteria 903
467 Ga0373934_0002385 3300035086 Bacteria 6916
468 Ga0373934_0032500 3300035086 Bacteria 2046
469 Ga0373934_0458947 3300035086 Bacteria 534
470 Ga0373940_0004143 3300035088 Bacteria 3039
471 Ga0373940_0087995 3300035088 Bacteria 927
472 Ga0373944_0156253 3300035089 Bacteria 806
473 Ga0373949_0015962 3300035090 Bacteria 1681
474 Ga0373949_0097427 3300035090 Bacteria 802
475 Ga0373951_0091522 3300035091 Bacteria 799
476 Ga0373952_0070289 3300035092 Bacteria 874
477 Ga0373952_0114563 3300035092 Bacteria 725
478 Ga0373923_0016921 3300035111 Bacteria 2780
479 Ga0373923_0145426 3300035111 Bacteria 1073
480 Ga0373923_0221620 3300035111 Bacteria 879
481 Ga0373932_0004155 3300035112 Bacteria 3439
482 Ga0373932_0015106 3300035112 Bacteria 1953
483 Ga0373932_0104604 3300035112 Bacteria 925
484 Ga0373936_0010448 3300035113 Bacteria 3502
485 Ga0373936_0036352 3300035113 Bacteria 1963
486 Ga0373936_0151947 3300035113 Bacteria 1004
487 Ga0373939_0006398 3300035114 Bacteria 2836
488 Ga0373941_0003680 3300035115 Bacteria 3490
489 Ga0373945_0081013 3300035116 Bacteria 1244
490 Ga0373945_0098308 3300035116 Bacteria 1142
491 Ga0373953_0000451 3300035117 Bacteria 11279
492 Ga0373953_0002689 3300035117 Bacteria 5391
493 Ga0373953_0153525 3300035117 Bacteria 988
494 Ga0373954_0010828 3300035118 Bacteria 4031
495 Ga0373954_0039752 3300035118 Bacteria 2190
496 Ga0373954_0062678 3300035118 Bacteria 1757
497 Ga0373954_0450385 3300035118 Bacteria 637
498 Ga0373956_0002041 3300035119 Bacteria 8361
499 Ga0373956_0057980 3300035119 Bacteria 1750
500 Ga0373956_0228536 3300035119 Bacteria 883
501 Ga0373956_0647372 3300035119 Bacteria 504
502 Ga0373957_0000922 3300035120 Bacteria 7704
503 Ga0373957_0024880 3300035120 Bacteria 2153
504 Ga0373957_0087551 3300035120 Bacteria 1235
505 Ga0373960_0007720 3300035121 Bacteria 2557
506 Ga0373960_0263211 3300035121 Bacteria 630
507 Ga0373943_0011379 3300035170 Bacteria 4003
508 Ga0373943_0103603 3300035170 Bacteria 1492
509 Ga0373946_0023521 3300035171 Bacteria 2408
510 Ga0373946_0030062 3300035171 Bacteria 2166
511 Ga0373946_0030581 3300035171 Bacteria 2150
512 Ga0373946_0698890 3300035171 Bacteria 530
513 Ga0373955_0018664 3300035172 Bacteria 3454
514 Ga0373955_0036421 3300035172 Bacteria 2610
515 Ga0373955_0339955 3300035172 Bacteria 908
516 Ga0373955_0575118 3300035172 Bacteria 689
517 Ga0373955_0586566 3300035172 Bacteria 682
518 Ga0373942_0025923 3300035207 Bacteria 1514
519 Ga0373942_0049660 3300035207 Bacteria 1172
520 Ga0373961_0129313 3300035241 Bacteria 844
521 Ga0373961_0275045 3300035241 Bacteria 616
522 Ga0373962_0006162 3300035242 Bacteria 2899
523 Ga0373962_0044564 3300035242 Bacteria 1260
524 Ga0316574_0060496 3300035398 Bacteria 2378
525 Ga0316574_0884697 3300035398 Bacteria 541
526 Ga0373924_0002270 3300035410 Bacteria 6451
527 Ga0373924_0177152 3300035410 Bacteria 938
528 Ga0373924_0364446 3300035410 Bacteria 644
529 Ga0373931_0003435 3300035691 Bacteria 7113
530 Ga0373931_0016082 3300035691 Bacteria 3678
531 Ga0373931_0111710 3300035691 Bacteria 1551
532 Ga0373931_0576443 3300035691 Bacteria 733
533 Ga0373931_0866343 3300035691 Bacteria 605
534 Ga0373935_0008830 3300035692 Bacteria 6033
535 Ga0373935_0062223 3300035692 Bacteria 2390
536 Ga0373935_0461452 3300035692 Bacteria 919
537 Ga0373935_0869174 3300035692 Bacteria 667
538 Ga0373927_0008181 3300035695 Bacteria 7048
539 Ga0373927_0247669 3300035695 Bacteria 1171
540 Ga0373927_0444094 3300035695 Bacteria 856
541 Ga0373927_1161960 3300035695 Bacteria 509
542 Ga0373933_0001285 3300035724 Bacteria 14780
543 Ga0373933_0003737 3300035724 Bacteria 8413
544 Ga0373933_0009986 3300035724 Bacteria 5198
545 Ga0373933_0835692 3300035724 Bacteria 606
546 Ga0373947_0015033 3300035725 Bacteria 4443
547 Ga0373947_0426491 3300035725 Bacteria 896
548 Ga0373947_0547921 3300035725 Bacteria 787
549 Ga0373947_0595387 3300035725 Bacteria 753
550 Ga0373937_0032065 3300036401 Bacteria 4764
551 Ga0373937_0203663 3300036401 Bacteria 1860
552 Ga0373937_0486637 3300036401 Bacteria 1172
553 Ga0373937_1764266 3300036401 Bacteria 565
554 Ga0316582_0005132 3300036647 Bacteria 6700
555 Ga0316582_0038482 3300036647 Bacteria 2973
556 Ga0316584_0001608 3300036712 Bacteria 13744
557 Ga0316584_0107814 3300036712 Bacteria 2084
558 Ga0373925_0042552 3300037068 Bacteria 3369
559 Ga0373925_0223844 3300037068 Bacteria 1502
560 Ga0373925_0435145 3300037068 Bacteria 1073
561 Ga0373925_0511106 3300037068 Bacteria 986
562 Ga0395905_0883615 3300037471 Bacteria 797
563 Ga0395905_1588208 3300037471 Bacteria 559
564 Ga0316581_0004172 3300037588 Bacteria 3662
565 Ga0400484_43813 3300038725 Bacteria 4326
566 Ga0400490_04650 3300038726 Bacteria 33929
567 Ga0400490_31977 3300038726 Bacteria 1792
568 Ga0400490_46408 3300038726 Bacteria 2178
569 Ga0400490_53470 3300038726 Bacteria 21187
570 Ga0400485_01281 3300038735 Bacteria 7687
571 Ga0400488_03774 3300038741 Bacteria 4675
572 Ga0400488_23211 3300038741 Unclassified 1604
573 Ga0400488_29591 3300038741 Bacteria 8917
574 Ga0400488_40428 3300038741 Bacteria 1334
575 Ga0400488_56483 3300038741 Bacteria 3221
576 Ga0400486_15244 3300038742 Bacteria 1529
577 Ga0400486_15329 3300038742 Bacteria 24403
578 Ga0400486_16341 3300038742 Bacteria 13135
579 Ga0400486_17930 3300038742 Bacteria 3096
580 Ga0400486_23238 3300038742 Bacteria 24429
581 Ga0400486_26120 3300038742 Bacteria 6005
582 Ga0400486_29541 3300038742 Unclassified 1321
583 Ga0400483_070153 3300039062 Bacteria 9786
584 Ga0400483_100355 3300039062 Bacteria 15183
585 Ga0400483_144743 3300039062 Bacteria 3479
586 Ga0400483_152336 3300039062 Bacteria 12601
587 Ga0400483_153077 3300039062 Bacteria 11242
588 Ga0400483_276135 3300039062 Bacteria 2906
589 Ga0400489_05416 3300039093 Bacteria 1657
590 Ga0400489_42426 3300039093 Bacteria 1916
591 Ga0400489_48881 3300039093 Bacteria 33119
592 Ga0400489_70731 3300039093 Bacteria 1001
593 Ga0400489_84991 3300039093 Bacteria 1276
594 Ga0400489_86670 3300039093 Bacteria 1128
595 Ga0400487_18239 3300039110 Bacteria 18844
596 Ga0400487_20435 3300039110 Bacteria 4564
597 Ga0400487_38077 3300039110 Bacteria 1374
598 Ga0436365_0301302 3300039437 Bacteria 585
599 Ga0436360_1277711 3300039438 Bacteria 1697
600 Ga0451793_1390847 3300041452 Bacteria 511
601 Ga0451793_1552121 3300041452 Bacteria 703
602 Ga0451847_0059918 3300041503 Unclassified 611
603 Ga0451855_0214715 3300041511 Bacteria 830
604 Ga0439441_000373 3300042001 Bacteria 4628
605 Ga0439441_006192 3300042001 Bacteria 1888
606 Ga0439441_048398 3300042001 Bacteria 870
607 Ga0439443_026787 3300042003 Unclassified 934
608 Ga0439450_074715 3300042008 Unclassified 836
609 Ga0439451_020599 3300042009 Bacteria 1329
610 Ga0439462_0231930 3300042015 Bacteria 529
611 Ga0450896_056548 3300042133 Bacteria 633
612 Ga0439435_0000244 3300042436 Bacteria 7823
613 Ga0439435_0000802 3300042436 Bacteria 5320
614 Ga0439435_0066814 3300042436 Bacteria 1058
615 Ga0439435_0370400 3300042436 Bacteria 500
616 Ga0439444_0000403 3300042437 Bacteria 4748
617 Ga0439444_0001242 3300042437 Bacteria 3240
618 Ga0439444_0191307 3300042437 Bacteria 512
619 Ga0439460_0001871 3300042461 Bacteria 5017
620 Ga0450893_0029174 3300042532 Bacteria 978
621 Ga0451577_0828954 3300042876 Bacteria 835
622 Ga0451577_2013956 3300042876 Bacteria 505
623 Ga0466964_0210609 3300044706 Bacteria 939
624 Ga0466960_0977279 3300044901 Bacteria 519
625 Ga0451576_0041328 3300045051 Bacteria 4875
626 Ga0451576_0178889 3300045051 Bacteria 2214
627 Ga0451576_0276893 3300045051 Bacteria 1754
628 Ga0451576_1334450 3300045051 Bacteria 747
629 Ga0495592_0005638 3300046454 Bacteria 9255
630 Ga0495592_0028405 3300046454 Bacteria 4237
631 Ga0495592_0057907 3300046454 Bacteria 2859
632 Ga0495592_0206503 3300046454 Bacteria 1322
633 Ga0495592_0863280 3300046454 Bacteria 534
634 Ga0495603_0070331 3300046455 Bacteria 2057
635 Ga0495603_0629509 3300046455 Bacteria 614
636 Ga0495629_0088991 3300046459 Bacteria 2154
637 Ga0495629_0169630 3300046459 Bacteria 1515
638 Ga0495641_0011057 3300046461 Bacteria 5170
639 Ga0495651_0003964 3300046462 Bacteria 11326
640 Ga0495651_0004143 3300046462 Bacteria 11106
641 Ga0495651_0161671 3300046462 Bacteria 1604
642 Ga0495653_0094012 3300046463 Bacteria 2185
643 Ga0495653_0390478 3300046463 Bacteria 887
644 Ga0495580_0036842 3300046472 Bacteria 3511
645 Ga0495580_0053320 3300046472 Bacteria 2854
646 Ga0495580_0346732 3300046472 Bacteria 1006
647 Ga0495582_0018344 3300046473 Bacteria 3828
648 Ga0495582_0118839 3300046473 Bacteria 1488
649 Ga0495639_0011815 3300046475 Bacteria 3765
650 Ga0495639_0029838 3300046475 Bacteria 2421
651 Ga0495639_0478615 3300046475 Bacteria 634
652 Ga0495662_0005450 3300046476 Bacteria 6370
653 Ga0495662_0241369 3300046476 Bacteria 890
654 Ga0495664_0003933 3300046477 Bacteria 8107
655 Ga0495594_0045584 3300046499 Bacteria 2407
656 Ga0495594_0294827 3300046499 Bacteria 924
657 Ga0495594_0863824 3300046499 Bacteria 509
658 Ga0495608_0007931 3300046511 Bacteria 7461
659 Ga0495608_0162952 3300046511 Bacteria 1417
660 Ga0495618_0632336 3300046514 Bacteria 634
661 Ga0495628_0036325 3300046516 Bacteria 3955
662 Ga0495628_0055686 3300046516 Bacteria 3114
663 Ga0495628_0099200 3300046516 Bacteria 2249
664 Ga0495628_0254377 3300046516 Bacteria 1310
665 Ga0495630_0008815 3300046517 Bacteria 7241
666 Ga0495630_0085122 3300046517 Bacteria 2387
667 Ga0495630_0514800 3300046517 Bacteria 917
668 Ga0495644_0081670 3300046523 Bacteria 1219
669 Ga0495644_0357483 3300046523 Bacteria 575
670 Ga0495663_0373144 3300046525 Bacteria 522
671 Ga0495666_0003346 3300046526 Bacteria 8092
672 Ga0495642_0031663 3300046528 Bacteria 2121
673 Ga0495642_0224820 3300046528 Bacteria 820
674 Ga0495652_0005494 3300046529 Bacteria 11936
675 Ga0495652_0142088 3300046529 Bacteria 1887
676 Ga0495652_0309349 3300046529 Bacteria 1145
677 Ga0495652_0343127 3300046529 Bacteria 1072
678 Ga0495652_0466951 3300046529 Bacteria 881
679 Ga0495665_0016354 3300046531 Bacteria 3998
680 Ga0495665_0153336 3300046531 Bacteria 1202
681 Ga0495665_0279099 3300046531 Bacteria 857
682 Ga0495640_0014075 3300046533 Bacteria 6066
683 Ga0495640_0185666 3300046533 Bacteria 1323
684 Ga0495640_0422074 3300046533 Bacteria 817
685 Ga0495586_0003635 3300046535 Bacteria 8263
686 Ga0495586_0012798 3300046535 Bacteria 4446
687 Ga0495586_0415695 3300046535 Bacteria 774
688 Ga0495587_0002077 3300046536 Bacteria 13382
689 Ga0495598_0066406 3300046537 Bacteria 1125
690 Ga0495598_0099675 3300046537 Bacteria 959
691 Ga0495598_0312795 3300046537 Bacteria 597
692 Ga0495621_0465641 3300046539 Bacteria 542
693 Ga0495645_0009908 3300046543 Bacteria 6669
694 Ga0495645_0605853 3300046543 Bacteria 673
695 Ga0495622_0129908 3300046557 Bacteria 1148
696 Ga0495667_0008752 3300046559 Bacteria 6878
697 Ga0495667_0086457 3300046559 Bacteria 2033
698 Ga0495667_0144445 3300046559 Bacteria 1533
699 Ga0495667_0249257 3300046559 Bacteria 1130
700 Ga0495667_0291268 3300046559 Bacteria 1035
701 Ga0495656_0159494 3300046615 Bacteria 1095
702 Ga0495634_0048416 3300046642 Bacteria 2861
703 Ga0495634_0230055 3300046642 Bacteria 1141
704 Ga0495635_0120013 3300046663 Bacteria 1794
705 Ga0495635_0873269 3300046663 Bacteria 577
706 Ga0495659_0136821 3300046664 Bacteria 975
707 Ga0495588_0176427 3300046674 Bacteria 1129
708 Ga0495657_0098049 3300046675 Bacteria 1871
709 Ga0495657_0170512 3300046675 Bacteria 1340
710 Ga0495657_0194229 3300046675 Bacteria 1239
711 Ga0495599_0005317 3300046678 Bacteria 7682
712 Ga0495599_0032803 3300046678 Bacteria 3260
713 Ga0495599_0107212 3300046678 Bacteria 1741
714 Ga0495599_0230772 3300046678 Bacteria 1130
715 Ga0495623_0534291 3300046679 Bacteria 616
716 Ga0495646_0621989 3300046680 Bacteria 547
717 Ga0495647_0165323 3300046681 Bacteria 955
718 Ga0495647_0342503 3300046681 Bacteria 679
719 Ga0495658_0006591 3300046683 Bacteria 5703
720 Ga0495658_0107496 3300046683 Bacteria 1673
721 Ga0495669_0014591 3300046684 Bacteria 3358
722 Ga0495669_0138507 3300046684 Bacteria 1148
723 Ga0495669_0562850 3300046684 Bacteria 555
724 Ga0495613_0080743 3300046689 Bacteria 2363
725 Ga0495624_0045558 3300046690 Bacteria 2791
726 Ga0495624_0250837 3300046690 Bacteria 1070
727 Ga0495670_0321599 3300046691 Bacteria 831
728 Ga0495600_0074913 3300046809 Bacteria 2210
729 Ga0495600_0132846 3300046809 Bacteria 1618
730 Ga0495600_0379195 3300046809 Bacteria 882
731 Ga0495581_0275574 3300047315 Bacteria 983
732 Ga0495581_0464384 3300047315 Bacteria 737
733 Ga0495604_0006828 3300047317 Bacteria 9045
734 Ga0495604_0208304 3300047317 Bacteria 1352
735 Ga0495604_0395128 3300047317 Bacteria 911
736 Ga0495636_0359066 3300047318 Bacteria 689
737 Ga0495674_0005220 3300047319 Bacteria 12468
738 Ga0495674_0072245 3300047319 Bacteria 2976
739 Ga0495674_1409804 3300047319 Bacteria 519
740 Ga0495680_0011364 3300047322 Bacteria 7884
741 Ga0495680_0020117 3300047322 Bacteria 5624
742 Ga0495680_0140126 3300047322 Bacteria 1770
743 Ga0495675_0018560 3300047444 Bacteria 4416
744 Ga0495677_0204707 3300047445 Bacteria 767
745 Ga0495677_0371655 3300047445 Bacteria 565
746 Ga0495684_0012445 3300047471 Bacteria 6558
747 Ga0495684_0071170 3300047471 Bacteria 2643
748 Ga0495684_0540081 3300047471 Bacteria 795
749 Ga0495593_0068347 3300047673 Bacteria 1849
750 Ga0495593_0157612 3300047673 Bacteria 1147
751 Ga0495614_0088704 3300048089 Bacteria 1344
752 Ga0496101_0850233 3300048904 Bacteria 719
753 Ga0496106_0292863 3300048909 Bacteria 1305
754 Ga0496106_1437399 3300048909 Bacteria 532
755 Ga0496108_0815914 3300048911 Bacteria 804
756 Ga0496109_0141848 3300048912 Bacteria 2247
757 Ga0496114_0418917 3300048917 Bacteria 1186
758 Ga0496114_0838062 3300048917 Bacteria 799
759 Ga0501298_057465 3300049521 Bacteria 818
760 Ga0501031_0265715 3300049568 Bacteria 1114
761 Ga0501031_0354837 3300049568 Bacteria 949
762 Ga0501031_0410465 3300049568 Bacteria 876
763 Ga0501031_0592929 3300049568 Bacteria 713
764 Ga0501033_0020853 3300049570 Bacteria 4947
765 Ga0501033_0085137 3300049570 Bacteria 2316
766 Ga0501033_0352324 3300049570 Bacteria 1031
767 Ga0501033_0563576 3300049570 Bacteria 784
768 Ga0501034_0353295 3300049571 Bacteria 1398
769 Ga0501036_0002322 3300049572 Bacteria 14872
770 Ga0501036_0166127 3300049572 Bacteria 1860
771 Ga0501036_0320712 3300049572 Bacteria 1295
772 Ga0501036_0383962 3300049572 Bacteria 1172
773 Ga0501036_0676094 3300049572 Bacteria 854
774 Ga0501036_0981828 3300049572 Bacteria 692
775 Ga0501036_1408520 3300049572 Bacteria 565
776 Ga0501037_0014951 3300049573 Bacteria 5709
777 Ga0501037_0397562 3300049573 Bacteria 945
778 Ga0501038_0000897 3300049574 Bacteria 26352
779 Ga0501038_0051781 3300049574 Bacteria 3541
780 Ga0501038_1101436 3300049574 Bacteria 580
781 Ga0501038_1355395 3300049574 Bacteria 512
782 Ga0501039_0008885 3300049575 Bacteria 7655
783 Ga0501039_0030832 3300049575 Bacteria 4135
784 Ga0501039_0072656 3300049575 Bacteria 2673
785 Ga0501039_0148698 3300049575 Bacteria 1840
786 Ga0501039_0372960 3300049575 Bacteria 1121
787 Ga0501040_0005353 3300049576 Bacteria 8299
788 Ga0501040_0009124 3300049576 Bacteria 6458
789 Ga0501040_0023931 3300049576 Bacteria 4096
790 Ga0501040_0045658 3300049576 Bacteria 2989
791 Ga0501040_0420810 3300049576 Bacteria 960
792 Ga0501040_1295159 3300049576 Bacteria 529
793 Ga0501041_0001118 3300049577 Bacteria 14698
794 Ga0501041_0022456 3300049577 Bacteria 3778
795 Ga0501041_0024383 3300049577 Bacteria 3631
796 Ga0501041_0025733 3300049577 Bacteria 3537
797 Ga0501041_0186183 3300049577 Bacteria 1300
798 Ga0501041_0195319 3300049577 Bacteria 1268
799 Ga0501041_0437333 3300049577 Bacteria 830
800 Ga0501041_1104931 3300049577 Bacteria 511
801 Ga0501042_0009920 3300049578 Bacteria 6363
802 Ga0501042_0023776 3300049578 Bacteria 4292
803 Ga0501042_0151239 3300049578 Bacteria 1674
804 Ga0501042_0294664 3300049578 Bacteria 1172
805 Ga0501042_0382640 3300049578 Bacteria 1019
806 Ga0501042_1125266 3300049578 Bacteria 572
807 Ga0501043_0053084 3300049579 Bacteria 3183
808 Ga0501043_0141342 3300049579 Bacteria 1885
809 Ga0501043_1086691 3300049579 Bacteria 566
810 Ga0501046_0004895 3300049580 Bacteria 12057
811 Ga0501046_0050466 3300049580 Bacteria 3287
812 Ga0501046_0083967 3300049580 Bacteria 2457
813 Ga0501046_0151977 3300049580 Bacteria 1746
814 Ga0501046_1072919 3300049580 Bacteria 557
815 Ga0501047_0360909 3300049581 Bacteria 1289
816 Ga0501048_0000253 3300049582 Bacteria 35754
817 Ga0501048_0011732 3300049582 Bacteria 6535
818 Ga0501048_0300665 3300049582 Bacteria 1142
819 Ga0501048_0484440 3300049582 Bacteria 887
820 Ga0501048_1061073 3300049582 Bacteria 583
821 Ga0501067_0395672 3300049583 Bacteria 770
822 Ga0501068_0044693 3300049584 Bacteria 2667
823 Ga0501068_0168606 3300049584 Bacteria 1381
824 Ga0501068_1206579 3300049584 Bacteria 501
825 Ga0501069_0984083 3300049585 Bacteria 515
826 Ga0501070_0022910 3300049586 Bacteria 5228
827 Ga0501071_0016865 3300049587 Bacteria 5025
828 Ga0501071_0075648 3300049587 Bacteria 2458
829 Ga0501071_0094598 3300049587 Bacteria 2198
830 Ga0501071_0717474 3300049587 Bacteria 770
831 Ga0501071_0722109 3300049587 Bacteria 767
832 Ga0501071_1388188 3300049587 Bacteria 542
833 Ga0501072_0004517 3300049588 Bacteria 10579
834 Ga0501072_0088238 3300049588 Bacteria 2461
835 Ga0501072_0237773 3300049588 Bacteria 1451
836 Ga0501072_0286288 3300049588 Bacteria 1310
837 Ga0501072_0403966 3300049588 Bacteria 1083
838 Ga0501074_0014632 3300049590 Bacteria 5706
839 Ga0501074_0382514 3300049590 Bacteria 998
840 Ga0501074_1136978 3300049590 Bacteria 548
841 Ga0501075_0000905 3300049591 Bacteria 18762
842 Ga0501075_0010458 3300049591 Bacteria 6518
843 Ga0501075_0063617 3300049591 Bacteria 2782
844 Ga0501076_0000285 3300049592 Bacteria 31507
845 Ga0501076_0015115 3300049592 Bacteria 5828
846 Ga0501076_0440805 3300049592 Bacteria 1072
847 Ga0501077_0007740 3300049593 Bacteria 6631
848 Ga0501225_0106669 3300049705 Bacteria 822
849 Ga0501079_0000672 3300049741 Bacteria 22946
850 Ga0501079_0002449 3300049741 Bacteria 13481
851 Ga0501079_0141741 3300049741 Bacteria 1872
852 Ga0501079_0371832 3300049741 Bacteria 1121
853 Ga0501079_0743924 3300049741 Bacteria 772
854 Ga0501079_1439279 3300049741 Bacteria 542
855 Ga0501080_0133779 3300049742 Bacteria 2295
856 Ga0501080_1628257 3300049742 Bacteria 546
857 Ga0501081_0000506 3300049743 Bacteria 21904
858 Ga0501081_0028038 3300049743 Bacteria 3798
859 Ga0501081_0039700 3300049743 Bacteria 3222
860 Ga0501081_0366773 3300049743 Bacteria 1063
861 Ga0501081_1123763 3300049743 Bacteria 595
862 Ga0501081_1308510 3300049743 Bacteria 550
863 Ga0501083_0228712 3300049744 Bacteria 1211
864 Ga0501283_028531 3300049779 Bacteria 927
865 Ga0501035_0040463 3300049822 Bacteria 4212
866 Ga0501035_0171240 3300049822 Bacteria 1876
867 Ga0501044_0416042 3300049823 Bacteria 1255
868 Ga0501045_0006856 3300049824 Bacteria 7890
869 Ga0501045_0020545 3300049824 Bacteria 4719
870 Ga0501045_0067205 3300049824 Bacteria 2632
871 Ga0501045_0133444 3300049824 Bacteria 1846
872 Ga0501045_0195308 3300049824 Bacteria 1508
873 Ga0501045_0341473 3300049824 Bacteria 1115
874 Ga0501045_0390563 3300049824 Bacteria 1036
875 Ga0501045_0451688 3300049824 Bacteria 955
876 Ga0501045_0714374 3300049824 Bacteria 739
877 nmdc:mga03683_237294_c1 3300050489 Bacteria 844
878 nmdc:mga05p37_1126_c1 3300050507 Bacteria 30703
879 nmdc:mga05p37_1420047_c1 3300050507 Bacteria 697
880 nmdc:mga05p37_2024549_c1 3300050507 Bacteria 543
881 nmdc:mga05p37_257817_c1 3300050507 Bacteria 2089
882 nmdc:mga05p37_573091_c1 3300050507 Bacteria 1280
883 nmdc:mga09592_1294054_c1 3300050508 Bacteria 600
884 nmdc:mga09592_146278_c1 3300050508 Bacteria 2038
885 nmdc:mga09592_1655_c1 3300050508 Bacteria 17927
886 nmdc:mga09592_254698_c1 3300050508 Bacteria 1521
887 nmdc:mga09592_31385_c1 3300050508 Bacteria 4427
888 nmdc:mga09592_382050_c1 3300050508 Bacteria 1218
889 nmdc:mga09592_558727_c1 3300050508 Bacteria 983
890 nmdc:mga0qj67_1518541_c1 3300050509 Bacteria 515
891 nmdc:mga0qj67_1548429_c1 3300050509 Bacteria 509
892 nmdc:mga0qj67_319931_c1 3300050509 Bacteria 1256
893 nmdc:mga0qj67_35741_c1 3300050509 Bacteria 3886
894 nmdc:mga0qj67_648_c1 3300050509 Bacteria 23982
895 nmdc:mga06r32_1200468_c1 3300050510 Bacteria 705
896 nmdc:mga06r32_134302_c1 3300050510 Bacteria 2449
897 nmdc:mga06r32_18886_c1 3300050510 Bacteria 6320
898 nmdc:mga06r32_217415_c1 3300050510 Bacteria 1899
899 nmdc:mga06r32_490113_c1 3300050510 Bacteria 1207
900 nmdc:mga06r32_610756_c1 3300050510 Bacteria 1061
901 nmdc:mga06r32_730038_c1 3300050510 Bacteria 955
902 nmdc:mga06r32_877268_c1 3300050510 Bacteria 855
903 nmdc:mga08y16_115926_c1 3300050511 Bacteria 2789
904 nmdc:mga08y16_1331314_c1 3300050511 Bacteria 684
905 nmdc:mga08y16_4849_c1 3300050511 Bacteria 14041
906 nmdc:mga08y16_48972_c1 3300050511 Bacteria 4422
907 nmdc:mga08y16_515000_c1 3300050511 Bacteria 1214
908 nmdc:mga08y16_54458_c1 3300050511 Bacteria 4180
909 nmdc:mga0n895_107701_c1 3300050512 Bacteria 2801
910 nmdc:mga0n895_1403553_c1 3300050512 Bacteria 667
911 nmdc:mga0n895_1506760_c1 3300050512 Bacteria 639
912 nmdc:mga0n895_491896_c1 3300050512 Bacteria 1236
913 nmdc:mga0n895_754560_c1 3300050512 Bacteria 966
914 nmdc:mga0n895_87725_c1 3300050512 Bacteria 3110
915 nmdc:mga0n895_914882_c1 3300050512 Bacteria 862
916 nmdc:mga0rr50_1605105_c1 3300050513 Bacteria 549
917 nmdc:mga0rr50_1816_c1 3300050513 Bacteria 11807
918 nmdc:mga0rr50_217129_c1 3300050513 Bacteria 1578
919 nmdc:mga0rr50_288186_c1 3300050513 Bacteria 1371
920 nmdc:mga0rr50_836208_c1 3300050513 Bacteria 785
921 nmdc:mga08x19_132992_c1 3300050514 Bacteria 1675
922 nmdc:mga08x19_271649_c1 3300050514 Bacteria 1173
923 nmdc:mga08x19_31181_c1 3300050514 Bacteria 3352
924 nmdc:mga08x19_3563_c1 3300050514 Bacteria 9267
925 nmdc:mga08x19_41359_c1 3300050514 Bacteria 2935
926 nmdc:mga08x19_8158_c1 3300050514 Bacteria 6223
927 nmdc:mga08x19_932484_c1 3300050514 Bacteria 617
928 nmdc:mga0a205_1274417_c1 3300050515 Bacteria 583
929 nmdc:mga0a205_156644_c1 3300050515 Bacteria 2176
930 nmdc:mga0a205_3207_c1 3300050515 Bacteria 14532
931 nmdc:mga0a205_624755_c1 3300050515 Bacteria 929
932 Ga0495601_0002901 3300053077 Bacteria 9754
933 Ga0495601_0268996 3300053077 Bacteria 1112
934 Ga0495601_0343214 3300053077 Bacteria 971
935 Ga0495601_0379335 3300053077 Bacteria 918
936 Ga0495601_0393287 3300053077 Bacteria 899
937 Ga0495612_0090242 3300053078 Bacteria 1296
938 Ga0495612_0233774 3300053078 Bacteria 815
939 Ga0495595_0001331 3300053084 Bacteria 9608
940 Ga0495619_0004232 3300053085 Bacteria 9147
941 Ga0495619_0723068 3300053085 Bacteria 676
942 Ga0500566_0131688 3300053094 Bacteria 1337
943 Ga0501084_0001838 3300054114 Bacteria 16928
944 Ga0501084_0035548 3300054114 Bacteria 4165
945 Ga0501084_0404933 3300054114 Bacteria 1153
946 Ga0590071_212572 3300059421 Bacteria 510
947 Ga0590075_027962 3300059424 Bacteria 1424
948 Ga0590077_025958 3300059426 Bacteria 1264
949 Ga0501082_0018673 3300060353 Bacteria 5973
950 Ga0501082_0033197 3300060353 Bacteria 4452
951 Ga0501082_0364383 3300060353 Bacteria 1260
952 Ga0501082_0769349 3300060353 Bacteria 843
953 Ga0501082_1204234 3300060353 Bacteria 662
954 Ga0530510_0000091 3300061734 Bacteria 48589
955 Ga0530510_0000518 3300061734 Bacteria 24630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10089431 Ga0070676_100894311 59
2 3300005330 Ga0070690_100000525 Ga0070690_1000005254 59
3 3300005334 Ga0068869_100009815 Ga0068869_1000098155 59
4 3300005334 Ga0068869_101525096 Ga0068869_1015250962 59
5 3300005336 Ga0070680_100062718 Ga0070680_1000627184 59
6 3300005340 Ga0070689_100000288 Ga0070689_10000028820 59
7 3300005341 Ga0070691_10013263 Ga0070691_100132632 59
8 3300005345 Ga0070692_10086335 Ga0070692_100863352 59
9 3300005356 Ga0070674_100264274 Ga0070674_1002642742 59
10 3300005365 Ga0070688_100144227 Ga0070688_1001442273 59
11 3300005365 Ga0070688_101078215 Ga0070688_1010782152 59
12 3300005438 Ga0070701_10043338 Ga0070701_100433382 59
13 3300005440 Ga0070705_100024264 Ga0070705_1000242644 59
14 3300005441 Ga0070700_100000241 Ga0070700_1000002418 59
15 3300005441 Ga0070700_101236123 Ga0070700_1012361231 59
16 3300005444 Ga0070694_100163989 Ga0070694_1001639892 59
17 3300005444 Ga0070694_100234204 Ga0070694_1002342042 59
18 3300005444 Ga0070694_100235915 Ga0070694_1002359152 59
19 3300005456 Ga0070678_100314014 Ga0070678_1003140142 59
20 3300005456 Ga0070678_100420398 Ga0070678_1004203981 59
21 3300005458 Ga0070681_10796294 Ga0070681_107962942 59
22 3300005459 Ga0068867_100011581 Ga0068867_1000115815 59
23 3300005466 Ga0070685_11163709 Ga0070685_111637091 59
24 3300005530 Ga0070679_101940598 Ga0070679_1019405981 59
25 3300005535 Ga0070684_101073665 Ga0070684_1010736652 59
26 3300005544 Ga0070686_100006108 Ga0070686_1000061085 59
27 3300005545 Ga0070695_100352582 Ga0070695_1003525821 59
28 3300005546 Ga0070696_100032452 Ga0070696_1000324525 59
29 3300005546 Ga0070696_100269062 Ga0070696_1002690622 59
30 3300005546 Ga0070696_101430200 Ga0070696_1014302002 59
31 3300005547 Ga0070693_100149468 Ga0070693_1001494682 59
32 3300005549 Ga0070704_100758248 Ga0070704_1007582482 59
33 3300005577 Ga0068857_101464189 Ga0068857_1014641891 59
34 3300005578 Ga0068854_100345651 Ga0068854_1003456512 59
35 3300005615 Ga0070702_100074788 Ga0070702_1000747883 59
36 3300005617 Ga0068859_100001619 Ga0068859_10000161922 59
37 3300005618 Ga0068864_100725880 Ga0068864_1007258802 59
38 3300005718 Ga0068866_10000528 Ga0068866_1000052815 59
39 3300005719 Ga0068861_100000423 Ga0068861_10000042322 59
40 3300005840 Ga0068870_10178339 Ga0068870_101783392 59
41 3300005841 Ga0068863_100854926 Ga0068863_1008549262 59
42 3300005842 Ga0068858_100005846 Ga0068858_10000584610 59
43 3300005843 Ga0068860_100030340 Ga0068860_1000303403 59
44 3300005844 Ga0068862_100017845 Ga0068862_1000178453 59
45 3300006237 Ga0097621_100001153 Ga0097621_10000115313 59
46 3300006358 Ga0068871_100189883 Ga0068871_1001898832 59
47 3300006844 Ga0075428_100001527 Ga0075428_1000015279 59
48 3300006844 Ga0075428_102460801 Ga0075428_1024608011 59
49 3300006852 Ga0075433_11501679 Ga0075433_115016791 59
50 3300006880 Ga0075429_100007581 Ga0075429_1000075816 59
51 3300006881 Ga0068865_100000385 Ga0068865_10000038524 59
52 3300006931 Ga0097620_100001619 Ga0097620_1000016192 59
53 3300009094 Ga0111539_10006721 Ga0111539_100067214 59
54 3300009094 Ga0111539_11707936 Ga0111539_117079362 59
55 3300009098 Ga0105245_10000515 Ga0105245_1000051528 59
56 3300009147 Ga0114129_10877299 Ga0114129_108772991 59
57 3300009148 Ga0105243_10006067 Ga0105243_100060677 59
58 3300009176 Ga0105242_10001066 Ga0105242_1000106617 59
59 3300009177 Ga0105248_10266766 Ga0105248_102667663 59
60 3300009177 Ga0105248_10319008 Ga0105248_103190082 59
61 3300009551 Ga0105238_12749690 Ga0105238_127496901 59
62 3300009553 Ga0105249_10031943 Ga0105249_100319434 59
63 3300011119 Ga0105246_11145808 Ga0105246_111458082 59
64 3300013297 Ga0157378_10000746 Ga0157378_100007469 59
65 3300013306 Ga0163162_11663976 Ga0163162_116639762 59
66 3300013306 Ga0163162_12670458 Ga0163162_126704582 59
67 3300013308 Ga0157375_10300376 Ga0157375_103003763 59
68 3300013308 Ga0157375_12625771 Ga0157375_126257712 59
69 3300014326 Ga0157380_10015130 Ga0157380_100151304 59
70 3300014968 Ga0157379_10136925 Ga0157379_101369252 59
71 3300035090 Ga0373949_0097427 Ga0373949_0097427_193_375 59
72 3300005290 Ga0065712_10248395 Ga0065712_102483951 60
73 3300005293 Ga0065715_10422296 Ga0065715_104222961 60
74 3300005329 Ga0070683_101879960 Ga0070683_1018799602 60
75 3300005441 Ga0070700_100821890 Ga0070700_1008218901 60
76 3300005444 Ga0070694_100108029 Ga0070694_1001080291 60
77 3300005471 Ga0070698_101224571 Ga0070698_1012245712 60
78 3300005719 Ga0068861_101963443 Ga0068861_1019634432 60
79 3300006195 Ga0075366_10832887 Ga0075366_108328871 60
80 3300006846 Ga0075430_100012906 Ga0075430_1000129064 60
81 3300006847 Ga0075431_100006916 Ga0075431_1000069164 60
82 3300006880 Ga0075429_100111915 Ga0075429_1001119153 60
83 3300009093 Ga0105240_12347077 Ga0105240_123470772 60
84 3300009094 Ga0111539_10086922 Ga0111539_100869221 60
85 3300009094 Ga0111539_11142438 Ga0111539_111424381 60
86 3300009094 Ga0111539_13061241 Ga0111539_130612411 60
87 3300009545 Ga0105237_12105200 Ga0105237_121052002 60
88 3300010375 Ga0105239_10992784 Ga0105239_109927842 60
89 3300013296 Ga0157374_10000104 Ga0157374_1000010474 60
90 3300013297 Ga0157378_10973027 Ga0157378_109730271 60
91 3300013306 Ga0163162_11774116 Ga0163162_117741162 60
92 3300025901 Ga0207688_10428585 Ga0207688_104285853 60
93 3300025931 Ga0207644_10762143 Ga0207644_107621432 60
94 3300026075 Ga0207708_10452827 Ga0207708_104528272 60
95 3300026075 Ga0207708_11167397 Ga0207708_111673971 60
96 3300031691 Ga0316579_10050697 Ga0316579_100506972 60
97 3300031727 Ga0316576_10580389 Ga0316576_105803892 60
98 3300031728 Ga0316578_10236666 Ga0316578_102366662 60
99 3300032002 Ga0307416_101210470 Ga0307416_1012104702 60
100 3300032139 Ga0316580_10035005 Ga0316580_100350052 60
101 3300032168 Ga0316593_10221454 Ga0316593_102214542 60
102 3300033524 Ga0316592_1156036 Ga0316592_11560362 60
103 3300033541 Ga0316596_1001064 Ga0316596_10010649 60
104 3300035083 Ga0373926_0055845 Ga0373926_0055845_1123_1308 60
105 3300035083 Ga0373926_0199620 Ga0373926_0199620_411_596 60
106 3300035086 Ga0373934_0002385 Ga0373934_0002385_4117_4302 60
107 3300035086 Ga0373934_0032500 Ga0373934_0032500_386_571 60
108 3300035088 Ga0373940_0087995 Ga0373940_0087995_124_306 60
109 3300035111 Ga0373923_0145426 Ga0373923_0145426_177_362 60
110 3300035113 Ga0373936_0010448 Ga0373936_0010448_1560_1745 60
111 3300035116 Ga0373945_0081013 Ga0373945_0081013_770_955 60
112 3300035117 Ga0373953_0000451 Ga0373953_0000451_9256_9441 60
113 3300035118 Ga0373954_0010828 Ga0373954_0010828_3695_3880 60
114 3300035118 Ga0373954_0039752 Ga0373954_0039752_1033_1218 60
115 3300035119 Ga0373956_0002041 Ga0373956_0002041_972_1157 60
116 3300035119 Ga0373956_0057980 Ga0373956_0057980_102_287 60
117 3300035119 Ga0373956_0647372 Ga0373956_0647372_108_293 60
118 3300035120 Ga0373957_0000922 Ga0373957_0000922_7260_7445 60
119 3300035120 Ga0373957_0024880 Ga0373957_0024880_1467_1652 60
120 3300035170 Ga0373943_0103603 Ga0373943_0103603_1022_1207 60
121 3300035171 Ga0373946_0023521 Ga0373946_0023521_2182_2367 60
122 3300035171 Ga0373946_0698890 Ga0373946_0698890_60_245 60
123 3300035172 Ga0373955_0036421 Ga0373955_0036421_669_854 60
124 3300035172 Ga0373955_0339955 Ga0373955_0339955_186_371 60
125 3300035172 Ga0373955_0575118 Ga0373955_0575118_108_293 60
126 3300035398 Ga0316574_0060496 Ga0316574_0060496_1126_1314 60
127 3300035410 Ga0373924_0002270 Ga0373924_0002270_4949_5134 60
128 3300035691 Ga0373931_0866343 Ga0373931_0866343_277_459 60
129 3300035692 Ga0373935_0008830 Ga0373935_0008830_2260_2445 60
130 3300035695 Ga0373927_0247669 Ga0373927_0247669_459_644 60
131 3300035724 Ga0373933_0001285 Ga0373933_0001285_7429_7614 60
132 3300035724 Ga0373933_0003737 Ga0373933_0003737_1194_1379 60
133 3300035725 Ga0373947_0595387 Ga0373947_0595387_433_618 60
134 3300036401 Ga0373937_0203663 Ga0373937_0203663_212_397 60
135 3300036401 Ga0373937_1764266 Ga0373937_1764266_328_513 60
136 3300036647 Ga0316582_0038482 Ga0316582_0038482_2314_2502 60
137 3300036712 Ga0316584_0001608 Ga0316584_0001608_22_210 60
138 3300037068 Ga0373925_0223844 Ga0373925_0223844_1106_1291 60
139 3300038725 Ga0400484_43813 Ga0400484_43813_1830_2018 60
140 3300038726 Ga0400490_04650 Ga0400490_04650_23547_23735 60
141 3300038726 Ga0400490_31977 Ga0400490_31977_138_320 60
142 3300038726 Ga0400490_46408 Ga0400490_46408_18_200 60
143 3300038726 Ga0400490_53470 Ga0400490_53470_7602_7790 60
144 3300038735 Ga0400485_01281 Ga0400485_01281_10_198 60
145 3300038741 Ga0400488_03774 Ga0400488_03774_2036_2224 60
146 3300038741 Ga0400488_23211 Ga0400488_23211_751_939 60
147 3300038741 Ga0400488_29591 Ga0400488_29591_1073_1261 60
148 3300038741 Ga0400488_56483 Ga0400488_56483_1557_1754 60
149 3300038742 Ga0400486_15244 Ga0400486_15244_1118_1303 60
150 3300038742 Ga0400486_16341 Ga0400486_16341_6762_6950 60
151 3300038742 Ga0400486_17930 Ga0400486_17930_365_547 60
152 3300038742 Ga0400486_23238 Ga0400486_23238_18481_18669 60
153 3300038742 Ga0400486_26120 Ga0400486_26120_205_402 60
154 3300038742 Ga0400486_29541 Ga0400486_29541_613_801 60
155 3300039062 Ga0400483_100355 Ga0400483_100355_3295_3483 60
156 3300039062 Ga0400483_144743 Ga0400483_144743_125_313 60
157 3300039062 Ga0400483_152336 Ga0400483_152336_804_1001 60
158 3300039062 Ga0400483_153077 Ga0400483_153077_1426_1614 60
159 3300039062 Ga0400483_276135 Ga0400483_276135_321_503 60
160 3300039093 Ga0400489_05416 Ga0400489_05416_80_268 60
161 3300039093 Ga0400489_42426 Ga0400489_42426_530_712 60
162 3300039093 Ga0400489_48881 Ga0400489_48881_24996_25184 60
163 3300039093 Ga0400489_70731 Ga0400489_70731_617_814 60
164 3300039093 Ga0400489_84991 Ga0400489_84991_740_928 60
165 3300039093 Ga0400489_86670 Ga0400489_86670_138_320 60
166 3300039110 Ga0400487_18239 Ga0400487_18239_11032_11220 60
167 3300039110 Ga0400487_38077 Ga0400487_38077_1098_1286 60
168 3300041452 Ga0451793_1390847 Ga0451793_1390847_160_342 60
169 3300041503 Ga0451847_0059918 Ga0451847_0059918_129_311 60
170 3300045051 Ga0451576_1334450 Ga0451576_1334450_110_292 60
171 3300046454 Ga0495592_0005638 Ga0495592_0005638_5596_5781 60
172 3300046454 Ga0495592_0028405 Ga0495592_0028405_3738_3923 60
173 3300046454 Ga0495592_0057907 Ga0495592_0057907_999_1184 60
174 3300046454 Ga0495592_0206503 Ga0495592_0206503_577_762 60
175 3300046455 Ga0495603_0629509 Ga0495603_0629509_395_580 60
176 3300046459 Ga0495629_0169630 Ga0495629_0169630_555_740 60
177 3300046461 Ga0495641_0011057 Ga0495641_0011057_668_853 60
178 3300046462 Ga0495651_0003964 Ga0495651_0003964_9494_9679 60
179 3300046462 Ga0495651_0004143 Ga0495651_0004143_1840_2025 60
180 3300046463 Ga0495653_0094012 Ga0495653_0094012_1476_1661 60
181 3300046472 Ga0495580_0053320 Ga0495580_0053320_1893_2078 60
182 3300046473 Ga0495582_0118839 Ga0495582_0118839_1021_1206 60
183 3300046475 Ga0495639_0029838 Ga0495639_0029838_1968_2153 60
184 3300046476 Ga0495662_0005450 Ga0495662_0005450_2491_2676 60
185 3300046477 Ga0495664_0003933 Ga0495664_0003933_816_1001 60
186 3300046499 Ga0495594_0045584 Ga0495594_0045584_1573_1758 60
187 3300046499 Ga0495594_0863824 Ga0495594_0863824_195_380 60
188 3300046511 Ga0495608_0007931 Ga0495608_0007931_1607_1792 60
189 3300046511 Ga0495608_0162952 Ga0495608_0162952_249_434 60
190 3300046514 Ga0495618_0632336 Ga0495618_0632336_134_319 60
191 3300046516 Ga0495628_0036325 Ga0495628_0036325_1863_2048 60
192 3300046516 Ga0495628_0055686 Ga0495628_0055686_420_605 60
193 3300046516 Ga0495628_0099200 Ga0495628_0099200_649_834 60
194 3300046517 Ga0495630_0008815 Ga0495630_0008815_1445_1630 60
195 3300046526 Ga0495666_0003346 Ga0495666_0003346_6828_7013 60
196 3300046529 Ga0495652_0005494 Ga0495652_0005494_2070_2255 60
197 3300046529 Ga0495652_0309349 Ga0495652_0309349_663_848 60
198 3300046529 Ga0495652_0343127 Ga0495652_0343127_394_579 60
199 3300046531 Ga0495665_0016354 Ga0495665_0016354_1343_1528 60
200 3300046533 Ga0495640_0014075 Ga0495640_0014075_4816_5001 60
201 3300046533 Ga0495640_0422074 Ga0495640_0422074_119_304 60
202 3300046535 Ga0495586_0003635 Ga0495586_0003635_6909_7094 60
203 3300046536 Ga0495587_0002077 Ga0495587_0002077_4775_4960 60
204 3300046543 Ga0495645_0009908 Ga0495645_0009908_6052_6237 60
205 3300046557 Ga0495622_0129908 Ga0495622_0129908_520_705 60
206 3300046559 Ga0495667_0008752 Ga0495667_0008752_6153_6338 60
207 3300046559 Ga0495667_0086457 Ga0495667_0086457_1788_1973 60
208 3300046559 Ga0495667_0291268 Ga0495667_0291268_532_717 60
209 3300046642 Ga0495634_0048416 Ga0495634_0048416_1455_1640 60
210 3300046675 Ga0495657_0170512 Ga0495657_0170512_660_845 60
211 3300046675 Ga0495657_0194229 Ga0495657_0194229_514_699 60
212 3300046678 Ga0495599_0005317 Ga0495599_0005317_6030_6215 60
213 3300046678 Ga0495599_0032803 Ga0495599_0032803_1631_1816 60
214 3300046678 Ga0495599_0230772 Ga0495599_0230772_672_857 60
215 3300046679 Ga0495623_0534291 Ga0495623_0534291_120_305 60
216 3300046680 Ga0495646_0621989 Ga0495646_0621989_116_301 60
217 3300046681 Ga0495647_0165323 Ga0495647_0165323_270_455 60
218 3300046683 Ga0495658_0107496 Ga0495658_0107496_1222_1407 60
219 3300046689 Ga0495613_0080743 Ga0495613_0080743_1113_1298 60
220 3300046690 Ga0495624_0045558 Ga0495624_0045558_1358_1543 60
221 3300046809 Ga0495600_0074913 Ga0495600_0074913_281_466 60
222 3300047315 Ga0495581_0275574 Ga0495581_0275574_109_294 60
223 3300047317 Ga0495604_0006828 Ga0495604_0006828_1074_1259 60
224 3300047317 Ga0495604_0395128 Ga0495604_0395128_109_294 60
225 3300047319 Ga0495674_0005220 Ga0495674_0005220_9849_10034 60
226 3300047322 Ga0495680_0011364 Ga0495680_0011364_2519_2704 60
227 3300047322 Ga0495680_0140126 Ga0495680_0140126_559_744 60
228 3300047444 Ga0495675_0018560 Ga0495675_0018560_3755_3940 60
229 3300047471 Ga0495684_0012445 Ga0495684_0012445_1193_1378 60
230 3300047673 Ga0495593_0068347 Ga0495593_0068347_596_781 60
231 3300048089 Ga0495614_0088704 Ga0495614_0088704_656_841 60
232 3300048909 Ga0496106_0292863 Ga0496106_0292863_38_220 60
233 3300048909 Ga0496106_1437399 Ga0496106_1437399_186_368 60
234 3300048911 Ga0496108_0815914 Ga0496108_0815914_51_233 60
235 3300048912 Ga0496109_0141848 Ga0496109_0141848_1179_1361 60
236 3300048917 Ga0496114_0418917 Ga0496114_0418917_72_254 60
237 3300049572 Ga0501036_0676094 Ga0501036_0676094_654_836 60
238 3300049592 Ga0501076_0440805 Ga0501076_0440805_666_848 60
239 3300049741 Ga0501079_0743924 Ga0501079_0743924_375_557 60
240 3300049824 Ga0501045_0341473 Ga0501045_0341473_718_906 60
241 3300050508 nmdc:mga09592_31385_c1 nmdc:mga09592_31385_c1_3193_3375 60
242 3300050509 nmdc:mga0qj67_319931_c1 nmdc:mga0qj67_319931_c1_341_523 60
243 3300050510 nmdc:mga06r32_18886_c1 nmdc:mga06r32_18886_c1_3063_3245 60
244 3300050511 nmdc:mga08y16_515000_c1 nmdc:mga08y16_515000_c1_211_393 60
245 3300050512 nmdc:mga0n895_1403553_c1 nmdc:mga0n895_1403553_c1_140_322 60
246 3300053077 Ga0495601_0002901 Ga0495601_0002901_4796_4981 60
247 3300053077 Ga0495601_0268996 Ga0495601_0268996_342_527 60
248 3300053077 Ga0495601_0343214 Ga0495601_0343214_668_853 60
249 3300053078 Ga0495612_0090242 Ga0495612_0090242_683_868 60
250 3300053084 Ga0495595_0001331 Ga0495595_0001331_7360_7545 60
251 3300053085 Ga0495619_0004232 Ga0495619_0004232_2041_2226 60
252 3300053085 Ga0495619_0723068 Ga0495619_0723068_221_406 60
253 3300053094 Ga0500566_0131688 Ga0500566_0131688_1134_1319 60
254 3300005343 Ga0070687_100270003 Ga0070687_1002700032 61
255 3300005353 Ga0070669_100410539 Ga0070669_1004105392 61
256 3300005438 Ga0070701_10195837 Ga0070701_101958372 61
257 3300005440 Ga0070705_100980900 Ga0070705_1009809001 61
258 3300005547 Ga0070693_100981859 Ga0070693_1009818592 61
259 3300005549 Ga0070704_100783944 Ga0070704_1007839442 61
260 3300005578 Ga0068854_101262291 Ga0068854_1012622912 61
261 3300005719 Ga0068861_100130189 Ga0068861_1001301892 61
262 3300005840 Ga0068870_10201290 Ga0068870_102012902 61
263 3300005840 Ga0068870_10283346 Ga0068870_102833461 61
264 3300006847 Ga0075431_100911482 Ga0075431_1009114822 61
265 3300014326 Ga0157380_12923155 Ga0157380_129231552 61
266 3300025908 Ga0207643_10029146 Ga0207643_100291464 61
267 3300025918 Ga0207662_10039411 Ga0207662_100394112 61
268 3300025923 Ga0207681_10107719 Ga0207681_101077192 61
269 3300025934 Ga0207686_10976435 Ga0207686_109764352 61
270 3300026116 Ga0207674_10549673 Ga0207674_105496733 61
271 3300026118 Ga0207675_101224058 Ga0207675_1012240582 61
272 3300027395 Ga0209996_1047224 Ga0209996_10472242 61
273 3300027462 Ga0210000_1007252 Ga0210000_10072523 61
274 3300027526 Ga0209968_1038970 Ga0209968_10389703 61
275 3300031548 Ga0307408_100220521 Ga0307408_1002205212 61
276 3300031548 Ga0307408_100428070 Ga0307408_1004280703 61
277 3300031731 Ga0307405_10316537 Ga0307405_103165371 61
278 3300031731 Ga0307405_10682704 Ga0307405_106827042 61
279 3300031824 Ga0307413_11442274 Ga0307413_114422742 61
280 3300031901 Ga0307406_11556118 Ga0307406_115561182 61
281 3300031903 Ga0307407_11558851 Ga0307407_115588512 61
282 3300031911 Ga0307412_10136384 Ga0307412_101363843 61
283 3300031995 Ga0307409_101530511 Ga0307409_1015305112 61
284 3300032002 Ga0307416_100296502 Ga0307416_1002965022 61
285 3300032002 Ga0307416_101861216 Ga0307416_1018612162 61
286 3300032005 Ga0307411_11513296 Ga0307411_115132962 61
287 3300038741 Ga0400488_40428 Ga0400488_40428_192_392 61
288 3300038742 Ga0400486_15329 Ga0400486_15329_7026_7226 61
289 3300039062 Ga0400483_070153 Ga0400483_070153_2932_3132 61
290 3300039110 Ga0400487_20435 Ga0400487_20435_3803_4003 61
291 3300042133 Ga0450896_056548 Ga0450896_056548_284_469 61
292 3300042436 Ga0439435_0370400 Ga0439435_0370400_242_427 61
293 3300046523 Ga0495644_0081670 Ga0495644_0081670_89_274 61
294 3300046537 Ga0495598_0066406 Ga0495598_0066406_546_731 61
295 3300046684 Ga0495669_0138507 Ga0495669_0138507_826_1011 61
296 3300049521 Ga0501298_057465 Ga0501298_057465_38_223 61
297 3300049705 Ga0501225_0106669 Ga0501225_0106669_232_417 61
298 3300049779 Ga0501283_028531 Ga0501283_028531_222_407 61
299 3300050508 nmdc:mga09592_146278_c1 nmdc:mga09592_146278_c1_428_613 61
300 3300050508 nmdc:mga09592_558727_c1 nmdc:mga09592_558727_c1_165_350 61
301 3300050509 nmdc:mga0qj67_35741_c1 nmdc:mga0qj67_35741_c1_2319_2504 61
302 3300050510 nmdc:mga06r32_217415_c1 nmdc:mga06r32_217415_c1_625_810 61
303 3300050510 nmdc:mga06r32_610756_c1 nmdc:mga06r32_610756_c1_322_507 61
304 3300050511 nmdc:mga08y16_115926_c1 nmdc:mga08y16_115926_c1_1444_1629 61
305 3300005434 Ga0070709_10648673 Ga0070709_106486732 62
306 3300005437 Ga0070710_10551529 Ga0070710_105515292 62
307 3300027471 Ga0209995_1050754 Ga0209995_10507542 62
308 3300032002 Ga0307416_102566382 Ga0307416_1025663822 62
309 3300032005 Ga0307411_10791963 Ga0307411_107919632 62
310 3300049568 Ga0501031_0265715 Ga0501031_0265715_200_388 62
311 3300049570 Ga0501033_0020853 Ga0501033_0020853_3224_3412 62
312 3300049571 Ga0501034_0353295 Ga0501034_0353295_287_475 62
313 3300049572 Ga0501036_0002322 Ga0501036_0002322_10101_10289 62
314 3300049573 Ga0501037_0014951 Ga0501037_0014951_1043_1231 62
315 3300049574 Ga0501038_0000897 Ga0501038_0000897_9848_10036 62
316 3300049575 Ga0501039_0008885 Ga0501039_0008885_2138_2326 62
317 3300049576 Ga0501040_0023931 Ga0501040_0023931_729_917 62
318 3300049577 Ga0501041_0001118 Ga0501041_0001118_12946_13134 62
319 3300049578 Ga0501042_0009920 Ga0501042_0009920_4141_4329 62
320 3300049578 Ga0501042_0151239 Ga0501042_0151239_1064_1252 62
321 3300049579 Ga0501043_0053084 Ga0501043_0053084_1013_1201 62
322 3300049580 Ga0501046_0004895 Ga0501046_0004895_9847_10035 62
323 3300049581 Ga0501047_0360909 Ga0501047_0360909_373_561 62
324 3300049582 Ga0501048_0000253 Ga0501048_0000253_25878_26066 62
325 3300049584 Ga0501068_0044693 Ga0501068_0044693_447_635 62
326 3300049586 Ga0501070_0022910 Ga0501070_0022910_1806_1994 62
327 3300049587 Ga0501071_0016865 Ga0501071_0016865_1387_1575 62
328 3300049588 Ga0501072_0403966 Ga0501072_0403966_633_821 62
329 3300049590 Ga0501074_0014632 Ga0501074_0014632_4447_4635 62
330 3300049591 Ga0501075_0000905 Ga0501075_0000905_17597_17785 62
331 3300049592 Ga0501076_0015115 Ga0501076_0015115_5127_5315 62
332 3300049593 Ga0501077_0007740 Ga0501077_0007740_4465_4653 62
333 3300049741 Ga0501079_0000672 Ga0501079_0000672_17381_17569 62
334 3300049742 Ga0501080_0133779 Ga0501080_0133779_1646_1834 62
335 3300049743 Ga0501081_0000506 Ga0501081_0000506_4255_4443 62
336 3300049743 Ga0501081_1123763 Ga0501081_1123763_75_263 62
337 3300049744 Ga0501083_0228712 Ga0501083_0228712_708_896 62
338 3300049822 Ga0501035_0040463 Ga0501035_0040463_1223_1411 62
339 3300049823 Ga0501044_0416042 Ga0501044_0416042_210_398 62
340 3300049824 Ga0501045_0006856 Ga0501045_0006856_4815_5003 62
341 3300049824 Ga0501045_0390563 Ga0501045_0390563_643_831 62
342 3300053077 Ga0495601_0379335 Ga0495601_0379335_22_210 62
343 3300054114 Ga0501084_0001838 Ga0501084_0001838_7486_7674 62
344 3300059424 Ga0590075_027962 Ga0590075_027962_670_858 62
345 3300059426 Ga0590077_025958 Ga0590077_025958_103_291 62
346 3300060353 Ga0501082_0033197 Ga0501082_0033197_2700_2888 62
347 3300060353 Ga0501082_0769349 Ga0501082_0769349_147_335 62
348 3300061734 Ga0530510_0000518 Ga0530510_0000518_2016_2204 62
349 3300002073 JGI24745J21846_1031541 JGI24745J21846_10315412 63
350 3300002244 JGI24742J22300_10057076 JGI24742J22300_100570762 63
351 3300005295 Ga0065707_10739179 Ga0065707_107391791 63
352 3300005330 Ga0070690_100000172 Ga0070690_10000017226 63
353 3300005330 Ga0070690_101481321 Ga0070690_1014813212 63
354 3300005334 Ga0068869_100004583 Ga0068869_1000045834 63
355 3300005334 Ga0068869_100075172 Ga0068869_1000751724 63
356 3300005335 Ga0070666_10169576 Ga0070666_101695762 63
357 3300005336 Ga0070680_100000230 Ga0070680_1000002309 63
358 3300005336 Ga0070680_100577203 Ga0070680_1005772032 63
359 3300005337 Ga0070682_100026535 Ga0070682_1000265354 63
360 3300005338 Ga0068868_100001075 Ga0068868_10000107515 63
361 3300005340 Ga0070689_100001034 Ga0070689_1000010344 63
362 3300005340 Ga0070689_100030972 Ga0070689_1000309724 63
363 3300005340 Ga0070689_100102156 Ga0070689_1001021564 63
364 3300005340 Ga0070689_100270512 Ga0070689_1002705123 63
365 3300005341 Ga0070691_10000935 Ga0070691_1000093513 63
366 3300005343 Ga0070687_100000141 Ga0070687_1000001419 63
367 3300005343 Ga0070687_100767646 Ga0070687_1007676462 63
368 3300005344 Ga0070661_100937074 Ga0070661_1009370742 63
369 3300005345 Ga0070692_10002703 Ga0070692_100027038 63
370 3300005345 Ga0070692_10034765 Ga0070692_100347653 63
371 3300005345 Ga0070692_11167486 Ga0070692_111674862 63
372 3300005353 Ga0070669_100844585 Ga0070669_1008445852 63
373 3300005355 Ga0070671_100978099 Ga0070671_1009780992 63
374 3300005355 Ga0070671_101093023 Ga0070671_1010930232 63
375 3300005364 Ga0070673_100408725 Ga0070673_1004087252 63
376 3300005365 Ga0070688_100094524 Ga0070688_1000945242 63
377 3300005365 Ga0070688_101670264 Ga0070688_1016702642 63
378 3300005406 Ga0070703_10004405 Ga0070703_100044054 63
379 3300005406 Ga0070703_10523304 Ga0070703_105233042 63
380 3300005434 Ga0070709_10870496 Ga0070709_108704962 63
381 3300005436 Ga0070713_101165032 Ga0070713_1011650322 63
382 3300005436 Ga0070713_101707603 Ga0070713_1017076031 63
383 3300005437 Ga0070710_10025335 Ga0070710_100253354 63
384 3300005437 Ga0070710_10717286 Ga0070710_107172862 63
385 3300005437 Ga0070710_10760521 Ga0070710_107605212 63
386 3300005438 Ga0070701_10004016 Ga0070701_100040164 63
387 3300005438 Ga0070701_10526600 Ga0070701_105266002 63
388 3300005438 Ga0070701_11332969 Ga0070701_113329691 63
389 3300005440 Ga0070705_100001001 Ga0070705_10000100115 63
390 3300005440 Ga0070705_100006101 Ga0070705_1000061017 63
391 3300005440 Ga0070705_100201953 Ga0070705_1002019532 63
392 3300005440 Ga0070705_100226425 Ga0070705_1002264252 63
393 3300005440 Ga0070705_100554213 Ga0070705_1005542132 63
394 3300005440 Ga0070705_100760892 Ga0070705_1007608922 63
395 3300005441 Ga0070700_100000591 Ga0070700_10000059115 63
396 3300005441 Ga0070700_101195529 Ga0070700_1011955292 63
397 3300005444 Ga0070694_100001923 Ga0070694_10000192315 63
398 3300005444 Ga0070694_100040371 Ga0070694_1000403714 63
399 3300005444 Ga0070694_100048516 Ga0070694_1000485162 63
400 3300005444 Ga0070694_101373747 Ga0070694_1013737472 63
401 3300005445 Ga0070708_100428923 Ga0070708_1004289233 63
402 3300005457 Ga0070662_101274901 Ga0070662_1012749012 63
403 3300005458 Ga0070681_10002547 Ga0070681_100025478 63
404 3300005458 Ga0070681_10073138 Ga0070681_100731384 63
405 3300005459 Ga0068867_100000487 Ga0068867_1000004879 63
406 3300005467 Ga0070706_100152546 Ga0070706_1001525462 63
407 3300005518 Ga0070699_100093440 Ga0070699_1000934402 63
408 3300005518 Ga0070699_101021991 Ga0070699_1010219912 63
409 3300005530 Ga0070679_100002377 Ga0070679_1000023775 63
410 3300005530 Ga0070679_100022031 Ga0070679_1000220315 63
411 3300005530 Ga0070679_101651013 Ga0070679_1016510132 63
412 3300005535 Ga0070684_100936328 Ga0070684_1009363282 63
413 3300005536 Ga0070697_100001057 Ga0070697_1000010575 63
414 3300005536 Ga0070697_100004435 Ga0070697_10000443514 63
415 3300005536 Ga0070697_100310424 Ga0070697_1003104243 63
416 3300005536 Ga0070697_100869690 Ga0070697_1008696901 63
417 3300005536 Ga0070697_101067084 Ga0070697_1010670842 63
418 3300005536 Ga0070697_102100337 Ga0070697_1021003372 63
419 3300005544 Ga0070686_100000527 Ga0070686_10000052726 63
420 3300005544 Ga0070686_100117866 Ga0070686_1001178662 63
421 3300005545 Ga0070695_100000298 Ga0070695_10000029827 63
422 3300005545 Ga0070695_100000498 Ga0070695_10000049818 63
423 3300005545 Ga0070695_100482188 Ga0070695_1004821882 63
424 3300005545 Ga0070695_100666429 Ga0070695_1006664292 63
425 3300005545 Ga0070695_101360760 Ga0070695_1013607602 63
426 3300005546 Ga0070696_100000061 Ga0070696_10000006144 63
427 3300005546 Ga0070696_100002472 Ga0070696_1000024725 63
428 3300005546 Ga0070696_100008068 Ga0070696_1000080684 63
429 3300005546 Ga0070696_100081100 Ga0070696_1000811004 63
430 3300005546 Ga0070696_101200717 Ga0070696_1012007172 63
431 3300005546 Ga0070696_101275852 Ga0070696_1012758522 63
432 3300005547 Ga0070693_100000016 Ga0070693_10000001626 63
433 3300005547 Ga0070693_101142245 Ga0070693_1011422452 63
434 3300005547 Ga0070693_101532506 Ga0070693_1015325061 63
435 3300005549 Ga0070704_100000246 Ga0070704_10000024624 63
436 3300005549 Ga0070704_100014320 Ga0070704_1000143202 63
437 3300005549 Ga0070704_100386245 Ga0070704_1003862452 63
438 3300005549 Ga0070704_100498078 Ga0070704_1004980782 63
439 3300005563 Ga0068855_100000975 Ga0068855_10000097524 63
440 3300005578 Ga0068854_100000366 Ga0068854_1000003669 63
441 3300005614 Ga0068856_100497566 Ga0068856_1004975662 63
442 3300005615 Ga0070702_100000485 Ga0070702_1000004857 63
443 3300005615 Ga0070702_100288871 Ga0070702_1002888713 63
444 3300005616 Ga0068852_100314752 Ga0068852_1003147522 63
445 3300005617 Ga0068859_100014820 Ga0068859_1000148207 63
446 3300005617 Ga0068859_102524061 Ga0068859_1025240612 63
447 3300005618 Ga0068864_100015369 Ga0068864_1000153699 63
448 3300005718 Ga0068866_10000176 Ga0068866_1000017627 63
449 3300005719 Ga0068861_100001699 Ga0068861_10000169918 63
450 3300005841 Ga0068863_100812686 Ga0068863_1008126862 63
451 3300005842 Ga0068858_100000619 Ga0068858_10000061921 63
452 3300005843 Ga0068860_100002570 Ga0068860_1000025708 63
453 3300005844 Ga0068862_100003412 Ga0068862_10000341218 63
454 3300005844 Ga0068862_101293506 Ga0068862_1012935062 63
455 3300005985 Ga0081539_10001364 Ga0081539_100013649 63
456 3300006163 Ga0070715_10468134 Ga0070715_104681342 63
457 3300006173 Ga0070716_100032456 Ga0070716_1000324564 63
458 3300006175 Ga0070712_101997504 Ga0070712_1019975042 63
459 3300006237 Ga0097621_100001255 Ga0097621_1000012552 63
460 3300006237 Ga0097621_101002611 Ga0097621_1010026112 63
461 3300006358 Ga0068871_100003554 Ga0068871_1000035543 63
462 3300006844 Ga0075428_100000532 Ga0075428_10000053230 63
463 3300006844 Ga0075428_100044919 Ga0075428_1000449193 63
464 3300006844 Ga0075428_100233663 Ga0075428_1002336634 63
465 3300006844 Ga0075428_100589625 Ga0075428_1005896251 63
466 3300006846 Ga0075430_100001203 Ga0075430_10000120312 63
467 3300006846 Ga0075430_100452115 Ga0075430_1004521151 63
468 3300006847 Ga0075431_100034541 Ga0075431_1000345412 63
469 3300006847 Ga0075431_100182411 Ga0075431_1001824114 63
470 3300006847 Ga0075431_100210289 Ga0075431_1002102894 63
471 3300006847 Ga0075431_100423176 Ga0075431_1004231762 63
472 3300006852 Ga0075433_10059938 Ga0075433_100599384 63
473 3300006852 Ga0075433_10969767 Ga0075433_109697672 63
474 3300006852 Ga0075433_11670364 Ga0075433_116703642 63
475 3300006871 Ga0075434_100011723 Ga0075434_1000117235 63
476 3300006871 Ga0075434_100069507 Ga0075434_1000695072 63
477 3300006871 Ga0075434_100867554 Ga0075434_1008675542 63
478 3300006871 Ga0075434_101003556 Ga0075434_1010035562 63
479 3300006871 Ga0075434_101247897 Ga0075434_1012478972 63
480 3300006871 Ga0075434_102226237 Ga0075434_1022262372 63
481 3300006880 Ga0075429_100000324 Ga0075429_10000032414 63
482 3300006880 Ga0075429_100154145 Ga0075429_1001541452 63
483 3300006880 Ga0075429_100276506 Ga0075429_1002765063 63
484 3300006880 Ga0075429_100282434 Ga0075429_1002824342 63
485 3300006880 Ga0075429_100691106 Ga0075429_1006911062 63
486 3300006880 Ga0075429_101847963 Ga0075429_1018479632 63
487 3300006881 Ga0068865_100000262 Ga0068865_10000026212 63
488 3300006914 Ga0075436_100027479 Ga0075436_1000274794 63
489 3300006914 Ga0075436_100067227 Ga0075436_1000672273 63
490 3300006914 Ga0075436_100074204 Ga0075436_1000742042 63
491 3300006914 Ga0075436_100188264 Ga0075436_1001882642 63
492 3300006914 Ga0075436_100686426 Ga0075436_1006864261 63
493 3300006914 Ga0075436_101029358 Ga0075436_1010293582 63
494 3300006914 Ga0075436_101330338 Ga0075436_1013303382 63
495 3300006931 Ga0097620_100014822 Ga0097620_1000148227 63
496 3300006931 Ga0097620_102524397 Ga0097620_1025243972 63
497 3300007076 Ga0075435_100000887 Ga0075435_1000008875 63
498 3300007076 Ga0075435_100207814 Ga0075435_1002078144 63
499 3300007076 Ga0075435_100351811 Ga0075435_1003518112 63
500 3300007076 Ga0075435_100861506 Ga0075435_1008615062 63
501 3300007076 Ga0075435_101387526 Ga0075435_1013875261 63
502 3300007265 Ga0099794_10010376 Ga0099794_100103763 63
503 3300007265 Ga0099794_10042383 Ga0099794_100423831 63
504 3300007265 Ga0099794_10093204 Ga0099794_100932042 63
505 3300007265 Ga0099794_10407602 Ga0099794_104076022 63
506 3300007788 Ga0099795_10060495 Ga0099795_100604952 63
507 3300009092 Ga0105250_10033278 Ga0105250_100332783 63
508 3300009093 Ga0105240_10393433 Ga0105240_103934332 63
509 3300009094 Ga0111539_10019692 Ga0111539_100196929 63
510 3300009094 Ga0111539_10080009 Ga0111539_100800094 63
511 3300009098 Ga0105245_10000178 Ga0105245_1000017844 63
512 3300009147 Ga0114129_10014186 Ga0114129_1001418614 63
513 3300009147 Ga0114129_10178816 Ga0114129_101788165 63
514 3300009147 Ga0114129_10602307 Ga0114129_106023072 63
515 3300009147 Ga0114129_11000204 Ga0114129_110002042 63
516 3300009147 Ga0114129_13142443 Ga0114129_131424432 63
517 3300009148 Ga0105243_10000270 Ga0105243_1000027040 63
518 3300009174 Ga0105241_10087687 Ga0105241_100876872 63
519 3300009174 Ga0105241_12191693 Ga0105241_121916932 63
520 3300009176 Ga0105242_10000409 Ga0105242_1000040925 63
521 3300009177 Ga0105248_10665880 Ga0105248_106658802 63
522 3300009177 Ga0105248_13057425 Ga0105248_130574251 63
523 3300009545 Ga0105237_12435979 Ga0105237_124359792 63
524 3300009553 Ga0105249_10012264 Ga0105249_100122649 63
525 3300009553 Ga0105249_12616062 Ga0105249_126160622 63
526 3300010159 Ga0099796_10382424 Ga0099796_103824242 63
527 3300010375 Ga0105239_11021185 Ga0105239_110211852 63
528 3300011119 Ga0105246_10449128 Ga0105246_104491281 63
529 3300012512 Ga0157327_1073375 Ga0157327_10733752 63
530 3300013105 Ga0157369_10495602 Ga0157369_104956022 63
531 3300013105 Ga0157369_12101250 Ga0157369_121012502 63
532 3300013297 Ga0157378_10000340 Ga0157378_1000034027 63
533 3300013306 Ga0163162_10997548 Ga0163162_109975482 63
534 3300013307 Ga0157372_10457782 Ga0157372_104577822 63
535 3300013307 Ga0157372_10654974 Ga0157372_106549742 63
536 3300013308 Ga0157375_12315930 Ga0157375_123159302 63
537 3300014326 Ga0157380_10009920 Ga0157380_100099203 63
538 3300014326 Ga0157380_10387978 Ga0157380_103879783 63
539 3300014326 Ga0157380_12480175 Ga0157380_124801752 63
540 3300014745 Ga0157377_10033972 Ga0157377_100339724 63
541 3300014968 Ga0157379_11809351 Ga0157379_118093512 63
542 3300014969 Ga0157376_10008044 Ga0157376_100080444 63
543 3300017792 Ga0163161_10704586 Ga0163161_107045862 63
544 3300021441 Ga0213871_10261613 Ga0213871_102616132 63
545 3300025711 Ga0207696_1164737 Ga0207696_11647372 63
546 3300025885 Ga0207653_10007033 Ga0207653_100070334 63
547 3300025898 Ga0207692_10169754 Ga0207692_101697542 63
548 3300025898 Ga0207692_10200537 Ga0207692_102005372 63
549 3300025898 Ga0207692_11093516 Ga0207692_110935162 63
550 3300025899 Ga0207642_10002060 Ga0207642_100020606 63
551 3300025901 Ga0207688_10199128 Ga0207688_101991282 63
552 3300025903 Ga0207680_10410608 Ga0207680_104106082 63
553 3300025904 Ga0207647_10277986 Ga0207647_102779862 63
554 3300025905 Ga0207685_10040579 Ga0207685_100405792 63
555 3300025905 Ga0207685_10118032 Ga0207685_101180322 63
556 3300025905 Ga0207685_10610367 Ga0207685_106103672 63
557 3300025906 Ga0207699_10430940 Ga0207699_104309402 63
558 3300025908 Ga0207643_10430303 Ga0207643_104303032 63
559 3300025910 Ga0207684_11534192 Ga0207684_115341922 63
560 3300025911 Ga0207654_10421479 Ga0207654_104214792 63
561 3300025912 Ga0207707_10005405 Ga0207707_1000540511 63
562 3300025913 Ga0207695_10428229 Ga0207695_104282292 63
563 3300025916 Ga0207663_10630391 Ga0207663_106303912 63
564 3300025916 Ga0207663_11663604 Ga0207663_116636042 63
565 3300025917 Ga0207660_10002634 Ga0207660_100026348 63
566 3300025917 Ga0207660_10059649 Ga0207660_100596494 63
567 3300025917 Ga0207660_10743023 Ga0207660_107430232 63
568 3300025918 Ga0207662_10000047 Ga0207662_1000004727 63
569 3300025918 Ga0207662_10194985 Ga0207662_101949852 63
570 3300025921 Ga0207652_10015482 Ga0207652_100154824 63
571 3300025921 Ga0207652_10027972 Ga0207652_100279726 63
572 3300025922 Ga0207646_10170746 Ga0207646_101707464 63
573 3300025922 Ga0207646_10515524 Ga0207646_105155242 63
574 3300025927 Ga0207687_10001597 Ga0207687_100015976 63
575 3300025928 Ga0207700_11356640 Ga0207700_113566401 63
576 3300025928 Ga0207700_11886261 Ga0207700_118862612 63
577 3300025929 Ga0207664_10080713 Ga0207664_100807134 63
578 3300025933 Ga0207706_10819868 Ga0207706_108198682 63
579 3300025934 Ga0207686_10000446 Ga0207686_1000044627 63
580 3300025935 Ga0207709_10002410 Ga0207709_1000241012 63
581 3300025936 Ga0207670_10000462 Ga0207670_100004628 63
582 3300025936 Ga0207670_11492561 Ga0207670_114925612 63
583 3300025938 Ga0207704_10000290 Ga0207704_100002906 63
584 3300025939 Ga0207665_10066961 Ga0207665_100669612 63
585 3300025939 Ga0207665_10101182 Ga0207665_101011822 63
586 3300025939 Ga0207665_10895308 Ga0207665_108953081 63
587 3300025940 Ga0207691_10687266 Ga0207691_106872662 63
588 3300025941 Ga0207711_10524885 Ga0207711_105248852 63
589 3300025941 Ga0207711_10542996 Ga0207711_105429962 63
590 3300025942 Ga0207689_10000148 Ga0207689_1000014841 63
591 3300025942 Ga0207689_10719676 Ga0207689_107196762 63
592 3300025949 Ga0207667_10004155 Ga0207667_1000415514 63
593 3300025960 Ga0207651_10448678 Ga0207651_104486782 63
594 3300025960 Ga0207651_12011099 Ga0207651_120110992 63
595 3300025961 Ga0207712_10012530 Ga0207712_100125302 63
596 3300025981 Ga0207640_10005645 Ga0207640_100056457 63
597 3300026023 Ga0207677_10002010 Ga0207677_100020102 63
598 3300026023 Ga0207677_12143414 Ga0207677_121434142 63
599 3300026035 Ga0207703_10001208 Ga0207703_1000120820 63
600 3300026041 Ga0207639_10360987 Ga0207639_103609871 63
601 3300026075 Ga0207708_10000676 Ga0207708_100006764 63
602 3300026078 Ga0207702_10076459 Ga0207702_100764594 63
603 3300026078 Ga0207702_11999002 Ga0207702_119990021 63
604 3300026088 Ga0207641_10294804 Ga0207641_102948042 63
605 3300026088 Ga0207641_11083642 Ga0207641_110836421 63
606 3300026089 Ga0207648_10000018 Ga0207648_10000018116 63
607 3300026095 Ga0207676_10490959 Ga0207676_104909592 63
608 3300026118 Ga0207675_100000170 Ga0207675_10000017041 63
609 3300026142 Ga0207698_10098960 Ga0207698_100989602 63
610 3300027360 Ga0209969_1018522 Ga0209969_10185222 63
611 3300027364 Ga0209967_1025342 Ga0209967_10253422 63
612 3300027378 Ga0209981_1008520 Ga0209981_10085202 63
613 3300027424 Ga0209984_1070459 Ga0209984_10704592 63
614 3300027462 Ga0210000_1000974 Ga0210000_10009742 63
615 3300027462 Ga0210000_1015320 Ga0210000_10153202 63
616 3300027526 Ga0209968_1005686 Ga0209968_10056861 63
617 3300027526 Ga0209968_1099133 Ga0209968_10991332 63
618 3300027543 Ga0209999_1011110 Ga0209999_10111102 63
619 3300027543 Ga0209999_1012664 Ga0209999_10126642 63
620 3300027614 Ga0209970_1061591 Ga0209970_10615912 63
621 3300027665 Ga0209983_1052966 Ga0209983_10529662 63
622 3300027665 Ga0209983_1058729 Ga0209983_10587292 63
623 3300027671 Ga0209588_1052779 Ga0209588_10527792 63
624 3300027682 Ga0209971_1002798 Ga0209971_10027984 63
625 3300027682 Ga0209971_1030717 Ga0209971_10307173 63
626 3300027695 Ga0209966_1002048 Ga0209966_10020484 63
627 3300027717 Ga0209998_10023646 Ga0209998_100236463 63
628 3300027717 Ga0209998_10129134 Ga0209998_101291342 63
629 3300027876 Ga0209974_10090429 Ga0209974_100904292 63
630 3300027907 Ga0207428_10000835 Ga0207428_1000083513 63
631 3300027907 Ga0207428_10963435 Ga0207428_109634352 63
632 3300028380 Ga0268265_10001514 Ga0268265_1000151416 63
633 3300028380 Ga0268265_10345993 Ga0268265_103459933 63
634 3300028380 Ga0268265_11860337 Ga0268265_118603372 63
635 3300028381 Ga0268264_10001414 Ga0268264_1000141414 63
636 3300028381 Ga0268264_10292650 Ga0268264_102926503 63
637 3300028381 Ga0268264_12011008 Ga0268264_120110082 63
638 3300028381 Ga0268264_12487117 Ga0268264_124871172 63
639 3300031548 Ga0307408_100166145 Ga0307408_1001661451 63
640 3300031548 Ga0307408_100318043 Ga0307408_1003180433 63
641 3300031548 Ga0307408_100668803 Ga0307408_1006688031 63
642 3300031665 Ga0316575_10083667 Ga0316575_100836672 63
643 3300031691 Ga0316579_10001744 Ga0316579_100017447 63
644 3300031728 Ga0316578_10240239 Ga0316578_102402392 63
645 3300031731 Ga0307405_10367349 Ga0307405_103673492 63
646 3300031731 Ga0307405_10775875 Ga0307405_107758751 63
647 3300031731 Ga0307405_11352031 Ga0307405_113520312 63
648 3300031901 Ga0307406_11720110 Ga0307406_117201102 63
649 3300031911 Ga0307412_11185843 Ga0307412_111858432 63
650 3300031995 Ga0307409_100353208 Ga0307409_1003532082 63
651 3300031995 Ga0307409_102682971 Ga0307409_1026829711 63
652 3300032002 Ga0307416_100162947 Ga0307416_1001629473 63
653 3300032002 Ga0307416_101795864 Ga0307416_1017958642 63
654 3300032002 Ga0307416_102224058 Ga0307416_1022240582 63
655 3300032002 Ga0307416_103002130 Ga0307416_1030021302 63
656 3300032002 Ga0307416_103098345 Ga0307416_1030983452 63
657 3300032005 Ga0307411_12057127 Ga0307411_120571272 63
658 3300032133 Ga0316583_10000604 Ga0316583_100006048 63
659 3300032139 Ga0316580_10047105 Ga0316580_100471052 63
660 3300034816 Ga0373930_0108413 Ga0373930_0108413_204_395 63
661 3300034817 Ga0373948_0065305 Ga0373948_0065305_275_466 63
662 3300034818 Ga0373950_0067147 Ga0373950_0067147_359_550 63
663 3300034818 Ga0373950_0131504 Ga0373950_0131504_272_463 63
664 3300034819 Ga0373958_0012755 Ga0373958_0012755_1075_1266 63
665 3300034819 Ga0373958_0185747 Ga0373958_0185747_249_440 63
666 3300034820 Ga0373959_0144219 Ga0373959_0144219_348_539 63
667 3300035083 Ga0373926_0011387 Ga0373926_0011387_2649_2840 63
668 3300035083 Ga0373926_0019898 Ga0373926_0019898_854_1045 63
669 3300035084 Ga0373928_0064479 Ga0373928_0064479_138_329 63
670 3300035084 Ga0373928_0096512 Ga0373928_0096512_345_536 63
671 3300035085 Ga0373929_0009025 Ga0373929_0009025_1382_1573 63
672 3300035085 Ga0373929_0057483 Ga0373929_0057483_213_404 63
673 3300035086 Ga0373934_0458947 Ga0373934_0458947_94_285 63
674 3300035088 Ga0373940_0004143 Ga0373940_0004143_551_742 63
675 3300035089 Ga0373944_0156253 Ga0373944_0156253_270_461 63
676 3300035090 Ga0373949_0015962 Ga0373949_0015962_318_509 63
677 3300035091 Ga0373951_0091522 Ga0373951_0091522_52_243 63
678 3300035092 Ga0373952_0070289 Ga0373952_0070289_204_395 63
679 3300035092 Ga0373952_0114563 Ga0373952_0114563_127_318 63
680 3300035111 Ga0373923_0016921 Ga0373923_0016921_1001_1192 63
681 3300035111 Ga0373923_0221620 Ga0373923_0221620_606_797 63
682 3300035112 Ga0373932_0004155 Ga0373932_0004155_1385_1576 63
683 3300035112 Ga0373932_0015106 Ga0373932_0015106_1013_1204 63
684 3300035112 Ga0373932_0104604 Ga0373932_0104604_640_831 63
685 3300035113 Ga0373936_0036352 Ga0373936_0036352_91_282 63
686 3300035113 Ga0373936_0151947 Ga0373936_0151947_531_731 63
687 3300035114 Ga0373939_0006398 Ga0373939_0006398_1265_1456 63
688 3300035115 Ga0373941_0003680 Ga0373941_0003680_92_283 63
689 3300035116 Ga0373945_0098308 Ga0373945_0098308_546_737 63
690 3300035117 Ga0373953_0002689 Ga0373953_0002689_3066_3257 63
691 3300035117 Ga0373953_0153525 Ga0373953_0153525_708_899 63
692 3300035118 Ga0373954_0062678 Ga0373954_0062678_939_1130 63
693 3300035118 Ga0373954_0450385 Ga0373954_0450385_248_439 63
694 3300035119 Ga0373956_0228536 Ga0373956_0228536_511_702 63
695 3300035120 Ga0373957_0087551 Ga0373957_0087551_287_478 63
696 3300035121 Ga0373960_0007720 Ga0373960_0007720_918_1109 63
697 3300035121 Ga0373960_0263211 Ga0373960_0263211_253_444 63
698 3300035170 Ga0373943_0011379 Ga0373943_0011379_3262_3453 63
699 3300035171 Ga0373946_0030062 Ga0373946_0030062_1636_1827 63
700 3300035171 Ga0373946_0030581 Ga0373946_0030581_53_244 63
701 3300035172 Ga0373955_0018664 Ga0373955_0018664_1797_1988 63
702 3300035172 Ga0373955_0586566 Ga0373955_0586566_228_419 63
703 3300035207 Ga0373942_0025923 Ga0373942_0025923_1014_1205 63
704 3300035207 Ga0373942_0049660 Ga0373942_0049660_760_951 63
705 3300035241 Ga0373961_0129313 Ga0373961_0129313_198_389 63
706 3300035241 Ga0373961_0275045 Ga0373961_0275045_257_448 63
707 3300035242 Ga0373962_0006162 Ga0373962_0006162_682_873 63
708 3300035242 Ga0373962_0044564 Ga0373962_0044564_738_929 63
709 3300035398 Ga0316574_0884697 Ga0316574_0884697_142_339 63
710 3300035410 Ga0373924_0177152 Ga0373924_0177152_312_512 63
711 3300035410 Ga0373924_0364446 Ga0373924_0364446_324_515 63
712 3300035691 Ga0373931_0003435 Ga0373931_0003435_1879_2070 63
713 3300035691 Ga0373931_0016082 Ga0373931_0016082_2111_2302 63
714 3300035691 Ga0373931_0111710 Ga0373931_0111710_337_528 63
715 3300035691 Ga0373931_0576443 Ga0373931_0576443_445_636 63
716 3300035692 Ga0373935_0062223 Ga0373935_0062223_1137_1328 63
717 3300035692 Ga0373935_0461452 Ga0373935_0461452_574_765 63
718 3300035692 Ga0373935_0869174 Ga0373935_0869174_255_446 63
719 3300035695 Ga0373927_0008181 Ga0373927_0008181_3864_4055 63
720 3300035695 Ga0373927_0444094 Ga0373927_0444094_625_816 63
721 3300035695 Ga0373927_1161960 Ga0373927_1161960_55_246 63
722 3300035724 Ga0373933_0009986 Ga0373933_0009986_1087_1278 63
723 3300035724 Ga0373933_0835692 Ga0373933_0835692_396_587 63
724 3300035725 Ga0373947_0015033 Ga0373947_0015033_138_329 63
725 3300035725 Ga0373947_0426491 Ga0373947_0426491_598_789 63
726 3300035725 Ga0373947_0547921 Ga0373947_0547921_409_600 63
727 3300036401 Ga0373937_0032065 Ga0373937_0032065_559_750 63
728 3300036401 Ga0373937_0486637 Ga0373937_0486637_386_577 63
729 3300036647 Ga0316582_0005132 Ga0316582_0005132_3411_3608 63
730 3300036712 Ga0316584_0107814 Ga0316584_0107814_1306_1503 63
731 3300037068 Ga0373925_0042552 Ga0373925_0042552_1554_1745 63
732 3300037068 Ga0373925_0435145 Ga0373925_0435145_381_572 63
733 3300037068 Ga0373925_0511106 Ga0373925_0511106_67_258 63
734 3300037471 Ga0395905_0883615 Ga0395905_0883615_346_537 63
735 3300037471 Ga0395905_1588208 Ga0395905_1588208_65_256 63
736 3300037588 Ga0316581_0004172 Ga0316581_0004172_3351_3548 63
737 3300039437 Ga0436365_0301302 Ga0436365_0301302_123_314 63
738 3300039438 Ga0436360_1277711 Ga0436360_1277711_963_1154 63
739 3300041452 Ga0451793_1552121 Ga0451793_1552121_87_278 63
740 3300041511 Ga0451855_0214715 Ga0451855_0214715_624_815 63
741 3300042001 Ga0439441_000373 Ga0439441_000373_3849_4043 63
742 3300042001 Ga0439441_006192 Ga0439441_006192_838_1029 63
743 3300042001 Ga0439441_048398 Ga0439441_048398_547_738 63
744 3300042003 Ga0439443_026787 Ga0439443_026787_388_579 63
745 3300042008 Ga0439450_074715 Ga0439450_074715_342_533 63
746 3300042009 Ga0439451_020599 Ga0439451_020599_427_618 63
747 3300042015 Ga0439462_0231930 Ga0439462_0231930_148_339 63
748 3300042436 Ga0439435_0000244 Ga0439435_0000244_5176_5367 63
749 3300042436 Ga0439435_0000802 Ga0439435_0000802_3849_4043 63
750 3300042436 Ga0439435_0066814 Ga0439435_0066814_793_1020 63
751 3300042437 Ga0439444_0000403 Ga0439444_0000403_3277_3471 63
752 3300042437 Ga0439444_0001242 Ga0439444_0001242_2811_3002 63
753 3300042437 Ga0439444_0191307 Ga0439444_0191307_271_462 63
754 3300042461 Ga0439460_0001871 Ga0439460_0001871_963_1154 63
755 3300042532 Ga0450893_0029174 Ga0450893_0029174_626_817 63
756 3300042876 Ga0451577_0828954 Ga0451577_0828954_82_273 63
757 3300042876 Ga0451577_2013956 Ga0451577_2013956_195_386 63
758 3300044706 Ga0466964_0210609 Ga0466964_0210609_498_692 63
759 3300044901 Ga0466960_0977279 Ga0466960_0977279_87_278 63
760 3300045051 Ga0451576_0041328 Ga0451576_0041328_647_838 63
761 3300045051 Ga0451576_0178889 Ga0451576_0178889_1346_1537 63
762 3300045051 Ga0451576_0276893 Ga0451576_0276893_349_540 63
763 3300046454 Ga0495592_0863280 Ga0495592_0863280_234_425 63
764 3300046455 Ga0495603_0070331 Ga0495603_0070331_1607_1798 63
765 3300046459 Ga0495629_0088991 Ga0495629_0088991_1277_1477 63
766 3300046462 Ga0495651_0161671 Ga0495651_0161671_370_561 63
767 3300046463 Ga0495653_0390478 Ga0495653_0390478_10_201 63
768 3300046472 Ga0495580_0036842 Ga0495580_0036842_2345_2536 63
769 3300046472 Ga0495580_0346732 Ga0495580_0346732_173_364 63
770 3300046473 Ga0495582_0018344 Ga0495582_0018344_95_286 63
771 3300046475 Ga0495639_0011815 Ga0495639_0011815_648_839 63
772 3300046475 Ga0495639_0478615 Ga0495639_0478615_260_460 63
773 3300046476 Ga0495662_0241369 Ga0495662_0241369_387_587 63
774 3300046499 Ga0495594_0294827 Ga0495594_0294827_296_487 63
775 3300046516 Ga0495628_0254377 Ga0495628_0254377_607_807 63
776 3300046517 Ga0495630_0085122 Ga0495630_0085122_1694_1894 63
777 3300046517 Ga0495630_0514800 Ga0495630_0514800_436_627 63
778 3300046523 Ga0495644_0357483 Ga0495644_0357483_175_366 63
779 3300046525 Ga0495663_0373144 Ga0495663_0373144_44_235 63
780 3300046528 Ga0495642_0031663 Ga0495642_0031663_1352_1543 63
781 3300046528 Ga0495642_0224820 Ga0495642_0224820_456_650 63
782 3300046529 Ga0495652_0142088 Ga0495652_0142088_167_358 63
783 3300046529 Ga0495652_0466951 Ga0495652_0466951_29_220 63
784 3300046531 Ga0495665_0153336 Ga0495665_0153336_285_476 63
785 3300046531 Ga0495665_0279099 Ga0495665_0279099_155_355 63
786 3300046533 Ga0495640_0185666 Ga0495640_0185666_291_491 63
787 3300046535 Ga0495586_0012798 Ga0495586_0012798_3160_3351 63
788 3300046535 Ga0495586_0415695 Ga0495586_0415695_548_748 63
789 3300046537 Ga0495598_0099675 Ga0495598_0099675_380_571 63
790 3300046537 Ga0495598_0312795 Ga0495598_0312795_35_229 63
791 3300046539 Ga0495621_0465641 Ga0495621_0465641_327_518 63
792 3300046543 Ga0495645_0605853 Ga0495645_0605853_124_315 63
793 3300046559 Ga0495667_0144445 Ga0495667_0144445_603_794 63
794 3300046559 Ga0495667_0249257 Ga0495667_0249257_690_881 63
795 3300046615 Ga0495656_0159494 Ga0495656_0159494_765_956 63
796 3300046642 Ga0495634_0230055 Ga0495634_0230055_61_261 63
797 3300046663 Ga0495635_0120013 Ga0495635_0120013_1073_1264 63
798 3300046663 Ga0495635_0873269 Ga0495635_0873269_239_430 63
799 3300046664 Ga0495659_0136821 Ga0495659_0136821_420_611 63
800 3300046674 Ga0495588_0176427 Ga0495588_0176427_319_510 63
801 3300046675 Ga0495657_0098049 Ga0495657_0098049_399_590 63
802 3300046678 Ga0495599_0107212 Ga0495599_0107212_610_801 63
803 3300046681 Ga0495647_0342503 Ga0495647_0342503_393_584 63
804 3300046683 Ga0495658_0006591 Ga0495658_0006591_2648_2839 63
805 3300046684 Ga0495669_0014591 Ga0495669_0014591_256_447 63
806 3300046684 Ga0495669_0562850 Ga0495669_0562850_159_350 63
807 3300046690 Ga0495624_0250837 Ga0495624_0250837_263_463 63
808 3300046691 Ga0495670_0321599 Ga0495670_0321599_129_320 63
809 3300046809 Ga0495600_0132846 Ga0495600_0132846_358_549 63
810 3300046809 Ga0495600_0379195 Ga0495600_0379195_433_624 63
811 3300047315 Ga0495581_0464384 Ga0495581_0464384_478_678 63
812 3300047317 Ga0495604_0208304 Ga0495604_0208304_662_862 63
813 3300047318 Ga0495636_0359066 Ga0495636_0359066_430_621 63
814 3300047319 Ga0495674_0072245 Ga0495674_0072245_1995_2195 63
815 3300047319 Ga0495674_1409804 Ga0495674_1409804_14_205 63
816 3300047322 Ga0495680_0020117 Ga0495680_0020117_3022_3213 63
817 3300047445 Ga0495677_0204707 Ga0495677_0204707_306_497 63
818 3300047445 Ga0495677_0371655 Ga0495677_0371655_202_393 63
819 3300047471 Ga0495684_0071170 Ga0495684_0071170_2189_2380 63
820 3300047471 Ga0495684_0540081 Ga0495684_0540081_465_665 63
821 3300047673 Ga0495593_0157612 Ga0495593_0157612_260_451 63
822 3300048904 Ga0496101_0850233 Ga0496101_0850233_399_590 63
823 3300048917 Ga0496114_0838062 Ga0496114_0838062_248_439 63
824 3300049568 Ga0501031_0354837 Ga0501031_0354837_406_597 63
825 3300049568 Ga0501031_0410465 Ga0501031_0410465_537_728 63
826 3300049568 Ga0501031_0592929 Ga0501031_0592929_59_250 63
827 3300049570 Ga0501033_0085137 Ga0501033_0085137_11_202 63
828 3300049570 Ga0501033_0352324 Ga0501033_0352324_399_590 63
829 3300049570 Ga0501033_0563576 Ga0501033_0563576_27_218 63
830 3300049572 Ga0501036_0166127 Ga0501036_0166127_1346_1537 63
831 3300049572 Ga0501036_0320712 Ga0501036_0320712_71_262 63
832 3300049572 Ga0501036_0383962 Ga0501036_0383962_917_1111 63
833 3300049572 Ga0501036_0981828 Ga0501036_0981828_483_674 63
834 3300049572 Ga0501036_1408520 Ga0501036_1408520_44_235 63
835 3300049573 Ga0501037_0397562 Ga0501037_0397562_740_931 63
836 3300049574 Ga0501038_0051781 Ga0501038_0051781_1367_1558 63
837 3300049574 Ga0501038_1101436 Ga0501038_1101436_275_466 63
838 3300049574 Ga0501038_1355395 Ga0501038_1355395_17_208 63
839 3300049575 Ga0501039_0030832 Ga0501039_0030832_2090_2281 63
840 3300049575 Ga0501039_0072656 Ga0501039_0072656_286_477 63
841 3300049575 Ga0501039_0148698 Ga0501039_0148698_691_882 63
842 3300049575 Ga0501039_0372960 Ga0501039_0372960_360_551 63
843 3300049576 Ga0501040_0005353 Ga0501040_0005353_4776_4967 63
844 3300049576 Ga0501040_0009124 Ga0501040_0009124_6198_6389 63
845 3300049576 Ga0501040_0045658 Ga0501040_0045658_1930_2121 63
846 3300049576 Ga0501040_0420810 Ga0501040_0420810_490_681 63
847 3300049576 Ga0501040_1295159 Ga0501040_1295159_246_437 63
848 3300049577 Ga0501041_0022456 Ga0501041_0022456_2703_2894 63
849 3300049577 Ga0501041_0024383 Ga0501041_0024383_565_756 63
850 3300049577 Ga0501041_0025733 Ga0501041_0025733_2017_2208 63
851 3300049577 Ga0501041_0186183 Ga0501041_0186183_168_359 63
852 3300049577 Ga0501041_0195319 Ga0501041_0195319_32_223 63
853 3300049577 Ga0501041_0437333 Ga0501041_0437333_435_626 63
854 3300049577 Ga0501041_1104931 Ga0501041_1104931_225_416 63
855 3300049578 Ga0501042_0023776 Ga0501042_0023776_1807_1998 63
856 3300049578 Ga0501042_0294664 Ga0501042_0294664_209_400 63
857 3300049578 Ga0501042_0382640 Ga0501042_0382640_541_732 63
858 3300049578 Ga0501042_1125266 Ga0501042_1125266_357_548 63
859 3300049579 Ga0501043_0141342 Ga0501043_0141342_714_905 63
860 3300049579 Ga0501043_1086691 Ga0501043_1086691_355_546 63
861 3300049580 Ga0501046_0050466 Ga0501046_0050466_1294_1485 63
862 3300049580 Ga0501046_0083967 Ga0501046_0083967_468_659 63
863 3300049580 Ga0501046_0151977 Ga0501046_0151977_727_918 63
864 3300049580 Ga0501046_1072919 Ga0501046_1072919_312_503 63
865 3300049582 Ga0501048_0011732 Ga0501048_0011732_5098_5289 63
866 3300049582 Ga0501048_0300665 Ga0501048_0300665_732_923 63
867 3300049582 Ga0501048_0484440 Ga0501048_0484440_279_470 63
868 3300049582 Ga0501048_1061073 Ga0501048_1061073_222_413 63
869 3300049583 Ga0501067_0395672 Ga0501067_0395672_361_552 63
870 3300049584 Ga0501068_0168606 Ga0501068_0168606_211_402 63
871 3300049584 Ga0501068_1206579 Ga0501068_1206579_126_320 63
872 3300049585 Ga0501069_0984083 Ga0501069_0984083_162_353 63
873 3300049587 Ga0501071_0075648 Ga0501071_0075648_472_663 63
874 3300049587 Ga0501071_0094598 Ga0501071_0094598_1721_1912 63
875 3300049587 Ga0501071_0717474 Ga0501071_0717474_504_695 63
876 3300049587 Ga0501071_0722109 Ga0501071_0722109_476_667 63
877 3300049587 Ga0501071_1388188 Ga0501071_1388188_61_252 63
878 3300049588 Ga0501072_0004517 Ga0501072_0004517_9262_9453 63
879 3300049588 Ga0501072_0088238 Ga0501072_0088238_1114_1317 63
880 3300049588 Ga0501072_0237773 Ga0501072_0237773_398_589 63
881 3300049588 Ga0501072_0286288 Ga0501072_0286288_867_1058 63
882 3300049590 Ga0501074_0382514 Ga0501074_0382514_549_740 63
883 3300049590 Ga0501074_1136978 Ga0501074_1136978_275_466 63
884 3300049591 Ga0501075_0010458 Ga0501075_0010458_357_548 63
885 3300049591 Ga0501075_0063617 Ga0501075_0063617_515_706 63
886 3300049592 Ga0501076_0000285 Ga0501076_0000285_1959_2150 63
887 3300049741 Ga0501079_0002449 Ga0501079_0002449_2003_2194 63
888 3300049741 Ga0501079_0141741 Ga0501079_0141741_850_1041 63
889 3300049741 Ga0501079_0371832 Ga0501079_0371832_833_1024 63
890 3300049741 Ga0501079_1439279 Ga0501079_1439279_309_500 63
891 3300049742 Ga0501080_1628257 Ga0501080_1628257_161_352 63
892 3300049743 Ga0501081_0028038 Ga0501081_0028038_827_1018 63
893 3300049743 Ga0501081_0039700 Ga0501081_0039700_2631_2822 63
894 3300049743 Ga0501081_0366773 Ga0501081_0366773_785_976 63
895 3300049743 Ga0501081_1308510 Ga0501081_1308510_96_287 63
896 3300049822 Ga0501035_0171240 Ga0501035_0171240_239_430 63
897 3300049824 Ga0501045_0020545 Ga0501045_0020545_859_1050 63
898 3300049824 Ga0501045_0067205 Ga0501045_0067205_755_946 63
899 3300049824 Ga0501045_0133444 Ga0501045_0133444_787_978 63
900 3300049824 Ga0501045_0195308 Ga0501045_0195308_298_489 63
901 3300049824 Ga0501045_0451688 Ga0501045_0451688_563_757 63
902 3300049824 Ga0501045_0714374 Ga0501045_0714374_140_331 63
903 3300050489 nmdc:mga03683_237294_c1 nmdc:mga03683_237294_c1_298_489 63
904 3300050507 nmdc:mga05p37_1126_c1 nmdc:mga05p37_1126_c1_29618_29809 63
905 3300050507 nmdc:mga05p37_1420047_c1 nmdc:mga05p37_1420047_c1_342_533 63
906 3300050507 nmdc:mga05p37_2024549_c1 nmdc:mga05p37_2024549_c1_76_270 63
907 3300050507 nmdc:mga05p37_257817_c1 nmdc:mga05p37_257817_c1_1247_1441 63
908 3300050507 nmdc:mga05p37_573091_c1 nmdc:mga05p37_573091_c1_893_1087 63
909 3300050508 nmdc:mga09592_1294054_c1 nmdc:mga09592_1294054_c1_186_380 63
910 3300050508 nmdc:mga09592_1655_c1 nmdc:mga09592_1655_c1_2481_2672 63
911 3300050508 nmdc:mga09592_254698_c1 nmdc:mga09592_254698_c1_594_785 63
912 3300050508 nmdc:mga09592_382050_c1 nmdc:mga09592_382050_c1_600_794 63
913 3300050509 nmdc:mga0qj67_1518541_c1 nmdc:mga0qj67_1518541_c1_74_268 63
914 3300050509 nmdc:mga0qj67_1548429_c1 nmdc:mga0qj67_1548429_c1_81_272 63
915 3300050509 nmdc:mga0qj67_648_c1 nmdc:mga0qj67_648_c1_1137_1328 63
916 3300050510 nmdc:mga06r32_1200468_c1 nmdc:mga06r32_1200468_c1_135_326 63
917 3300050510 nmdc:mga06r32_134302_c1 nmdc:mga06r32_134302_c1_1459_1653 63
918 3300050510 nmdc:mga06r32_490113_c1 nmdc:mga06r32_490113_c1_487_678 63
919 3300050510 nmdc:mga06r32_730038_c1 nmdc:mga06r32_730038_c1_537_728 63
920 3300050510 nmdc:mga06r32_877268_c1 nmdc:mga06r32_877268_c1_285_479 63
921 3300050511 nmdc:mga08y16_1331314_c1 nmdc:mga08y16_1331314_c1_471_662 63
922 3300050511 nmdc:mga08y16_4849_c1 nmdc:mga08y16_4849_c1_4401_4592 63
923 3300050511 nmdc:mga08y16_48972_c1 nmdc:mga08y16_48972_c1_138_329 63
924 3300050511 nmdc:mga08y16_54458_c1 nmdc:mga08y16_54458_c1_2450_2641 63
925 3300050512 nmdc:mga0n895_107701_c1 nmdc:mga0n895_107701_c1_237_428 63
926 3300050512 nmdc:mga0n895_1506760_c1 nmdc:mga0n895_1506760_c1_30_221 63
927 3300050512 nmdc:mga0n895_491896_c1 nmdc:mga0n895_491896_c1_162_353 63
928 3300050512 nmdc:mga0n895_754560_c1 nmdc:mga0n895_754560_c1_538_729 63
929 3300050512 nmdc:mga0n895_87725_c1 nmdc:mga0n895_87725_c1_381_572 63
930 3300050512 nmdc:mga0n895_914882_c1 nmdc:mga0n895_914882_c1_21_215 63
931 3300050513 nmdc:mga0rr50_1605105_c1 nmdc:mga0rr50_1605105_c1_61_255 63
932 3300050513 nmdc:mga0rr50_1816_c1 nmdc:mga0rr50_1816_c1_10091_10282 63
933 3300050513 nmdc:mga0rr50_217129_c1 nmdc:mga0rr50_217129_c1_100_291 63
934 3300050513 nmdc:mga0rr50_288186_c1 nmdc:mga0rr50_288186_c1_844_1038 63
935 3300050513 nmdc:mga0rr50_836208_c1 nmdc:mga0rr50_836208_c1_582_773 63
936 3300050514 nmdc:mga08x19_132992_c1 nmdc:mga08x19_132992_c1_874_1068 63
937 3300050514 nmdc:mga08x19_271649_c1 nmdc:mga08x19_271649_c1_432_623 63
938 3300050514 nmdc:mga08x19_31181_c1 nmdc:mga08x19_31181_c1_3009_3203 63
939 3300050514 nmdc:mga08x19_3563_c1 nmdc:mga08x19_3563_c1_5357_5548 63
940 3300050514 nmdc:mga08x19_41359_c1 nmdc:mga08x19_41359_c1_2271_2462 63
941 3300050514 nmdc:mga08x19_8158_c1 nmdc:mga08x19_8158_c1_1233_1427 63
942 3300050514 nmdc:mga08x19_932484_c1 nmdc:mga08x19_932484_c1_400_594 63
943 3300050515 nmdc:mga0a205_1274417_c1 nmdc:mga0a205_1274417_c1_67_258 63
944 3300050515 nmdc:mga0a205_156644_c1 nmdc:mga0a205_156644_c1_47_238 63
945 3300050515 nmdc:mga0a205_3207_c1 nmdc:mga0a205_3207_c1_12440_12631 63
946 3300050515 nmdc:mga0a205_624755_c1 nmdc:mga0a205_624755_c1_229_429 63
947 3300053077 Ga0495601_0393287 Ga0495601_0393287_627_827 63
948 3300053078 Ga0495612_0233774 Ga0495612_0233774_148_348 63
949 3300054114 Ga0501084_0035548 Ga0501084_0035548_488_679 63
950 3300054114 Ga0501084_0404933 Ga0501084_0404933_91_282 63
951 3300059421 Ga0590071_212572 Ga0590071_212572_232_423 63
952 3300060353 Ga0501082_0018673 Ga0501082_0018673_3404_3595 63
953 3300060353 Ga0501082_0364383 Ga0501082_0364383_370_561 63
954 3300060353 Ga0501082_1204234 Ga0501082_1204234_306_497 63
955 3300061734 Ga0530510_0000091 Ga0530510_0000091_37395_37586 63

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

17

56

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgs-assembly1.cif.gz_B crystal structure of arsenite oxidase from alcaligenes faecalis (af aio) bound to antimony oxyanion 0.9514 13 41
1g8j-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9501 13 40
1g8k-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9487 13 41
2pk7-assembly1.cif.gz_B crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.9157 8 59
2pk7-assembly1.cif.gz_A crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.9088 8 59
ID Description Score Start End Superfamily
af_Q5U1Z8_55_112_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9844 12 56 2.20.25.10
2hf1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.949 12 59 2.20.25.10
1g8kF00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9465 13 40 2.102.10.10
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9434 12 59 2.20.25.10
af_O33186_9_68_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9149 12 58 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A1R4I215-F1-model_v4 UPF0434 protein CZ787_11875 1.001 12 58 GO:0005829
AF-A0A521GYE5-F1-model_v4 UPF0434 protein EYC62_03595 0.9984 3 56 GO:0005829
AF-A0A2A5BFY4-F1-model_v4 UPF0434 protein COA93_12405 0.9977 3 57 GO:0005829
AF-A0A2E7PIZ8-F1-model_v4 UPF0434 protein CMM26_04985 0.9976 3 56 GO:0005829
AF-A0A7Z9K2R0-F1-model_v4 UPF0434 protein EYO23_09205 0.9961 5 58 GO:0005829

Feature Viewer

pLDDT pTM Quality
87.39 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map