F486730

General Info

Members Datasets Scaffolds Average Seq Length
955 786 556 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023207|2524450795
Length 264
Sequence TQAENNPWPIDTGEQTVWLRKAARVINPPMKKLDRLPTHAEFAHVTDWVFDLDNTLYPHHVNLFSQIDRNMTAYVAELLSLEPAEAKKLQKEYYRDHGTTLQGLMLHHGIDPNDFLERAHAIDYSVVPADPALGEAIKALPGRKFIFTNGSVAHAEMTARALGILEHFNDIFDIVAAGFIPKPAGDTYDKFMGLHRIDTANAVMFEDLPRNLIVPKALGMKTVLLVPRNLEYEFAEAWETSSDADDQIDYVTEDLAGFLRSVVV

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
24 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
32 2519899620 Rhizobium sp. Pop5 Isolate Nodule
33 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
34 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
35 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
36 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
37 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
38 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
39 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
40 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
41 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
42 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
43 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
44 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
45 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
46 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
47 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
48 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
49 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
50 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
51 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
52 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
53 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
54 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
55 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
56 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
57 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
58 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
59 2643221557 Ensifer sp. Root558 Isolate Unclassified
60 2643221558 Rhizobium sp. Root149 Isolate Unclassified
61 2643221607 Rhizobium sp. Root73 Isolate Unclassified
62 2643221610 Ensifer sp. Root74 Isolate Unclassified
63 2643221618 Ensifer sp. Root231 Isolate Unclassified
64 2643221626 Ensifer sp. Root31 Isolate Unclassified
65 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
66 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
67 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
68 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
69 2643221655 Ensifer sp. Root1252 Isolate Unclassified
70 2643221659 Ensifer sp. Root127 Isolate Unclassified
71 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
72 2643221668 Ensifer sp. Root423 Isolate Unclassified
73 2643221675 Ensifer sp. Root1298 Isolate Unclassified
74 2643221680 Ensifer sp. Root1312 Isolate Unclassified
75 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
76 2643221688 Rhizobium sp. Root482 Isolate Unclassified
77 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
78 2643221698 Ensifer sp. Root142 Isolate Unclassified
79 2643221712 Ensifer sp. Root258 Isolate Unclassified
80 2643221718 Rhizobium sp. Root268 Isolate Unclassified
81 2643221719 Rhizobium sp. Root274 Isolate Unclassified
82 2643221723 Ensifer sp. Root278 Isolate Unclassified
83 2643221726 Ensifer sp. Root954 Isolate Unclassified
84 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
85 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
86 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
87 2718217927 Rhizobium sp. N324 Isolate Nodule
88 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
89 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
90 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
91 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
92 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
93 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
94 2718218423 Rhizobium sp. N941 Isolate Nodule
95 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
96 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
97 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
98 2721755809 Rhizobium sp. N541 Isolate Nodule
99 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
100 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
101 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
102 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
103 2738541293 Rhizobium sp. GV031 Isolate Unclassified
104 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
105 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
106 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
107 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
108 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
109 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
110 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
111 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
112 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
113 2791355256 Rhizobium sp. M10 Isolate Nodule
114 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
115 2791355261 Rhizobium sp. J15 Isolate Nodule
116 2791355263 Rhizobium chutanense C5 Isolate Nodule
117 2791355265 Rhizobium sp. H4 Isolate Nodule
118 2791355266 Rhizobium sp. L43 Isolate Nodule
119 2791355267 Rhizobium sp. L18 Isolate Nodule
120 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
121 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
122 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
123 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
124 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
125 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
126 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
127 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
128 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
129 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
130 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
131 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
132 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
133 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
134 2838048938 Rhizobium pisi 27/80 Isolate Nodule
135 2838061910 Rhizobium phaseoli L15 Isolate Nodule
136 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
137 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
138 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
139 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
140 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
141 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
142 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
143 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
144 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
145 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
146 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
147 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
148 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
149 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
150 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
151 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
152 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
153 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
154 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
155 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
156 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
157 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
158 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
159 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
160 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
161 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
162 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
163 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
164 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
165 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
166 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
167 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
168 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
169 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
170 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
171 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
172 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
173 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
174 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
175 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
176 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
177 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
178 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
179 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
180 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
181 2844163670 Ensifer sp. 1H6 Isolate Unclassified
182 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
183 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
184 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
185 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
186 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
187 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
188 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
189 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
190 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
191 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
192 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
193 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
194 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
195 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
196 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
197 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
198 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
199 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
200 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
201 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
202 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
203 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
204 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
205 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
206 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
207 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
208 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
209 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
210 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
211 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
212 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
213 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
214 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
215 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
216 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
217 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
218 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
219 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
220 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
221 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
222 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
223 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
224 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
225 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
226 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
227 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
228 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
229 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
230 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
231 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
232 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
233 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
234 2933599457 Rhizobium phaseoli M3 Isolate Nodule
235 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
236 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
237 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
238 2936381700 Rhizobium chutanense C16 Isolate Unclassified
239 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
240 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
241 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
242 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
243 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
244 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
245 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
246 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
247 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
248 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
249 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
250 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
251 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
252 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
253 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
254 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
255 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
256 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
257 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
258 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
259 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
260 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
261 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
262 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
263 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
264 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
265 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
266 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
267 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
268 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
269 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
270 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
271 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
272 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
273 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
274 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
275 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
276 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
277 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
278 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
279 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
280 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
281 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
282 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
283 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
284 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
285 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
286 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
287 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
288 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
289 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
290 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
291 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
292 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
293 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
294 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
295 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
296 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
297 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
298 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
299 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
300 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
301 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
302 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
303 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
304 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
305 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
306 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
307 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
308 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
309 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
310 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
311 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
312 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
313 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
314 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
315 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
316 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
317 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
318 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
319 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
320 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
321 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
322 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
323 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
324 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
325 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
326 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
327 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
328 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
329 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
330 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
331 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
332 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
333 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
334 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
335 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
336 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
337 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
338 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
339 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
340 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
341 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
342 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
343 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
344 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
345 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
346 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
347 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
348 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
349 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
350 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
351 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
352 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
353 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
354 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
355 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
356 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
357 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
358 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
359 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
360 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
361 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
362 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
363 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
364 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
365 2996893221 Rhizobium sp. R635 Isolate Nodule
366 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
367 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
368 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
369 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
370 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
371 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
372 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
373 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
374 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
375 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
376 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
377 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
378 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
379 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
380 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
381 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
382 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
383 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
384 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
385 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
386 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
387 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
388 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
389 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
390 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
391 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
392 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
393 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
394 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
395 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
396 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
397 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
398 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
399 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
400 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
401 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
402 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
403 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
404 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
405 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
406 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
407 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
408 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
409 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
410 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
411 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
412 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
413 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
414 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
415 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
416 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
417 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
418 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
419 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
420 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
421 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
422 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
423 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
424 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
425 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
426 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
427 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
428 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
429 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
430 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
431 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
432 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
433 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
434 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
435 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
436 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
437 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
438 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
439 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
440 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
441 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
442 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
443 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
444 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
445 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
446 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
447 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
448 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
449 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
450 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
451 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
452 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
453 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
454 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
455 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
456 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
457 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
458 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
459 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
460 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
461 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
462 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
463 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
464 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
465 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
466 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
467 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
468 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
469 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
470 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
471 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
472 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
473 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
474 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
475 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
476 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
477 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
478 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
479 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
480 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
481 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
482 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
483 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
484 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
485 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
486 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
487 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
488 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
489 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
490 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
491 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
492 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
493 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
494 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
495 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
496 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
497 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
498 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
499 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
500 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
501 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
502 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
503 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
504 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
505 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
506 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
507 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
508 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
509 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
510 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
511 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
512 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
513 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
514 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
515 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
516 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
517 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
518 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
519 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
520 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
521 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
522 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
523 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
524 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
525 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
526 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
527 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
528 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
529 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
530 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
531 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
532 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
533 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
585 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
590 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
591 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
592 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
593 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
595 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
597 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
598 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
599 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
600 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
601 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
602 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
603 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
604 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
605 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
606 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
607 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
608 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
609 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
610 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
611 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
612 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
613 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
614 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
615 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
616 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
617 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
618 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
619 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
620 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
621 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
622 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
623 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
624 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
625 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
626 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
627 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
628 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
629 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
630 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
631 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
632 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
633 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
634 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
635 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
636 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
637 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
638 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
639 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
640 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
641 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
642 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
643 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
644 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
645 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
646 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
647 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
648 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
649 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
650 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
651 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
652 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
653 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
654 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
655 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
656 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
657 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
658 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
659 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
660 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
661 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
662 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
663 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
664 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
665 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
666 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
667 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
668 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
669 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
670 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
671 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
672 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
673 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
674 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
675 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
676 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
677 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
678 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
679 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
680 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
681 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
682 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
683 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
684 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
685 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
686 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
687 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
688 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
689 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
690 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
691 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
692 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
693 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
694 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
695 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
696 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
697 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
698 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
699 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
700 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
701 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
702 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
703 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
705 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
706 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
707 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
708 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
710 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
711 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
712 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
713 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
715 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
716 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
717 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
718 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
719 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
720 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
721 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
722 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
723 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
724 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
725 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
726 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
727 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
728 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
729 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
730 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
731 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
732 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
733 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
734 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
735 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
736 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
737 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
738 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
739 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
740 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
741 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
742 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
743 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
744 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
745 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
746 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
747 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
748 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
749 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
750 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
751 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
752 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
753 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
754 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
755 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
756 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
757 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
758 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
759 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
760 8005275841 Rhizobium sp. N4311 Isolate Nodule
761 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
762 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
763 8005382845 Rhizobium sp. R634 Isolate Nodule
764 8005395548 Rhizobium sp. R339 Isolate Nodule
765 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
766 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
767 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
768 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
769 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
770 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
771 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
772 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
773 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
774 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
775 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
776 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
777 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
778 8018176218 Rhizobium sp. N122 Isolate Nodule
779 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
780 8024501048 Rhizobium sp. H4 Isolate Nodule
781 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
782 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
783 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
784 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
785 8056382006 Rhizobium croatiense 13T Isolate Nodule
786 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.12
Metatranscriptomes 0.1
Isolates 41.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 35.18
Rhizoplane 3.98
Rhizosphere 44.08
Stem 0
Stem Tuber 0.1
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1000894 3300001978 Bacteria 2065
2 JGI24739J22299_10015778 3300001989 Bacteria 2743
3 JGI24737J22298_10005021 3300001990 Bacteria 4584
4 JGI24750J21931_1005672 3300002070 Bacteria 1538
5 JGI24738J21930_10001689 3300002075 Bacteria 6039
6 JGI24751J29686_10013533 3300002459 Bacteria 1683
7 JGI25155J39150_1000013 3300002704 Bacteria 198215
8 JGI25156J39149_1000011 3300002705 Bacteria 198215
9 JGI25154J39366_1000030 3300002738 Bacteria 191444
10 JGI25158J39367_1002679 3300002739 Bacteria 2850
11 JGI25157J39369_1000013 3300002741 Bacteria 198211
12 JGI25152J39213_1002077 3300002773 Bacteria 7883
13 JGI25150J39212_1000194 3300002774 Bacteria 34186
14 JGI25150J39212_1000314 3300002774 Bacteria 23981
15 JGI25159J45721_1000003 3300002987 Bacteria 274069
16 JGI25151J46595_10000555 3300003187 Bacteria 34026
17 JGI25151J46595_10011543 3300003187 Bacteria 4057
18 JGI25153J46596_10009765 3300003215 Bacteria 4412
19 JGI25160J50197_1000003 3300003354 Bacteria 482719
20 JGI25161J50226_1000692 3300003374 Bacteria 13214
21 Ga0055526_1000453 3300003771 Bacteria 32668
22 Ga0055526_1019862 3300003771 Bacteria 2425
23 Ga0055524_1001731 3300003775 Bacteria 12119
24 Ga0055524_1021083 3300003775 Bacteria 2171
25 Ga0055524_1021294 3300003775 Bacteria 2154
26 Ga0055540_1000897 3300003792 Bacteria 19585
27 Ga0055531_10016495 3300003794 Bacteria 3182
28 Ga0055543_1000043 3300004625 Bacteria 116599
29 Ga0065165_1000025 3300005262 Bacteria 246909
30 Ga0065715_10307674 3300005293 Bacteria 1027
31 Ga0070658_10033216 3300005327 Bacteria 4150
32 Ga0070658_10085120 3300005327 Bacteria 2600
33 Ga0070658_10185352 3300005327 Bacteria 1752
34 Ga0070676_10047135 3300005328 Bacteria 2516
35 Ga0070683_100049464 3300005329 Bacteria 3889
36 Ga0070690_100001970 3300005330 Bacteria 10933
37 Ga0070670_100007675 3300005331 Bacteria 9169
38 Ga0070670_100084612 3300005331 Bacteria 2725
39 Ga0068869_100131549 3300005334 Bacteria 1924
40 Ga0070666_10002907 3300005335 Bacteria 10353
41 Ga0070680_100013027 3300005336 Bacteria 6472
42 Ga0070682_100002150 3300005337 Bacteria 10950
43 Ga0068868_100001086 3300005338 Bacteria 18621
44 Ga0070660_100001084 3300005339 Bacteria 18307
45 Ga0070660_100044069 3300005339 Unclassified 3411
46 Ga0070689_100001378 3300005340 Bacteria 15452
47 Ga0070691_10000938 3300005341 Bacteria 11849
48 Ga0070687_100054985 3300005343 Bacteria 2076
49 Ga0070661_100001859 3300005344 Bacteria 14612
50 Ga0070661_100059306 3300005344 Bacteria 2806
51 Ga0070692_10000600 3300005345 Bacteria 11312
52 Ga0070692_10537239 3300005345 Bacteria 764
53 Ga0070668_100002327 3300005347 Bacteria 13980
54 Ga0070668_100152303 3300005347 Bacteria 1871
55 Ga0070669_100000391 3300005353 Bacteria 33788
56 Ga0070669_100050478 3300005353 Bacteria 3039
57 Ga0070675_100009210 3300005354 Bacteria 7670
58 Ga0070671_100006662 3300005355 Bacteria 9236
59 Ga0070671_100241100 3300005355 Bacteria 1535
60 Ga0070673_100003670 3300005364 Bacteria 9612
61 Ga0070688_100000242 3300005365 Bacteria 28832
62 Ga0070688_100327089 3300005365 Bacteria 1116
63 Ga0070659_100002388 3300005366 Bacteria 13345
64 Ga0070659_100383664 3300005366 Bacteria 1184
65 Ga0070667_100002252 3300005367 Bacteria 16981
66 Ga0070667_100158713 3300005367 Bacteria 1991
67 Ga0070709_10002660 3300005434 Bacteria 9644
68 Ga0070714_100022263 3300005435 Bacteria 5194
69 Ga0070713_100019680 3300005436 Bacteria 5161
70 Ga0070710_10028465 3300005437 Bacteria 2990
71 Ga0070701_10000157 3300005438 Bacteria 20959
72 Ga0070711_100002114 3300005439 Bacteria 11238
73 Ga0070711_100285688 3300005439 Bacteria 1307
74 Ga0070705_100019607 3300005440 Bacteria 3562
75 Ga0070700_100025440 3300005441 Bacteria 3485
76 Ga0070694_100000736 3300005444 Bacteria 18296
77 Ga0070663_100003095 3300005455 Bacteria 9513
78 Ga0070663_100138745 3300005455 Bacteria 1854
79 Ga0070663_100383853 3300005455 Bacteria 1145
80 Ga0070678_100005607 3300005456 Bacteria 7283
81 Ga0070662_100002449 3300005457 Bacteria 11430
82 Ga0070681_10159404 3300005458 Bacteria 2180
83 Ga0070699_100101105 3300005518 Bacteria 2527
84 Ga0070679_100198949 3300005530 Bacteria 1970
85 Ga0070684_100210031 3300005535 Bacteria 1774
86 Ga0070697_100003492 3300005536 Bacteria 12081
87 Ga0070697_100671591 3300005536 Bacteria 913
88 Ga0068853_100027860 3300005539 Bacteria 4750
89 Ga0068853_100116954 3300005539 Bacteria 2374
90 Ga0070672_100001821 3300005543 Bacteria 13300
91 Ga0070686_100000939 3300005544 Bacteria 16781
92 Ga0070695_100031541 3300005545 Bacteria 3307
93 Ga0070696_100009914 3300005546 Bacteria 6373
94 Ga0070693_100000255 3300005547 Bacteria 24871
95 Ga0070665_100017049 3300005548 Bacteria 7285
96 Ga0070665_100068823 3300005548 Bacteria 3549
97 Ga0070665_100105348 3300005548 Bacteria 2822
98 Ga0070704_100000179 3300005549 Bacteria 25590
99 Ga0068855_100011031 3300005563 Bacteria 10906
100 Ga0068855_100144965 3300005563 Bacteria 2704
101 Ga0070664_100009148 3300005564 Bacteria 8041
102 Ga0068854_100001319 3300005578 Bacteria 14977
103 Ga0068854_100722219 3300005578 Bacteria 862
104 Ga0068856_100006818 3300005614 Bacteria 11173
105 Ga0070702_100000227 3300005615 Bacteria 19020
106 Ga0068852_100000992 3300005616 Bacteria 18727
107 Ga0068852_100002345 3300005616 Bacteria 13033
108 Ga0068852_100044059 3300005616 Bacteria 3787
109 Ga0068852_100246214 3300005616 Bacteria 1711
110 Ga0068859_100003356 3300005617 Bacteria 16289
111 Ga0068859_100089883 3300005617 Bacteria 3122
112 Ga0068864_100007720 3300005618 Bacteria 8864
113 Ga0068866_10004165 3300005718 Bacteria 5932
114 Ga0068861_100012060 3300005719 Bacteria 6022
115 Ga0068851_10006003 3300005834 Bacteria 5533
116 Ga0068863_100082483 3300005841 Bacteria 3047
117 Ga0068858_100010035 3300005842 Bacteria 8988
118 Ga0068860_100002798 3300005843 Bacteria 18148
119 Ga0068862_100022680 3300005844 Bacteria 5253
120 Ga0081455_10003036 3300005937 Bacteria 19569
121 Ga0081455_10004332 3300005937 Bacteria 15984
122 Ga0075364_10109195 3300006051 Bacteria 1845
123 Ga0075432_10002196 3300006058 Bacteria 6499
124 Ga0070715_10000066 3300006163 Bacteria 33254
125 Ga0070716_100000075 3300006173 Bacteria 38157
126 Ga0070712_100000753 3300006175 Bacteria 19137
127 Ga0075367_10000992 3300006178 Bacteria 11629
128 Ga0075366_10090101 3300006195 Bacteria 1837
129 Ga0068871_100292308 3300006358 Bacteria 1428
130 Ga0075428_100069760 3300006844 Bacteria 3842
131 Ga0075430_100174741 3300006846 Bacteria 1787
132 Ga0075431_100014998 3300006847 Bacteria 7845
133 Ga0075429_100008622 3300006880 Bacteria 8868
134 Ga0068865_100064406 3300006881 Bacteria 2580
135 Ga0075436_100013216 3300006914 Bacteria 5658
136 Ga0097620_100003356 3300006931 Bacteria 16289
137 Ga0097620_100089885 3300006931 Bacteria 3122
138 Ga0079104_1052387 3300006946 Bacteria 904
139 Ga0075435_100003192 3300007076 Bacteria 11094
140 Ga0105251_10159397 3300009011 Bacteria 1017
141 Ga0105244_10075044 3300009036 Bacteria 1681
142 Ga0105250_10019508 3300009092 Bacteria 2742
143 Ga0105250_10035299 3300009092 Bacteria 2006
144 Ga0105240_10011014 3300009093 Bacteria 12658
145 Ga0105240_10352457 3300009093 Bacteria 1669
146 Ga0105245_10003424 3300009098 Bacteria 14211
147 Ga0105245_10309295 3300009098 Bacteria 1553
148 Ga0105247_10000648 3300009101 Bacteria 27713
149 Ga0114129_10062288 3300009147 Bacteria 5212
150 Ga0105243_10007291 3300009148 Bacteria 8498
151 Ga0105243_10185553 3300009148 Bacteria 1812
152 Ga0105241_10000469 3300009174 Bacteria 30491
153 Ga0105242_10002939 3300009176 Bacteria 13325
154 Ga0105242_10159466 3300009176 Bacteria 1973
155 Ga0105248_10000756 3300009177 Bacteria 36212
156 Ga0105248_10100910 3300009177 Bacteria 3252
157 Ga0105237_10002677 3300009545 Bacteria 21847
158 Ga0105237_10883596 3300009545 Bacteria 901
159 Ga0105237_11177741 3300009545 Bacteria 773
160 Ga0105238_10023817 3300009551 Bacteria 6241
161 Ga0105238_10026958 3300009551 Bacteria 5857
162 Ga0105238_10311209 3300009551 Bacteria 1560
163 Ga0105249_10002381 3300009553 Bacteria 16317
164 Ga0123341_1000038 3300009765 Bacteria 60679
165 Ga0123342_1006624 3300009766 Bacteria 15924
166 Ga0105239_10016755 3300010375 Bacteria 8101
167 Ga0105239_10594706 3300010375 Bacteria 1262
168 Ga0105246_10002676 3300011119 Bacteria 10793
169 Ga0157373_10029903 3300013100 Bacteria 3922
170 Ga0157371_10006694 3300013102 Bacteria 9424
171 Ga0157370_10043578 3300013104 Bacteria 4317
172 Ga0157370_10127953 3300013104 Bacteria 2370
173 Ga0157369_10000947 3300013105 Bacteria 36855
174 Ga0157369_10013440 3300013105 Bacteria 9253
175 Ga0157369_10120803 3300013105 Bacteria 2780
176 Ga0171463_1001 3300013249 Bacteria 1406070
177 Ga0157374_10006205 3300013296 Bacteria 10130
178 Ga0157378_10001777 3300013297 Bacteria 19356
179 Ga0157378_10040596 3300013297 Bacteria 4127
180 Ga0163162_10009552 3300013306 Bacteria 9437
181 Ga0157372_10000133 3300013307 Bacteria 81875
182 Ga0157375_10000531 3300013308 Bacteria 34206
183 Ga0157375_10066246 3300013308 Bacteria 3604
184 Ga0163163_10003430 3300014325 Bacteria 13467
185 Ga0163163_10441499 3300014325 Bacteria 1361
186 Ga0157380_10001038 3300014326 Bacteria 17730
187 Ga0157377_10003185 3300014745 Bacteria 7400
188 Ga0157379_10000847 3300014968 Bacteria 24772
189 Ga0157379_10039170 3300014968 Bacteria 4228
190 Ga0157376_10000565 3300014969 Bacteria 23889
191 Ga0157376_10061377 3300014969 Bacteria 3160
192 Ga0157376_10110384 3300014969 Bacteria 2419
193 Ga0183363_1154 3300015690 Bacteria 16953
194 Ga0163161_10018838 3300017792 Bacteria 4838
195 Ga0206353_11154994 3300020082 Bacteria 2152
196 Ga0214544_1000105 3300021320 Bacteria 114109
197 Ga0214542_1000029 3300021321 Bacteria 174097
198 Ga0214542_1025661 3300021321 Bacteria 3026
199 Ga0214543_1000027 3300021327 Bacteria 215065
200 Ga0214543_1000040 3300021327 Bacteria 174142
201 Ga0213872_10001809 3300021361 Bacteria 13303
202 Ga0213872_10105251 3300021361 Bacteria 1256
203 Ga0228711_1000013 3300022739 Bacteria 132585
204 Ga0228710_1000008 3300022740 Bacteria 174306
205 Ga0209435_100026 3300025206 Bacteria 198295
206 Ga0209436_100844 3300025208 Bacteria 12354
207 Ga0207425_1000012 3300025245 Bacteria 528324
208 Ga0207425_1014108 3300025245 Bacteria 1823
209 Ga0209646_1000084 3300025246 Bacteria 198295
210 Ga0209026_1000080 3300025250 Bacteria 198295
211 Ga0209759_1000061 3300025256 Bacteria 198295
212 Ga0209129_1000110 3300025258 Bacteria 150918
213 Ga0209129_1004479 3300025258 Bacteria 5433
214 Ga0209673_1001375 3300025273 Bacteria 23927
215 Ga0209673_1007743 3300025273 Bacteria 4886
216 Ga0209130_1000005 3300025284 Bacteria 599620
217 Ga0209676_1004789 3300025292 Bacteria 7367
218 Ga0209676_1048290 3300025292 Bacteria 1138
219 Ga0209025_1000024 3300025294 Bacteria 528324
220 Ga0209025_1000037 3300025294 Bacteria 383429
221 Ga0209025_1000105 3300025294 Bacteria 224157
222 Ga0209564_1000093 3300025295 Bacteria 245793
223 Ga0209758_1000150 3300025297 Bacteria 163494
224 Ga0209050_1013670 3300025298 Bacteria 3580
225 Ga0209050_1015020 3300025298 Bacteria 3287
226 Ga0209256_1000027 3300025299 Bacteria 423283
227 Ga0209256_1002975 3300025299 Bacteria 12662
228 Ga0207426_1000015 3300025302 Bacteria 599316
229 Ga0207426_1002050 3300025302 Bacteria 14036
230 Ga0209051_1000197 3300025303 Bacteria 106822
231 Ga0209051_1008183 3300025303 Bacteria 5576
232 Ga0209051_1015915 3300025303 Bacteria 3438
233 Ga0209257_1005309 3300025304 Bacteria 9148
234 Ga0209257_1006739 3300025304 Bacteria 7251
235 Ga0207697_10070743 3300025315 Bacteria 1462
236 Ga0207656_10016543 3300025321 Bacteria 2873
237 Ga0207692_10011569 3300025898 Bacteria 3761
238 Ga0207642_10009018 3300025899 Bacteria 3452
239 Ga0207710_10011735 3300025900 Bacteria 3686
240 Ga0207688_10013336 3300025901 Bacteria 4466
241 Ga0207647_10007944 3300025904 Bacteria 7628
242 Ga0207685_10002025 3300025905 Bacteria 4513
243 Ga0207699_10012529 3300025906 Bacteria 4315
244 Ga0207645_10000890 3300025907 Bacteria 24772
245 Ga0207705_10057790 3300025909 Bacteria 2798
246 Ga0207705_10077826 3300025909 Bacteria 2413
247 Ga0207705_10203555 3300025909 Bacteria 1500
248 Ga0207654_10002917 3300025911 Bacteria 8671
249 Ga0207671_10040775 3300025914 Bacteria 3436
250 Ga0207693_10000110 3300025915 Bacteria 74444
251 Ga0207663_10001557 3300025916 Bacteria 10749
252 Ga0207660_10070804 3300025917 Bacteria 2535
253 Ga0207662_10004730 3300025918 Bacteria 7189
254 Ga0207657_10000023 3300025919 Bacteria 152701
255 Ga0207649_10061477 3300025920 Bacteria 2364
256 Ga0207649_10105646 3300025920 Bacteria 1872
257 Ga0207652_10131234 3300025921 Bacteria 2235
258 Ga0207681_10027333 3300025923 Bacteria 3688
259 Ga0207694_10016047 3300025924 Bacteria 5651
260 Ga0207650_10001700 3300025925 Bacteria 15636
261 Ga0207659_10067421 3300025926 Bacteria 2599
262 Ga0207687_10002507 3300025927 Bacteria 12470
263 Ga0207700_10010074 3300025928 Bacteria 5942
264 Ga0207644_10004689 3300025931 Bacteria 8887
265 Ga0207690_10055941 3300025932 Bacteria 2659
266 Ga0207706_10000019 3300025933 Bacteria 167592
267 Ga0207709_10031209 3300025935 Bacteria 3110
268 Ga0207670_10030617 3300025936 Bacteria 3438
269 Ga0207670_10073251 3300025936 Bacteria 2374
270 Ga0207669_10002185 3300025937 Bacteria 8305
271 Ga0207704_10003825 3300025938 Bacteria 6850
272 Ga0207665_10000095 3300025939 Bacteria 57181
273 Ga0207665_10237769 3300025939 Bacteria 1341
274 Ga0207691_10000947 3300025940 Bacteria 28721
275 Ga0207711_10100635 3300025941 Bacteria 2557
276 Ga0207689_10025567 3300025942 Bacteria 4947
277 Ga0207661_10111532 3300025944 Bacteria 2314
278 Ga0207679_10005015 3300025945 Bacteria 8268
279 Ga0207679_10143180 3300025945 Bacteria 1935
280 Ga0207667_10015775 3300025949 Bacteria 8566
281 Ga0207712_10001385 3300025961 Bacteria 16600
282 Ga0207668_10002303 3300025972 Bacteria 11147
283 Ga0207668_10092183 3300025972 Bacteria 2229
284 Ga0207640_10025492 3300025981 Bacteria 3580
285 Ga0207658_10066449 3300025986 Bacteria 2712
286 Ga0207703_10065051 3300026035 Bacteria 2995
287 Ga0207639_10027428 3300026041 Bacteria 4150
288 Ga0207639_10135414 3300026041 Bacteria 2045
289 Ga0207678_10000017 3300026067 Bacteria 135871
290 Ga0207678_10098164 3300026067 Bacteria 2503
291 Ga0207678_10226774 3300026067 Bacteria 1599
292 Ga0207678_10365204 3300026067 Bacteria 1246
293 Ga0207708_10026076 3300026075 Bacteria 4421
294 Ga0207641_10086631 3300026088 Bacteria 2731
295 Ga0207676_10019059 3300026095 Bacteria 4999
296 Ga0207674_10000437 3300026116 Bacteria 53986
297 Ga0207675_100020926 3300026118 Bacteria 6099
298 Ga0207683_10000223 3300026121 Bacteria 49909
299 Ga0207698_10000739 3300026142 Bacteria 18966
300 Ga0207698_10005850 3300026142 Bacteria 7640
301 Ga0209281_1000134 3300027111 Bacteria 185406
302 Ga0209281_1000783 3300027111 Bacteria 30223
303 Ga0209282_1000029 3300027666 Bacteria 157883
304 Ga0209998_10007160 3300027717 Bacteria 2314
305 Ga0207428_10060612 3300027907 Bacteria 2998
306 Ga0268266_10044842 3300028379 Bacteria 3781
307 Ga0268266_10108320 3300028379 Bacteria 2458
308 Ga0268265_10014998 3300028380 Bacteria 5291
309 Ga0268264_10145840 3300028381 Bacteria 2116
310 Ga0307515_10000029 3300028794 Bacteria 365410
311 Ga0307515_10175456 3300028794 Bacteria 2116
312 Ga0307408_100046261 3300031548 Bacteria 3112
313 Ga0307405_10000918 3300031731 Bacteria 11737
314 Ga0307405_10326741 3300031731 Bacteria 1174
315 Ga0307413_10167305 3300031824 Bacteria 1552
316 Ga0307406_10004933 3300031901 Bacteria 7271
317 Ga0307412_10029101 3300031911 Bacteria 3464
318 Ga0315914_1000021 3300031967 Bacteria 119592
319 Ga0307409_100014709 3300031995 Bacteria 5104
320 Ga0307409_100366375 3300031995 Bacteria 1365
321 Ga0307416_100055242 3300032002 Bacteria 3197
322 Ga0307415_100208922 3300032126 Bacteria 1556
323 Ga0315913_1000014 3300033430 Bacteria 120114
324 Ga0315915_1000003 3300033464 Bacteria 407996
325 Ga0373926_0045234 3300035083 Bacteria 1578
326 Ga0373943_0228464 3300035170 Bacteria 1039
327 Ga0373946_0115131 3300035171 Bacteria 1221
328 Ga0373931_0031196 3300035691 Bacteria 2749
329 Ga0373927_0000103 3300035695 Bacteria 64324
330 Ga0373927_0006033 3300035695 Bacteria 8301
331 Ga0373937_0283606 3300036401 Bacteria 1564
332 Ga0395900_0010720 3300037418 Bacteria 9375
333 Ga0395900_0204524 3300037418 Bacteria 1996
334 Ga0395898_0023028 3300037466 Bacteria 6298
335 Ga0395905_0001223 3300037471 Bacteria 32002
336 Ga0395905_0023682 3300037471 Bacteria 5797
337 Ga0395901_0308496 3300038443 Bacteria 1639
338 Ga0395901_0325305 3300038443 Bacteria 1590
339 Ga0400491_08946 3300038727 Bacteria 2063
340 Ga0436365_1537137 3300039437 Bacteria 3183
341 Ga0436361_0402048 3300039447 Bacteria 7502
342 Ga0436361_0517647 3300039447 Bacteria 1341
343 Ga0436361_1064960 3300039447 Bacteria 5318
344 Ga0439453_0062422 3300041408 Bacteria 774
345 Ga0439465_0132553 3300041413 Bacteria 880
346 Ga0451841_0249814 3300041498 Bacteria 3886
347 Ga0451841_0345758 3300041498 Bacteria 940
348 Ga0439449_0037559 3300042007 Bacteria 1802
349 Ga0439449_0038495 3300042007 Bacteria 1778
350 Ga0439462_0025658 3300042015 Bacteria 1552
351 Ga0439446_0055371 3300042156 Bacteria 1191
352 Ga0450918_009020 3300042531 Bacteria 1750
353 Ga0466958_0205960 3300045836 Unclassified 1252
354 Ga0466967_0003821 3300045976 Bacteria 9965
355 Ga0495603_0000944 3300046455 Bacteria 16712
356 Ga0495629_0000725 3300046459 Bacteria 26753
357 Ga0495638_0000418 3300046460 Bacteria 51339
358 Ga0495638_0008731 3300046460 Bacteria 7161
359 Ga0495580_0000812 3300046472 Bacteria 27065
360 Ga0495582_0000614 3300046473 Bacteria 19582
361 Ga0495605_0014465 3300046474 Bacteria 4322
362 Ga0495639_0000788 3300046475 Bacteria 14461
363 Ga0495584_0031132 3300046491 Bacteria 2701
364 Ga0495585_0009897 3300046492 Bacteria 5696
365 Ga0495585_0032564 3300046492 Bacteria 2953
366 Ga0495594_0000364 3300046499 Bacteria 22686
367 Ga0495607_0032931 3300046501 Bacteria 3157
368 Ga0495583_0009459 3300046506 Bacteria 5818
369 Ga0495606_0039632 3300046507 Bacteria 3172
370 Ga0495606_0159359 3300046507 Bacteria 1318
371 Ga0495610_0005716 3300046512 Bacteria 8761
372 Ga0495616_0011197 3300046513 Bacteria 5149
373 Ga0495631_0003370 3300046518 Bacteria 8757
374 Ga0495643_0050366 3300046522 Bacteria 2243
375 Ga0495654_0084256 3300046530 Bacteria 1485
376 Ga0495665_0001409 3300046531 Bacteria 12877
377 Ga0495609_0006983 3300046538 Bacteria 5693
378 Ga0495622_0049017 3300046557 Bacteria 1961
379 Ga0495633_0126673 3300046558 Bacteria 1182
380 Ga0495667_0176944 3300046559 Bacteria 1370
381 Ga0495668_0003238 3300046616 Bacteria 12409
382 Ga0495634_0001507 3300046642 Bacteria 20604
383 Ga0495625_0022819 3300046660 Bacteria 4789
384 Ga0495661_0118943 3300046665 Bacteria 1462
385 Ga0495588_0002719 3300046674 Bacteria 7579
386 Ga0495657_0064475 3300046675 Bacteria 2413
387 Ga0495647_0001075 3300046681 Bacteria 8331
388 Ga0495658_0001306 3300046683 Bacteria 13049
389 Ga0495669_0271624 3300046684 Bacteria 815
390 Ga0495613_0001074 3300046689 Bacteria 20824
391 Ga0495613_0245543 3300046689 Bacteria 1251
392 Ga0495624_0171965 3300046690 Bacteria 1321
393 Ga0495670_0009549 3300046691 Bacteria 4767
394 Ga0495671_0036036 3300046692 Bacteria 2509
395 Ga0495600_0089909 3300046809 Bacteria 2002
396 Ga0495581_0003415 3300047315 Bacteria 9119
397 Ga0495672_0011736 3300047320 Bacteria 6160
398 Ga0495676_0028005 3300047321 Bacteria 4822
399 Ga0495681_0049686 3300047470 Bacteria 1981
400 Ga0495686_0002521 3300047472 Bacteria 17142
401 Ga0495686_0015350 3300047472 Bacteria 5233
402 Ga0495686_0018878 3300047472 Bacteria 4618
403 Ga0495686_0119221 3300047472 Bacteria 1575
404 Ga0495593_0003119 3300047673 Bacteria 9964
405 Ga0496100_0014800 3300048903 Bacteria 4538
406 Ga0496100_0042422 3300048903 Bacteria 2905
407 Ga0496100_0225039 3300048903 Bacteria 1378
408 Ga0496101_0018352 3300048904 Bacteria 4755
409 Ga0496101_0031978 3300048904 Bacteria 3701
410 Ga0496101_0593327 3300048904 Bacteria 876
411 Ga0496102_0060227 3300048905 Bacteria 3472
412 Ga0496102_0063713 3300048905 Bacteria 3376
413 Ga0496103_0004556 3300048906 Bacteria 8390
414 Ga0496103_0135571 3300048906 Bacteria 1573
415 Ga0496104_0003766 3300048907 Bacteria 13108
416 Ga0496104_0134914 3300048907 Bacteria 2371
417 Ga0496105_0001382 3300048908 Bacteria 17041
418 Ga0496105_0034755 3300048908 Bacteria 4146
419 Ga0496106_0019240 3300048909 Bacteria 5064
420 Ga0496106_0168197 3300048909 Bacteria 1736
421 Ga0496107_0002472 3300048910 Bacteria 11994
422 Ga0496107_0033873 3300048910 Bacteria 3655
423 Ga0496108_0111477 3300048911 Bacteria 2340
424 Ga0496108_0244551 3300048911 Bacteria 1561
425 Ga0496109_0026146 3300048912 Bacteria 5203
426 Ga0496109_0048835 3300048912 Bacteria 3850
427 Ga0496109_0071068 3300048912 Bacteria 3194
428 Ga0496110_0038765 3300048913 Bacteria 4147
429 Ga0496110_0220079 3300048913 Bacteria 1726
430 Ga0496111_0016607 3300048914 Bacteria 5075
431 Ga0496111_0042144 3300048914 Bacteria 3277
432 Ga0496112_0009755 3300048915 Bacteria 8668
433 Ga0496112_0113590 3300048915 Bacteria 2679
434 Ga0496113_0011201 3300048916 Bacteria 5969
435 Ga0496113_0258660 3300048916 Bacteria 1390
436 Ga0496114_0649164 3300048917 Bacteria 928
437 Ga0496115_0008597 3300048918 Bacteria 7559
438 Ga0496115_0030801 3300048918 Bacteria 4223
439 Ga0496116_0009380 3300048919 Bacteria 8348
440 Ga0496116_0022122 3300048919 Bacteria 4777
441 Ga0496117_0001877 3300048920 Bacteria 28290
442 Ga0496117_0023810 3300048920 Bacteria 4863
443 Ga0496118_0031454 3300048921 Bacteria 4399
444 Ga0496121_0000737 3300048924 Bacteria 60298
445 Ga0496121_0232263 3300048924 Bacteria 1291
446 Ga0496121_0299233 3300048924 Bacteria 1092
447 Ga0496122_0000309 3300048925 Bacteria 107844
448 Ga0496122_0087314 3300048925 Bacteria 2143
449 Ga0496123_0000238 3300048926 Bacteria 111297
450 Ga0496123_0013251 3300048926 Bacteria 6944
451 Ga0496124_0001541 3300048927 Bacteria 33429
452 Ga0496124_0006313 3300048927 Bacteria 12947
453 Ga0496124_0063616 3300048927 Bacteria 3081
454 Ga0496125_0000393 3300048928 Bacteria 81258
455 Ga0496125_0004955 3300048928 Bacteria 15064
456 Ga0496125_0029373 3300048928 Bacteria 4941
457 Ga0496126_0001032 3300048929 Bacteria 47122
458 Ga0496126_0050996 3300048929 Bacteria 3770
459 Ga0496126_0119744 3300048929 Bacteria 2284
460 Ga0495678_023419 3300049459 Bacteria 2683
461 Ga0501031_0088069 3300049568 Bacteria 2024
462 Ga0501032_0126362 3300049569 Bacteria 1689
463 Ga0501032_0128019 3300049569 Bacteria 1676
464 Ga0501033_0011923 3300049570 Bacteria 6642
465 Ga0501033_0134616 3300049570 Bacteria 1788
466 Ga0501033_0270616 3300049570 Bacteria 1201
467 Ga0501034_0135336 3300049571 Bacteria 2445
468 Ga0501034_0141949 3300049571 Bacteria 2380
469 Ga0501036_0066290 3300049572 Bacteria 3055
470 Ga0501036_0092159 3300049572 Bacteria 2560
471 Ga0501036_0149021 3300049572 Bacteria 1973
472 Ga0501037_0457774 3300049573 Bacteria 869
473 Ga0501038_0009548 3300049574 Bacteria 8900
474 Ga0501038_0066397 3300049574 Bacteria 3072
475 Ga0501038_0209492 3300049574 Bacteria 1560
476 Ga0501038_0223774 3300049574 Bacteria 1500
477 Ga0501039_0022806 3300049575 Bacteria 4802
478 Ga0501039_0039981 3300049575 Bacteria 3621
479 Ga0501039_0218226 3300049575 Bacteria 1499
480 Ga0501040_0018070 3300049576 Bacteria 4683
481 Ga0501040_0377472 3300049576 Bacteria 1017
482 Ga0501041_0035223 3300049577 Bacteria 3033
483 Ga0501042_0105058 3300049578 Bacteria 2032
484 Ga0501042_0143905 3300049578 Bacteria 1719
485 Ga0501043_0007759 3300049579 Bacteria 8489
486 Ga0501043_0167214 3300049579 Bacteria 1717
487 Ga0501046_0015387 3300049580 Bacteria 6430
488 Ga0501046_0063486 3300049580 Bacteria 2884
489 Ga0501047_0010148 3300049581 Bacteria 8907
490 Ga0501047_0113738 3300049581 Bacteria 2589
491 Ga0501048_0031926 3300049582 Bacteria 3808
492 Ga0501048_0164225 3300049582 Bacteria 1572
493 Ga0501068_0346979 3300049584 Bacteria 954
494 Ga0501069_0180728 3300049585 Bacteria 1219
495 Ga0501069_0350170 3300049585 Bacteria 870
496 Ga0501070_0000739 3300049586 Bacteria 29890
497 Ga0501070_0081916 3300049586 Bacteria 2671
498 Ga0501070_0187361 3300049586 Bacteria 1702
499 Ga0501070_0228377 3300049586 Bacteria 1525
500 Ga0501071_0070810 3300049587 Bacteria 2541
501 Ga0501071_0094295 3300049587 Bacteria 2201
502 Ga0501072_0193620 3300049588 Bacteria 1621
503 Ga0501074_0083577 3300049590 Bacteria 2289
504 Ga0501074_0164748 3300049590 Bacteria 1583
505 Ga0501075_0011765 3300049591 Bacteria 6204
506 Ga0501075_0015478 3300049591 Bacteria 5475
507 Ga0501075_0114991 3300049591 Bacteria 2046
508 Ga0501075_0546404 3300049591 Bacteria 884
509 Ga0501076_0044948 3300049592 Bacteria 3485
510 Ga0501076_0259261 3300049592 Bacteria 1423
511 Ga0501077_0086808 3300049593 Bacteria 1983
512 Ga0501079_0024976 3300049741 Bacteria 4584
513 Ga0501079_0088671 3300049741 Bacteria 2395
514 Ga0501080_0001237 3300049742 Bacteria 21233
515 Ga0501081_0046874 3300049743 Bacteria 2972
516 Ga0501081_0147782 3300049743 Bacteria 1687
517 Ga0501083_0144618 3300049744 Bacteria 1557
518 Ga0501280_004615 3300049776 Bacteria 2011
519 Ga0501035_0000288 3300049822 Bacteria 59750
520 Ga0501035_0097134 3300049822 Bacteria 2587
521 Ga0501035_0133889 3300049822 Bacteria 2159
522 Ga0501035_0530571 3300049822 Bacteria 966
523 Ga0501044_0004774 3300049823 Bacteria 15160
524 Ga0501044_0045361 3300049823 Bacteria 4554
525 Ga0501044_0660716 3300049823 Bacteria 933
526 Ga0501045_0112881 3300049824 Bacteria 2015
527 nmdc:mga00v17_6643_c1 3300050491 Bacteria 6143
528 nmdc:mga0k408_71132_c1 3300050493 Bacteria 1719
529 nmdc:mga05p37_105759_c1 3300050507 Bacteria 3462
530 nmdc:mga06r32_116656_c1 3300050510 Bacteria 2631
531 nmdc:mga0rr50_25376_c1 3300050513 Bacteria 4120
532 nmdc:mga08x19_96515_c1 3300050514 Bacteria 1957
533 Ga0495601_0058053 3300053077 Bacteria 2452
534 Ga0500610_0013155 3300053079 Bacteria 3839
535 Ga0495619_0003111 3300053085 Bacteria 10766
536 Ga0495619_0151813 3300053085 Bacteria 1598
537 Ga0500578_0077492 3300053086 Bacteria 2116
538 Ga0500650_0024198 3300053098 Bacteria 2706
539 Ga0500569_021295 3300053109 Bacteria 1712
540 Ga0500594_0000803 3300053118 Bacteria 6694
541 Ga0500559_0042968 3300053136 Bacteria 1974
542 Ga0500559_0203830 3300053136 Bacteria 933
543 Ga0500568_0001319 3300053139 Bacteria 16252
544 Ga0500590_004746 3300053148 Bacteria 6458
545 Ga0500616_0001070 3300053153 Bacteria 28660
546 Ga0500622_0127190 3300053156 Bacteria 1229
547 Ga0500624_015036 3300053157 Bacteria 1179
548 Ga0500627_0010602 3300053158 Bacteria 3368
549 Ga0500634_0002414 3300053161 Bacteria 7859
550 Ga0501084_0293513 3300054114 Bacteria 1373
551 Ga0501084_0314455 3300054114 Bacteria 1323
552 Ga0501084_0414341 3300054114 Bacteria 1139
553 Ga0501084_0508262 3300054114 Bacteria 1018
554 Ga0501082_0550060 3300060353 Bacteria 1009
555 Ga0530510_0008192 3300061734 Bacteria 7290
556 Ga0530510_0029165 3300061734 Bacteria 3959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10307674 Ga0065715_103076741 201
2 3300046460 Ga0495638_0008731 Ga0495638_0008731_1040_1741 205
3 3300021361 Ga0213872_10105251 Ga0213872_101052512 209
4 3300039447 Ga0436361_0517647 Ga0436361_0517647_250_903 209
5 3300046507 Ga0495606_0039632 Ga0495606_0039632_1136_1852 210
6 3300009093 Ga0105240_10352457 Ga0105240_103524571 211
7 3300009545 Ga0105237_10883596 Ga0105237_108835961 211
8 3300009551 Ga0105238_10311209 Ga0105238_103112093 211
9 3300048905 Ga0496102_0063713 Ga0496102_0063713_33_695 213
10 3300048924 Ga0496121_0000737 Ga0496121_0000737_31854_32516 213
11 3300048928 Ga0496125_0029373 Ga0496125_0029373_1123_1803 213
12 3300053136 Ga0500559_0042968 Ga0500559_0042968_911_1612 213
13 iso_pu_bacteria 2643221663 2644351716 213
14 3300045836 Ga0466958_0205960 Ga0466958_0205960_119_784 214
15 3300045976 Ga0466967_0003821 Ga0466967_0003821_9139_9804 214
16 iso_pu_bacteria 2896429255 2896431666 214
17 3300035171 Ga0373946_0115131 Ga0373946_0115131_11_658 215
18 3300049776 Ga0501280_004615 Ga0501280_004615_312_1001 215
19 iso_pu_bacteria 2885427238 2885429179 215
20 3300005366 Ga0070659_100383664 Ga0070659_1003836642 216
21 3300021361 Ga0213872_10001809 Ga0213872_1000180910 216
22 3300031824 Ga0307413_10167305 Ga0307413_101673052 216
23 3300031995 Ga0307409_100366375 Ga0307409_1003663752 216
24 3300039447 Ga0436361_0402048 Ga0436361_0402048_2771_3445 216
25 3300039447 Ga0436361_1064960 Ga0436361_1064960_4108_4782 216
26 3300048917 Ga0496114_0649164 Ga0496114_0649164_33_695 216
27 iso_pu_bacteria 2523231067 2523466950 216
28 iso_pu_bacteria 2738543031 2739348630 216
29 3300005327 Ga0070658_10085120 Ga0070658_100851202 217
30 3300005327 Ga0070658_10185352 Ga0070658_101853522 217
31 3300005339 Ga0070660_100044069 Ga0070660_1000440692 217
32 3300005344 Ga0070661_100059306 Ga0070661_1000593063 217
33 3300005345 Ga0070692_10537239 Ga0070692_105372391 217
34 3300005455 Ga0070663_100383853 Ga0070663_1003838532 217
35 3300005530 Ga0070679_100198949 Ga0070679_1001989492 217
36 3300005539 Ga0068853_100027860 Ga0068853_1000278602 217
37 3300005563 Ga0068855_100144965 Ga0068855_1001449653 217
38 3300005578 Ga0068854_100722219 Ga0068854_1007222191 217
39 3300005616 Ga0068852_100000992 Ga0068852_10000099215 217
40 3300005616 Ga0068852_100002345 Ga0068852_1000023456 217
41 3300009545 Ga0105237_11177741 Ga0105237_111777411 217
42 3300009551 Ga0105238_10026958 Ga0105238_100269582 217
43 3300013104 Ga0157370_10043578 Ga0157370_100435782 217
44 3300013105 Ga0157369_10013440 Ga0157369_100134407 217
45 3300013105 Ga0157369_10120803 Ga0157369_101208033 217
46 3300020082 Ga0206353_11154994 Ga0206353_111549942 217
47 3300025909 Ga0207705_10057790 Ga0207705_100577902 217
48 3300025909 Ga0207705_10203555 Ga0207705_102035552 217
49 3300025920 Ga0207649_10105646 Ga0207649_101056461 217
50 3300025981 Ga0207640_10025492 Ga0207640_100254922 217
51 3300026041 Ga0207639_10135414 Ga0207639_101354142 217
52 3300026067 Ga0207678_10365204 Ga0207678_103652042 217
53 3300026142 Ga0207698_10000739 Ga0207698_100007398 217
54 3300026142 Ga0207698_10005850 Ga0207698_100058503 217
55 3300037418 Ga0395900_0204524 Ga0395900_0204524_153_842 217
56 3300038443 Ga0395901_0325305 Ga0395901_0325305_691_1380 217
57 3300048906 Ga0496103_0135571 Ga0496103_0135571_836_1525 218
58 iso_pu_bacteria 2891373044 2891375250 218
59 iso_pu_bacteria 2989349275 2989351716 218
60 iso_pu_bacteria 3003930520 3003931671 218
61 3300047472 Ga0495686_0002521 Ga0495686_0002521_8910_9602 219
62 iso_pu_bacteria 2838029111 2838029508 219
63 iso_pu_bacteria 2842205361 2842211153 219
64 iso_pu_bacteria 2842278818 2842284606 219
65 iso_pu_bacteria 2842475841 2842476062 219
66 iso_pu_bacteria 2842502639 2842503036 219
67 iso_pu_bacteria 2852387548 2852388209 219
68 3300025294 Ga0209025_1000037 Ga0209025_100003783 220
69 3300048920 Ga0496117_0001877 Ga0496117_0001877_2653_3348 220
70 3300048925 Ga0496122_0000309 Ga0496122_0000309_96064_96759 220
71 3300048926 Ga0496123_0000238 Ga0496123_0000238_413_1108 220
72 3300048927 Ga0496124_0001541 Ga0496124_0001541_7582_8277 220
73 3300048928 Ga0496125_0000393 Ga0496125_0000393_33629_34324 220
74 3300048929 Ga0496126_0001032 Ga0496126_0001032_24994_25689 220
75 3300048929 Ga0496126_0119744 Ga0496126_0119744_107_802 220
76 3300049568 Ga0501031_0088069 Ga0501031_0088069_955_1650 220
77 3300049569 Ga0501032_0128019 Ga0501032_0128019_249_944 220
78 3300049570 Ga0501033_0134616 Ga0501033_0134616_410_1105 220
79 3300049571 Ga0501034_0135336 Ga0501034_0135336_1252_1947 220
80 3300049571 Ga0501034_0141949 Ga0501034_0141949_1101_1796 220
81 3300049572 Ga0501036_0066290 Ga0501036_0066290_681_1376 220
82 3300049573 Ga0501037_0457774 Ga0501037_0457774_77_772 220
83 3300049574 Ga0501038_0066397 Ga0501038_0066397_1178_1873 220
84 3300049579 Ga0501043_0007759 Ga0501043_0007759_6099_6794 220
85 3300049822 Ga0501035_0097134 Ga0501035_0097134_220_915 220
86 3300049823 Ga0501044_0660716 Ga0501044_0660716_220_915 220
87 iso_pu_bacteria 2510461076 2510897393 220
88 iso_pu_bacteria 2510917030 2511194812 220
89 iso_pu_bacteria 2513237084 2513570298 220
90 iso_pu_bacteria 2513237088 2513600707 220
91 iso_pu_bacteria 2513237093 2513633967 220
92 iso_pu_bacteria 2513237144 2513911278 220
93 iso_pu_bacteria 2513237146 2513924525 220
94 iso_pu_bacteria 2515154113 2515634012 220
95 iso_pu_bacteria 2515154114 2515641168 220
96 iso_pu_bacteria 2516653077 2517038713 220
97 iso_pu_bacteria 2534681796 2535514815 220
98 iso_pu_bacteria 2582581304 2585256165 220
99 iso_pu_bacteria 2585427594 2585843955 220
100 iso_pu_bacteria 2599185170 2599419512 220
101 iso_pu_bacteria 2643221637 2644207092 220
102 iso_pu_bacteria 2643221718 2644650740 220
103 iso_pu_bacteria 2738541293 2738804534 220
104 iso_pu_bacteria 2765235942 2766063410 220
105 iso_pu_bacteria 2775507049 2776911744 220
106 iso_pu_bacteria 2838035591 2838039953 220
107 iso_pu_bacteria 2838661181 2838664236 220
108 iso_pu_bacteria 2842110456 2842112501 220
109 iso_pu_bacteria 2916014648 2916019070 220
110 iso_pu_bacteria 2921257292 2921262741 220
111 iso_pu_bacteria 2921289301 2921289807 220
112 iso_pu_bacteria 2924165586 2924170802 220
113 iso_pu_bacteria 2924186466 2924189444 220
114 iso_pu_bacteria 2924214083 2924214658 220
115 iso_pu_bacteria 2924221636 2924226397 220
116 iso_pu_bacteria 2933586486 2933588610 220
117 iso_pu_bacteria 2936367885 2936369270 220
118 iso_pu_bacteria 2936375103 2936377382 220
119 iso_pu_bacteria 2996893221 2996897831 220
120 iso_pu_bacteria 3005452660 3005456605 220
121 iso_pu_bacteria 8005376324 8005377776 220
122 iso_pu_bacteria 8005542996 8005543485 220
123 iso_pu_bacteria 8005556819 8005560273 220
124 iso_pu_bacteria 8005563573 8005564272 220
125 iso_pu_bacteria 8018163183 8018167348 220
126 iso_pu_bacteria 8024479707 8024479946 220
127 iso_pu_bacteria 8054558443 8054563234 220
128 iso_pu_bacteria 8055431914 8055433621 220
129 iso_pu_bacteria 8057874678 8057877504 220
130 3300002704 JGI25155J39150_1000013 JGI25155J39150_1000013127 221
131 3300002705 JGI25156J39149_1000011 JGI25156J39149_1000011127 221
132 3300002738 JGI25154J39366_1000030 JGI25154J39366_1000030127 221
133 3300002741 JGI25157J39369_1000013 JGI25157J39369_1000013127 221
134 3300005331 Ga0070670_100007675 Ga0070670_1000076757 221
135 3300025206 Ga0209435_100026 Ga0209435_100026124 221
136 3300025246 Ga0209646_1000084 Ga0209646_1000084124 221
137 3300025250 Ga0209026_1000080 Ga0209026_1000080124 221
138 3300025256 Ga0209759_1000061 Ga0209759_1000061124 221
139 3300025925 Ga0207650_10001700 Ga0207650_100017007 221
140 3300035170 Ga0373943_0228464 Ga0373943_0228464_112_813 221
141 3300035695 Ga0373927_0000103 Ga0373927_0000103_13319_14020 221
142 3300037471 Ga0395905_0023682 Ga0395905_0023682_226_927 221
143 3300038727 Ga0400491_08946 Ga0400491_08946_487_1191 221
144 3300046507 Ga0495606_0159359 Ga0495606_0159359_146_850 221
145 3300046557 Ga0495622_0049017 Ga0495622_0049017_516_1283 221
146 3300046675 Ga0495657_0064475 Ga0495657_0064475_1120_1887 221
147 3300046689 Ga0495613_0245543 Ga0495613_0245543_397_1164 221
148 3300046809 Ga0495600_0089909 Ga0495600_0089909_225_992 221
149 3300047472 Ga0495686_0015350 Ga0495686_0015350_2362_3066 221
150 3300048924 Ga0496121_0232263 Ga0496121_0232263_471_1175 221
151 3300053077 Ga0495601_0058053 Ga0495601_0058053_224_991 221
152 3300053085 Ga0495619_0151813 Ga0495619_0151813_635_1402 221
153 3300053136 Ga0500559_0203830 Ga0500559_0203830_65_766 221
154 3300053148 Ga0500590_004746 Ga0500590_004746_1184_1951 221
155 iso_pu_bacteria 2643221558 2643812699 221
156 iso_pu_bacteria 2899803654 2899805585 221
157 iso_pu_bacteria 8018150411 8018155075 221
158 3300002773 JGI25152J39213_1002077 JGI25152J39213_10020776 222
159 3300003771 Ga0055526_1019862 Ga0055526_10198622 222
160 3300003775 Ga0055524_1021083 Ga0055524_10210831 222
161 3300005347 Ga0070668_100152303 Ga0070668_1001523032 222
162 3300005353 Ga0070669_100050478 Ga0070669_1000504782 222
163 3300005455 Ga0070663_100138745 Ga0070663_1001387453 222
164 3300006178 Ga0075367_10000992 Ga0075367_100009922 222
165 3300009036 Ga0105244_10075044 Ga0105244_100750442 222
166 3300009092 Ga0105250_10019508 Ga0105250_100195082 222
167 3300009177 Ga0105248_10100910 Ga0105248_101009104 222
168 3300025258 Ga0209129_1004479 Ga0209129_10044796 222
169 3300025302 Ga0207426_1002050 Ga0207426_10020507 222
170 3300025303 Ga0209051_1008183 Ga0209051_10081834 222
171 3300025972 Ga0207668_10092183 Ga0207668_100921833 222
172 3300026067 Ga0207678_10226774 Ga0207678_102267742 222
173 3300027111 Ga0209281_1000783 Ga0209281_100078312 222
174 3300031731 Ga0307405_10000918 Ga0307405_100009185 222
175 3300031901 Ga0307406_10004933 Ga0307406_100049334 222
176 3300041498 Ga0451841_0249814 Ga0451841_0249814_2004_2711 222
177 3300041498 Ga0451841_0345758 Ga0451841_0345758_37_744 222
178 3300046460 Ga0495638_0000418 Ga0495638_0000418_23870_24577 222
179 3300046474 Ga0495605_0014465 Ga0495605_0014465_2426_3133 222
180 3300046492 Ga0495585_0009897 Ga0495585_0009897_4032_4739 222
181 3300046492 Ga0495585_0032564 Ga0495585_0032564_1246_1953 222
182 3300046501 Ga0495607_0032931 Ga0495607_0032931_1227_1934 222
183 3300046506 Ga0495583_0009459 Ga0495583_0009459_4092_4799 222
184 3300046512 Ga0495610_0005716 Ga0495610_0005716_5260_5967 222
185 3300046513 Ga0495616_0011197 Ga0495616_0011197_155_862 222
186 3300046518 Ga0495631_0003370 Ga0495631_0003370_5743_6450 222
187 3300046522 Ga0495643_0050366 Ga0495643_0050366_451_1158 222
188 3300046530 Ga0495654_0084256 Ga0495654_0084256_347_1054 222
189 3300046538 Ga0495609_0006983 Ga0495609_0006983_1280_1987 222
190 3300046558 Ga0495633_0126673 Ga0495633_0126673_53_760 222
191 3300046616 Ga0495668_0003238 Ga0495668_0003238_2182_2889 222
192 3300046660 Ga0495625_0022819 Ga0495625_0022819_2149_2856 222
193 3300046665 Ga0495661_0118943 Ga0495661_0118943_166_873 222
194 3300046684 Ga0495669_0271624 Ga0495669_0271624_42_749 222
195 3300046691 Ga0495670_0009549 Ga0495670_0009549_3107_3814 222
196 3300046692 Ga0495671_0036036 Ga0495671_0036036_1101_1808 222
197 3300047320 Ga0495672_0011736 Ga0495672_0011736_3103_3810 222
198 3300047470 Ga0495681_0049686 Ga0495681_0049686_997_1704 222
199 3300047472 Ga0495686_0018878 Ga0495686_0018878_2726_3433 222
200 3300047472 Ga0495686_0119221 Ga0495686_0119221_707_1414 222
201 3300048924 Ga0496121_0299233 Ga0496121_0299233_368_1075 222
202 3300048925 Ga0496122_0087314 Ga0496122_0087314_642_1349 222
203 3300048927 Ga0496124_0006313 Ga0496124_0006313_7107_7814 222
204 3300049459 Ga0495678_023419 Ga0495678_023419_1146_1853 222
205 3300049569 Ga0501032_0126362 Ga0501032_0126362_760_1461 222
206 3300049570 Ga0501033_0011923 Ga0501033_0011923_2725_3426 222
207 3300049572 Ga0501036_0149021 Ga0501036_0149021_1142_1849 222
208 3300049574 Ga0501038_0009548 Ga0501038_0009548_1428_2126 222
209 3300049581 Ga0501047_0010148 Ga0501047_0010148_152_853 222
210 3300049582 Ga0501048_0031926 Ga0501048_0031926_705_1412 222
211 3300049584 Ga0501068_0346979 Ga0501068_0346979_141_842 222
212 3300049586 Ga0501070_0000739 Ga0501070_0000739_4078_4779 222
213 3300049742 Ga0501080_0001237 Ga0501080_0001237_2187_2888 222
214 3300049822 Ga0501035_0000288 Ga0501035_0000288_49345_50046 222
215 3300049823 Ga0501044_0004774 Ga0501044_0004774_4739_5440 222
216 3300049823 Ga0501044_0045361 Ga0501044_0045361_920_1627 222
217 3300053079 Ga0500610_0013155 Ga0500610_0013155_857_1564 222
218 3300053086 Ga0500578_0077492 Ga0500578_0077492_275_982 222
219 3300053098 Ga0500650_0024198 Ga0500650_0024198_859_1566 222
220 3300053109 Ga0500569_021295 Ga0500569_021295_699_1406 222
221 3300053118 Ga0500594_0000803 Ga0500594_0000803_1084_1791 222
222 3300053139 Ga0500568_0001319 Ga0500568_0001319_2222_2929 222
223 3300053153 Ga0500616_0001070 Ga0500616_0001070_25717_26424 222
224 3300053156 Ga0500622_0127190 Ga0500622_0127190_474_1181 222
225 3300053158 Ga0500627_0010602 Ga0500627_0010602_1516_2223 222
226 iso_pu_bacteria 2508501122 2509109000 222
227 iso_pu_bacteria 2509276019 2509375278 222
228 iso_pu_bacteria 2509276021 2509388763 222
229 iso_pu_bacteria 2509276033 2509444350 222
230 iso_pu_bacteria 2510065057 2510307160 222
231 iso_pu_bacteria 2511231052 2511499046 222
232 iso_pu_bacteria 2512047086 2512531645 222
233 iso_pu_bacteria 2512875026 2512973001 222
234 iso_pu_bacteria 2513237086 2513582393 222
235 iso_pu_bacteria 2513237089 2513604417 222
236 iso_pu_bacteria 2513237091 2513616095 222
237 iso_pu_bacteria 2513237140 2513884703 222
238 iso_pu_bacteria 2513237143 2513905098 222
239 iso_pu_bacteria 2513237156 2513983058 222
240 iso_pu_bacteria 2513237159 2513996490 222
241 iso_pu_bacteria 2513237160 2514007117 222
242 iso_pu_bacteria 2515154107 2515607466 222
243 iso_pu_bacteria 2516143018 2516204585 222
244 iso_pu_bacteria 2516653046 2516891595 222
245 iso_pu_bacteria 2517487022 2517568381 222
246 iso_pu_bacteria 2524023207 2524450795 222
247 iso_pu_bacteria 2529292951 2530648122 222
248 iso_pu_bacteria 2551306084 2551679994 222
249 iso_pu_bacteria 2551306085 2551683651 222
250 iso_pu_bacteria 2551306086 2551691631 222
251 iso_pu_bacteria 2551306087 2551702806 222
252 iso_pu_bacteria 2551306089 2551708717 222
253 iso_pu_bacteria 2551306090 2551718107 222
254 iso_pu_bacteria 2551306091 2551725042 222
255 iso_pu_bacteria 2551306092 2551733874 222
256 iso_pu_bacteria 2551306093 2551741157 222
257 iso_pu_bacteria 2558860100 2558866366 222
258 iso_pu_bacteria 2582581283 2585164643 222
259 iso_pu_bacteria 2582581306 2585264983 222
260 iso_pu_bacteria 2582581865 2585385958 222
261 iso_pu_bacteria 2582581866 2585392189 222
262 iso_pu_bacteria 2599185156 2599332786 222
263 iso_pu_bacteria 2599185352 2600191142 222
264 iso_pu_bacteria 2600254933 2600376565 222
265 iso_pu_bacteria 2643221557 2643806025 222
266 iso_pu_bacteria 2643221607 2644047487 222
267 iso_pu_bacteria 2643221610 2644066201 222
268 iso_pu_bacteria 2643221618 2644103554 222
269 iso_pu_bacteria 2643221626 2644144433 222
270 iso_pu_bacteria 2643221634 2644196840 222
271 iso_pu_bacteria 2643221636 2644199905 222
272 iso_pu_bacteria 2643221655 2644306484 222
273 iso_pu_bacteria 2643221659 2644330674 222
274 iso_pu_bacteria 2643221668 2644377285 222
275 iso_pu_bacteria 2643221675 2644417532 222
276 iso_pu_bacteria 2643221680 2644450928 222
277 iso_pu_bacteria 2643221686 2644480276 222
278 iso_pu_bacteria 2643221688 2644495588 222
279 iso_pu_bacteria 2643221689 2644498439 222
280 iso_pu_bacteria 2643221698 2644542522 222
281 iso_pu_bacteria 2643221712 2644612095 222
282 iso_pu_bacteria 2643221723 2644671711 222
283 iso_pu_bacteria 2643221726 2644692649 222
284 iso_pu_bacteria 2657244999 2657682974 222
285 iso_pu_bacteria 2690316117 2692317537 222
286 iso_pu_bacteria 2718217927 2719383819 222
287 iso_pu_bacteria 2718218423 2721397577 222
288 iso_pu_bacteria 2721755809 2724036387 222
289 iso_pu_bacteria 2751185821 2753462700 222
290 iso_pu_bacteria 2791355082 2792583148 222
291 iso_pu_bacteria 2791355091 2792621173 222
292 iso_pu_bacteria 2791355092 2792625387 222
293 iso_pu_bacteria 2791355094 2792637818 222
294 iso_pu_bacteria 2791355253 2793282937 222
295 iso_pu_bacteria 2791355259 2793313986 222
296 iso_pu_bacteria 2791355263 2793343934 222
297 iso_pu_bacteria 2791355266 2793358278 222
298 iso_pu_bacteria 2791355267 2793365568 222
299 iso_pu_bacteria 2802428858 2802718568 222
300 iso_pu_bacteria 2802428859 2802724249 222
301 iso_pu_bacteria 2802428860 2802730089 222
302 iso_pu_bacteria 2802428861 2802737432 222
303 iso_pu_bacteria 2802428862 2802742348 222
304 iso_pu_bacteria 2802428863 2802749031 222
305 iso_pu_bacteria 2802429268 2804750692 222
306 iso_pu_bacteria 2802429605 2805928136 222
307 iso_pu_bacteria 2802429606 2805935487 222
308 iso_pu_bacteria 2838042994 2838048446 222
309 iso_pu_bacteria 2838074704 2838075093 222
310 iso_pu_bacteria 2838668709 2838674330 222
311 iso_pu_bacteria 2838680041 2838680262 222
312 iso_pu_bacteria 2838694306 2838695707 222
313 iso_pu_bacteria 2838701080 2838706760 222
314 iso_pu_bacteria 2838707686 2838709082 222
315 iso_pu_bacteria 2841864319 2841868880 222
316 iso_pu_bacteria 2842077413 2842079682 222
317 iso_pu_bacteria 2842118031 2842120300 222
318 iso_pu_bacteria 2842146304 2842151413 222
319 iso_pu_bacteria 2842192696 2842198134 222
320 iso_pu_bacteria 2842237096 2842238493 222
321 iso_pu_bacteria 2842250916 2842256551 222
322 iso_pu_bacteria 2842291075 2842293343 222
323 iso_pu_bacteria 2842317721 2842322037 222
324 iso_pu_bacteria 2842341865 2842344409 222
325 iso_pu_bacteria 2842363717 2842367450 222
326 iso_pu_bacteria 2842370503 2842370724 222
327 iso_pu_bacteria 2842377471 2842379740 222
328 iso_pu_bacteria 2842384541 2842386811 222
329 iso_pu_bacteria 2842489311 2842494597 222
330 iso_pu_bacteria 2842495871 2842499943 222
331 iso_pu_bacteria 2842521101 2842521414 222
332 iso_pu_bacteria 2842922631 2842923061 222
333 iso_pu_bacteria 2844163670 2844170174 222
334 iso_pu_bacteria 2847417321 2847417392 222
335 iso_pu_bacteria 2848992105 2848992178 222
336 iso_pu_bacteria 2850079185 2850079657 222
337 iso_pu_bacteria 2855825444 2855827959 222
338 iso_pu_bacteria 2855839649 2855839715 222
339 iso_pu_bacteria 2855872281 2855875183 222
340 iso_pu_bacteria 2858800743 2858803608 222
341 iso_pu_bacteria 2896384573 2896384800 222
342 iso_pu_bacteria 2913295892 2913298218 222
343 iso_pu_bacteria 2915980308 2915986492 222
344 iso_pu_bacteria 2915986958 2915990310 222
345 iso_pu_bacteria 2915993759 2915997261 222
346 iso_pu_bacteria 2916000859 2916004683 222
347 iso_pu_bacteria 2916007675 2916012079 222
348 iso_pu_bacteria 2916021584 2916027941 222
349 iso_pu_bacteria 2916028427 2916031510 222
350 iso_pu_bacteria 2916035215 2916039410 222
351 iso_pu_bacteria 2916041962 2916048271 222
352 iso_pu_bacteria 2916048683 2916051967 222
353 iso_pu_bacteria 2916055098 2916057061 222
354 iso_pu_bacteria 2916061851 2916065231 222
355 iso_pu_bacteria 2916068649 2916076378 222
356 iso_pu_bacteria 2916076590 2916077863 222
357 iso_pu_bacteria 2920760137 2920763650 222
358 iso_pu_bacteria 2920822456 2920823064 222
359 iso_pu_bacteria 2921237296 2921242751 222
360 iso_pu_bacteria 2921244191 2921248985 222
361 iso_pu_bacteria 2921250672 2921252660 222
362 iso_pu_bacteria 2921263974 2921268807 222
363 iso_pu_bacteria 2921282425 2921287013 222
364 iso_pu_bacteria 2924144063 2924148871 222
365 iso_pu_bacteria 2924150972 2924154318 222
366 iso_pu_bacteria 2924158325 2924164652 222
367 iso_pu_bacteria 2924172951 2924179240 222
368 iso_pu_bacteria 2924179722 2924181126 222
369 iso_pu_bacteria 2924193448 2924200179 222
370 iso_pu_bacteria 2924200457 2924204648 222
371 iso_pu_bacteria 2924207177 2924211725 222
372 iso_pu_bacteria 2924228884 2924230030 222
373 iso_pu_bacteria 2935894831 2935896227 222
374 iso_pu_bacteria 2936381700 2936385785 222
375 iso_pu_bacteria 2936996657 2936998548 222
376 iso_pu_bacteria 2937002841 2937007454 222
377 iso_pu_bacteria 2937009748 2937015570 222
378 iso_pu_bacteria 2937016420 2937021357 222
379 iso_pu_bacteria 2937023124 2937023464 222
380 iso_pu_bacteria 2937029754 2937031585 222
381 iso_pu_bacteria 2937036028 2937037731 222
382 iso_pu_bacteria 2937042894 2937047401 222
383 iso_pu_bacteria 2937049772 2937053256 222
384 iso_pu_bacteria 2937056579 2937060794 222
385 iso_pu_bacteria 2937063883 2937066785 222
386 iso_pu_bacteria 2937071275 2937073347 222
387 iso_pu_bacteria 2937078374 2937081726 222
388 iso_pu_bacteria 2937084907 2937088746 222
389 iso_pu_bacteria 2937091812 2937098696 222
390 iso_pu_bacteria 2937098957 2937102793 222
391 iso_pu_bacteria 2937106411 2937106507 222
392 iso_pu_bacteria 2937113482 2937119383 222
393 iso_pu_bacteria 2937119839 2937124288 222
394 iso_pu_bacteria 2937126314 2937130868 222
395 iso_pu_bacteria 2941499720 2941500978 222
396 iso_pu_bacteria 2957375807 2957377798 222
397 iso_pu_bacteria 2957382221 2957386469 222
398 iso_pu_bacteria 2957388812 2957393288 222
399 iso_pu_bacteria 2957395598 2957397155 222
400 iso_pu_bacteria 2957402308 2957403392 222
401 iso_pu_bacteria 2957408893 2957413413 222
402 iso_pu_bacteria 2957415311 2957420842 222
403 iso_pu_bacteria 2957430029 2957435910 222
404 iso_pu_bacteria 2957437181 2957443272 222
405 iso_pu_bacteria 2957443900 2957449242 222
406 iso_pu_bacteria 2957450854 2957455639 222
407 iso_pu_bacteria 2957457609 2957461875 222
408 iso_pu_bacteria 2957464669 2957469428 222
409 iso_pu_bacteria 2957478035 2957481888 222
410 iso_pu_bacteria 2957484790 2957490992 222
411 iso_pu_bacteria 2957491536 2957494038 222
412 iso_pu_bacteria 2957498199 2957500759 222
413 iso_pu_bacteria 2957505466 2957505899 222
414 iso_pu_bacteria 2960584000 2960590428 222
415 iso_pu_bacteria 2960591022 2960593369 222
416 iso_pu_bacteria 2960597568 2960601239 222
417 iso_pu_bacteria 2960603979 2960604342 222
418 iso_pu_bacteria 2960610863 2960613312 222
419 iso_pu_bacteria 2960617483 2960620119 222
420 iso_pu_bacteria 2960624210 2960626239 222
421 iso_pu_bacteria 2960631154 2960637155 222
422 iso_pu_bacteria 2960637947 2960644152 222
423 iso_pu_bacteria 2960645483 2960650382 222
424 iso_pu_bacteria 2960652885 2960658898 222
425 iso_pu_bacteria 2960660292 2960660673 222
426 iso_pu_bacteria 2960667422 2960673055 222
427 iso_pu_bacteria 2960674078 2960677712 222
428 iso_pu_bacteria 2960680706 2960684406 222
429 iso_pu_bacteria 2960687367 2960687410 222
430 iso_pu_bacteria 2960693952 2960697480 222
431 iso_pu_bacteria 2964607997 2964614794 222
432 iso_pu_bacteria 2964615318 2964618337 222
433 iso_pu_bacteria 2964621998 2964626609 222
434 iso_pu_bacteria 2964628898 2964633368 222
435 iso_pu_bacteria 2964636051 2964642271 222
436 iso_pu_bacteria 2964643177 2964649803 222
437 iso_pu_bacteria 2964649959 2964650054 222
438 iso_pu_bacteria 2964656573 2964661666 222
439 iso_pu_bacteria 2964663802 2964670239 222
440 iso_pu_bacteria 2964678106 2964683593 222
441 iso_pu_bacteria 2964685014 2964689848 222
442 iso_pu_bacteria 2964691889 2964696171 222
443 iso_pu_bacteria 2964698721 2964702862 222
444 iso_pu_bacteria 2964705432 2964710739 222
445 iso_pu_bacteria 2964712639 2964712996 222
446 iso_pu_bacteria 2964719344 2964724407 222
447 iso_pu_bacteria 2967664464 2967667504 222
448 iso_pu_bacteria 2967671571 2967676830 222
449 iso_pu_bacteria 2967678726 2967682585 222
450 iso_pu_bacteria 2967686174 2967688130 222
451 iso_pu_bacteria 2967693043 2967694809 222
452 iso_pu_bacteria 2967699805 2967706922 222
453 iso_pu_bacteria 2967706974 2967711494 222
454 iso_pu_bacteria 2967714385 2967714403 222
455 iso_pu_bacteria 2967721400 2967723727 222
456 iso_pu_bacteria 2967728569 2967731140 222
457 iso_pu_bacteria 2967735183 2967739153 222
458 iso_pu_bacteria 2967742019 2967745724 222
459 iso_pu_bacteria 2967748971 2967754551 222
460 iso_pu_bacteria 2967755722 2967757237 222
461 iso_pu_bacteria 2967762386 2967768783 222
462 iso_pu_bacteria 2967769361 2967773759 222
463 iso_pu_bacteria 2967775926 2967780056 222
464 iso_pu_bacteria 2970019648 2970021242 222
465 iso_pu_bacteria 2970026789 2970027318 222
466 iso_pu_bacteria 2970033650 2970037471 222
467 iso_pu_bacteria 2970040964 2970041003 222
468 iso_pu_bacteria 2970047711 2970048167 222
469 iso_pu_bacteria 2970054988 2970056944 222
470 iso_pu_bacteria 2970061556 2970068347 222
471 iso_pu_bacteria 2970068827 2970074593 222
472 iso_pu_bacteria 2970076120 2970080458 222
473 iso_pu_bacteria 2970082768 2970088095 222
474 iso_pu_bacteria 2970088815 2970093729 222
475 iso_pu_bacteria 2970095765 2970100795 222
476 iso_pu_bacteria 2970102677 2970106076 222
477 iso_pu_bacteria 2970109326 2970111535 222
478 iso_pu_bacteria 2970116247 2970121386 222
479 iso_pu_bacteria 2970122695 2970125207 222
480 iso_pu_bacteria 2970129317 2970131307 222
481 iso_pu_bacteria 2970136068 2970140803 222
482 iso_pu_bacteria 2970143518 2970146315 222
483 iso_pu_bacteria 2970149975 2970151872 222
484 iso_pu_bacteria 2970156795 2970162599 222
485 iso_pu_bacteria 2970164137 2970169566 222
486 iso_pu_bacteria 2970170962 2970175691 222
487 iso_pu_bacteria 2970177841 2970179379 222
488 iso_pu_bacteria 2970184632 2970188788 222
489 iso_pu_bacteria 2970191845 2970196584 222
490 iso_pu_bacteria 2977523885 2977528453 222
491 iso_pu_bacteria 2977530762 2977531101 222
492 iso_pu_bacteria 2977537788 2977538506 222
493 iso_pu_bacteria 2977544691 2977545843 222
494 iso_pu_bacteria 2977551784 2977554726 222
495 iso_pu_bacteria 2977558990 2977563342 222
496 iso_pu_bacteria 2977565890 2977570080 222
497 iso_pu_bacteria 2977572785 2977575576 222
498 iso_pu_bacteria 2977579622 2977584327 222
499 iso_pu_bacteria 648276728 648736782 222
500 iso_pu_bacteria 8003992118 8003992187 222
501 iso_pu_bacteria 8003999396 8003999464 222
502 iso_pu_bacteria 8005275841 8005278521 222
503 iso_pu_bacteria 8018176218 8018181825 222
504 iso_pu_bacteria 8024501048 8024502218 222
505 iso_pu_bacteria 8049293176 8049293242 222
506 iso_pu_bacteria 8056375014 8056376159 222
507 3300005548 Ga0070665_100105348 Ga0070665_1001053482 223
508 3300028379 Ga0268266_10108320 Ga0268266_101083202 223
509 3300032126 Ga0307415_100208922 Ga0307415_1002089222 223
510 3300053157 Ga0500624_015036 Ga0500624_015036_138_848 223
511 3300053161 Ga0500634_0002414 Ga0500634_0002414_4738_5448 223
512 iso_pu_bacteria 2510461069 2510839425 223
513 iso_pu_bacteria 2519899620 2520375744 223
514 iso_pu_bacteria 2615840624 2616293721 223
515 iso_pu_bacteria 2643221653 2644297880 223
516 iso_pu_bacteria 2643221719 2644656133 223
517 iso_pu_bacteria 2718217997 2719663616 223
518 iso_pu_bacteria 2718218199 2720490035 223
519 iso_pu_bacteria 2718218232 2720611411 223
520 iso_pu_bacteria 2718218233 2720618261 223
521 iso_pu_bacteria 2718218235 2720629664 223
522 iso_pu_bacteria 2718218269 2720773360 223
523 iso_pu_bacteria 2721755556 2723025038 223
524 iso_pu_bacteria 2721755684 2723558617 223
525 iso_pu_bacteria 2721755685 2723565186 223
526 iso_pu_bacteria 2721755819 2724087967 223
527 iso_pu_bacteria 2721755822 2724102451 223
528 iso_pu_bacteria 2721755823 2724108355 223
529 iso_pu_bacteria 2728369352 2730105974 223
530 iso_pu_bacteria 2791355256 2793296846 223
531 iso_pu_bacteria 2791355261 2793329024 223
532 iso_pu_bacteria 2791355265 2793352710 223
533 iso_pu_bacteria 2838016132 2838020580 223
534 iso_pu_bacteria 2838048938 2838053089 223
535 iso_pu_bacteria 2838061910 2838065897 223
536 iso_pu_bacteria 2838068647 2838070765 223
537 iso_pu_bacteria 2842264693 2842268392 223
538 iso_pu_bacteria 2842285085 2842286511 223
539 iso_pu_bacteria 2842311132 2842312462 223
540 iso_pu_bacteria 2842395702 2842401614 223
541 iso_pu_bacteria 2842402390 2842403936 223
542 iso_pu_bacteria 2842409023 2842410361 223
543 iso_pu_bacteria 2842415677 2842417009 223
544 iso_pu_bacteria 2842422224 2842424380 223
545 iso_pu_bacteria 2842428310 2842432364 223
546 iso_pu_bacteria 2842434925 2842438668 223
547 iso_pu_bacteria 2842441272 2842445298 223
548 iso_pu_bacteria 2842447887 2842452882 223
549 iso_pu_bacteria 2842462802 2842466301 223
550 iso_pu_bacteria 2842469257 2842473121 223
551 iso_pu_bacteria 2933599457 2933601569 223
552 iso_pu_bacteria 2989776772 2989777169 223
553 iso_pu_bacteria 8005246636 8005247678 223
554 iso_pu_bacteria 8005282627 8005282933 223
555 iso_pu_bacteria 8005382845 8005385077 223
556 iso_pu_bacteria 8005395548 8005399843 223
557 iso_pu_bacteria 8005430974 8005432630 223
558 iso_pu_bacteria 8005497431 8005498352 223
559 iso_pu_bacteria 8005619151 8005619547 223
560 iso_pu_bacteria 8005626139 8005628111 223
561 iso_pu_bacteria 8005668836 8005669760 223
562 iso_pu_bacteria 8005695170 8005699617 223
563 iso_pu_bacteria 8018127388 8018132796 223
564 iso_pu_bacteria 8056382006 8056384098 223
565 3300002739 JGI25158J39367_1002679 JGI25158J39367_10026792 224
566 3300002987 JGI25159J45721_1000003 JGI25159J45721_100000391 224
567 3300003187 JGI25151J46595_10011543 JGI25151J46595_100115431 224
568 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003272 224
569 3300003374 JGI25161J50226_1000692 JGI25161J50226_100069210 224
570 3300003771 Ga0055526_1000453 Ga0055526_10004535 224
571 3300003775 Ga0055524_1001731 Ga0055524_10017319 224
572 3300003775 Ga0055524_1021294 Ga0055524_10212942 224
573 3300003792 Ga0055540_1000897 Ga0055540_100089715 224
574 3300003794 Ga0055531_10016495 Ga0055531_100164951 224
575 3300004625 Ga0055543_1000043 Ga0055543_100004362 224
576 3300005262 Ga0065165_1000025 Ga0065165_100002557 224
577 3300006195 Ga0075366_10090101 Ga0075366_100901013 224
578 3300006946 Ga0079104_1052387 Ga0079104_10523871 224
579 3300009765 Ga0123341_1000038 Ga0123341_10000381 224
580 3300009766 Ga0123342_1006624 Ga0123342_10066241 224
581 3300013249 Ga0171463_1001 Ga0171463_10011013 224
582 3300015690 Ga0183363_1154 Ga0183363_11542 224
583 3300021320 Ga0214544_1000105 Ga0214544_100010534 224
584 3300021321 Ga0214542_1000029 Ga0214542_1000029135 224
585 3300021321 Ga0214542_1025661 Ga0214542_10256612 224
586 3300021327 Ga0214543_1000027 Ga0214543_100002758 224
587 3300021327 Ga0214543_1000040 Ga0214543_1000040135 224
588 3300022739 Ga0228711_1000013 Ga0228711_100001329 224
589 3300022740 Ga0228710_1000008 Ga0228710_1000008100 224
590 3300025208 Ga0209436_100844 Ga0209436_10084412 224
591 3300025245 Ga0207425_1014108 Ga0207425_10141081 224
592 3300025273 Ga0209673_1001375 Ga0209673_10013757 224
593 3300025284 Ga0209130_1000005 Ga0209130_1000005209 224
594 3300025292 Ga0209676_1004789 Ga0209676_10047894 224
595 3300025292 Ga0209676_1048290 Ga0209676_10482902 224
596 3300025294 Ga0209025_1000105 Ga0209025_1000105207 224
597 3300025295 Ga0209564_1000093 Ga0209564_1000093211 224
598 3300025298 Ga0209050_1013670 Ga0209050_10136701 224
599 3300025298 Ga0209050_1015020 Ga0209050_10150203 224
600 3300025299 Ga0209256_1000027 Ga0209256_1000027201 224
601 3300025299 Ga0209256_1002975 Ga0209256_100297514 224
602 3300025302 Ga0207426_1000015 Ga0207426_1000015390 224
603 3300025303 Ga0209051_1000197 Ga0209051_100019760 224
604 3300025303 Ga0209051_1015915 Ga0209051_10159152 224
605 3300025304 Ga0209257_1005309 Ga0209257_10053099 224
606 3300025304 Ga0209257_1006739 Ga0209257_10067394 224
607 3300027111 Ga0209281_1000134 Ga0209281_1000134162 224
608 3300027666 Ga0209282_1000029 Ga0209282_1000029130 224
609 3300028794 Ga0307515_10000029 Ga0307515_10000029297 224
610 3300028794 Ga0307515_10175456 Ga0307515_101754562 224
611 3300031548 Ga0307408_100046261 Ga0307408_1000462614 224
612 3300031731 Ga0307405_10326741 Ga0307405_103267411 224
613 3300031911 Ga0307412_10029101 Ga0307412_100291012 224
614 3300031967 Ga0315914_1000021 Ga0315914_100002115 224
615 3300031995 Ga0307409_100014709 Ga0307409_1000147095 224
616 3300032002 Ga0307416_100055242 Ga0307416_1000552422 224
617 3300033430 Ga0315913_1000014 Ga0315913_100001495 224
618 3300033464 Ga0315915_1000003 Ga0315915_100000315 224
619 3300041408 Ga0439453_0062422 Ga0439453_0062422_44_757 224
620 3300041413 Ga0439465_0132553 Ga0439465_0132553_44_757 224
621 3300042007 Ga0439449_0037559 Ga0439449_0037559_790_1503 224
622 3300042007 Ga0439449_0038495 Ga0439449_0038495_382_1095 224
623 3300042015 Ga0439462_0025658 Ga0439462_0025658_163_876 224
624 3300042156 Ga0439446_0055371 Ga0439446_0055371_373_1086 224
625 3300042531 Ga0450918_009020 Ga0450918_009020_665_1378 224
626 3300050493 nmdc:mga0k408_71132_c1 nmdc:mga0k408_71132_c1_852_1565 224
627 iso_pu_bacteria 643692032 643824279 224
628 iso_pu_bacteria 8005658619 8005662633 224
629 iso_pu_bacteria 2818991272 2819245125 225
630 3300002774 JGI25150J39212_1000194 JGI25150J39212_100019419 226
631 3300002774 JGI25150J39212_1000314 JGI25150J39212_10003145 226
632 3300003187 JGI25151J46595_10000555 JGI25151J46595_1000055538 226
633 3300003215 JGI25153J46596_10009765 JGI25153J46596_100097654 226
634 3300025245 Ga0207425_1000012 Ga0207425_100001238 226
635 3300025258 Ga0209129_1000110 Ga0209129_100011038 226
636 3300025273 Ga0209673_1007743 Ga0209673_10077432 226
637 3300025294 Ga0209025_1000024 Ga0209025_100002438 226
638 3300025297 Ga0209758_1000150 Ga0209758_1000150128 226
639 3300048919 Ga0496116_0009380 Ga0496116_0009380_2768_3487 226
640 3300048919 Ga0496116_0022122 Ga0496116_0022122_2263_2982 226
641 3300048920 Ga0496117_0023810 Ga0496117_0023810_2754_3473 226
642 3300048921 Ga0496118_0031454 Ga0496118_0031454_2467_3237 226
643 3300048926 Ga0496123_0013251 Ga0496123_0013251_1081_1800 226
644 3300048927 Ga0496124_0063616 Ga0496124_0063616_195_914 226
645 3300048928 Ga0496125_0004955 Ga0496125_0004955_14151_14870 226
646 3300048929 Ga0496126_0050996 Ga0496126_0050996_2620_3339 226
647 3300049570 Ga0501033_0270616 Ga0501033_0270616_414_1157 226
648 3300049581 Ga0501047_0113738 Ga0501047_0113738_1720_2463 226
649 3300049585 Ga0501069_0350170 Ga0501069_0350170_22_765 226
650 3300049586 Ga0501070_0228377 Ga0501070_0228377_568_1311 226
651 3300049590 Ga0501074_0164748 Ga0501074_0164748_299_1042 226
652 3300049744 Ga0501083_0144618 Ga0501083_0144618_515_1258 226
653 3300049822 Ga0501035_0530571 Ga0501035_0530571_133_876 226
654 3300054114 Ga0501084_0314455 Ga0501084_0314455_368_1111 226
655 iso_pu_bacteria 2671180139 2671693709 226
656 3300006051 Ga0075364_10109195 Ga0075364_101091952 228
657 3300039437 Ga0436365_1537137 Ga0436365_1537137_1741_2484 228
658 3300050491 nmdc:mga00v17_6643_c1 nmdc:mga00v17_6643_c1_2893_3633 228
659 iso_pu_bacteria 2558860983 2561466751 228
660 3300025939 Ga0207665_10237769 Ga0207665_102377692 244
661 3300005548 Ga0070665_100068823 Ga0070665_1000688235 245
662 3300005617 Ga0068859_100089883 Ga0068859_1000898835 245
663 3300005844 Ga0068862_100022680 Ga0068862_1000226803 245
664 3300005937 Ga0081455_10004332 Ga0081455_100043325 245
665 3300006846 Ga0075430_100174741 Ga0075430_1001747412 245
666 3300006931 Ga0097620_100089885 Ga0097620_1000898851 245
667 3300009098 Ga0105245_10309295 Ga0105245_103092952 245
668 3300009148 Ga0105243_10185553 Ga0105243_101855532 245
669 3300009176 Ga0105242_10159466 Ga0105242_101594662 245
670 3300010375 Ga0105239_10594706 Ga0105239_105947062 245
671 3300013297 Ga0157378_10040596 Ga0157378_100405963 245
672 3300013308 Ga0157375_10000531 Ga0157375_100005312 245
673 3300014325 Ga0163163_10441499 Ga0163163_104414992 245
674 3300014968 Ga0157379_10039170 Ga0157379_100391704 245
675 3300014969 Ga0157376_10061377 Ga0157376_100613774 245
676 3300025936 Ga0207670_10073251 Ga0207670_100732514 245
677 3300025945 Ga0207679_10143180 Ga0207679_101431802 245
678 3300026067 Ga0207678_10098164 Ga0207678_100981642 245
679 3300028380 Ga0268265_10014998 Ga0268265_100149985 245
680 3300048903 Ga0496100_0014800 Ga0496100_0014800_381_1160 245
681 3300048904 Ga0496101_0031978 Ga0496101_0031978_2534_3313 245
682 3300048907 Ga0496104_0003766 Ga0496104_0003766_2148_2927 245
683 3300048908 Ga0496105_0001382 Ga0496105_0001382_2121_2900 245
684 3300048909 Ga0496106_0168197 Ga0496106_0168197_794_1573 245
685 3300048910 Ga0496107_0002472 Ga0496107_0002472_6247_7026 245
686 3300048911 Ga0496108_0111477 Ga0496108_0111477_1383_2138 245
687 3300048912 Ga0496109_0048835 Ga0496109_0048835_643_1398 245
688 3300048912 Ga0496109_0071068 Ga0496109_0071068_1541_2320 245
689 3300048913 Ga0496110_0220079 Ga0496110_0220079_61_840 245
690 3300048914 Ga0496111_0042144 Ga0496111_0042144_2411_3190 245
691 3300048915 Ga0496112_0009755 Ga0496112_0009755_5166_5945 245
692 3300048916 Ga0496113_0258660 Ga0496113_0258660_456_1211 245
693 3300048918 Ga0496115_0030801 Ga0496115_0030801_1672_2451 245
694 3300049572 Ga0501036_0092159 Ga0501036_0092159_82_840 245
695 3300049575 Ga0501039_0218226 Ga0501039_0218226_131_889 245
696 3300049578 Ga0501042_0143905 Ga0501042_0143905_718_1476 245
697 3300049582 Ga0501048_0164225 Ga0501048_0164225_85_837 245
698 3300049586 Ga0501070_0081916 Ga0501070_0081916_654_1412 245
699 3300049591 Ga0501075_0114991 Ga0501075_0114991_1067_1825 245
700 3300049591 Ga0501075_0546404 Ga0501075_0546404_110_868 245
701 3300049743 Ga0501081_0147782 Ga0501081_0147782_690_1448 245
702 3300061734 Ga0530510_0008192 Ga0530510_0008192_619_1377 245
703 3300005536 Ga0070697_100671591 Ga0070697_1006715911 246
704 3300027717 Ga0209998_10007160 Ga0209998_100071603 246
705 3300005355 Ga0070671_100241100 Ga0070671_1002411002 247
706 3300005365 Ga0070688_100327089 Ga0070688_1003270892 247
707 3300005367 Ga0070667_100158713 Ga0070667_1001587132 247
708 3300005458 Ga0070681_10159404 Ga0070681_101594042 247
709 3300005616 Ga0068852_100246214 Ga0068852_1002462142 247
710 3300005937 Ga0081455_10003036 Ga0081455_100030367 247
711 3300049586 Ga0501070_0187361 Ga0501070_0187361_814_1572 247
712 3300005439 Ga0070711_100285688 Ga0070711_1002856882 248
713 3300035083 Ga0373926_0045234 Ga0373926_0045234_690_1454 248
714 3300035695 Ga0373927_0006033 Ga0373927_0006033_501_1265 248
715 3300036401 Ga0373937_0283606 Ga0373937_0283606_541_1305 248
716 3300046455 Ga0495603_0000944 Ga0495603_0000944_15868_16632 248
717 3300046459 Ga0495629_0000725 Ga0495629_0000725_18817_19581 248
718 3300046472 Ga0495580_0000812 Ga0495580_0000812_19726_20490 248
719 3300046473 Ga0495582_0000614 Ga0495582_0000614_6749_7513 248
720 3300046475 Ga0495639_0000788 Ga0495639_0000788_7609_8373 248
721 3300046491 Ga0495584_0031132 Ga0495584_0031132_854_1618 248
722 3300046499 Ga0495594_0000364 Ga0495594_0000364_7034_7798 248
723 3300046531 Ga0495665_0001409 Ga0495665_0001409_6912_7676 248
724 3300046559 Ga0495667_0176944 Ga0495667_0176944_258_1022 248
725 3300046642 Ga0495634_0001507 Ga0495634_0001507_16727_17491 248
726 3300046674 Ga0495588_0002719 Ga0495588_0002719_439_1203 248
727 3300046681 Ga0495647_0001075 Ga0495647_0001075_7249_8013 248
728 3300046683 Ga0495658_0001306 Ga0495658_0001306_8456_9220 248
729 3300046689 Ga0495613_0001074 Ga0495613_0001074_18305_19069 248
730 3300046690 Ga0495624_0171965 Ga0495624_0171965_316_1080 248
731 3300047315 Ga0495581_0003415 Ga0495581_0003415_2457_3221 248
732 3300047321 Ga0495676_0028005 Ga0495676_0028005_1818_2582 248
733 3300047673 Ga0495593_0003119 Ga0495593_0003119_1414_2178 248
734 3300048907 Ga0496104_0134914 Ga0496104_0134914_354_1118 248
735 3300048911 Ga0496108_0244551 Ga0496108_0244551_337_1101 248
736 3300049574 Ga0501038_0209492 Ga0501038_0209492_197_958 248
737 3300049574 Ga0501038_0223774 Ga0501038_0223774_665_1426 248
738 3300049575 Ga0501039_0022806 Ga0501039_0022806_107_868 248
739 3300049575 Ga0501039_0039981 Ga0501039_0039981_318_1079 248
740 3300049576 Ga0501040_0018070 Ga0501040_0018070_380_1141 248
741 3300049576 Ga0501040_0377472 Ga0501040_0377472_234_1001 248
742 3300049577 Ga0501041_0035223 Ga0501041_0035223_1894_2655 248
743 3300049578 Ga0501042_0105058 Ga0501042_0105058_1023_1784 248
744 3300049579 Ga0501043_0167214 Ga0501043_0167214_675_1436 248
745 3300049580 Ga0501046_0015387 Ga0501046_0015387_743_1504 248
746 3300049580 Ga0501046_0063486 Ga0501046_0063486_1678_2439 248
747 3300049585 Ga0501069_0180728 Ga0501069_0180728_166_927 248
748 3300049587 Ga0501071_0070810 Ga0501071_0070810_909_1670 248
749 3300049587 Ga0501071_0094295 Ga0501071_0094295_1087_1848 248
750 3300049588 Ga0501072_0193620 Ga0501072_0193620_31_792 248
751 3300049590 Ga0501074_0083577 Ga0501074_0083577_1023_1784 248
752 3300049591 Ga0501075_0011765 Ga0501075_0011765_1038_1799 248
753 3300049591 Ga0501075_0015478 Ga0501075_0015478_1776_2537 248
754 3300049592 Ga0501076_0044948 Ga0501076_0044948_1636_2397 248
755 3300049592 Ga0501076_0259261 Ga0501076_0259261_247_1008 248
756 3300049593 Ga0501077_0086808 Ga0501077_0086808_940_1701 248
757 3300049741 Ga0501079_0024976 Ga0501079_0024976_1516_2277 248
758 3300049741 Ga0501079_0088671 Ga0501079_0088671_272_1033 248
759 3300049743 Ga0501081_0046874 Ga0501081_0046874_1947_2708 248
760 3300049822 Ga0501035_0133889 Ga0501035_0133889_207_968 248
761 3300049824 Ga0501045_0112881 Ga0501045_0112881_641_1402 248
762 3300053085 Ga0495619_0003111 Ga0495619_0003111_5578_6342 248
763 3300054114 Ga0501084_0293513 Ga0501084_0293513_485_1243 248
764 3300054114 Ga0501084_0414341 Ga0501084_0414341_341_1108 248
765 3300054114 Ga0501084_0508262 Ga0501084_0508262_183_944 248
766 3300060353 Ga0501082_0550060 Ga0501082_0550060_161_922 248
767 3300061734 Ga0530510_0029165 Ga0530510_0029165_1603_2364 248
768 3300001978 JGI24747J21853_1000894 JGI24747J21853_10008942 249
769 3300001989 JGI24739J22299_10015778 JGI24739J22299_100157784 249
770 3300001990 JGI24737J22298_10005021 JGI24737J22298_100050215 249
771 3300002070 JGI24750J21931_1005672 JGI24750J21931_10056721 249
772 3300002075 JGI24738J21930_10001689 JGI24738J21930_100016893 249
773 3300002459 JGI24751J29686_10013533 JGI24751J29686_100135332 249
774 3300005327 Ga0070658_10033216 Ga0070658_100332163 249
775 3300005328 Ga0070676_10047135 Ga0070676_100471352 249
776 3300005329 Ga0070683_100049464 Ga0070683_1000494644 249
777 3300005330 Ga0070690_100001970 Ga0070690_10000197011 249
778 3300005331 Ga0070670_100084612 Ga0070670_1000846122 249
779 3300005334 Ga0068869_100131549 Ga0068869_1001315492 249
780 3300005335 Ga0070666_10002907 Ga0070666_100029072 249
781 3300005336 Ga0070680_100013027 Ga0070680_1000130272 249
782 3300005337 Ga0070682_100002150 Ga0070682_1000021502 249
783 3300005338 Ga0068868_100001086 Ga0068868_10000108614 249
784 3300005339 Ga0070660_100001084 Ga0070660_10000108410 249
785 3300005340 Ga0070689_100001378 Ga0070689_1000013788 249
786 3300005341 Ga0070691_10000938 Ga0070691_1000093814 249
787 3300005343 Ga0070687_100054985 Ga0070687_1000549852 249
788 3300005344 Ga0070661_100001859 Ga0070661_1000018593 249
789 3300005345 Ga0070692_10000600 Ga0070692_100006007 249
790 3300005347 Ga0070668_100002327 Ga0070668_1000023273 249
791 3300005353 Ga0070669_100000391 Ga0070669_1000003912 249
792 3300005354 Ga0070675_100009210 Ga0070675_1000092102 249
793 3300005355 Ga0070671_100006662 Ga0070671_1000066624 249
794 3300005364 Ga0070673_100003670 Ga0070673_1000036707 249
795 3300005365 Ga0070688_100000242 Ga0070688_10000024217 249
796 3300005366 Ga0070659_100002388 Ga0070659_1000023882 249
797 3300005367 Ga0070667_100002252 Ga0070667_1000022529 249
798 3300005434 Ga0070709_10002660 Ga0070709_1000266010 249
799 3300005435 Ga0070714_100022263 Ga0070714_1000222635 249
800 3300005436 Ga0070713_100019680 Ga0070713_1000196802 249
801 3300005437 Ga0070710_10028465 Ga0070710_100284652 249
802 3300005438 Ga0070701_10000157 Ga0070701_1000015718 249
803 3300005439 Ga0070711_100002114 Ga0070711_10000211411 249
804 3300005440 Ga0070705_100019607 Ga0070705_1000196072 249
805 3300005441 Ga0070700_100025440 Ga0070700_1000254403 249
806 3300005444 Ga0070694_100000736 Ga0070694_1000007369 249
807 3300005455 Ga0070663_100003095 Ga0070663_10000309510 249
808 3300005456 Ga0070678_100005607 Ga0070678_1000056078 249
809 3300005457 Ga0070662_100002449 Ga0070662_1000024499 249
810 3300005518 Ga0070699_100101105 Ga0070699_1001011052 249
811 3300005535 Ga0070684_100210031 Ga0070684_1002100311 249
812 3300005536 Ga0070697_100003492 Ga0070697_1000034922 249
813 3300005539 Ga0068853_100116954 Ga0068853_1001169542 249
814 3300005543 Ga0070672_100001821 Ga0070672_1000018218 249
815 3300005544 Ga0070686_100000939 Ga0070686_1000009393 249
816 3300005545 Ga0070695_100031541 Ga0070695_1000315412 249
817 3300005546 Ga0070696_100009914 Ga0070696_1000099146 249
818 3300005547 Ga0070693_100000255 Ga0070693_1000002557 249
819 3300005548 Ga0070665_100017049 Ga0070665_1000170494 249
820 3300005549 Ga0070704_100000179 Ga0070704_10000017921 249
821 3300005563 Ga0068855_100011031 Ga0068855_10001103110 249
822 3300005564 Ga0070664_100009148 Ga0070664_1000091484 249
823 3300005578 Ga0068854_100001319 Ga0068854_1000013197 249
824 3300005614 Ga0068856_100006818 Ga0068856_1000068183 249
825 3300005615 Ga0070702_100000227 Ga0070702_10000022711 249
826 3300005616 Ga0068852_100044059 Ga0068852_1000440593 249
827 3300005617 Ga0068859_100003356 Ga0068859_1000033563 249
828 3300005618 Ga0068864_100007720 Ga0068864_1000077209 249
829 3300005718 Ga0068866_10004165 Ga0068866_100041657 249
830 3300005719 Ga0068861_100012060 Ga0068861_1000120604 249
831 3300005834 Ga0068851_10006003 Ga0068851_100060033 249
832 3300005841 Ga0068863_100082483 Ga0068863_1000824832 249
833 3300005842 Ga0068858_100010035 Ga0068858_1000100352 249
834 3300005843 Ga0068860_100002798 Ga0068860_1000027984 249
835 3300006058 Ga0075432_10002196 Ga0075432_100021966 249
836 3300006163 Ga0070715_10000066 Ga0070715_100000662 249
837 3300006173 Ga0070716_100000075 Ga0070716_10000007513 249
838 3300006175 Ga0070712_100000753 Ga0070712_10000075311 249
839 3300006358 Ga0068871_100292308 Ga0068871_1002923082 249
840 3300006844 Ga0075428_100069760 Ga0075428_1000697601 249
841 3300006847 Ga0075431_100014998 Ga0075431_1000149983 249
842 3300006880 Ga0075429_100008622 Ga0075429_1000086228 249
843 3300006881 Ga0068865_100064406 Ga0068865_1000644064 249
844 3300006914 Ga0075436_100013216 Ga0075436_1000132162 249
845 3300006931 Ga0097620_100003356 Ga0097620_10000335616 249
846 3300007076 Ga0075435_100003192 Ga0075435_1000031923 249
847 3300009011 Ga0105251_10159397 Ga0105251_101593972 249
848 3300009092 Ga0105250_10035299 Ga0105250_100352992 249
849 3300009093 Ga0105240_10011014 Ga0105240_1001101410 249
850 3300009098 Ga0105245_10003424 Ga0105245_100034243 249
851 3300009101 Ga0105247_10000648 Ga0105247_1000064815 249
852 3300009147 Ga0114129_10062288 Ga0114129_100622884 249
853 3300009148 Ga0105243_10007291 Ga0105243_100072917 249
854 3300009174 Ga0105241_10000469 Ga0105241_1000046921 249
855 3300009176 Ga0105242_10002939 Ga0105242_100029392 249
856 3300009177 Ga0105248_10000756 Ga0105248_100007562 249
857 3300009545 Ga0105237_10002677 Ga0105237_1000267711 249
858 3300009551 Ga0105238_10023817 Ga0105238_100238176 249
859 3300009553 Ga0105249_10002381 Ga0105249_100023814 249
860 3300010375 Ga0105239_10016755 Ga0105239_100167556 249
861 3300011119 Ga0105246_10002676 Ga0105246_1000267612 249
862 3300013100 Ga0157373_10029903 Ga0157373_100299035 249
863 3300013102 Ga0157371_10006694 Ga0157371_100066949 249
864 3300013104 Ga0157370_10127953 Ga0157370_101279533 249
865 3300013105 Ga0157369_10000947 Ga0157369_1000094730 249
866 3300013296 Ga0157374_10006205 Ga0157374_1000620510 249
867 3300013297 Ga0157378_10001777 Ga0157378_1000177716 249
868 3300013306 Ga0163162_10009552 Ga0163162_1000955210 249
869 3300013307 Ga0157372_10000133 Ga0157372_1000013334 249
870 3300013308 Ga0157375_10066246 Ga0157375_100662462 249
871 3300014325 Ga0163163_10003430 Ga0163163_1000343013 249
872 3300014326 Ga0157380_10001038 Ga0157380_1000103816 249
873 3300014745 Ga0157377_10003185 Ga0157377_100031856 249
874 3300014968 Ga0157379_10000847 Ga0157379_1000084717 249
875 3300014969 Ga0157376_10000565 Ga0157376_100005657 249
876 3300014969 Ga0157376_10110384 Ga0157376_101103842 249
877 3300017792 Ga0163161_10018838 Ga0163161_100188384 249
878 3300025315 Ga0207697_10070743 Ga0207697_100707432 249
879 3300025321 Ga0207656_10016543 Ga0207656_100165433 249
880 3300025898 Ga0207692_10011569 Ga0207692_100115693 249
881 3300025899 Ga0207642_10009018 Ga0207642_100090184 249
882 3300025900 Ga0207710_10011735 Ga0207710_100117352 249
883 3300025901 Ga0207688_10013336 Ga0207688_100133364 249
884 3300025904 Ga0207647_10007944 Ga0207647_100079446 249
885 3300025905 Ga0207685_10002025 Ga0207685_100020252 249
886 3300025906 Ga0207699_10012529 Ga0207699_100125294 249
887 3300025907 Ga0207645_10000890 Ga0207645_1000089023 249
888 3300025909 Ga0207705_10077826 Ga0207705_100778262 249
889 3300025911 Ga0207654_10002917 Ga0207654_100029175 249
890 3300025914 Ga0207671_10040775 Ga0207671_100407754 249
891 3300025915 Ga0207693_10000110 Ga0207693_1000011026 249
892 3300025916 Ga0207663_10001557 Ga0207663_100015575 249
893 3300025917 Ga0207660_10070804 Ga0207660_100708043 249
894 3300025918 Ga0207662_10004730 Ga0207662_100047303 249
895 3300025919 Ga0207657_10000023 Ga0207657_10000023106 249
896 3300025920 Ga0207649_10061477 Ga0207649_100614772 249
897 3300025921 Ga0207652_10131234 Ga0207652_101312342 249
898 3300025923 Ga0207681_10027333 Ga0207681_100273334 249
899 3300025924 Ga0207694_10016047 Ga0207694_100160476 249
900 3300025926 Ga0207659_10067421 Ga0207659_100674213 249
901 3300025927 Ga0207687_10002507 Ga0207687_100025075 249
902 3300025928 Ga0207700_10010074 Ga0207700_100100744 249
903 3300025931 Ga0207644_10004689 Ga0207644_100046899 249
904 3300025932 Ga0207690_10055941 Ga0207690_100559412 249
905 3300025933 Ga0207706_10000019 Ga0207706_10000019113 249
906 3300025935 Ga0207709_10031209 Ga0207709_100312092 249
907 3300025936 Ga0207670_10030617 Ga0207670_100306173 249
908 3300025937 Ga0207669_10002185 Ga0207669_100021854 249
909 3300025938 Ga0207704_10003825 Ga0207704_100038252 249
910 3300025939 Ga0207665_10000095 Ga0207665_1000009520 249
911 3300025940 Ga0207691_10000947 Ga0207691_1000094716 249
912 3300025941 Ga0207711_10100635 Ga0207711_101006352 249
913 3300025942 Ga0207689_10025567 Ga0207689_100255672 249
914 3300025944 Ga0207661_10111532 Ga0207661_101115322 249
915 3300025945 Ga0207679_10005015 Ga0207679_100050153 249
916 3300025949 Ga0207667_10015775 Ga0207667_100157757 249
917 3300025961 Ga0207712_10001385 Ga0207712_1000138517 249
918 3300025972 Ga0207668_10002303 Ga0207668_100023039 249
919 3300025986 Ga0207658_10066449 Ga0207658_100664492 249
920 3300026035 Ga0207703_10065051 Ga0207703_100650512 249
921 3300026041 Ga0207639_10027428 Ga0207639_100274282 249
922 3300026067 Ga0207678_10000017 Ga0207678_10000017113 249
923 3300026075 Ga0207708_10026076 Ga0207708_100260764 249
924 3300026088 Ga0207641_10086631 Ga0207641_100866312 249
925 3300026095 Ga0207676_10019059 Ga0207676_100190595 249
926 3300026116 Ga0207674_10000437 Ga0207674_100004371 249
927 3300026118 Ga0207675_100020926 Ga0207675_1000209264 249
928 3300026121 Ga0207683_10000223 Ga0207683_1000022315 249
929 3300027907 Ga0207428_10060612 Ga0207428_100606123 249
930 3300028379 Ga0268266_10044842 Ga0268266_100448423 249
931 3300028381 Ga0268264_10145840 Ga0268264_101458403 249
932 3300035691 Ga0373931_0031196 Ga0373931_0031196_966_1733 249
933 3300037418 Ga0395900_0010720 Ga0395900_0010720_7362_8129 249
934 3300037466 Ga0395898_0023028 Ga0395898_0023028_4433_5200 249
935 3300037471 Ga0395905_0001223 Ga0395905_0001223_20653_21420 249
936 3300038443 Ga0395901_0308496 Ga0395901_0308496_640_1407 249
937 3300048903 Ga0496100_0042422 Ga0496100_0042422_833_1600 249
938 3300048903 Ga0496100_0225039 Ga0496100_0225039_493_1260 249
939 3300048904 Ga0496101_0018352 Ga0496101_0018352_1695_2462 249
940 3300048904 Ga0496101_0593327 Ga0496101_0593327_97_864 249
941 3300048905 Ga0496102_0060227 Ga0496102_0060227_1307_2074 249
942 3300048906 Ga0496103_0004556 Ga0496103_0004556_3510_4277 249
943 3300048908 Ga0496105_0034755 Ga0496105_0034755_1685_2452 249
944 3300048909 Ga0496106_0019240 Ga0496106_0019240_3120_3887 249
945 3300048910 Ga0496107_0033873 Ga0496107_0033873_1066_1833 249
946 3300048912 Ga0496109_0026146 Ga0496109_0026146_1194_1961 249
947 3300048913 Ga0496110_0038765 Ga0496110_0038765_1823_2590 249
948 3300048914 Ga0496111_0016607 Ga0496111_0016607_1194_1961 249
949 3300048915 Ga0496112_0113590 Ga0496112_0113590_70_837 249
950 3300048916 Ga0496113_0011201 Ga0496113_0011201_4137_4904 249
951 3300048918 Ga0496115_0008597 Ga0496115_0008597_937_1704 249
952 3300050507 nmdc:mga05p37_105759_c1 nmdc:mga05p37_105759_c1_1669_2436 249
953 3300050510 nmdc:mga06r32_116656_c1 nmdc:mga06r32_116656_c1_810_1577 249
954 3300050513 nmdc:mga0rr50_25376_c1 nmdc:mga0rr50_25376_c1_1886_2653 249
955 3300050514 nmdc:mga08x19_96515_c1 nmdc:mga08x19_96515_c1_809_1576 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

48

225

0.8

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

49

219

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8852 9 232
3onn-assembly1.cif.gz_A crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae 0.8577 8 230
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.8507 9 249
3opx-assembly1.cif.gz_A crystal structure of pyrimidine 5 -nucleotidase sdt1 from saccharomyces cerevisiae complexed with uridine 5'-monophosphate 0.8489 8 230
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8485 9 232
ID Description Score Start End Superfamily
3opxA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9268 23 89 1.10.150.450
af_Q4E4C3_1_85_1.10.150.450 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9089 15 84 1.10.150.450
af_P40025_28_283_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9062 9 197 3.40.50.1000
af_K7KDK8_16_102_3.30.70.1620 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8918 14 90 3.30.70.1620
af_Q5AK98_45_279_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8784 11 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3S1WCW2-F1-model_v4 deleted 0.9834 1 190
AF-A0A2G4II92-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9787 6 139
AF-A0A3C0FTG3-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9772 8 148
AF-A0A519JRP0-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9759 6 180
AF-A0A530AQA5-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9752 1 159

Feature Viewer

pLDDT pTM Quality
90.8 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map