F486741

General Info

Members Datasets Scaffolds Average Seq Length
956 402 1912 180

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000113|Ga0105248_1000011336
Length 216
Sequence MVGRQSTTVKNVALSDFLPEGLSGITGSSRMRDAGIVKKLTLLRHAKSGWDDPVARDFDRPLNAKGKRAAHRVGEYLRDHHLDFDHVVASPAVRVVETIENLVAGSGETMTPAWDKRVYLASAVSLLDVVHEADDRYDSLLLVGHNPGLEDLVLMMVPDRAGDEARDQIEEKFPTASIAEISFPVEHWEDVQPNSGTLSLFIRPRDLDPALGPDRD

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
106 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
301 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
302 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
303 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
304 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
318 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
319 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
320 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
323 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
324 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
325 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
326 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
327 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
328 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
329 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
330 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
331 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
332 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
333 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
334 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
335 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
336 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
337 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
338 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
339 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
359 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
368 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
376 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
379 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
380 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
381 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
382 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
383 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
384 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
385 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
386 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
387 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
388 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
389 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
390 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
391 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
392 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
393 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
394 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
395 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
396 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
397 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
398 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
399 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
400 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
401 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
402 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 16
Nodule 0
Rhizoplane 3.24
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000113 3300009177 Bacteria 91128
2 SwRhRL3b_contig_2766702 2162886006 Bacteria 3709
3 ARcpr5yngRDRAFT_c000749 3300000043 Bacteria 3985
4 JGI24736J21556_1000083 3300001904 Bacteria 15464
5 JGI24741J21665_1004664 3300001915 Bacteria 2993
6 JGI24741J21665_1016602 3300001915 Bacteria 1200
7 JGI24752J21851_1000379 3300001976 Bacteria 6152
8 JGI24752J21851_1002368 3300001976 Bacteria 2507
9 JGI24740J21852_10005913 3300001979 Bacteria 5128
10 JGI24740J21852_10016144 3300001979 Bacteria 2705
11 JGI24740J21852_10017375 3300001979 Bacteria 2575
12 JGI24739J22299_10006876 3300001989 Bacteria 4284
13 JGI24739J22299_10008728 3300001989 Bacteria 3780
14 JGI24739J22299_10020919 3300001989 Bacteria 2334
15 JGI24737J22298_10022130 3300001990 Bacteria 2020
16 JGI24737J22298_10076137 3300001990 Bacteria 1000
17 JGI24737J22298_10082606 3300001990 Bacteria 955
18 JGI24735J21928_10001347 3300002067 Bacteria 8689
19 JGI24750J21931_1001923 3300002070 Bacteria 2536
20 JGI24750J21931_1027918 3300002070 Unclassified 818
21 JGI24748J21848_1000124 3300002074 Bacteria 14795
22 JGI24738J21930_10000970 3300002075 Bacteria 8229
23 JGI24738J21930_10020685 3300002075 Bacteria 1368
24 JGI24749J21850_1000179 3300002076 Bacteria 10133
25 JGI24749J21850_1000879 3300002076 Bacteria 4324
26 JGI24749J21850_1030677 3300002076 Unclassified 771
27 JGI24744J21845_10057570 3300002077 Bacteria 712
28 JGI24034J26672_10000048 3300002239 Bacteria 56597
29 JGI24034J26672_10013219 3300002239 Bacteria 1251
30 JGI24742J22300_10004390 3300002244 Bacteria 2308
31 JGI24751J29686_10000022 3300002459 Bacteria 104477
32 JGI24751J29686_10008525 3300002459 Bacteria 2097
33 JGI24751J29686_10009785 3300002459 Bacteria 1975
34 JGI25150J39212_1000336 3300002774 Bacteria 23118
35 JGI25165J46597_1000010 3300003214 Bacteria 442113
36 JGI25153J46596_10000045 3300003215 Bacteria 149347
37 JGI25153J46596_10000055 3300003215 Bacteria 135518
38 JGI25153J46596_10003282 3300003215 Bacteria 9084
39 rootH2_10053686 3300003320 Bacteria 1105
40 rootH1_10009798 3300003323 Bacteria 2252
41 rootH1_10239172 3300003323 Bacteria 1068
42 Ga0055539_1017913 3300003752 Bacteria 855
43 Ga0055525_1000080 3300003759 Bacteria 164642
44 Ga0055542_1000012 3300003762 Bacteria 391808
45 Ga0055529_1000002 3300003763 Bacteria 537914
46 Ga0055529_1000004 3300003763 Bacteria 433331
47 Ga0055526_1005851 3300003771 Bacteria 6905
48 Ga0055537_1003306 3300003773 Bacteria 4996
49 Ga0055524_1000405 3300003775 Bacteria 36783
50 Ga0055536_1002944 3300003781 Bacteria 9347
51 Ga0055536_1010300 3300003781 Bacteria 3731
52 Ga0055536_1019463 3300003781 Bacteria 2133
53 Ga0055534_1014749 3300003784 Bacteria 1454
54 Ga0055530_10000203 3300003791 Bacteria 53592
55 Ga0055530_10000915 3300003791 Bacteria 24243
56 Ga0055530_10006827 3300003791 Bacteria 4961
57 Ga0055530_10009074 3300003791 Bacteria 3873
58 Ga0055540_1004237 3300003792 Bacteria 6581
59 Ga0055531_10001375 3300003794 Bacteria 18071
60 Ga0055531_10005683 3300003794 Bacteria 7237
61 Ga0055531_10005973 3300003794 Bacteria 6995
62 Ga0055531_10006693 3300003794 Bacteria 6458
63 Ga0055531_10078366 3300003794 Bacteria 736
64 Ga0055543_1034130 3300004625 Bacteria 877
65 Ga0065165_1004742 3300005262 Bacteria 8148
66 Ga0065165_1018884 3300005262 Bacteria 2480
67 Ga0065707_10082321 3300005295 Bacteria 16892
68 Ga0065707_10250722 3300005295 Bacteria 1126
69 Ga0065707_10309846 3300005295 Unclassified 987
70 Ga0065707_10316426 3300005295 Bacteria 975
71 Ga0070658_10000003 3300005327 Bacteria 465963
72 Ga0070658_10002437 3300005327 Bacteria 15566
73 Ga0070658_10100600 3300005327 Bacteria 2390
74 Ga0070658_10359976 3300005327 Bacteria 1246
75 Ga0070676_10020378 3300005328 Bacteria 3701
76 Ga0070683_100104667 3300005329 Bacteria 2667
77 Ga0070683_100108350 3300005329 Bacteria 2620
78 Ga0070683_100577103 3300005329 Bacteria 1076
79 Ga0070690_100000016 3300005330 Bacteria 85515
80 Ga0070670_100000006 3300005331 Bacteria 319420
81 Ga0070670_100000292 3300005331 Bacteria 43960
82 Ga0070670_100002143 3300005331 Bacteria 16199
83 Ga0070670_100002325 3300005331 Bacteria 15657
84 Ga0070670_100061762 3300005331 Bacteria 3216
85 Ga0068869_100725405 3300005334 Bacteria 849
86 Ga0068869_100897459 3300005334 Bacteria 767
87 Ga0070666_10000011 3300005335 Bacteria 261736
88 Ga0070666_10000829 3300005335 Bacteria 18742
89 Ga0070682_100509515 3300005337 Bacteria 934
90 Ga0070660_100002821 3300005339 Bacteria 11956
91 Ga0070660_100047738 3300005339 Bacteria 3286
92 Ga0070660_100309086 3300005339 Bacteria 1297
93 Ga0070660_100811019 3300005339 Bacteria 787
94 Ga0070689_100045939 3300005340 Bacteria 3364
95 Ga0070687_100040703 3300005343 Bacteria 2343
96 Ga0070661_100000261 3300005344 Bacteria 43151
97 Ga0070661_100027201 3300005344 Bacteria 4117
98 Ga0070661_100085227 3300005344 Bacteria 2334
99 Ga0070661_100374564 3300005344 Bacteria 1121
100 Ga0070692_10005410 3300005345 Bacteria 5443
101 Ga0070668_100002152 3300005347 Bacteria 14427
102 Ga0070668_100004339 3300005347 Bacteria 10518
103 Ga0070668_100007957 3300005347 Bacteria 7872
104 Ga0070669_100000004 3300005353 Bacteria 314707
105 Ga0070669_100000009 3300005353 Bacteria 224683
106 Ga0070669_100000036 3300005353 Bacteria 137564
107 Ga0070669_100049847 3300005353 Bacteria 3057
108 Ga0070675_100985551 3300005354 Bacteria 774
109 Ga0070671_100000004 3300005355 Bacteria 262155
110 Ga0070671_100000273 3300005355 Bacteria 34866
111 Ga0070671_100039735 3300005355 Bacteria 3906
112 Ga0070671_100094914 3300005355 Bacteria 2500
113 Ga0070671_100549088 3300005355 Bacteria 996
114 Ga0070674_100001683 3300005356 Bacteria 11963
115 Ga0070674_100030244 3300005356 Bacteria 3576
116 Ga0070673_100248365 3300005364 Bacteria 1550
117 Ga0070673_100617176 3300005364 Bacteria 990
118 Ga0070688_100001707 3300005365 Bacteria 10964
119 Ga0070688_101066772 3300005365 Bacteria 644
120 Ga0070659_100001775 3300005366 Bacteria 15502
121 Ga0070659_100264976 3300005366 Bacteria 1426
122 Ga0070659_100727003 3300005366 Bacteria 860
123 Ga0070667_100000298 3300005367 Bacteria 55786
124 Ga0070667_100000398 3300005367 Bacteria 46959
125 Ga0070667_100000415 3300005367 Bacteria 45632
126 Ga0070667_100002347 3300005367 Bacteria 16582
127 Ga0070667_100179436 3300005367 Bacteria 1872
128 Ga0070667_100256711 3300005367 Bacteria 1564
129 Ga0070705_100005751 3300005440 Bacteria 6058
130 Ga0070663_100046814 3300005455 Bacteria 3062
131 Ga0070663_100329966 3300005455 Bacteria 1229
132 Ga0070678_100000679 3300005456 Bacteria 16764
133 Ga0070678_100124729 3300005456 Bacteria 2036
134 Ga0070662_100043140 3300005457 Bacteria 3225
135 Ga0070662_100160195 3300005457 Bacteria 1760
136 Ga0070681_11001110 3300005458 Bacteria 755
137 Ga0068867_100169110 3300005459 Bacteria 1730
138 Ga0068867_101393210 3300005459 Bacteria 650
139 Ga0070685_10000186 3300005466 Bacteria 41567
140 Ga0070679_100199935 3300005530 Bacteria 1965
141 Ga0070679_100671658 3300005530 Bacteria 979
142 Ga0070684_100093789 3300005535 Bacteria 2672
143 Ga0068853_100004467 3300005539 Bacteria 10846
144 Ga0068853_100016381 3300005539 Bacteria 6100
145 Ga0068853_100081684 3300005539 Bacteria 2830
146 Ga0068853_100467353 3300005539 Bacteria 1188
147 Ga0068853_100894298 3300005539 Unclassified 853
148 Ga0070686_100000001 3300005544 Bacteria 515830
149 Ga0070665_100000004 3300005548 Bacteria 785500
150 Ga0070665_100000088 3300005548 Bacteria 177729
151 Ga0070665_100332902 3300005548 Bacteria 1523
152 Ga0070665_100471593 3300005548 Bacteria 1266
153 Ga0070665_100511047 3300005548 Bacteria 1213
154 Ga0070665_100667779 3300005548 Unclassified 1052
155 Ga0068855_100000667 3300005563 Bacteria 41874
156 Ga0068855_100099751 3300005563 Bacteria 3344
157 Ga0068855_100250360 3300005563 Bacteria 1976
158 Ga0068855_100346840 3300005563 Bacteria 1636
159 Ga0068855_101055868 3300005563 Bacteria 851
160 Ga0068857_100017231 3300005577 Bacteria 6330
161 Ga0068857_100043041 3300005577 Bacteria 4006
162 Ga0068857_100204800 3300005577 Bacteria 1799
163 Ga0068857_100380072 3300005577 Bacteria 1311
164 Ga0068857_100555250 3300005577 Bacteria 1082
165 Ga0068854_100008336 3300005578 Bacteria 6659
166 Ga0068854_100074397 3300005578 Bacteria 2492
167 Ga0068854_100083318 3300005578 Bacteria 2364
168 Ga0068854_100908063 3300005578 Bacteria 774
169 Ga0068856_100100701 3300005614 Bacteria 2882
170 Ga0068856_100123778 3300005614 Bacteria 2588
171 Ga0068852_100086066 3300005616 Bacteria 2801
172 Ga0068852_100090931 3300005616 Bacteria 2730
173 Ga0068852_100117605 3300005616 Bacteria 2427
174 Ga0068852_100160386 3300005616 Bacteria 2099
175 Ga0068859_100001079 3300005617 Bacteria 27844
176 Ga0068859_100003565 3300005617 Bacteria 15857
177 Ga0068859_100006631 3300005617 Bacteria 11757
178 Ga0068859_100007071 3300005617 Bacteria 11392
179 Ga0068859_100028197 3300005617 Bacteria 5629
180 Ga0068859_100948772 3300005617 Unclassified 944
181 Ga0068864_100000014 3300005618 Bacteria 308927
182 Ga0068864_100000300 3300005618 Bacteria 43960
183 Ga0068864_100000544 3300005618 Bacteria 32111
184 Ga0068864_100001484 3300005618 Bacteria 19321
185 Ga0068864_100009598 3300005618 Bacteria 7980
186 Ga0068864_100014481 3300005618 Bacteria 6551
187 Ga0068861_100000203 3300005719 Bacteria 31717
188 Ga0068861_100003016 3300005719 Bacteria 11116
189 Ga0068861_100031375 3300005719 Bacteria 3903
190 Ga0068861_100434862 3300005719 Bacteria 1172
191 Ga0068851_10019572 3300005834 Bacteria 3271
192 Ga0068851_10077021 3300005834 Bacteria 1735
193 Ga0068851_10295787 3300005834 Bacteria 929
194 Ga0068863_100000010 3300005841 Bacteria 237758
195 Ga0068863_100000073 3300005841 Bacteria 110576
196 Ga0068863_100015329 3300005841 Bacteria 7366
197 Ga0068863_100025444 3300005841 Bacteria 5644
198 Ga0068863_100053484 3300005841 Bacteria 3827
199 Ga0068858_100000360 3300005842 Bacteria 48023
200 Ga0068858_100000487 3300005842 Bacteria 41394
201 Ga0068858_100000782 3300005842 Bacteria 33248
202 Ga0068858_100000957 3300005842 Bacteria 29868
203 Ga0068858_100001582 3300005842 Bacteria 23264
204 Ga0068858_100072688 3300005842 Bacteria 3191
205 Ga0068860_100000030 3300005843 Bacteria 256364
206 Ga0068860_100000143 3300005843 Bacteria 116787
207 Ga0068860_100000412 3300005843 Bacteria 55786
208 Ga0068860_100001278 3300005843 Bacteria 27382
209 Ga0068860_100007681 3300005843 Bacteria 10779
210 Ga0068862_100000007 3300005844 Bacteria 313933
211 Ga0068862_100000014 3300005844 Bacteria 251552
212 Ga0068862_100000431 3300005844 Bacteria 45517
213 Ga0068862_100000462 3300005844 Bacteria 43948
214 Ga0068862_100000716 3300005844 Bacteria 33750
215 Ga0068862_100000810 3300005844 Bacteria 31040
216 Ga0068862_100012378 3300005844 Bacteria 7054
217 Ga0068862_100096973 3300005844 Bacteria 2574
218 Ga0068862_100292157 3300005844 Bacteria 1497
219 Ga0081455_10000405 3300005937 Bacteria 56782
220 Ga0075364_10061051 3300006051 Bacteria 2472
221 Ga0075366_10104846 3300006195 Bacteria 1699
222 Ga0075366_10445365 3300006195 Bacteria 799
223 Ga0097621_100193783 3300006237 Bacteria 1761
224 Ga0097621_100385789 3300006237 Bacteria 1252
225 Ga0075370_10026022 3300006353 Bacteria 3239
226 Ga0075370_10174138 3300006353 Bacteria 1265
227 Ga0068871_100315503 3300006358 Bacteria 1375
228 Ga0068871_100784643 3300006358 Bacteria 877
229 Ga0075429_100216459 3300006880 Bacteria 1678
230 Ga0097620_100001079 3300006931 Bacteria 27844
231 Ga0097620_100003566 3300006931 Bacteria 15857
232 Ga0097620_100006631 3300006931 Bacteria 11757
233 Ga0097620_100007071 3300006931 Bacteria 11392
234 Ga0097620_100028198 3300006931 Bacteria 5629
235 Ga0097620_100948790 3300006931 Unclassified 944
236 Ga0105251_10000296 3300009011 Bacteria 49888
237 Ga0105251_10176357 3300009011 Unclassified 963
238 Ga0105240_10110084 3300009093 Bacteria 3334
239 Ga0105240_10114767 3300009093 Bacteria 3253
240 Ga0105240_10445502 3300009093 Bacteria 1450
241 Ga0105240_10502904 3300009093 Bacteria 1347
242 Ga0105245_10005729 3300009098 Bacteria 10905
243 Ga0105247_10000874 3300009101 Bacteria 22814
244 Ga0105247_10024765 3300009101 Bacteria 3617
245 Ga0105247_10108150 3300009101 Bacteria 1786
246 Ga0105243_10001945 3300009148 Bacteria 17580
247 Ga0105241_10012572 3300009174 Bacteria 6210
248 Ga0105241_10077684 3300009174 Bacteria 2592
249 Ga0105241_10640398 3300009174 Bacteria 964
250 Ga0105248_10000029 3300009177 Bacteria 223366
251 Ga0105248_10056147 3300009177 Bacteria 4417
252 Ga0105248_10123446 3300009177 Bacteria 2921
253 Ga0105248_10144662 3300009177 Bacteria 2682
254 Ga0105248_10222120 3300009177 Bacteria 2127
255 Ga0105248_10805215 3300009177 Bacteria 1060
256 Ga0105237_10009797 3300009545 Bacteria 10244
257 Ga0105237_10035288 3300009545 Bacteria 5060
258 Ga0105237_10951022 3300009545 Bacteria 866
259 Ga0105238_10116166 3300009551 Bacteria 2655
260 Ga0105238_10226626 3300009551 Bacteria 1846
261 Ga0105238_11111161 3300009551 Bacteria 813
262 Ga0105249_10000002 3300009553 Bacteria 376207
263 Ga0105249_10000016 3300009553 Bacteria 278643
264 Ga0105249_10000024 3300009553 Bacteria 232947
265 Ga0105249_10014933 3300009553 Bacteria 6869
266 Ga0105249_10687866 3300009553 Bacteria 1082
267 Ga0105239_10145283 3300010375 Bacteria 2645
268 Ga0105239_10332665 3300010375 Bacteria 1714
269 Ga0105239_11184609 3300010375 Bacteria 880
270 Ga0105239_11299434 3300010375 Bacteria 839
271 Ga0105239_11597561 3300010375 Bacteria 754
272 Ga0105246_10118019 3300011119 Bacteria 1961
273 Ga0157317_1006477 3300012475 Bacteria 818
274 Ga0157326_1003753 3300012513 Bacteria 1594
275 Ga0157373_10015634 3300013100 Bacteria 5543
276 Ga0157373_10066327 3300013100 Bacteria 2554
277 Ga0157371_10000290 3300013102 Bacteria 67914
278 Ga0157371_10100385 3300013102 Bacteria 2053
279 Ga0157370_10013637 3300013104 Bacteria 8362
280 Ga0157370_10260172 3300013104 Bacteria 1604
281 Ga0157370_10919005 3300013104 Bacteria 794
282 Ga0157369_10006147 3300013105 Bacteria 13934
283 Ga0157369_10027424 3300013105 Bacteria 6314
284 Ga0157369_10493554 3300013105 Bacteria 1267
285 Ga0157369_11043934 3300013105 Bacteria 836
286 Ga0157369_11240354 3300013105 Bacteria 761
287 Ga0157369_11510405 3300013105 Bacteria 683
288 Ga0157374_10033722 3300013296 Bacteria 4672
289 Ga0157378_10014680 3300013297 Bacteria 6862
290 Ga0157378_10131445 3300013297 Bacteria 2317
291 Ga0157378_10247544 3300013297 Bacteria 1705
292 Ga0163162_10001555 3300013306 Bacteria 21458
293 Ga0163162_10068722 3300013306 Bacteria 3594
294 Ga0163162_10609628 3300013306 Bacteria 1217
295 Ga0157372_10029722 3300013307 Bacteria 5970
296 Ga0157372_10195146 3300013307 Bacteria 2345
297 Ga0157372_10828150 3300013307 Bacteria 1075
298 Ga0157375_10840863 3300013308 Bacteria 1065
299 Ga0163163_10010448 3300014325 Bacteria 8353
300 Ga0163163_10015142 3300014325 Bacteria 7120
301 Ga0163163_10165587 3300014325 Bacteria 2257
302 Ga0157380_10000042 3300014326 Bacteria 75921
303 Ga0157380_10009001 3300014326 Bacteria 7135
304 Ga0157380_10072337 3300014326 Bacteria 2792
305 Ga0157380_10098586 3300014326 Bacteria 2428
306 Ga0157379_10010222 3300014968 Bacteria 8174
307 Ga0157379_10017701 3300014968 Bacteria 6277
308 Ga0183363_1003 3300015690 Bacteria 421263
309 Ga0163161_10000044 3300017792 Bacteria 132739
310 Ga0163161_10047151 3300017792 Bacteria 3112
311 Ga0163161_10138163 3300017792 Bacteria 1843
312 Ga0163161_10614660 3300017792 Bacteria 897
313 Ga0213876_10001336 3300021384 Bacteria 15468
314 Ga0213875_10000820 3300021388 Bacteria 23114
315 Ga0207672_1001095 3300025223 Bacteria 2447
316 Ga0209563_100058 3300025230 Bacteria 302571
317 Ga0207425_1000005 3300025245 Bacteria 900502
318 Ga0207425_1003780 3300025245 Bacteria 4727
319 Ga0209646_1016590 3300025246 Bacteria 1091
320 Ga0209026_1023261 3300025250 Bacteria 945
321 Ga0209677_105890 3300025253 Bacteria 3067
322 Ga0209148_1000008 3300025254 Bacteria 1504371
323 Ga0209129_1001045 3300025258 Bacteria 16360
324 Ga0209233_1000044 3300025261 Bacteria 489783
325 Ga0209565_1000029 3300025263 Bacteria 340335
326 Ga0209565_1000272 3300025263 Bacteria 52468
327 Ga0209455_1000002 3300025272 Bacteria 1505459
328 Ga0209455_1008948 3300025272 Bacteria 2669
329 Ga0209673_1001949 3300025273 Bacteria 16202
330 Ga0209673_1002970 3300025273 Bacteria 10595
331 Ga0209675_1000399 3300025291 Bacteria 36040
332 Ga0209675_1008112 3300025291 Bacteria 3914
333 Ga0209676_1000358 3300025292 Bacteria 86541
334 Ga0209676_1000829 3300025292 Bacteria 40137
335 Ga0209676_1001005 3300025292 Bacteria 33061
336 Ga0209025_1001074 3300025294 Bacteria 39612
337 Ga0209025_1017474 3300025294 Bacteria 4136
338 Ga0209564_1000949 3300025295 Bacteria 37130
339 Ga0209564_1038417 3300025295 Bacteria 1332
340 Ga0209758_1000002 3300025297 Bacteria 1400310
341 Ga0209758_1000007 3300025297 Bacteria 1270410
342 Ga0209758_1012238 3300025297 Bacteria 4826
343 Ga0209050_1000001 3300025298 Bacteria 3563507
344 Ga0209050_1000167 3300025298 Bacteria 151608
345 Ga0209050_1000437 3300025298 Bacteria 76322
346 Ga0209050_1004286 3300025298 Bacteria 9767
347 Ga0209050_1020129 3300025298 Bacteria 2496
348 Ga0209050_1040150 3300025298 Bacteria 1308
349 Ga0209050_1040886 3300025298 Bacteria 1285
350 Ga0209256_1000008 3300025299 Bacteria 975723
351 Ga0207426_1025383 3300025302 Bacteria 1996
352 Ga0209051_1000364 3300025303 Bacteria 66340
353 Ga0209257_1000028 3300025304 Bacteria 699493
354 Ga0209257_1000328 3300025304 Bacteria 99542
355 Ga0209257_1004831 3300025304 Bacteria 9988
356 Ga0209257_1007735 3300025304 Bacteria 6402
357 Ga0209257_1008403 3300025304 Bacteria 5880
358 Ga0209257_1012636 3300025304 Bacteria 3873
359 Ga0209257_1017646 3300025304 Bacteria 2798
360 Ga0209257_1046897 3300025304 Bacteria 1246
361 Ga0207697_10003772 3300025315 Bacteria 7401
362 Ga0207656_10004100 3300025321 Bacteria 5057
363 Ga0207656_10008193 3300025321 Bacteria 3835
364 Ga0207656_10252561 3300025321 Bacteria 864
365 Ga0207713_1002770 3300025735 Bacteria 12405
366 Ga0207710_10002774 3300025900 Bacteria 8005
367 Ga0207710_10018608 3300025900 Bacteria 2956
368 Ga0207710_10059562 3300025900 Bacteria 1729
369 Ga0207680_10000008 3300025903 Bacteria 518177
370 Ga0207680_10000253 3300025903 Bacteria 25735
371 Ga0207647_10001877 3300025904 Bacteria 16094
372 Ga0207647_10116105 3300025904 Bacteria 1580
373 Ga0207647_10132150 3300025904 Bacteria 1466
374 Ga0207705_10000005 3300025909 Bacteria 673478
375 Ga0207705_10000103 3300025909 Bacteria 97511
376 Ga0207705_10013836 3300025909 Bacteria 5819
377 Ga0207654_10000150 3300025911 Bacteria 44134
378 Ga0207654_10001270 3300025911 Bacteria 13439
379 Ga0207695_10008046 3300025913 Bacteria 13275
380 Ga0207695_10039997 3300025913 Bacteria 5034
381 Ga0207695_10052087 3300025913 Bacteria 4291
382 Ga0207695_10091029 3300025913 Bacteria 3065
383 Ga0207671_10001574 3300025914 Bacteria 26006
384 Ga0207671_10003457 3300025914 Bacteria 15723
385 Ga0207671_10174640 3300025914 Bacteria 1670
386 Ga0207671_10358640 3300025914 Unclassified 1157
387 Ga0207662_10080808 3300025918 Bacteria 1984
388 Ga0207657_10002670 3300025919 Bacteria 19230
389 Ga0207657_10146650 3300025919 Bacteria 1924
390 Ga0207657_10262423 3300025919 Bacteria 1374
391 Ga0207657_10420358 3300025919 Bacteria 1051
392 Ga0207649_10000016 3300025920 Bacteria 243843
393 Ga0207649_10000660 3300025920 Bacteria 22994
394 Ga0207649_10352116 3300025920 Bacteria 1090
395 Ga0207681_10000001 3300025923 Bacteria 1105841
396 Ga0207681_10000010 3300025923 Bacteria 403379
397 Ga0207681_10000020 3300025923 Bacteria 240498
398 Ga0207681_10004630 3300025923 Bacteria 8460
399 Ga0207681_10625461 3300025923 Bacteria 891
400 Ga0207694_10003254 3300025924 Bacteria 12936
401 Ga0207694_10046069 3300025924 Bacteria 3370
402 Ga0207694_10048382 3300025924 Bacteria 3290
403 Ga0207694_10104889 3300025924 Bacteria 2244
404 Ga0207694_10156022 3300025924 Bacteria 1841
405 Ga0207694_10774217 3300025924 Bacteria 810
406 Ga0207650_10000023 3300025925 Bacteria 308148
407 Ga0207650_10000354 3300025925 Bacteria 44199
408 Ga0207650_10002062 3300025925 Bacteria 14048
409 Ga0207650_10093199 3300025925 Bacteria 2305
410 Ga0207687_10001020 3300025927 Bacteria 18993
411 Ga0207644_10000007 3300025931 Bacteria 381778
412 Ga0207644_10000283 3300025931 Bacteria 33445
413 Ga0207644_10008404 3300025931 Bacteria 6756
414 Ga0207690_10012099 3300025932 Bacteria 5161
415 Ga0207690_10033348 3300025932 Bacteria 3311
416 Ga0207690_10285539 3300025932 Bacteria 1286
417 Ga0207706_10010038 3300025933 Bacteria 8677
418 Ga0207706_10051291 3300025933 Bacteria 3643
419 Ga0207706_10263123 3300025933 Bacteria 1505
420 Ga0207709_10000005 3300025935 Bacteria 806813
421 Ga0207670_10032086 3300025936 Bacteria 3374
422 Ga0207669_10000322 3300025937 Bacteria 21900
423 Ga0207669_10001286 3300025937 Bacteria 10655
424 Ga0207691_10183964 3300025940 Bacteria 1825
425 Ga0207711_10000004 3300025941 Bacteria 870636
426 Ga0207711_10003287 3300025941 Bacteria 14053
427 Ga0207711_10011919 3300025941 Bacteria 7225
428 Ga0207711_10076009 3300025941 Bacteria 2924
429 Ga0207711_10116915 3300025941 Bacteria 2378
430 Ga0207711_10142200 3300025941 Bacteria 2159
431 Ga0207689_10737011 3300025942 Bacteria 831
432 Ga0207661_10553420 3300025944 Bacteria 1054
433 Ga0207679_10802779 3300025945 Bacteria 858
434 Ga0207679_10911472 3300025945 Bacteria 804
435 Ga0207667_10000001 3300025949 Bacteria 1178522
436 Ga0207667_10000603 3300025949 Bacteria 46518
437 Ga0207667_10024985 3300025949 Bacteria 6549
438 Ga0207667_10357351 3300025949 Bacteria 1490
439 Ga0207667_10823067 3300025949 Bacteria 924
440 Ga0207667_10853012 3300025949 Bacteria 905
441 Ga0207712_10000002 3300025961 Bacteria 706628
442 Ga0207712_10000009 3300025961 Bacteria 518177
443 Ga0207712_10000510 3300025961 Bacteria 32303
444 Ga0207712_10018856 3300025961 Bacteria 4499
445 Ga0207712_10458833 3300025961 Bacteria 1082
446 Ga0207668_10001363 3300025972 Bacteria 14427
447 Ga0207668_10002028 3300025972 Bacteria 11816
448 Ga0207668_10006578 3300025972 Bacteria 6869
449 Ga0207668_10039903 3300025972 Bacteria 3164
450 Ga0207640_10005130 3300025981 Bacteria 7124
451 Ga0207640_10006365 3300025981 Bacteria 6476
452 Ga0207640_10020510 3300025981 Bacteria 3925
453 Ga0207640_10367889 3300025981 Bacteria 1161
454 Ga0207640_10384262 3300025981 Bacteria 1138
455 Ga0207640_10599555 3300025981 Bacteria 932
456 Ga0207640_10798783 3300025981 Bacteria 817
457 Ga0207640_11174619 3300025981 Bacteria 681
458 Ga0207658_10000026 3300025986 Bacteria 178292
459 Ga0207658_10000254 3300025986 Bacteria 55800
460 Ga0207658_10001005 3300025986 Bacteria 23144
461 Ga0207658_10001129 3300025986 Bacteria 21497
462 Ga0207658_10001394 3300025986 Bacteria 18834
463 Ga0207658_10001522 3300025986 Bacteria 18013
464 Ga0207658_10302095 3300025986 Bacteria 1379
465 Ga0207703_10000108 3300026035 Bacteria 97908
466 Ga0207703_10000845 3300026035 Bacteria 30089
467 Ga0207703_10001794 3300026035 Bacteria 19143
468 Ga0207703_10002095 3300026035 Bacteria 17541
469 Ga0207703_10007252 3300026035 Bacteria 8815
470 Ga0207639_10001679 3300026041 Bacteria 14938
471 Ga0207639_10003338 3300026041 Bacteria 10793
472 Ga0207639_10021197 3300026041 Bacteria 4664
473 Ga0207639_10035037 3300026041 Bacteria 3714
474 Ga0207639_10137934 3300026041 Bacteria 2028
475 Ga0207639_10430236 3300026041 Bacteria 1195
476 Ga0207678_10048806 3300026067 Bacteria 3658
477 Ga0207678_10111417 3300026067 Bacteria 2335
478 Ga0207678_10303638 3300026067 Bacteria 1372
479 Ga0207702_10000723 3300026078 Bacteria 35400
480 Ga0207702_10026646 3300026078 Bacteria 4799
481 Ga0207702_10065672 3300026078 Bacteria 3108
482 Ga0207702_10093967 3300026078 Bacteria 2631
483 Ga0207641_10000018 3300026088 Bacteria 298209
484 Ga0207641_10000346 3300026088 Bacteria 55535
485 Ga0207641_10000386 3300026088 Bacteria 52430
486 Ga0207641_10013111 3300026088 Bacteria 6797
487 Ga0207641_10017585 3300026088 Bacteria 5853
488 Ga0207641_10056278 3300026088 Bacteria 3341
489 Ga0207648_10647762 3300026089 Bacteria 976
490 Ga0207676_10000017 3300026095 Bacteria 308709
491 Ga0207676_10000137 3300026095 Bacteria 63867
492 Ga0207676_10000276 3300026095 Bacteria 44706
493 Ga0207676_10001455 3300026095 Bacteria 17617
494 Ga0207676_10003438 3300026095 Bacteria 11204
495 Ga0207676_10022019 3300026095 Bacteria 4683
496 Ga0207674_10010611 3300026116 Bacteria 10420
497 Ga0207674_10025744 3300026116 Bacteria 6265
498 Ga0207674_10066737 3300026116 Bacteria 3623
499 Ga0207674_10074826 3300026116 Bacteria 3397
500 Ga0207674_10578482 3300026116 Bacteria 1085
501 Ga0207674_10659422 3300026116 Bacteria 1010
502 Ga0207675_100000110 3300026118 Bacteria 66177
503 Ga0207675_100000280 3300026118 Bacteria 48895
504 Ga0207675_100000329 3300026118 Bacteria 45296
505 Ga0207675_100689672 3300026118 Bacteria 1030
506 Ga0207683_10001013 3300026121 Bacteria 25627
507 Ga0207683_10196466 3300026121 Bacteria 1833
508 Ga0207698_10005044 3300026142 Bacteria 8100
509 Ga0207698_10006839 3300026142 Bacteria 7136
510 Ga0207698_10057071 3300026142 Bacteria 3018
511 Ga0207698_10116692 3300026142 Bacteria 2250
512 Ga0207698_10384683 3300026142 Bacteria 1336
513 Ga0268266_10000009 3300028379 Bacteria 1097737
514 Ga0268266_10000074 3300028379 Bacteria 230993
515 Ga0268266_10241808 3300028379 Bacteria 1666
516 Ga0268266_10399215 3300028379 Unclassified 1300
517 Ga0268266_10497953 3300028379 Unclassified 1163
518 Ga0268265_10000002 3300028380 Bacteria 1035381
519 Ga0268265_10000058 3300028380 Bacteria 154702
520 Ga0268265_10000097 3300028380 Bacteria 110755
521 Ga0268265_10000149 3300028380 Bacteria 86376
522 Ga0268265_10000607 3300028380 Bacteria 35893
523 Ga0268265_10001059 3300028380 Bacteria 24670
524 Ga0268265_10121344 3300028380 Bacteria 2154
525 Ga0268265_10192792 3300028380 Bacteria 1761
526 Ga0268264_10000003 3300028381 Bacteria 1141976
527 Ga0268264_10000076 3300028381 Bacteria 255518
528 Ga0268264_10000083 3300028381 Bacteria 245366
529 Ga0268264_10000106 3300028381 Bacteria 210031
530 Ga0268264_10000634 3300028381 Bacteria 41826
531 Ga0307517_10013945 3300028786 Bacteria 10858
532 Ga0307517_10044893 3300028786 Bacteria 4660
533 Ga0307517_10231038 3300028786 Bacteria 1110
534 Ga0307513_10049071 3300031456 Bacteria 4575
535 Ga0307513_10052452 3300031456 Bacteria 4392
536 Ga0307509_10042055 3300031507 Bacteria 4954
537 Ga0307408_100008545 3300031548 Bacteria 6762
538 Ga0307408_100008592 3300031548 Bacteria 6745
539 Ga0307408_100366558 3300031548 Bacteria 1227
540 Ga0307408_100409157 3300031548 Bacteria 1167
541 Ga0307408_100633645 3300031548 Bacteria 954
542 Ga0307408_100676087 3300031548 Bacteria 925
543 Ga0307508_10005032 3300031616 Bacteria 12703
544 Ga0307405_10041988 3300031731 Bacteria 2781
545 Ga0307405_10137760 3300031731 Bacteria 1697
546 Ga0307405_10285238 3300031731 Bacteria 1245
547 Ga0307405_10355492 3300031731 Bacteria 1131
548 Ga0307405_10491549 3300031731 Bacteria 982
549 Ga0307405_10574013 3300031731 Bacteria 916
550 Ga0307413_10034190 3300031824 Bacteria 2903
551 Ga0307410_10376873 3300031852 Bacteria 1141
552 Ga0307406_10002345 3300031901 Bacteria 10289
553 Ga0307406_10138671 3300031901 Bacteria 1718
554 Ga0307406_10400810 3300031901 Bacteria 1087
555 Ga0307412_10000342 3300031911 Bacteria 29331
556 Ga0307412_10003855 3300031911 Bacteria 8336
557 Ga0307412_10014907 3300031911 Bacteria 4595
558 Ga0307412_10026822 3300031911 Bacteria 3586
559 Ga0307412_10052383 3300031911 Bacteria 2702
560 Ga0307412_10064718 3300031911 Bacteria 2471
561 Ga0307412_10065516 3300031911 Bacteria 2459
562 Ga0307412_10157651 3300031911 Bacteria 1682
563 Ga0307416_100110021 3300032002 Bacteria 2425
564 Ga0307416_100532938 3300032002 Bacteria 1245
565 Ga0307416_101011654 3300032002 Bacteria 934
566 Ga0307414_10000239 3300032004 Bacteria 34941
567 Ga0307414_10009181 3300032004 Bacteria 5665
568 Ga0307414_10018842 3300032004 Bacteria 4262
569 Ga0307414_10023279 3300032004 Bacteria 3926
570 Ga0307414_10356668 3300032004 Bacteria 1257
571 Ga0307414_10407337 3300032004 Bacteria 1183
572 Ga0307414_10419870 3300032004 Bacteria 1166
573 Ga0307414_10503440 3300032004 Bacteria 1072
574 Ga0307411_10049357 3300032005 Bacteria 2734
575 Ga0307411_10356223 3300032005 Bacteria 1195
576 Ga0307510_10005677 3300033180 Bacteria 14872
577 Ga0307510_10033362 3300033180 Bacteria 5782
578 Ga0373923_0185193 3300035111 Unclassified 958
579 Ga0373954_0032080 3300035118 Bacteria 2428
580 Ga0373927_0096292 3300035695 Bacteria 1924
581 Ga0373937_0432554 3300036401 Bacteria 1249
582 Ga0395900_1030673 3300037418 Bacteria 742
583 Ga0395905_0096269 3300037471 Bacteria 2779
584 Ga0395905_0447278 3300037471 Bacteria 1190
585 Ga0395905_1334915 3300037471 Unclassified 621
586 Ga0436364_0752226 3300037853 Bacteria 1979
587 Ga0436364_1409528 3300037853 Bacteria 22143
588 Ga0395901_0029420 3300038443 Bacteria 5657
589 Ga0395901_0040961 3300038443 Bacteria 4799
590 Ga0395901_1258397 3300038443 Bacteria 703
591 Ga0237819_03124 3300038705 Bacteria 3030
592 Ga0436365_0062931 3300039437 Bacteria 52276
593 Ga0436365_0340026 3300039437 Bacteria 1680
594 Ga0436363_0901981 3300039450 Bacteria 1091
595 Ga0439439_0064079 3300041406 Bacteria 979
596 Ga0439465_0000267 3300041413 Bacteria 14538
597 Ga0439465_0001572 3300041413 Bacteria 7418
598 Ga0451789_0057199 3300041443 Bacteria 828
599 Ga0451800_0410130 3300041459 Bacteria 728
600 Ga0451802_2041707 3300041460 Bacteria 809
601 Ga0451853_2935544 3300041512 Bacteria 701
602 Ga0439431_0000273 3300041997 Bacteria 10607
603 Ga0439431_0014648 3300041997 Bacteria 1819
604 Ga0439442_009040 3300042002 Bacteria 2014
605 Ga0439445_0000417 3300042004 Bacteria 8552
606 Ga0439445_0008347 3300042004 Bacteria 2421
607 Ga0439445_0024060 3300042004 Bacteria 1545
608 Ga0439432_002453 3300042006 Bacteria 6983
609 Ga0439449_0045533 3300042007 Bacteria 1626
610 Ga0439452_020562 3300042010 Bacteria 1730
611 Ga0439457_014047 3300042014 Bacteria 1795
612 Ga0439462_0004232 3300042015 Bacteria 3491
613 Ga0439446_0043431 3300042156 Bacteria 1328
614 Ga0439434_0000488 3300042435 Bacteria 11259
615 Ga0451577_1286555 3300042876 Bacteria 651
616 Ga0451576_0005491 3300045051 Bacteria 15866
617 Ga0495627_005422 3300046453 Bacteria 5143
618 Ga0495590_0280425 3300046457 Bacteria 624
619 Ga0495638_0000014 3300046460 Bacteria 417060
620 Ga0495638_0000732 3300046460 Bacteria 35317
621 Ga0495638_0004896 3300046460 Bacteria 10068
622 Ga0495638_0054875 3300046460 Bacteria 2476
623 Ga0495638_0238855 3300046460 Bacteria 1007
624 Ga0495650_0000196 3300046471 Bacteria 131306
625 Ga0495639_0354264 3300046475 Bacteria 737
626 Ga0495662_0508846 3300046476 Bacteria 590
627 Ga0495585_0000620 3300046492 Bacteria 33105
628 Ga0495585_0039871 3300046492 Bacteria 2639
629 Ga0495596_0028535 3300046500 Bacteria 2240
630 Ga0495607_0037621 3300046501 Bacteria 2905
631 Ga0495583_0000406 3300046506 Bacteria 65391
632 Ga0495583_0000557 3300046506 Bacteria 52013
633 Ga0495583_0001125 3300046506 Bacteria 29400
634 Ga0495583_0007101 3300046506 Bacteria 7155
635 Ga0495583_0015490 3300046506 Bacteria 4144
636 Ga0495583_0046112 3300046506 Bacteria 2011
637 Ga0495583_0087721 3300046506 Bacteria 1344
638 Ga0495606_0000259 3300046507 Bacteria 93403
639 Ga0495606_0000497 3300046507 Bacteria 64227
640 Ga0495606_0022207 3300046507 Bacteria 4629
641 Ga0495631_0085611 3300046518 Bacteria 1358
642 Ga0495632_0000446 3300046519 Bacteria 39306
643 Ga0495632_0188767 3300046519 Bacteria 942
644 Ga0495637_0010269 3300046520 Bacteria 4535
645 Ga0495637_0020660 3300046520 Bacteria 3027
646 Ga0495637_0078074 3300046520 Bacteria 1324
647 Ga0495643_0002033 3300046522 Bacteria 16829
648 Ga0495643_0004844 3300046522 Bacteria 9274
649 Ga0495643_0005462 3300046522 Bacteria 8595
650 Ga0495643_0044540 3300046522 Bacteria 2411
651 Ga0495643_0058007 3300046522 Bacteria 2061
652 Ga0495648_0000021 3300046524 Bacteria 246945
653 Ga0495648_0000114 3300046524 Bacteria 98677
654 Ga0495648_0020266 3300046524 Bacteria 4642
655 Ga0495648_0065607 3300046524 Bacteria 2133
656 Ga0495648_0098124 3300046524 Bacteria 1623
657 Ga0495663_0000369 3300046525 Bacteria 16622
658 Ga0495663_0070503 3300046525 Bacteria 1112
659 Ga0495642_0040137 3300046528 Bacteria 1900
660 Ga0495654_0001113 3300046530 Bacteria 19393
661 Ga0495654_0096529 3300046530 Bacteria 1366
662 Ga0495609_0294533 3300046538 Bacteria 662
663 Ga0495597_0013437 3300046542 Bacteria 3922
664 Ga0495597_0103983 3300046542 Bacteria 1195
665 Ga0495622_0021745 3300046557 Bacteria 2987
666 Ga0495622_0033946 3300046557 Bacteria 2381
667 Ga0495622_0067429 3300046557 Bacteria 1653
668 Ga0495633_0000207 3300046558 Bacteria 74645
669 Ga0495633_0010366 3300046558 Bacteria 5091
670 Ga0495668_0000022 3300046616 Bacteria 363999
671 Ga0495668_0000387 3300046616 Bacteria 58040
672 Ga0495668_0012858 3300046616 Bacteria 4955
673 Ga0495668_0017893 3300046616 Bacteria 4105
674 Ga0495668_0042229 3300046616 Bacteria 2539
675 Ga0495668_0069004 3300046616 Bacteria 1944
676 Ga0495611_0002606 3300046648 Bacteria 8162
677 Ga0495611_0052799 3300046648 Bacteria 1834
678 Ga0495611_0129649 3300046648 Bacteria 1176
679 Ga0495625_0000031 3300046660 Bacteria 238193
680 Ga0495625_0000588 3300046660 Bacteria 52820
681 Ga0495625_0002611 3300046660 Bacteria 19281
682 Ga0495625_0002676 3300046660 Bacteria 18953
683 Ga0495625_0011605 3300046660 Bacteria 7168
684 Ga0495625_0013677 3300046660 Bacteria 6508
685 Ga0495625_0270528 3300046660 Bacteria 1096
686 Ga0495625_0448300 3300046660 Bacteria 798
687 Ga0495661_0092822 3300046665 Bacteria 1714
688 Ga0495661_0102062 3300046665 Bacteria 1613
689 Ga0495669_0000047 3300046684 Bacteria 82672
690 Ga0495669_0041952 3300046684 Bacteria 2033
691 Ga0495670_0000016 3300046691 Bacteria 128045
692 Ga0495670_0002882 3300046691 Bacteria 8474
693 Ga0495670_0011648 3300046691 Bacteria 4327
694 Ga0495670_0014291 3300046691 Bacteria 3905
695 Ga0495671_0000028 3300046692 Bacteria 234938
696 Ga0495671_0007026 3300046692 Bacteria 6452
697 Ga0495671_0015741 3300046692 Bacteria 4046
698 Ga0495671_0043874 3300046692 Bacteria 2244
699 Ga0495671_0131335 3300046692 Bacteria 1221
700 Ga0495671_0361940 3300046692 Bacteria 695
701 Ga0495649_0228736 3300046694 Bacteria 960
702 Ga0495589_0076479 3300046794 Bacteria 1632
703 Ga0495600_0038150 3300046809 Bacteria 3125
704 Ga0495660_0044172 3300046810 Bacteria 2453
705 Ga0495660_0164844 3300046810 Bacteria 1084
706 Ga0495683_0013776 3300047323 Bacteria 4221
707 Ga0495687_000043 3300047443 Bacteria 216711
708 Ga0495687_002080 3300047443 Bacteria 16814
709 Ga0495677_0003536 3300047445 Bacteria 6063
710 Ga0495673_0000058 3300047469 Bacteria 235044
711 Ga0495673_0013172 3300047469 Bacteria 4353
712 Ga0495681_0005101 3300047470 Bacteria 8854
713 Ga0495686_0000139 3300047472 Bacteria 145796
714 Ga0495686_0000523 3300047472 Bacteria 55456
715 Ga0495686_0001582 3300047472 Bacteria 24064
716 Ga0495686_0010788 3300047472 Bacteria 6479
717 Ga0496100_0191427 3300048903 Bacteria 1485
718 Ga0496102_0000022 3300048905 Bacteria 246314
719 Ga0496102_0000034 3300048905 Bacteria 213826
720 Ga0496102_0025183 3300048905 Bacteria 5293
721 Ga0496102_0146484 3300048905 Bacteria 2216
722 Ga0496102_0225699 3300048905 Bacteria 1766
723 Ga0496102_0832373 3300048905 Bacteria 845
724 Ga0496103_0000026 3300048906 Bacteria 213826
725 Ga0496103_0000075 3300048906 Bacteria 114569
726 Ga0496103_0002036 3300048906 Bacteria 12973
727 Ga0496103_0014765 3300048906 Bacteria 4642
728 Ga0496103_0460315 3300048906 Unclassified 816
729 Ga0496104_0003920 3300048907 Bacteria 12878
730 Ga0496104_0125628 3300048907 Bacteria 2463
731 Ga0496105_0000847 3300048908 Bacteria 20846
732 Ga0496105_0066116 3300048908 Bacteria 2984
733 Ga0496107_0059004 3300048910 Bacteria 2776
734 Ga0496107_0060780 3300048910 Bacteria 2735
735 Ga0496108_0674775 3300048911 Bacteria 897
736 Ga0496109_0230113 3300048912 Bacteria 1744
737 Ga0496111_0018587 3300048914 Bacteria 4816
738 Ga0496113_0030152 3300048916 Bacteria 3924
739 Ga0496114_0006903 3300048917 Bacteria 8945
740 Ga0496115_0000029 3300048918 Bacteria 141359
741 Ga0496115_0000304 3300048918 Bacteria 41844
742 Ga0496115_0256703 3300048918 Bacteria 1438
743 Ga0496116_0001435 3300048919 Bacteria 26777
744 Ga0496116_0002308 3300048919 Bacteria 20225
745 Ga0496116_0020839 3300048919 Bacteria 4965
746 Ga0496116_0290060 3300048919 Bacteria 786
747 Ga0496117_0000072 3300048920 Bacteria 238366
748 Ga0496117_0000260 3300048920 Bacteria 99636
749 Ga0496117_0004000 3300048920 Bacteria 16644
750 Ga0496117_0005912 3300048920 Bacteria 12633
751 Ga0496117_0009616 3300048920 Bacteria 8952
752 Ga0496117_0061114 3300048920 Bacteria 2592
753 Ga0496117_0434779 3300048920 Bacteria 653
754 Ga0496118_0000030 3300048921 Bacteria 339946
755 Ga0496118_0000039 3300048921 Bacteria 305458
756 Ga0496118_0002183 3300048921 Bacteria 27245
757 Ga0496118_0002784 3300048921 Bacteria 22888
758 Ga0496118_0030499 3300048921 Bacteria 4498
759 Ga0496119_0011873 3300048922 Bacteria 7151
760 Ga0496119_0019906 3300048922 Bacteria 4917
761 Ga0496120_0011696 3300048923 Bacteria 6020
762 Ga0496121_0000269 3300048924 Bacteria 108869
763 Ga0496121_0255892 3300048924 Bacteria 1212
764 Ga0496122_0000359 3300048925 Bacteria 97927
765 Ga0496122_0072028 3300048925 Bacteria 2459
766 Ga0496122_0114676 3300048925 Bacteria 1757
767 Ga0496122_0173154 3300048925 Bacteria 1298
768 Ga0496123_0002200 3300048926 Bacteria 24799
769 Ga0496123_0010124 3300048926 Bacteria 8381
770 Ga0496123_0017074 3300048926 Bacteria 5860
771 Ga0496123_0071430 3300048926 Bacteria 2165
772 Ga0496123_0113147 3300048926 Bacteria 1546
773 Ga0496123_0134808 3300048926 Bacteria 1361
774 Ga0496124_0000061 3300048927 Bacteria 238225
775 Ga0496124_0000076 3300048927 Bacteria 215767
776 Ga0496124_0000972 3300048927 Bacteria 45648
777 Ga0496124_0009807 3300048927 Bacteria 9795
778 Ga0496124_0060812 3300048927 Bacteria 3168
779 Ga0496124_0210206 3300048927 Bacteria 1473
780 Ga0496124_0259721 3300048927 Bacteria 1279
781 Ga0496124_0366393 3300048927 Bacteria 1013
782 Ga0496124_0384241 3300048927 Bacteria 981
783 Ga0496125_0000505 3300048928 Bacteria 67726
784 Ga0496125_0048947 3300048928 Bacteria 3518
785 Ga0496125_0180549 3300048928 Bacteria 1407
786 Ga0496125_0342270 3300048928 Bacteria 897
787 Ga0496125_0392358 3300048928 Bacteria 814
788 Ga0496125_0423031 3300048928 Bacteria 771
789 Ga0496125_0424528 3300048928 Bacteria 769
790 Ga0496126_0000469 3300048929 Bacteria 80156
791 Ga0496126_0072263 3300048929 Bacteria 3069
792 Ga0496126_0142042 3300048929 Bacteria 2066
793 Ga0496126_0181775 3300048929 Bacteria 1786
794 Ga0495678_067352 3300049459 Bacteria 1323
795 Ga0495678_089306 3300049459 Bacteria 1089
796 Ga0495682_0005472 3300049460 Bacteria 5269
797 Ga0501290_010424 3300049513 Bacteria 1188
798 Ga0501292_000003 3300049515 Bacteria 161908
799 Ga0501293_014882 3300049516 Bacteria 711
800 Ga0501294_001507 3300049517 Bacteria 2331
801 Ga0501300_000435 3300049523 Bacteria 6338
802 Ga0501300_006309 3300049523 Bacteria 1747
803 Ga0501031_0063333 3300049568 Bacteria 2409
804 Ga0501032_0010092 3300049569 Bacteria 6817
805 Ga0501032_0116551 3300049569 Bacteria 1766
806 Ga0501033_0086928 3300049570 Bacteria 2288
807 Ga0501033_0108351 3300049570 Bacteria 2023
808 Ga0501034_0008195 3300049571 Bacteria 11079
809 Ga0501034_0027966 3300049571 Bacteria 5734
810 Ga0501034_0051809 3300049571 Bacteria 4138
811 Ga0501034_0169871 3300049571 Bacteria 2148
812 Ga0501036_0147928 3300049572 Bacteria 1981
813 Ga0501036_0515586 3300049572 Bacteria 994
814 Ga0501037_0635499 3300049573 Bacteria 714
815 Ga0501038_0022352 3300049574 Bacteria 5669
816 Ga0501039_0530071 3300049575 Bacteria 924
817 Ga0501043_0057451 3300049579 Bacteria 3055
818 Ga0501043_0135872 3300049579 Bacteria 1926
819 Ga0501046_0132703 3300049580 Bacteria 1888
820 Ga0501047_0001517 3300049581 Bacteria 22668
821 Ga0501047_0200828 3300049581 Bacteria 1855
822 Ga0501047_0372518 3300049581 Bacteria 1263
823 Ga0501048_0119258 3300049582 Bacteria 1864
824 Ga0501198_038966 3300049649 Bacteria 818
825 Ga0501202_003716 3300049652 Bacteria 2629
826 Ga0501206_004721 3300049653 Bacteria 1741
827 Ga0501207_014963 3300049654 Bacteria 1190
828 Ga0501222_000605 3300049662 Bacteria 5260
829 Ga0501223_000090 3300049663 Bacteria 26538
830 Ga0501223_002495 3300049663 Bacteria 4074
831 Ga0501224_000025 3300049664 Bacteria 56130
832 Ga0501224_001119 3300049664 Bacteria 3492
833 Ga0501227_002177 3300049665 Bacteria 4333
834 Ga0501233_000238 3300049668 Bacteria 8300
835 Ga0501235_043485 3300049669 Bacteria 1031
836 Ga0501242_023965 3300049674 Bacteria 798
837 Ga0501249_000067 3300049679 Bacteria 37308
838 Ga0501257_000019 3300049686 Bacteria 47149
839 Ga0501257_009301 3300049686 Bacteria 2217
840 Ga0501259_000022 3300049688 Bacteria 22627
841 Ga0501261_000007 3300049690 Bacteria 60773
842 Ga0501221_002092 3300049704 Bacteria 3321
843 Ga0501221_017434 3300049704 Bacteria 1371
844 Ga0501225_0000115 3300049705 Bacteria 24964
845 Ga0501234_000307 3300049707 Bacteria 7144
846 Ga0501245_017803 3300049708 Bacteria 1087
847 Ga0501279_000082 3300049775 Bacteria 15759
848 Ga0501280_000047 3300049776 Bacteria 35975
849 Ga0501280_000638 3300049776 Bacteria 7890
850 Ga0501281_00165 3300049777 Bacteria 7693
851 Ga0501282_000814 3300049778 Bacteria 3580
852 Ga0501035_0076990 3300049822 Bacteria 2948
853 Ga0501035_0217406 3300049822 Bacteria 1633
854 Ga0501035_0296075 3300049822 Bacteria 1364
855 Ga0501035_0531848 3300049822 Bacteria 965
856 Ga0501044_0153977 3300049823 Bacteria 2279
857 Ga0501044_0232027 3300049823 Bacteria 1792
858 Ga0501226_000020 3300049853 Bacteria 141193
859 nmdc:mga0k408_167288_c1 3300050493 Bacteria 1310
860 nmdc:mga07m45_62558_c1 3300050496 Bacteria 1663
861 Ga0500610_0000075 3300053079 Bacteria 30153
862 Ga0500643_000293 3300053087 Bacteria 42902
863 Ga0500643_000709 3300053087 Bacteria 22105
864 Ga0500643_000824 3300053087 Bacteria 20040
865 Ga0500643_000847 3300053087 Bacteria 19541
866 Ga0500643_017589 3300053087 Bacteria 2391
867 Ga0500647_0067941 3300053091 Bacteria 1714
868 Ga0500583_0330907 3300053092 Bacteria 741
869 Ga0500651_0071175 3300053093 Bacteria 2164
870 Ga0500566_0015005 3300053094 Bacteria 4549
871 Ga0500566_0050704 3300053094 Bacteria 2376
872 Ga0500641_0014638 3300053096 Bacteria 2897
873 Ga0500641_0062406 3300053096 Bacteria 1554
874 Ga0500555_000708 3300053103 Bacteria 12614
875 Ga0500556_0081715 3300053104 Bacteria 1222
876 Ga0500562_128708 3300053108 Bacteria 690
877 Ga0500592_000543 3300053116 Bacteria 6225
878 Ga0500592_000812 3300053116 Bacteria 5113
879 Ga0500592_004915 3300053116 Bacteria 2122
880 Ga0500592_015284 3300053116 Bacteria 1231
881 Ga0500592_023894 3300053116 Bacteria 985
882 Ga0500594_0008100 3300053118 Bacteria 2390
883 Ga0500594_0020557 3300053118 Bacteria 1648
884 Ga0500595_000789 3300053119 Bacteria 18477
885 Ga0500595_004048 3300053119 Bacteria 6670
886 Ga0500595_047484 3300053119 Bacteria 1345
887 Ga0500597_002858 3300053120 Bacteria 4935
888 Ga0500614_029717 3300053123 Bacteria 1328
889 Ga0500618_011159 3300053125 Bacteria 2392
890 Ga0500642_0002794 3300053130 Bacteria 5177
891 Ga0500652_173387 3300053131 Bacteria 887
892 Ga0500655_000411 3300053133 Bacteria 8997
893 Ga0500658_0010536 3300053134 Bacteria 3409
894 Ga0500658_0018148 3300053134 Bacteria 2634
895 Ga0500658_0027407 3300053134 Bacteria 2203
896 Ga0500658_0168690 3300053134 Bacteria 993
897 Ga0500658_0343353 3300053134 Bacteria 685
898 Ga0500559_0001245 3300053136 Bacteria 14977
899 Ga0500559_0019742 3300053136 Bacteria 2848
900 Ga0500559_0026803 3300053136 Bacteria 2457
901 Ga0500568_0003154 3300053139 Bacteria 9393
902 Ga0500568_0020227 3300053139 Bacteria 2882
903 Ga0500568_0025795 3300053139 Bacteria 2474
904 Ga0500568_0047498 3300053139 Bacteria 1700
905 Ga0500568_0075216 3300053139 Bacteria 1288
906 Ga0500573_0000041 3300053140 Bacteria 103805
907 Ga0500590_002280 3300053148 Bacteria 8425
908 Ga0500604_0030240 3300053151 Bacteria 1583
909 Ga0500604_0164895 3300053151 Bacteria 756
910 Ga0500616_0112681 3300053153 Bacteria 1311
911 Ga0500616_0145388 3300053153 Bacteria 1103
912 Ga0500624_000004 3300053157 Bacteria 196921
913 Ga0500624_000095 3300053157 Bacteria 43267
914 Ga0500624_016035 3300053157 Bacteria 1152
915 Ga0500627_0000056 3300053158 Bacteria 53879
916 Ga0500627_0000374 3300053158 Bacteria 12179
917 Ga0500627_0000418 3300053158 Bacteria 11489
918 Ga0500627_0036703 3300053158 Bacteria 2088
919 Ga0500627_0105744 3300053158 Bacteria 1265
920 Ga0500627_0155528 3300053158 Bacteria 1032
921 Ga0500627_0165050 3300053158 Bacteria 999
922 Ga0500636_0004155 3300053177 Bacteria 8192
923 Ga0500636_0019811 3300053177 Bacteria 3978
924 Ga0500636_0043398 3300053177 Bacteria 2655
925 Ga0500636_0135147 3300053177 Bacteria 1370
926 Ga0500637_0000454 3300053178 Bacteria 15762
927 Ga0500570_000528 3300053724 Bacteria 14985
928 Ga0500611_001307 3300053727 Bacteria 2703
929 Ga0500645_000038 3300053730 Bacteria 112786
930 Ga0500645_003201 3300053730 Bacteria 6792
931 Ga0500645_103965 3300053730 Bacteria 799
932 Ga0500596_000565 3300053735 Bacteria 7056
933 Ga0500601_012482 3300053737 Bacteria 960
934 2585263300 2582581305 Bacteria 4895574
935 2600203137 2599185354 Bacteria 4398675
936 2600227134 2599185359 Bacteria 4772316
937 2643727822 2643221541 Bacteria 5498788
938 2643835339 2643221563 Bacteria 4726935
939 2644038937 2643221605 Bacteria 4772303
940 2644043228 2643221606 Bacteria 5588032
941 2644056265 2643221608 Bacteria 4724829
942 2644127386 2643221622 Bacteria 4212502
943 2644395341 2643221671 Bacteria 5496681
944 2753766557 2751185897 Bacteria 5322941
945 2819715414 2818991466 Bacteria 4748179
946 2830075873 2830075706 Bacteria 3855215
947 2852654927 2852653556 Bacteria 4050083
948 2852681730 2852680915 Bacteria 4100189
949 2879163245 2879163058 Bacteria 4223965
950 2885432402 2885429604 Bacteria 3642894
951 2928530843 2928526807 Bacteria 4760224
952 2928971083 2928968154 Bacteria 4633371
953 2946790433 2946787523 Bacteria 4366789
954 2990268352 2990265787 Bacteria 3943888
955 2993696616 2993693658 Bacteria 4040749
956 8057105483 8057101203 Bacteria 5034064
957 Ga0105248_10000113
958 SwRhRL3b_contig_2766702
959 ARcpr5yngRDRAFT_c000749
960 JGI24736J21556_1000083
961 JGI24741J21665_1004664
962 JGI24741J21665_1016602
963 JGI24752J21851_1000379
964 JGI24752J21851_1002368
965 JGI24740J21852_10005913
966 JGI24740J21852_10016144
967 JGI24740J21852_10017375
968 JGI24739J22299_10006876
969 JGI24739J22299_10008728
970 JGI24739J22299_10020919
971 JGI24737J22298_10022130
972 JGI24737J22298_10076137
973 JGI24737J22298_10082606
974 JGI24735J21928_10001347
975 JGI24750J21931_1001923
976 JGI24750J21931_1027918
977 JGI24748J21848_1000124
978 JGI24738J21930_10000970
979 JGI24738J21930_10020685
980 JGI24749J21850_1000179
981 JGI24749J21850_1000879
982 JGI24749J21850_1030677
983 JGI24744J21845_10057570
984 JGI24034J26672_10000048
985 JGI24034J26672_10013219
986 JGI24742J22300_10004390
987 JGI24751J29686_10000022
988 JGI24751J29686_10008525
989 JGI24751J29686_10009785
990 JGI25150J39212_1000336
991 JGI25165J46597_1000010
992 JGI25153J46596_10000045
993 JGI25153J46596_10000055
994 JGI25153J46596_10003282
995 rootH2_10053686
996 rootH1_10009798
997 rootH1_10239172
998 Ga0055539_1017913
999 Ga0055525_1000080
1000 Ga0055542_1000012
1001 Ga0055529_1000002
1002 Ga0055529_1000004
1003 Ga0055526_1005851
1004 Ga0055537_1003306
1005 Ga0055524_1000405
1006 Ga0055536_1002944
1007 Ga0055536_1010300
1008 Ga0055536_1019463
1009 Ga0055534_1014749
1010 Ga0055530_10000203
1011 Ga0055530_10000915
1012 Ga0055530_10006827
1013 Ga0055530_10009074
1014 Ga0055540_1004237
1015 Ga0055531_10001375
1016 Ga0055531_10005683
1017 Ga0055531_10005973
1018 Ga0055531_10006693
1019 Ga0055531_10078366
1020 Ga0055543_1034130
1021 Ga0065165_1004742
1022 Ga0065165_1018884
1023 Ga0065707_10082321
1024 Ga0065707_10250722
1025 Ga0065707_10309846
1026 Ga0065707_10316426
1027 Ga0070658_10000003
1028 Ga0070658_10002437
1029 Ga0070658_10100600
1030 Ga0070658_10359976
1031 Ga0070676_10020378
1032 Ga0070683_100104667
1033 Ga0070683_100108350
1034 Ga0070683_100577103
1035 Ga0070690_100000016
1036 Ga0070670_100000006
1037 Ga0070670_100000292
1038 Ga0070670_100002143
1039 Ga0070670_100002325
1040 Ga0070670_100061762
1041 Ga0068869_100725405
1042 Ga0068869_100897459
1043 Ga0070666_10000011
1044 Ga0070666_10000829
1045 Ga0070682_100509515
1046 Ga0070660_100002821
1047 Ga0070660_100047738
1048 Ga0070660_100309086
1049 Ga0070660_100811019
1050 Ga0070689_100045939
1051 Ga0070687_100040703
1052 Ga0070661_100000261
1053 Ga0070661_100027201
1054 Ga0070661_100085227
1055 Ga0070661_100374564
1056 Ga0070692_10005410
1057 Ga0070668_100002152
1058 Ga0070668_100004339
1059 Ga0070668_100007957
1060 Ga0070669_100000004
1061 Ga0070669_100000009
1062 Ga0070669_100000036
1063 Ga0070669_100049847
1064 Ga0070675_100985551
1065 Ga0070671_100000004
1066 Ga0070671_100000273
1067 Ga0070671_100039735
1068 Ga0070671_100094914
1069 Ga0070671_100549088
1070 Ga0070674_100001683
1071 Ga0070674_100030244
1072 Ga0070673_100248365
1073 Ga0070673_100617176
1074 Ga0070688_100001707
1075 Ga0070688_101066772
1076 Ga0070659_100001775
1077 Ga0070659_100264976
1078 Ga0070659_100727003
1079 Ga0070667_100000298
1080 Ga0070667_100000398
1081 Ga0070667_100000415
1082 Ga0070667_100002347
1083 Ga0070667_100179436
1084 Ga0070667_100256711
1085 Ga0070705_100005751
1086 Ga0070663_100046814
1087 Ga0070663_100329966
1088 Ga0070678_100000679
1089 Ga0070678_100124729
1090 Ga0070662_100043140
1091 Ga0070662_100160195
1092 Ga0070681_11001110
1093 Ga0068867_100169110
1094 Ga0068867_101393210
1095 Ga0070685_10000186
1096 Ga0070679_100199935
1097 Ga0070679_100671658
1098 Ga0070684_100093789
1099 Ga0068853_100004467
1100 Ga0068853_100016381
1101 Ga0068853_100081684
1102 Ga0068853_100467353
1103 Ga0068853_100894298
1104 Ga0070686_100000001
1105 Ga0070665_100000004
1106 Ga0070665_100000088
1107 Ga0070665_100332902
1108 Ga0070665_100471593
1109 Ga0070665_100511047
1110 Ga0070665_100667779
1111 Ga0068855_100000667
1112 Ga0068855_100099751
1113 Ga0068855_100250360
1114 Ga0068855_100346840
1115 Ga0068855_101055868
1116 Ga0068857_100017231
1117 Ga0068857_100043041
1118 Ga0068857_100204800
1119 Ga0068857_100380072
1120 Ga0068857_100555250
1121 Ga0068854_100008336
1122 Ga0068854_100074397
1123 Ga0068854_100083318
1124 Ga0068854_100908063
1125 Ga0068856_100100701
1126 Ga0068856_100123778
1127 Ga0068852_100086066
1128 Ga0068852_100090931
1129 Ga0068852_100117605
1130 Ga0068852_100160386
1131 Ga0068859_100001079
1132 Ga0068859_100003565
1133 Ga0068859_100006631
1134 Ga0068859_100007071
1135 Ga0068859_100028197
1136 Ga0068859_100948772
1137 Ga0068864_100000014
1138 Ga0068864_100000300
1139 Ga0068864_100000544
1140 Ga0068864_100001484
1141 Ga0068864_100009598
1142 Ga0068864_100014481
1143 Ga0068861_100000203
1144 Ga0068861_100003016
1145 Ga0068861_100031375
1146 Ga0068861_100434862
1147 Ga0068851_10019572
1148 Ga0068851_10077021
1149 Ga0068851_10295787
1150 Ga0068863_100000010
1151 Ga0068863_100000073
1152 Ga0068863_100015329
1153 Ga0068863_100025444
1154 Ga0068863_100053484
1155 Ga0068858_100000360
1156 Ga0068858_100000487
1157 Ga0068858_100000782
1158 Ga0068858_100000957
1159 Ga0068858_100001582
1160 Ga0068858_100072688
1161 Ga0068860_100000030
1162 Ga0068860_100000143
1163 Ga0068860_100000412
1164 Ga0068860_100001278
1165 Ga0068860_100007681
1166 Ga0068862_100000007
1167 Ga0068862_100000014
1168 Ga0068862_100000431
1169 Ga0068862_100000462
1170 Ga0068862_100000716
1171 Ga0068862_100000810
1172 Ga0068862_100012378
1173 Ga0068862_100096973
1174 Ga0068862_100292157
1175 Ga0081455_10000405
1176 Ga0075364_10061051
1177 Ga0075366_10104846
1178 Ga0075366_10445365
1179 Ga0097621_100193783
1180 Ga0097621_100385789
1181 Ga0075370_10026022
1182 Ga0075370_10174138
1183 Ga0068871_100315503
1184 Ga0068871_100784643
1185 Ga0075429_100216459
1186 Ga0097620_100001079
1187 Ga0097620_100003566
1188 Ga0097620_100006631
1189 Ga0097620_100007071
1190 Ga0097620_100028198
1191 Ga0097620_100948790
1192 Ga0105251_10000296
1193 Ga0105251_10176357
1194 Ga0105240_10110084
1195 Ga0105240_10114767
1196 Ga0105240_10445502
1197 Ga0105240_10502904
1198 Ga0105245_10005729
1199 Ga0105247_10000874
1200 Ga0105247_10024765
1201 Ga0105247_10108150
1202 Ga0105243_10001945
1203 Ga0105241_10012572
1204 Ga0105241_10077684
1205 Ga0105241_10640398
1206 Ga0105248_10000029
1207 Ga0105248_10056147
1208 Ga0105248_10123446
1209 Ga0105248_10144662
1210 Ga0105248_10222120
1211 Ga0105248_10805215
1212 Ga0105237_10009797
1213 Ga0105237_10035288
1214 Ga0105237_10951022
1215 Ga0105238_10116166
1216 Ga0105238_10226626
1217 Ga0105238_11111161
1218 Ga0105249_10000002
1219 Ga0105249_10000016
1220 Ga0105249_10000024
1221 Ga0105249_10014933
1222 Ga0105249_10687866
1223 Ga0105239_10145283
1224 Ga0105239_10332665
1225 Ga0105239_11184609
1226 Ga0105239_11299434
1227 Ga0105239_11597561
1228 Ga0105246_10118019
1229 Ga0157317_1006477
1230 Ga0157326_1003753
1231 Ga0157373_10015634
1232 Ga0157373_10066327
1233 Ga0157371_10000290
1234 Ga0157371_10100385
1235 Ga0157370_10013637
1236 Ga0157370_10260172
1237 Ga0157370_10919005
1238 Ga0157369_10006147
1239 Ga0157369_10027424
1240 Ga0157369_10493554
1241 Ga0157369_11043934
1242 Ga0157369_11240354
1243 Ga0157369_11510405
1244 Ga0157374_10033722
1245 Ga0157378_10014680
1246 Ga0157378_10131445
1247 Ga0157378_10247544
1248 Ga0163162_10001555
1249 Ga0163162_10068722
1250 Ga0163162_10609628
1251 Ga0157372_10029722
1252 Ga0157372_10195146
1253 Ga0157372_10828150
1254 Ga0157375_10840863
1255 Ga0163163_10010448
1256 Ga0163163_10015142
1257 Ga0163163_10165587
1258 Ga0157380_10000042
1259 Ga0157380_10009001
1260 Ga0157380_10072337
1261 Ga0157380_10098586
1262 Ga0157379_10010222
1263 Ga0157379_10017701
1264 Ga0183363_1003
1265 Ga0163161_10000044
1266 Ga0163161_10047151
1267 Ga0163161_10138163
1268 Ga0163161_10614660
1269 Ga0213876_10001336
1270 Ga0213875_10000820
1271 Ga0207672_1001095
1272 Ga0209563_100058
1273 Ga0207425_1000005
1274 Ga0207425_1003780
1275 Ga0209646_1016590
1276 Ga0209026_1023261
1277 Ga0209677_105890
1278 Ga0209148_1000008
1279 Ga0209129_1001045
1280 Ga0209233_1000044
1281 Ga0209565_1000029
1282 Ga0209565_1000272
1283 Ga0209455_1000002
1284 Ga0209455_1008948
1285 Ga0209673_1001949
1286 Ga0209673_1002970
1287 Ga0209675_1000399
1288 Ga0209675_1008112
1289 Ga0209676_1000358
1290 Ga0209676_1000829
1291 Ga0209676_1001005
1292 Ga0209025_1001074
1293 Ga0209025_1017474
1294 Ga0209564_1000949
1295 Ga0209564_1038417
1296 Ga0209758_1000002
1297 Ga0209758_1000007
1298 Ga0209758_1012238
1299 Ga0209050_1000001
1300 Ga0209050_1000167
1301 Ga0209050_1000437
1302 Ga0209050_1004286
1303 Ga0209050_1020129
1304 Ga0209050_1040150
1305 Ga0209050_1040886
1306 Ga0209256_1000008
1307 Ga0207426_1025383
1308 Ga0209051_1000364
1309 Ga0209257_1000028
1310 Ga0209257_1000328
1311 Ga0209257_1004831
1312 Ga0209257_1007735
1313 Ga0209257_1008403
1314 Ga0209257_1012636
1315 Ga0209257_1017646
1316 Ga0209257_1046897
1317 Ga0207697_10003772
1318 Ga0207656_10004100
1319 Ga0207656_10008193
1320 Ga0207656_10252561
1321 Ga0207713_1002770
1322 Ga0207710_10002774
1323 Ga0207710_10018608
1324 Ga0207710_10059562
1325 Ga0207680_10000008
1326 Ga0207680_10000253
1327 Ga0207647_10001877
1328 Ga0207647_10116105
1329 Ga0207647_10132150
1330 Ga0207705_10000005
1331 Ga0207705_10000103
1332 Ga0207705_10013836
1333 Ga0207654_10000150
1334 Ga0207654_10001270
1335 Ga0207695_10008046
1336 Ga0207695_10039997
1337 Ga0207695_10052087
1338 Ga0207695_10091029
1339 Ga0207671_10001574
1340 Ga0207671_10003457
1341 Ga0207671_10174640
1342 Ga0207671_10358640
1343 Ga0207662_10080808
1344 Ga0207657_10002670
1345 Ga0207657_10146650
1346 Ga0207657_10262423
1347 Ga0207657_10420358
1348 Ga0207649_10000016
1349 Ga0207649_10000660
1350 Ga0207649_10352116
1351 Ga0207681_10000001
1352 Ga0207681_10000010
1353 Ga0207681_10000020
1354 Ga0207681_10004630
1355 Ga0207681_10625461
1356 Ga0207694_10003254
1357 Ga0207694_10046069
1358 Ga0207694_10048382
1359 Ga0207694_10104889
1360 Ga0207694_10156022
1361 Ga0207694_10774217
1362 Ga0207650_10000023
1363 Ga0207650_10000354
1364 Ga0207650_10002062
1365 Ga0207650_10093199
1366 Ga0207687_10001020
1367 Ga0207644_10000007
1368 Ga0207644_10000283
1369 Ga0207644_10008404
1370 Ga0207690_10012099
1371 Ga0207690_10033348
1372 Ga0207690_10285539
1373 Ga0207706_10010038
1374 Ga0207706_10051291
1375 Ga0207706_10263123
1376 Ga0207709_10000005
1377 Ga0207670_10032086
1378 Ga0207669_10000322
1379 Ga0207669_10001286
1380 Ga0207691_10183964
1381 Ga0207711_10000004
1382 Ga0207711_10003287
1383 Ga0207711_10011919
1384 Ga0207711_10076009
1385 Ga0207711_10116915
1386 Ga0207711_10142200
1387 Ga0207689_10737011
1388 Ga0207661_10553420
1389 Ga0207679_10802779
1390 Ga0207679_10911472
1391 Ga0207667_10000001
1392 Ga0207667_10000603
1393 Ga0207667_10024985
1394 Ga0207667_10357351
1395 Ga0207667_10823067
1396 Ga0207667_10853012
1397 Ga0207712_10000002
1398 Ga0207712_10000009
1399 Ga0207712_10000510
1400 Ga0207712_10018856
1401 Ga0207712_10458833
1402 Ga0207668_10001363
1403 Ga0207668_10002028
1404 Ga0207668_10006578
1405 Ga0207668_10039903
1406 Ga0207640_10005130
1407 Ga0207640_10006365
1408 Ga0207640_10020510
1409 Ga0207640_10367889
1410 Ga0207640_10384262
1411 Ga0207640_10599555
1412 Ga0207640_10798783
1413 Ga0207640_11174619
1414 Ga0207658_10000026
1415 Ga0207658_10000254
1416 Ga0207658_10001005
1417 Ga0207658_10001129
1418 Ga0207658_10001394
1419 Ga0207658_10001522
1420 Ga0207658_10302095
1421 Ga0207703_10000108
1422 Ga0207703_10000845
1423 Ga0207703_10001794
1424 Ga0207703_10002095
1425 Ga0207703_10007252
1426 Ga0207639_10001679
1427 Ga0207639_10003338
1428 Ga0207639_10021197
1429 Ga0207639_10035037
1430 Ga0207639_10137934
1431 Ga0207639_10430236
1432 Ga0207678_10048806
1433 Ga0207678_10111417
1434 Ga0207678_10303638
1435 Ga0207702_10000723
1436 Ga0207702_10026646
1437 Ga0207702_10065672
1438 Ga0207702_10093967
1439 Ga0207641_10000018
1440 Ga0207641_10000346
1441 Ga0207641_10000386
1442 Ga0207641_10013111
1443 Ga0207641_10017585
1444 Ga0207641_10056278
1445 Ga0207648_10647762
1446 Ga0207676_10000017
1447 Ga0207676_10000137
1448 Ga0207676_10000276
1449 Ga0207676_10001455
1450 Ga0207676_10003438
1451 Ga0207676_10022019
1452 Ga0207674_10010611
1453 Ga0207674_10025744
1454 Ga0207674_10066737
1455 Ga0207674_10074826
1456 Ga0207674_10578482
1457 Ga0207674_10659422
1458 Ga0207675_100000110
1459 Ga0207675_100000280
1460 Ga0207675_100000329
1461 Ga0207675_100689672
1462 Ga0207683_10001013
1463 Ga0207683_10196466
1464 Ga0207698_10005044
1465 Ga0207698_10006839
1466 Ga0207698_10057071
1467 Ga0207698_10116692
1468 Ga0207698_10384683
1469 Ga0268266_10000009
1470 Ga0268266_10000074
1471 Ga0268266_10241808
1472 Ga0268266_10399215
1473 Ga0268266_10497953
1474 Ga0268265_10000002
1475 Ga0268265_10000058
1476 Ga0268265_10000097
1477 Ga0268265_10000149
1478 Ga0268265_10000607
1479 Ga0268265_10001059
1480 Ga0268265_10121344
1481 Ga0268265_10192792
1482 Ga0268264_10000003
1483 Ga0268264_10000076
1484 Ga0268264_10000083
1485 Ga0268264_10000106
1486 Ga0268264_10000634
1487 Ga0307517_10013945
1488 Ga0307517_10044893
1489 Ga0307517_10231038
1490 Ga0307513_10049071
1491 Ga0307513_10052452
1492 Ga0307509_10042055
1493 Ga0307408_100008545
1494 Ga0307408_100008592
1495 Ga0307408_100366558
1496 Ga0307408_100409157
1497 Ga0307408_100633645
1498 Ga0307408_100676087
1499 Ga0307508_10005032
1500 Ga0307405_10041988
1501 Ga0307405_10137760
1502 Ga0307405_10285238
1503 Ga0307405_10355492
1504 Ga0307405_10491549
1505 Ga0307405_10574013
1506 Ga0307413_10034190
1507 Ga0307410_10376873
1508 Ga0307406_10002345
1509 Ga0307406_10138671
1510 Ga0307406_10400810
1511 Ga0307412_10000342
1512 Ga0307412_10003855
1513 Ga0307412_10014907
1514 Ga0307412_10026822
1515 Ga0307412_10052383
1516 Ga0307412_10064718
1517 Ga0307412_10065516
1518 Ga0307412_10157651
1519 Ga0307416_100110021
1520 Ga0307416_100532938
1521 Ga0307416_101011654
1522 Ga0307414_10000239
1523 Ga0307414_10009181
1524 Ga0307414_10018842
1525 Ga0307414_10023279
1526 Ga0307414_10356668
1527 Ga0307414_10407337
1528 Ga0307414_10419870
1529 Ga0307414_10503440
1530 Ga0307411_10049357
1531 Ga0307411_10356223
1532 Ga0307510_10005677
1533 Ga0307510_10033362
1534 Ga0373923_0185193
1535 Ga0373954_0032080
1536 Ga0373927_0096292
1537 Ga0373937_0432554
1538 Ga0395900_1030673
1539 Ga0395905_0096269
1540 Ga0395905_0447278
1541 Ga0395905_1334915
1542 Ga0436364_0752226
1543 Ga0436364_1409528
1544 Ga0395901_0029420
1545 Ga0395901_0040961
1546 Ga0395901_1258397
1547 Ga0237819_03124
1548 Ga0436365_0062931
1549 Ga0436365_0340026
1550 Ga0436363_0901981
1551 Ga0439439_0064079
1552 Ga0439465_0000267
1553 Ga0439465_0001572
1554 Ga0451789_0057199
1555 Ga0451800_0410130
1556 Ga0451802_2041707
1557 Ga0451853_2935544
1558 Ga0439431_0000273
1559 Ga0439431_0014648
1560 Ga0439442_009040
1561 Ga0439445_0000417
1562 Ga0439445_0008347
1563 Ga0439445_0024060
1564 Ga0439432_002453
1565 Ga0439449_0045533
1566 Ga0439452_020562
1567 Ga0439457_014047
1568 Ga0439462_0004232
1569 Ga0439446_0043431
1570 Ga0439434_0000488
1571 Ga0451577_1286555
1572 Ga0451576_0005491
1573 Ga0495627_005422
1574 Ga0495590_0280425
1575 Ga0495638_0000014
1576 Ga0495638_0000732
1577 Ga0495638_0004896
1578 Ga0495638_0054875
1579 Ga0495638_0238855
1580 Ga0495650_0000196
1581 Ga0495639_0354264
1582 Ga0495662_0508846
1583 Ga0495585_0000620
1584 Ga0495585_0039871
1585 Ga0495596_0028535
1586 Ga0495607_0037621
1587 Ga0495583_0000406
1588 Ga0495583_0000557
1589 Ga0495583_0001125
1590 Ga0495583_0007101
1591 Ga0495583_0015490
1592 Ga0495583_0046112
1593 Ga0495583_0087721
1594 Ga0495606_0000259
1595 Ga0495606_0000497
1596 Ga0495606_0022207
1597 Ga0495631_0085611
1598 Ga0495632_0000446
1599 Ga0495632_0188767
1600 Ga0495637_0010269
1601 Ga0495637_0020660
1602 Ga0495637_0078074
1603 Ga0495643_0002033
1604 Ga0495643_0004844
1605 Ga0495643_0005462
1606 Ga0495643_0044540
1607 Ga0495643_0058007
1608 Ga0495648_0000021
1609 Ga0495648_0000114
1610 Ga0495648_0020266
1611 Ga0495648_0065607
1612 Ga0495648_0098124
1613 Ga0495663_0000369
1614 Ga0495663_0070503
1615 Ga0495642_0040137
1616 Ga0495654_0001113
1617 Ga0495654_0096529
1618 Ga0495609_0294533
1619 Ga0495597_0013437
1620 Ga0495597_0103983
1621 Ga0495622_0021745
1622 Ga0495622_0033946
1623 Ga0495622_0067429
1624 Ga0495633_0000207
1625 Ga0495633_0010366
1626 Ga0495668_0000022
1627 Ga0495668_0000387
1628 Ga0495668_0012858
1629 Ga0495668_0017893
1630 Ga0495668_0042229
1631 Ga0495668_0069004
1632 Ga0495611_0002606
1633 Ga0495611_0052799
1634 Ga0495611_0129649
1635 Ga0495625_0000031
1636 Ga0495625_0000588
1637 Ga0495625_0002611
1638 Ga0495625_0002676
1639 Ga0495625_0011605
1640 Ga0495625_0013677
1641 Ga0495625_0270528
1642 Ga0495625_0448300
1643 Ga0495661_0092822
1644 Ga0495661_0102062
1645 Ga0495669_0000047
1646 Ga0495669_0041952
1647 Ga0495670_0000016
1648 Ga0495670_0002882
1649 Ga0495670_0011648
1650 Ga0495670_0014291
1651 Ga0495671_0000028
1652 Ga0495671_0007026
1653 Ga0495671_0015741
1654 Ga0495671_0043874
1655 Ga0495671_0131335
1656 Ga0495671_0361940
1657 Ga0495649_0228736
1658 Ga0495589_0076479
1659 Ga0495600_0038150
1660 Ga0495660_0044172
1661 Ga0495660_0164844
1662 Ga0495683_0013776
1663 Ga0495687_000043
1664 Ga0495687_002080
1665 Ga0495677_0003536
1666 Ga0495673_0000058
1667 Ga0495673_0013172
1668 Ga0495681_0005101
1669 Ga0495686_0000139
1670 Ga0495686_0000523
1671 Ga0495686_0001582
1672 Ga0495686_0010788
1673 Ga0496100_0191427
1674 Ga0496102_0000022
1675 Ga0496102_0000034
1676 Ga0496102_0025183
1677 Ga0496102_0146484
1678 Ga0496102_0225699
1679 Ga0496102_0832373
1680 Ga0496103_0000026
1681 Ga0496103_0000075
1682 Ga0496103_0002036
1683 Ga0496103_0014765
1684 Ga0496103_0460315
1685 Ga0496104_0003920
1686 Ga0496104_0125628
1687 Ga0496105_0000847
1688 Ga0496105_0066116
1689 Ga0496107_0059004
1690 Ga0496107_0060780
1691 Ga0496108_0674775
1692 Ga0496109_0230113
1693 Ga0496111_0018587
1694 Ga0496113_0030152
1695 Ga0496114_0006903
1696 Ga0496115_0000029
1697 Ga0496115_0000304
1698 Ga0496115_0256703
1699 Ga0496116_0001435
1700 Ga0496116_0002308
1701 Ga0496116_0020839
1702 Ga0496116_0290060
1703 Ga0496117_0000072
1704 Ga0496117_0000260
1705 Ga0496117_0004000
1706 Ga0496117_0005912
1707 Ga0496117_0009616
1708 Ga0496117_0061114
1709 Ga0496117_0434779
1710 Ga0496118_0000030
1711 Ga0496118_0000039
1712 Ga0496118_0002183
1713 Ga0496118_0002784
1714 Ga0496118_0030499
1715 Ga0496119_0011873
1716 Ga0496119_0019906
1717 Ga0496120_0011696
1718 Ga0496121_0000269
1719 Ga0496121_0255892
1720 Ga0496122_0000359
1721 Ga0496122_0072028
1722 Ga0496122_0114676
1723 Ga0496122_0173154
1724 Ga0496123_0002200
1725 Ga0496123_0010124
1726 Ga0496123_0017074
1727 Ga0496123_0071430
1728 Ga0496123_0113147
1729 Ga0496123_0134808
1730 Ga0496124_0000061
1731 Ga0496124_0000076
1732 Ga0496124_0000972
1733 Ga0496124_0009807
1734 Ga0496124_0060812
1735 Ga0496124_0210206
1736 Ga0496124_0259721
1737 Ga0496124_0366393
1738 Ga0496124_0384241
1739 Ga0496125_0000505
1740 Ga0496125_0048947
1741 Ga0496125_0180549
1742 Ga0496125_0342270
1743 Ga0496125_0392358
1744 Ga0496125_0423031
1745 Ga0496125_0424528
1746 Ga0496126_0000469
1747 Ga0496126_0072263
1748 Ga0496126_0142042
1749 Ga0496126_0181775
1750 Ga0495678_067352
1751 Ga0495678_089306
1752 Ga0495682_0005472
1753 Ga0501290_010424
1754 Ga0501292_000003
1755 Ga0501293_014882
1756 Ga0501294_001507
1757 Ga0501300_000435
1758 Ga0501300_006309
1759 Ga0501031_0063333
1760 Ga0501032_0010092
1761 Ga0501032_0116551
1762 Ga0501033_0086928
1763 Ga0501033_0108351
1764 Ga0501034_0008195
1765 Ga0501034_0027966
1766 Ga0501034_0051809
1767 Ga0501034_0169871
1768 Ga0501036_0147928
1769 Ga0501036_0515586
1770 Ga0501037_0635499
1771 Ga0501038_0022352
1772 Ga0501039_0530071
1773 Ga0501043_0057451
1774 Ga0501043_0135872
1775 Ga0501046_0132703
1776 Ga0501047_0001517
1777 Ga0501047_0200828
1778 Ga0501047_0372518
1779 Ga0501048_0119258
1780 Ga0501198_038966
1781 Ga0501202_003716
1782 Ga0501206_004721
1783 Ga0501207_014963
1784 Ga0501222_000605
1785 Ga0501223_000090
1786 Ga0501223_002495
1787 Ga0501224_000025
1788 Ga0501224_001119
1789 Ga0501227_002177
1790 Ga0501233_000238
1791 Ga0501235_043485
1792 Ga0501242_023965
1793 Ga0501249_000067
1794 Ga0501257_000019
1795 Ga0501257_009301
1796 Ga0501259_000022
1797 Ga0501261_000007
1798 Ga0501221_002092
1799 Ga0501221_017434
1800 Ga0501225_0000115
1801 Ga0501234_000307
1802 Ga0501245_017803
1803 Ga0501279_000082
1804 Ga0501280_000047
1805 Ga0501280_000638
1806 Ga0501281_00165
1807 Ga0501282_000814
1808 Ga0501035_0076990
1809 Ga0501035_0217406
1810 Ga0501035_0296075
1811 Ga0501035_0531848
1812 Ga0501044_0153977
1813 Ga0501044_0232027
1814 Ga0501226_000020
1815 nmdc:mga0k408_167288_c1
1816 nmdc:mga07m45_62558_c1
1817 Ga0500610_0000075
1818 Ga0500643_000293
1819 Ga0500643_000709
1820 Ga0500643_000824
1821 Ga0500643_000847
1822 Ga0500643_017589
1823 Ga0500647_0067941
1824 Ga0500583_0330907
1825 Ga0500651_0071175
1826 Ga0500566_0015005
1827 Ga0500566_0050704
1828 Ga0500641_0014638
1829 Ga0500641_0062406
1830 Ga0500555_000708
1831 Ga0500556_0081715
1832 Ga0500562_128708
1833 Ga0500592_000543
1834 Ga0500592_000812
1835 Ga0500592_004915
1836 Ga0500592_015284
1837 Ga0500592_023894
1838 Ga0500594_0008100
1839 Ga0500594_0020557
1840 Ga0500595_000789
1841 Ga0500595_004048
1842 Ga0500595_047484
1843 Ga0500597_002858
1844 Ga0500614_029717
1845 Ga0500618_011159
1846 Ga0500642_0002794
1847 Ga0500652_173387
1848 Ga0500655_000411
1849 Ga0500658_0010536
1850 Ga0500658_0018148
1851 Ga0500658_0027407
1852 Ga0500658_0168690
1853 Ga0500658_0343353
1854 Ga0500559_0001245
1855 Ga0500559_0019742
1856 Ga0500559_0026803
1857 Ga0500568_0003154
1858 Ga0500568_0020227
1859 Ga0500568_0025795
1860 Ga0500568_0047498
1861 Ga0500568_0075216
1862 Ga0500573_0000041
1863 Ga0500590_002280
1864 Ga0500604_0030240
1865 Ga0500604_0164895
1866 Ga0500616_0112681
1867 Ga0500616_0145388
1868 Ga0500624_000004
1869 Ga0500624_000095
1870 Ga0500624_016035
1871 Ga0500627_0000056
1872 Ga0500627_0000374
1873 Ga0500627_0000418
1874 Ga0500627_0036703
1875 Ga0500627_0105744
1876 Ga0500627_0155528
1877 Ga0500627_0165050
1878 Ga0500636_0004155
1879 Ga0500636_0019811
1880 Ga0500636_0043398
1881 Ga0500636_0135147
1882 Ga0500637_0000454
1883 Ga0500570_000528
1884 Ga0500611_001307
1885 Ga0500645_000038
1886 Ga0500645_003201
1887 Ga0500645_103965
1888 Ga0500596_000565
1889 Ga0500601_012482
1890 2585263300
1891 2600203137
1892 2600227134
1893 2643727822
1894 2643835339
1895 2644038937
1896 2644043228
1897 2644056265
1898 2644127386
1899 2644395341
1900 2753766557
1901 2819715414
1902 2830075873
1903 2852654927
1904 2852681730
1905 2879163245
1906 2885432402
1907 2928530843
1908 2928971083
1909 2946790433
1910 2990268352
1911 2993696616
1912 8057105483

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

40

117

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.9027 2 168
2rfl-assembly2.cif.gz_B crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8991 2 168
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8981 2 168
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8925 2 168
2rfl-assembly6.cif.gz_F crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8886 2 166
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9205 8 169 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9094 8 169 3.40.50.1240
4hbzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8769 2 168 3.40.50.1240
2rflF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8687 2 166 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8596 2 168 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7H0GC17-F1-model_v4 deleted 0.9809 1 171
AF-A0A537MJY4-F1-model_v4 Histidine phosphatase family protein 0.9761 1 171
AF-A0A7H0GC17-F1-model_v4 deleted 0.9752 1 171
AF-A0A1L3JAK2-F1-model_v4 Histidine phosphatase family protein 0.9738 1 180
AF-A0A1B2AGG6-F1-model_v4 Histidine phosphatase superfamily (Branch 1) 0.9685 1 177

Map