F486741
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 956 | 402 | 1912 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10000113|Ga0105248_1000011336 |
| Length | 216 |
| Sequence | MVGRQSTTVKNVALSDFLPEGLSGITGSSRMRDAGIVKKLTLLRHAKSGWDDPVARDFDRPLNAKGKRAAHRVGEYLRDHHLDFDHVVASPAVRVVETIENLVAGSGETMTPAWDKRVYLASAVSLLDVVHEADDRYDSLLLVGHNPGLEDLVLMMVPDRAGDEARDQIEEKFPTASIAEISFPVEHWEDVQPNSGTLSLFIRPRDLDPALGPDRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 106 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 224 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 227 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 228 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 229 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 301 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 303 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 304 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 318 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 320 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 321 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 322 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 326 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 336 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 337 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 339 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 355 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 360 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 363 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 368 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 372 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 376 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 377 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 380 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 381 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 382 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 383 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 384 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 385 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 386 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 387 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 388 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 389 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 390 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 391 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 392 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 393 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 394 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 395 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 396 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 397 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 398 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 399 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 400 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 401 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 402 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0 |
| Isolates | 2.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 16 |
| Nodule | 0 |
| Rhizoplane | 3.24 |
| Rhizosphere | 71.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10000113 | 3300009177 | Bacteria | 91128 |
| 2 | SwRhRL3b_contig_2766702 | 2162886006 | Bacteria | 3709 |
| 3 | ARcpr5yngRDRAFT_c000749 | 3300000043 | Bacteria | 3985 |
| 4 | JGI24736J21556_1000083 | 3300001904 | Bacteria | 15464 |
| 5 | JGI24741J21665_1004664 | 3300001915 | Bacteria | 2993 |
| 6 | JGI24741J21665_1016602 | 3300001915 | Bacteria | 1200 |
| 7 | JGI24752J21851_1000379 | 3300001976 | Bacteria | 6152 |
| 8 | JGI24752J21851_1002368 | 3300001976 | Bacteria | 2507 |
| 9 | JGI24740J21852_10005913 | 3300001979 | Bacteria | 5128 |
| 10 | JGI24740J21852_10016144 | 3300001979 | Bacteria | 2705 |
| 11 | JGI24740J21852_10017375 | 3300001979 | Bacteria | 2575 |
| 12 | JGI24739J22299_10006876 | 3300001989 | Bacteria | 4284 |
| 13 | JGI24739J22299_10008728 | 3300001989 | Bacteria | 3780 |
| 14 | JGI24739J22299_10020919 | 3300001989 | Bacteria | 2334 |
| 15 | JGI24737J22298_10022130 | 3300001990 | Bacteria | 2020 |
| 16 | JGI24737J22298_10076137 | 3300001990 | Bacteria | 1000 |
| 17 | JGI24737J22298_10082606 | 3300001990 | Bacteria | 955 |
| 18 | JGI24735J21928_10001347 | 3300002067 | Bacteria | 8689 |
| 19 | JGI24750J21931_1001923 | 3300002070 | Bacteria | 2536 |
| 20 | JGI24750J21931_1027918 | 3300002070 | Unclassified | 818 |
| 21 | JGI24748J21848_1000124 | 3300002074 | Bacteria | 14795 |
| 22 | JGI24738J21930_10000970 | 3300002075 | Bacteria | 8229 |
| 23 | JGI24738J21930_10020685 | 3300002075 | Bacteria | 1368 |
| 24 | JGI24749J21850_1000179 | 3300002076 | Bacteria | 10133 |
| 25 | JGI24749J21850_1000879 | 3300002076 | Bacteria | 4324 |
| 26 | JGI24749J21850_1030677 | 3300002076 | Unclassified | 771 |
| 27 | JGI24744J21845_10057570 | 3300002077 | Bacteria | 712 |
| 28 | JGI24034J26672_10000048 | 3300002239 | Bacteria | 56597 |
| 29 | JGI24034J26672_10013219 | 3300002239 | Bacteria | 1251 |
| 30 | JGI24742J22300_10004390 | 3300002244 | Bacteria | 2308 |
| 31 | JGI24751J29686_10000022 | 3300002459 | Bacteria | 104477 |
| 32 | JGI24751J29686_10008525 | 3300002459 | Bacteria | 2097 |
| 33 | JGI24751J29686_10009785 | 3300002459 | Bacteria | 1975 |
| 34 | JGI25150J39212_1000336 | 3300002774 | Bacteria | 23118 |
| 35 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 36 | JGI25153J46596_10000045 | 3300003215 | Bacteria | 149347 |
| 37 | JGI25153J46596_10000055 | 3300003215 | Bacteria | 135518 |
| 38 | JGI25153J46596_10003282 | 3300003215 | Bacteria | 9084 |
| 39 | rootH2_10053686 | 3300003320 | Bacteria | 1105 |
| 40 | rootH1_10009798 | 3300003323 | Bacteria | 2252 |
| 41 | rootH1_10239172 | 3300003323 | Bacteria | 1068 |
| 42 | Ga0055539_1017913 | 3300003752 | Bacteria | 855 |
| 43 | Ga0055525_1000080 | 3300003759 | Bacteria | 164642 |
| 44 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 45 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 46 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 47 | Ga0055526_1005851 | 3300003771 | Bacteria | 6905 |
| 48 | Ga0055537_1003306 | 3300003773 | Bacteria | 4996 |
| 49 | Ga0055524_1000405 | 3300003775 | Bacteria | 36783 |
| 50 | Ga0055536_1002944 | 3300003781 | Bacteria | 9347 |
| 51 | Ga0055536_1010300 | 3300003781 | Bacteria | 3731 |
| 52 | Ga0055536_1019463 | 3300003781 | Bacteria | 2133 |
| 53 | Ga0055534_1014749 | 3300003784 | Bacteria | 1454 |
| 54 | Ga0055530_10000203 | 3300003791 | Bacteria | 53592 |
| 55 | Ga0055530_10000915 | 3300003791 | Bacteria | 24243 |
| 56 | Ga0055530_10006827 | 3300003791 | Bacteria | 4961 |
| 57 | Ga0055530_10009074 | 3300003791 | Bacteria | 3873 |
| 58 | Ga0055540_1004237 | 3300003792 | Bacteria | 6581 |
| 59 | Ga0055531_10001375 | 3300003794 | Bacteria | 18071 |
| 60 | Ga0055531_10005683 | 3300003794 | Bacteria | 7237 |
| 61 | Ga0055531_10005973 | 3300003794 | Bacteria | 6995 |
| 62 | Ga0055531_10006693 | 3300003794 | Bacteria | 6458 |
| 63 | Ga0055531_10078366 | 3300003794 | Bacteria | 736 |
| 64 | Ga0055543_1034130 | 3300004625 | Bacteria | 877 |
| 65 | Ga0065165_1004742 | 3300005262 | Bacteria | 8148 |
| 66 | Ga0065165_1018884 | 3300005262 | Bacteria | 2480 |
| 67 | Ga0065707_10082321 | 3300005295 | Bacteria | 16892 |
| 68 | Ga0065707_10250722 | 3300005295 | Bacteria | 1126 |
| 69 | Ga0065707_10309846 | 3300005295 | Unclassified | 987 |
| 70 | Ga0065707_10316426 | 3300005295 | Bacteria | 975 |
| 71 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 72 | Ga0070658_10002437 | 3300005327 | Bacteria | 15566 |
| 73 | Ga0070658_10100600 | 3300005327 | Bacteria | 2390 |
| 74 | Ga0070658_10359976 | 3300005327 | Bacteria | 1246 |
| 75 | Ga0070676_10020378 | 3300005328 | Bacteria | 3701 |
| 76 | Ga0070683_100104667 | 3300005329 | Bacteria | 2667 |
| 77 | Ga0070683_100108350 | 3300005329 | Bacteria | 2620 |
| 78 | Ga0070683_100577103 | 3300005329 | Bacteria | 1076 |
| 79 | Ga0070690_100000016 | 3300005330 | Bacteria | 85515 |
| 80 | Ga0070670_100000006 | 3300005331 | Bacteria | 319420 |
| 81 | Ga0070670_100000292 | 3300005331 | Bacteria | 43960 |
| 82 | Ga0070670_100002143 | 3300005331 | Bacteria | 16199 |
| 83 | Ga0070670_100002325 | 3300005331 | Bacteria | 15657 |
| 84 | Ga0070670_100061762 | 3300005331 | Bacteria | 3216 |
| 85 | Ga0068869_100725405 | 3300005334 | Bacteria | 849 |
| 86 | Ga0068869_100897459 | 3300005334 | Bacteria | 767 |
| 87 | Ga0070666_10000011 | 3300005335 | Bacteria | 261736 |
| 88 | Ga0070666_10000829 | 3300005335 | Bacteria | 18742 |
| 89 | Ga0070682_100509515 | 3300005337 | Bacteria | 934 |
| 90 | Ga0070660_100002821 | 3300005339 | Bacteria | 11956 |
| 91 | Ga0070660_100047738 | 3300005339 | Bacteria | 3286 |
| 92 | Ga0070660_100309086 | 3300005339 | Bacteria | 1297 |
| 93 | Ga0070660_100811019 | 3300005339 | Bacteria | 787 |
| 94 | Ga0070689_100045939 | 3300005340 | Bacteria | 3364 |
| 95 | Ga0070687_100040703 | 3300005343 | Bacteria | 2343 |
| 96 | Ga0070661_100000261 | 3300005344 | Bacteria | 43151 |
| 97 | Ga0070661_100027201 | 3300005344 | Bacteria | 4117 |
| 98 | Ga0070661_100085227 | 3300005344 | Bacteria | 2334 |
| 99 | Ga0070661_100374564 | 3300005344 | Bacteria | 1121 |
| 100 | Ga0070692_10005410 | 3300005345 | Bacteria | 5443 |
| 101 | Ga0070668_100002152 | 3300005347 | Bacteria | 14427 |
| 102 | Ga0070668_100004339 | 3300005347 | Bacteria | 10518 |
| 103 | Ga0070668_100007957 | 3300005347 | Bacteria | 7872 |
| 104 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 105 | Ga0070669_100000009 | 3300005353 | Bacteria | 224683 |
| 106 | Ga0070669_100000036 | 3300005353 | Bacteria | 137564 |
| 107 | Ga0070669_100049847 | 3300005353 | Bacteria | 3057 |
| 108 | Ga0070675_100985551 | 3300005354 | Bacteria | 774 |
| 109 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 110 | Ga0070671_100000273 | 3300005355 | Bacteria | 34866 |
| 111 | Ga0070671_100039735 | 3300005355 | Bacteria | 3906 |
| 112 | Ga0070671_100094914 | 3300005355 | Bacteria | 2500 |
| 113 | Ga0070671_100549088 | 3300005355 | Bacteria | 996 |
| 114 | Ga0070674_100001683 | 3300005356 | Bacteria | 11963 |
| 115 | Ga0070674_100030244 | 3300005356 | Bacteria | 3576 |
| 116 | Ga0070673_100248365 | 3300005364 | Bacteria | 1550 |
| 117 | Ga0070673_100617176 | 3300005364 | Bacteria | 990 |
| 118 | Ga0070688_100001707 | 3300005365 | Bacteria | 10964 |
| 119 | Ga0070688_101066772 | 3300005365 | Bacteria | 644 |
| 120 | Ga0070659_100001775 | 3300005366 | Bacteria | 15502 |
| 121 | Ga0070659_100264976 | 3300005366 | Bacteria | 1426 |
| 122 | Ga0070659_100727003 | 3300005366 | Bacteria | 860 |
| 123 | Ga0070667_100000298 | 3300005367 | Bacteria | 55786 |
| 124 | Ga0070667_100000398 | 3300005367 | Bacteria | 46959 |
| 125 | Ga0070667_100000415 | 3300005367 | Bacteria | 45632 |
| 126 | Ga0070667_100002347 | 3300005367 | Bacteria | 16582 |
| 127 | Ga0070667_100179436 | 3300005367 | Bacteria | 1872 |
| 128 | Ga0070667_100256711 | 3300005367 | Bacteria | 1564 |
| 129 | Ga0070705_100005751 | 3300005440 | Bacteria | 6058 |
| 130 | Ga0070663_100046814 | 3300005455 | Bacteria | 3062 |
| 131 | Ga0070663_100329966 | 3300005455 | Bacteria | 1229 |
| 132 | Ga0070678_100000679 | 3300005456 | Bacteria | 16764 |
| 133 | Ga0070678_100124729 | 3300005456 | Bacteria | 2036 |
| 134 | Ga0070662_100043140 | 3300005457 | Bacteria | 3225 |
| 135 | Ga0070662_100160195 | 3300005457 | Bacteria | 1760 |
| 136 | Ga0070681_11001110 | 3300005458 | Bacteria | 755 |
| 137 | Ga0068867_100169110 | 3300005459 | Bacteria | 1730 |
| 138 | Ga0068867_101393210 | 3300005459 | Bacteria | 650 |
| 139 | Ga0070685_10000186 | 3300005466 | Bacteria | 41567 |
| 140 | Ga0070679_100199935 | 3300005530 | Bacteria | 1965 |
| 141 | Ga0070679_100671658 | 3300005530 | Bacteria | 979 |
| 142 | Ga0070684_100093789 | 3300005535 | Bacteria | 2672 |
| 143 | Ga0068853_100004467 | 3300005539 | Bacteria | 10846 |
| 144 | Ga0068853_100016381 | 3300005539 | Bacteria | 6100 |
| 145 | Ga0068853_100081684 | 3300005539 | Bacteria | 2830 |
| 146 | Ga0068853_100467353 | 3300005539 | Bacteria | 1188 |
| 147 | Ga0068853_100894298 | 3300005539 | Unclassified | 853 |
| 148 | Ga0070686_100000001 | 3300005544 | Bacteria | 515830 |
| 149 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 150 | Ga0070665_100000088 | 3300005548 | Bacteria | 177729 |
| 151 | Ga0070665_100332902 | 3300005548 | Bacteria | 1523 |
| 152 | Ga0070665_100471593 | 3300005548 | Bacteria | 1266 |
| 153 | Ga0070665_100511047 | 3300005548 | Bacteria | 1213 |
| 154 | Ga0070665_100667779 | 3300005548 | Unclassified | 1052 |
| 155 | Ga0068855_100000667 | 3300005563 | Bacteria | 41874 |
| 156 | Ga0068855_100099751 | 3300005563 | Bacteria | 3344 |
| 157 | Ga0068855_100250360 | 3300005563 | Bacteria | 1976 |
| 158 | Ga0068855_100346840 | 3300005563 | Bacteria | 1636 |
| 159 | Ga0068855_101055868 | 3300005563 | Bacteria | 851 |
| 160 | Ga0068857_100017231 | 3300005577 | Bacteria | 6330 |
| 161 | Ga0068857_100043041 | 3300005577 | Bacteria | 4006 |
| 162 | Ga0068857_100204800 | 3300005577 | Bacteria | 1799 |
| 163 | Ga0068857_100380072 | 3300005577 | Bacteria | 1311 |
| 164 | Ga0068857_100555250 | 3300005577 | Bacteria | 1082 |
| 165 | Ga0068854_100008336 | 3300005578 | Bacteria | 6659 |
| 166 | Ga0068854_100074397 | 3300005578 | Bacteria | 2492 |
| 167 | Ga0068854_100083318 | 3300005578 | Bacteria | 2364 |
| 168 | Ga0068854_100908063 | 3300005578 | Bacteria | 774 |
| 169 | Ga0068856_100100701 | 3300005614 | Bacteria | 2882 |
| 170 | Ga0068856_100123778 | 3300005614 | Bacteria | 2588 |
| 171 | Ga0068852_100086066 | 3300005616 | Bacteria | 2801 |
| 172 | Ga0068852_100090931 | 3300005616 | Bacteria | 2730 |
| 173 | Ga0068852_100117605 | 3300005616 | Bacteria | 2427 |
| 174 | Ga0068852_100160386 | 3300005616 | Bacteria | 2099 |
| 175 | Ga0068859_100001079 | 3300005617 | Bacteria | 27844 |
| 176 | Ga0068859_100003565 | 3300005617 | Bacteria | 15857 |
| 177 | Ga0068859_100006631 | 3300005617 | Bacteria | 11757 |
| 178 | Ga0068859_100007071 | 3300005617 | Bacteria | 11392 |
| 179 | Ga0068859_100028197 | 3300005617 | Bacteria | 5629 |
| 180 | Ga0068859_100948772 | 3300005617 | Unclassified | 944 |
| 181 | Ga0068864_100000014 | 3300005618 | Bacteria | 308927 |
| 182 | Ga0068864_100000300 | 3300005618 | Bacteria | 43960 |
| 183 | Ga0068864_100000544 | 3300005618 | Bacteria | 32111 |
| 184 | Ga0068864_100001484 | 3300005618 | Bacteria | 19321 |
| 185 | Ga0068864_100009598 | 3300005618 | Bacteria | 7980 |
| 186 | Ga0068864_100014481 | 3300005618 | Bacteria | 6551 |
| 187 | Ga0068861_100000203 | 3300005719 | Bacteria | 31717 |
| 188 | Ga0068861_100003016 | 3300005719 | Bacteria | 11116 |
| 189 | Ga0068861_100031375 | 3300005719 | Bacteria | 3903 |
| 190 | Ga0068861_100434862 | 3300005719 | Bacteria | 1172 |
| 191 | Ga0068851_10019572 | 3300005834 | Bacteria | 3271 |
| 192 | Ga0068851_10077021 | 3300005834 | Bacteria | 1735 |
| 193 | Ga0068851_10295787 | 3300005834 | Bacteria | 929 |
| 194 | Ga0068863_100000010 | 3300005841 | Bacteria | 237758 |
| 195 | Ga0068863_100000073 | 3300005841 | Bacteria | 110576 |
| 196 | Ga0068863_100015329 | 3300005841 | Bacteria | 7366 |
| 197 | Ga0068863_100025444 | 3300005841 | Bacteria | 5644 |
| 198 | Ga0068863_100053484 | 3300005841 | Bacteria | 3827 |
| 199 | Ga0068858_100000360 | 3300005842 | Bacteria | 48023 |
| 200 | Ga0068858_100000487 | 3300005842 | Bacteria | 41394 |
| 201 | Ga0068858_100000782 | 3300005842 | Bacteria | 33248 |
| 202 | Ga0068858_100000957 | 3300005842 | Bacteria | 29868 |
| 203 | Ga0068858_100001582 | 3300005842 | Bacteria | 23264 |
| 204 | Ga0068858_100072688 | 3300005842 | Bacteria | 3191 |
| 205 | Ga0068860_100000030 | 3300005843 | Bacteria | 256364 |
| 206 | Ga0068860_100000143 | 3300005843 | Bacteria | 116787 |
| 207 | Ga0068860_100000412 | 3300005843 | Bacteria | 55786 |
| 208 | Ga0068860_100001278 | 3300005843 | Bacteria | 27382 |
| 209 | Ga0068860_100007681 | 3300005843 | Bacteria | 10779 |
| 210 | Ga0068862_100000007 | 3300005844 | Bacteria | 313933 |
| 211 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 212 | Ga0068862_100000431 | 3300005844 | Bacteria | 45517 |
| 213 | Ga0068862_100000462 | 3300005844 | Bacteria | 43948 |
| 214 | Ga0068862_100000716 | 3300005844 | Bacteria | 33750 |
| 215 | Ga0068862_100000810 | 3300005844 | Bacteria | 31040 |
| 216 | Ga0068862_100012378 | 3300005844 | Bacteria | 7054 |
| 217 | Ga0068862_100096973 | 3300005844 | Bacteria | 2574 |
| 218 | Ga0068862_100292157 | 3300005844 | Bacteria | 1497 |
| 219 | Ga0081455_10000405 | 3300005937 | Bacteria | 56782 |
| 220 | Ga0075364_10061051 | 3300006051 | Bacteria | 2472 |
| 221 | Ga0075366_10104846 | 3300006195 | Bacteria | 1699 |
| 222 | Ga0075366_10445365 | 3300006195 | Bacteria | 799 |
| 223 | Ga0097621_100193783 | 3300006237 | Bacteria | 1761 |
| 224 | Ga0097621_100385789 | 3300006237 | Bacteria | 1252 |
| 225 | Ga0075370_10026022 | 3300006353 | Bacteria | 3239 |
| 226 | Ga0075370_10174138 | 3300006353 | Bacteria | 1265 |
| 227 | Ga0068871_100315503 | 3300006358 | Bacteria | 1375 |
| 228 | Ga0068871_100784643 | 3300006358 | Bacteria | 877 |
| 229 | Ga0075429_100216459 | 3300006880 | Bacteria | 1678 |
| 230 | Ga0097620_100001079 | 3300006931 | Bacteria | 27844 |
| 231 | Ga0097620_100003566 | 3300006931 | Bacteria | 15857 |
| 232 | Ga0097620_100006631 | 3300006931 | Bacteria | 11757 |
| 233 | Ga0097620_100007071 | 3300006931 | Bacteria | 11392 |
| 234 | Ga0097620_100028198 | 3300006931 | Bacteria | 5629 |
| 235 | Ga0097620_100948790 | 3300006931 | Unclassified | 944 |
| 236 | Ga0105251_10000296 | 3300009011 | Bacteria | 49888 |
| 237 | Ga0105251_10176357 | 3300009011 | Unclassified | 963 |
| 238 | Ga0105240_10110084 | 3300009093 | Bacteria | 3334 |
| 239 | Ga0105240_10114767 | 3300009093 | Bacteria | 3253 |
| 240 | Ga0105240_10445502 | 3300009093 | Bacteria | 1450 |
| 241 | Ga0105240_10502904 | 3300009093 | Bacteria | 1347 |
| 242 | Ga0105245_10005729 | 3300009098 | Bacteria | 10905 |
| 243 | Ga0105247_10000874 | 3300009101 | Bacteria | 22814 |
| 244 | Ga0105247_10024765 | 3300009101 | Bacteria | 3617 |
| 245 | Ga0105247_10108150 | 3300009101 | Bacteria | 1786 |
| 246 | Ga0105243_10001945 | 3300009148 | Bacteria | 17580 |
| 247 | Ga0105241_10012572 | 3300009174 | Bacteria | 6210 |
| 248 | Ga0105241_10077684 | 3300009174 | Bacteria | 2592 |
| 249 | Ga0105241_10640398 | 3300009174 | Bacteria | 964 |
| 250 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 251 | Ga0105248_10056147 | 3300009177 | Bacteria | 4417 |
| 252 | Ga0105248_10123446 | 3300009177 | Bacteria | 2921 |
| 253 | Ga0105248_10144662 | 3300009177 | Bacteria | 2682 |
| 254 | Ga0105248_10222120 | 3300009177 | Bacteria | 2127 |
| 255 | Ga0105248_10805215 | 3300009177 | Bacteria | 1060 |
| 256 | Ga0105237_10009797 | 3300009545 | Bacteria | 10244 |
| 257 | Ga0105237_10035288 | 3300009545 | Bacteria | 5060 |
| 258 | Ga0105237_10951022 | 3300009545 | Bacteria | 866 |
| 259 | Ga0105238_10116166 | 3300009551 | Bacteria | 2655 |
| 260 | Ga0105238_10226626 | 3300009551 | Bacteria | 1846 |
| 261 | Ga0105238_11111161 | 3300009551 | Bacteria | 813 |
| 262 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 263 | Ga0105249_10000016 | 3300009553 | Bacteria | 278643 |
| 264 | Ga0105249_10000024 | 3300009553 | Bacteria | 232947 |
| 265 | Ga0105249_10014933 | 3300009553 | Bacteria | 6869 |
| 266 | Ga0105249_10687866 | 3300009553 | Bacteria | 1082 |
| 267 | Ga0105239_10145283 | 3300010375 | Bacteria | 2645 |
| 268 | Ga0105239_10332665 | 3300010375 | Bacteria | 1714 |
| 269 | Ga0105239_11184609 | 3300010375 | Bacteria | 880 |
| 270 | Ga0105239_11299434 | 3300010375 | Bacteria | 839 |
| 271 | Ga0105239_11597561 | 3300010375 | Bacteria | 754 |
| 272 | Ga0105246_10118019 | 3300011119 | Bacteria | 1961 |
| 273 | Ga0157317_1006477 | 3300012475 | Bacteria | 818 |
| 274 | Ga0157326_1003753 | 3300012513 | Bacteria | 1594 |
| 275 | Ga0157373_10015634 | 3300013100 | Bacteria | 5543 |
| 276 | Ga0157373_10066327 | 3300013100 | Bacteria | 2554 |
| 277 | Ga0157371_10000290 | 3300013102 | Bacteria | 67914 |
| 278 | Ga0157371_10100385 | 3300013102 | Bacteria | 2053 |
| 279 | Ga0157370_10013637 | 3300013104 | Bacteria | 8362 |
| 280 | Ga0157370_10260172 | 3300013104 | Bacteria | 1604 |
| 281 | Ga0157370_10919005 | 3300013104 | Bacteria | 794 |
| 282 | Ga0157369_10006147 | 3300013105 | Bacteria | 13934 |
| 283 | Ga0157369_10027424 | 3300013105 | Bacteria | 6314 |
| 284 | Ga0157369_10493554 | 3300013105 | Bacteria | 1267 |
| 285 | Ga0157369_11043934 | 3300013105 | Bacteria | 836 |
| 286 | Ga0157369_11240354 | 3300013105 | Bacteria | 761 |
| 287 | Ga0157369_11510405 | 3300013105 | Bacteria | 683 |
| 288 | Ga0157374_10033722 | 3300013296 | Bacteria | 4672 |
| 289 | Ga0157378_10014680 | 3300013297 | Bacteria | 6862 |
| 290 | Ga0157378_10131445 | 3300013297 | Bacteria | 2317 |
| 291 | Ga0157378_10247544 | 3300013297 | Bacteria | 1705 |
| 292 | Ga0163162_10001555 | 3300013306 | Bacteria | 21458 |
| 293 | Ga0163162_10068722 | 3300013306 | Bacteria | 3594 |
| 294 | Ga0163162_10609628 | 3300013306 | Bacteria | 1217 |
| 295 | Ga0157372_10029722 | 3300013307 | Bacteria | 5970 |
| 296 | Ga0157372_10195146 | 3300013307 | Bacteria | 2345 |
| 297 | Ga0157372_10828150 | 3300013307 | Bacteria | 1075 |
| 298 | Ga0157375_10840863 | 3300013308 | Bacteria | 1065 |
| 299 | Ga0163163_10010448 | 3300014325 | Bacteria | 8353 |
| 300 | Ga0163163_10015142 | 3300014325 | Bacteria | 7120 |
| 301 | Ga0163163_10165587 | 3300014325 | Bacteria | 2257 |
| 302 | Ga0157380_10000042 | 3300014326 | Bacteria | 75921 |
| 303 | Ga0157380_10009001 | 3300014326 | Bacteria | 7135 |
| 304 | Ga0157380_10072337 | 3300014326 | Bacteria | 2792 |
| 305 | Ga0157380_10098586 | 3300014326 | Bacteria | 2428 |
| 306 | Ga0157379_10010222 | 3300014968 | Bacteria | 8174 |
| 307 | Ga0157379_10017701 | 3300014968 | Bacteria | 6277 |
| 308 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 309 | Ga0163161_10000044 | 3300017792 | Bacteria | 132739 |
| 310 | Ga0163161_10047151 | 3300017792 | Bacteria | 3112 |
| 311 | Ga0163161_10138163 | 3300017792 | Bacteria | 1843 |
| 312 | Ga0163161_10614660 | 3300017792 | Bacteria | 897 |
| 313 | Ga0213876_10001336 | 3300021384 | Bacteria | 15468 |
| 314 | Ga0213875_10000820 | 3300021388 | Bacteria | 23114 |
| 315 | Ga0207672_1001095 | 3300025223 | Bacteria | 2447 |
| 316 | Ga0209563_100058 | 3300025230 | Bacteria | 302571 |
| 317 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 318 | Ga0207425_1003780 | 3300025245 | Bacteria | 4727 |
| 319 | Ga0209646_1016590 | 3300025246 | Bacteria | 1091 |
| 320 | Ga0209026_1023261 | 3300025250 | Bacteria | 945 |
| 321 | Ga0209677_105890 | 3300025253 | Bacteria | 3067 |
| 322 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 323 | Ga0209129_1001045 | 3300025258 | Bacteria | 16360 |
| 324 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 325 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 326 | Ga0209565_1000272 | 3300025263 | Bacteria | 52468 |
| 327 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 328 | Ga0209455_1008948 | 3300025272 | Bacteria | 2669 |
| 329 | Ga0209673_1001949 | 3300025273 | Bacteria | 16202 |
| 330 | Ga0209673_1002970 | 3300025273 | Bacteria | 10595 |
| 331 | Ga0209675_1000399 | 3300025291 | Bacteria | 36040 |
| 332 | Ga0209675_1008112 | 3300025291 | Bacteria | 3914 |
| 333 | Ga0209676_1000358 | 3300025292 | Bacteria | 86541 |
| 334 | Ga0209676_1000829 | 3300025292 | Bacteria | 40137 |
| 335 | Ga0209676_1001005 | 3300025292 | Bacteria | 33061 |
| 336 | Ga0209025_1001074 | 3300025294 | Bacteria | 39612 |
| 337 | Ga0209025_1017474 | 3300025294 | Bacteria | 4136 |
| 338 | Ga0209564_1000949 | 3300025295 | Bacteria | 37130 |
| 339 | Ga0209564_1038417 | 3300025295 | Bacteria | 1332 |
| 340 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 341 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 342 | Ga0209758_1012238 | 3300025297 | Bacteria | 4826 |
| 343 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 344 | Ga0209050_1000167 | 3300025298 | Bacteria | 151608 |
| 345 | Ga0209050_1000437 | 3300025298 | Bacteria | 76322 |
| 346 | Ga0209050_1004286 | 3300025298 | Bacteria | 9767 |
| 347 | Ga0209050_1020129 | 3300025298 | Bacteria | 2496 |
| 348 | Ga0209050_1040150 | 3300025298 | Bacteria | 1308 |
| 349 | Ga0209050_1040886 | 3300025298 | Bacteria | 1285 |
| 350 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 351 | Ga0207426_1025383 | 3300025302 | Bacteria | 1996 |
| 352 | Ga0209051_1000364 | 3300025303 | Bacteria | 66340 |
| 353 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 354 | Ga0209257_1000328 | 3300025304 | Bacteria | 99542 |
| 355 | Ga0209257_1004831 | 3300025304 | Bacteria | 9988 |
| 356 | Ga0209257_1007735 | 3300025304 | Bacteria | 6402 |
| 357 | Ga0209257_1008403 | 3300025304 | Bacteria | 5880 |
| 358 | Ga0209257_1012636 | 3300025304 | Bacteria | 3873 |
| 359 | Ga0209257_1017646 | 3300025304 | Bacteria | 2798 |
| 360 | Ga0209257_1046897 | 3300025304 | Bacteria | 1246 |
| 361 | Ga0207697_10003772 | 3300025315 | Bacteria | 7401 |
| 362 | Ga0207656_10004100 | 3300025321 | Bacteria | 5057 |
| 363 | Ga0207656_10008193 | 3300025321 | Bacteria | 3835 |
| 364 | Ga0207656_10252561 | 3300025321 | Bacteria | 864 |
| 365 | Ga0207713_1002770 | 3300025735 | Bacteria | 12405 |
| 366 | Ga0207710_10002774 | 3300025900 | Bacteria | 8005 |
| 367 | Ga0207710_10018608 | 3300025900 | Bacteria | 2956 |
| 368 | Ga0207710_10059562 | 3300025900 | Bacteria | 1729 |
| 369 | Ga0207680_10000008 | 3300025903 | Bacteria | 518177 |
| 370 | Ga0207680_10000253 | 3300025903 | Bacteria | 25735 |
| 371 | Ga0207647_10001877 | 3300025904 | Bacteria | 16094 |
| 372 | Ga0207647_10116105 | 3300025904 | Bacteria | 1580 |
| 373 | Ga0207647_10132150 | 3300025904 | Bacteria | 1466 |
| 374 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 375 | Ga0207705_10000103 | 3300025909 | Bacteria | 97511 |
| 376 | Ga0207705_10013836 | 3300025909 | Bacteria | 5819 |
| 377 | Ga0207654_10000150 | 3300025911 | Bacteria | 44134 |
| 378 | Ga0207654_10001270 | 3300025911 | Bacteria | 13439 |
| 379 | Ga0207695_10008046 | 3300025913 | Bacteria | 13275 |
| 380 | Ga0207695_10039997 | 3300025913 | Bacteria | 5034 |
| 381 | Ga0207695_10052087 | 3300025913 | Bacteria | 4291 |
| 382 | Ga0207695_10091029 | 3300025913 | Bacteria | 3065 |
| 383 | Ga0207671_10001574 | 3300025914 | Bacteria | 26006 |
| 384 | Ga0207671_10003457 | 3300025914 | Bacteria | 15723 |
| 385 | Ga0207671_10174640 | 3300025914 | Bacteria | 1670 |
| 386 | Ga0207671_10358640 | 3300025914 | Unclassified | 1157 |
| 387 | Ga0207662_10080808 | 3300025918 | Bacteria | 1984 |
| 388 | Ga0207657_10002670 | 3300025919 | Bacteria | 19230 |
| 389 | Ga0207657_10146650 | 3300025919 | Bacteria | 1924 |
| 390 | Ga0207657_10262423 | 3300025919 | Bacteria | 1374 |
| 391 | Ga0207657_10420358 | 3300025919 | Bacteria | 1051 |
| 392 | Ga0207649_10000016 | 3300025920 | Bacteria | 243843 |
| 393 | Ga0207649_10000660 | 3300025920 | Bacteria | 22994 |
| 394 | Ga0207649_10352116 | 3300025920 | Bacteria | 1090 |
| 395 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 396 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 397 | Ga0207681_10000020 | 3300025923 | Bacteria | 240498 |
| 398 | Ga0207681_10004630 | 3300025923 | Bacteria | 8460 |
| 399 | Ga0207681_10625461 | 3300025923 | Bacteria | 891 |
| 400 | Ga0207694_10003254 | 3300025924 | Bacteria | 12936 |
| 401 | Ga0207694_10046069 | 3300025924 | Bacteria | 3370 |
| 402 | Ga0207694_10048382 | 3300025924 | Bacteria | 3290 |
| 403 | Ga0207694_10104889 | 3300025924 | Bacteria | 2244 |
| 404 | Ga0207694_10156022 | 3300025924 | Bacteria | 1841 |
| 405 | Ga0207694_10774217 | 3300025924 | Bacteria | 810 |
| 406 | Ga0207650_10000023 | 3300025925 | Bacteria | 308148 |
| 407 | Ga0207650_10000354 | 3300025925 | Bacteria | 44199 |
| 408 | Ga0207650_10002062 | 3300025925 | Bacteria | 14048 |
| 409 | Ga0207650_10093199 | 3300025925 | Bacteria | 2305 |
| 410 | Ga0207687_10001020 | 3300025927 | Bacteria | 18993 |
| 411 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 412 | Ga0207644_10000283 | 3300025931 | Bacteria | 33445 |
| 413 | Ga0207644_10008404 | 3300025931 | Bacteria | 6756 |
| 414 | Ga0207690_10012099 | 3300025932 | Bacteria | 5161 |
| 415 | Ga0207690_10033348 | 3300025932 | Bacteria | 3311 |
| 416 | Ga0207690_10285539 | 3300025932 | Bacteria | 1286 |
| 417 | Ga0207706_10010038 | 3300025933 | Bacteria | 8677 |
| 418 | Ga0207706_10051291 | 3300025933 | Bacteria | 3643 |
| 419 | Ga0207706_10263123 | 3300025933 | Bacteria | 1505 |
| 420 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 421 | Ga0207670_10032086 | 3300025936 | Bacteria | 3374 |
| 422 | Ga0207669_10000322 | 3300025937 | Bacteria | 21900 |
| 423 | Ga0207669_10001286 | 3300025937 | Bacteria | 10655 |
| 424 | Ga0207691_10183964 | 3300025940 | Bacteria | 1825 |
| 425 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 426 | Ga0207711_10003287 | 3300025941 | Bacteria | 14053 |
| 427 | Ga0207711_10011919 | 3300025941 | Bacteria | 7225 |
| 428 | Ga0207711_10076009 | 3300025941 | Bacteria | 2924 |
| 429 | Ga0207711_10116915 | 3300025941 | Bacteria | 2378 |
| 430 | Ga0207711_10142200 | 3300025941 | Bacteria | 2159 |
| 431 | Ga0207689_10737011 | 3300025942 | Bacteria | 831 |
| 432 | Ga0207661_10553420 | 3300025944 | Bacteria | 1054 |
| 433 | Ga0207679_10802779 | 3300025945 | Bacteria | 858 |
| 434 | Ga0207679_10911472 | 3300025945 | Bacteria | 804 |
| 435 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 436 | Ga0207667_10000603 | 3300025949 | Bacteria | 46518 |
| 437 | Ga0207667_10024985 | 3300025949 | Bacteria | 6549 |
| 438 | Ga0207667_10357351 | 3300025949 | Bacteria | 1490 |
| 439 | Ga0207667_10823067 | 3300025949 | Bacteria | 924 |
| 440 | Ga0207667_10853012 | 3300025949 | Bacteria | 905 |
| 441 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 442 | Ga0207712_10000009 | 3300025961 | Bacteria | 518177 |
| 443 | Ga0207712_10000510 | 3300025961 | Bacteria | 32303 |
| 444 | Ga0207712_10018856 | 3300025961 | Bacteria | 4499 |
| 445 | Ga0207712_10458833 | 3300025961 | Bacteria | 1082 |
| 446 | Ga0207668_10001363 | 3300025972 | Bacteria | 14427 |
| 447 | Ga0207668_10002028 | 3300025972 | Bacteria | 11816 |
| 448 | Ga0207668_10006578 | 3300025972 | Bacteria | 6869 |
| 449 | Ga0207668_10039903 | 3300025972 | Bacteria | 3164 |
| 450 | Ga0207640_10005130 | 3300025981 | Bacteria | 7124 |
| 451 | Ga0207640_10006365 | 3300025981 | Bacteria | 6476 |
| 452 | Ga0207640_10020510 | 3300025981 | Bacteria | 3925 |
| 453 | Ga0207640_10367889 | 3300025981 | Bacteria | 1161 |
| 454 | Ga0207640_10384262 | 3300025981 | Bacteria | 1138 |
| 455 | Ga0207640_10599555 | 3300025981 | Bacteria | 932 |
| 456 | Ga0207640_10798783 | 3300025981 | Bacteria | 817 |
| 457 | Ga0207640_11174619 | 3300025981 | Bacteria | 681 |
| 458 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 459 | Ga0207658_10000254 | 3300025986 | Bacteria | 55800 |
| 460 | Ga0207658_10001005 | 3300025986 | Bacteria | 23144 |
| 461 | Ga0207658_10001129 | 3300025986 | Bacteria | 21497 |
| 462 | Ga0207658_10001394 | 3300025986 | Bacteria | 18834 |
| 463 | Ga0207658_10001522 | 3300025986 | Bacteria | 18013 |
| 464 | Ga0207658_10302095 | 3300025986 | Bacteria | 1379 |
| 465 | Ga0207703_10000108 | 3300026035 | Bacteria | 97908 |
| 466 | Ga0207703_10000845 | 3300026035 | Bacteria | 30089 |
| 467 | Ga0207703_10001794 | 3300026035 | Bacteria | 19143 |
| 468 | Ga0207703_10002095 | 3300026035 | Bacteria | 17541 |
| 469 | Ga0207703_10007252 | 3300026035 | Bacteria | 8815 |
| 470 | Ga0207639_10001679 | 3300026041 | Bacteria | 14938 |
| 471 | Ga0207639_10003338 | 3300026041 | Bacteria | 10793 |
| 472 | Ga0207639_10021197 | 3300026041 | Bacteria | 4664 |
| 473 | Ga0207639_10035037 | 3300026041 | Bacteria | 3714 |
| 474 | Ga0207639_10137934 | 3300026041 | Bacteria | 2028 |
| 475 | Ga0207639_10430236 | 3300026041 | Bacteria | 1195 |
| 476 | Ga0207678_10048806 | 3300026067 | Bacteria | 3658 |
| 477 | Ga0207678_10111417 | 3300026067 | Bacteria | 2335 |
| 478 | Ga0207678_10303638 | 3300026067 | Bacteria | 1372 |
| 479 | Ga0207702_10000723 | 3300026078 | Bacteria | 35400 |
| 480 | Ga0207702_10026646 | 3300026078 | Bacteria | 4799 |
| 481 | Ga0207702_10065672 | 3300026078 | Bacteria | 3108 |
| 482 | Ga0207702_10093967 | 3300026078 | Bacteria | 2631 |
| 483 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 484 | Ga0207641_10000346 | 3300026088 | Bacteria | 55535 |
| 485 | Ga0207641_10000386 | 3300026088 | Bacteria | 52430 |
| 486 | Ga0207641_10013111 | 3300026088 | Bacteria | 6797 |
| 487 | Ga0207641_10017585 | 3300026088 | Bacteria | 5853 |
| 488 | Ga0207641_10056278 | 3300026088 | Bacteria | 3341 |
| 489 | Ga0207648_10647762 | 3300026089 | Bacteria | 976 |
| 490 | Ga0207676_10000017 | 3300026095 | Bacteria | 308709 |
| 491 | Ga0207676_10000137 | 3300026095 | Bacteria | 63867 |
| 492 | Ga0207676_10000276 | 3300026095 | Bacteria | 44706 |
| 493 | Ga0207676_10001455 | 3300026095 | Bacteria | 17617 |
| 494 | Ga0207676_10003438 | 3300026095 | Bacteria | 11204 |
| 495 | Ga0207676_10022019 | 3300026095 | Bacteria | 4683 |
| 496 | Ga0207674_10010611 | 3300026116 | Bacteria | 10420 |
| 497 | Ga0207674_10025744 | 3300026116 | Bacteria | 6265 |
| 498 | Ga0207674_10066737 | 3300026116 | Bacteria | 3623 |
| 499 | Ga0207674_10074826 | 3300026116 | Bacteria | 3397 |
| 500 | Ga0207674_10578482 | 3300026116 | Bacteria | 1085 |
| 501 | Ga0207674_10659422 | 3300026116 | Bacteria | 1010 |
| 502 | Ga0207675_100000110 | 3300026118 | Bacteria | 66177 |
| 503 | Ga0207675_100000280 | 3300026118 | Bacteria | 48895 |
| 504 | Ga0207675_100000329 | 3300026118 | Bacteria | 45296 |
| 505 | Ga0207675_100689672 | 3300026118 | Bacteria | 1030 |
| 506 | Ga0207683_10001013 | 3300026121 | Bacteria | 25627 |
| 507 | Ga0207683_10196466 | 3300026121 | Bacteria | 1833 |
| 508 | Ga0207698_10005044 | 3300026142 | Bacteria | 8100 |
| 509 | Ga0207698_10006839 | 3300026142 | Bacteria | 7136 |
| 510 | Ga0207698_10057071 | 3300026142 | Bacteria | 3018 |
| 511 | Ga0207698_10116692 | 3300026142 | Bacteria | 2250 |
| 512 | Ga0207698_10384683 | 3300026142 | Bacteria | 1336 |
| 513 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 514 | Ga0268266_10000074 | 3300028379 | Bacteria | 230993 |
| 515 | Ga0268266_10241808 | 3300028379 | Bacteria | 1666 |
| 516 | Ga0268266_10399215 | 3300028379 | Unclassified | 1300 |
| 517 | Ga0268266_10497953 | 3300028379 | Unclassified | 1163 |
| 518 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 519 | Ga0268265_10000058 | 3300028380 | Bacteria | 154702 |
| 520 | Ga0268265_10000097 | 3300028380 | Bacteria | 110755 |
| 521 | Ga0268265_10000149 | 3300028380 | Bacteria | 86376 |
| 522 | Ga0268265_10000607 | 3300028380 | Bacteria | 35893 |
| 523 | Ga0268265_10001059 | 3300028380 | Bacteria | 24670 |
| 524 | Ga0268265_10121344 | 3300028380 | Bacteria | 2154 |
| 525 | Ga0268265_10192792 | 3300028380 | Bacteria | 1761 |
| 526 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 527 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 528 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 529 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 530 | Ga0268264_10000634 | 3300028381 | Bacteria | 41826 |
| 531 | Ga0307517_10013945 | 3300028786 | Bacteria | 10858 |
| 532 | Ga0307517_10044893 | 3300028786 | Bacteria | 4660 |
| 533 | Ga0307517_10231038 | 3300028786 | Bacteria | 1110 |
| 534 | Ga0307513_10049071 | 3300031456 | Bacteria | 4575 |
| 535 | Ga0307513_10052452 | 3300031456 | Bacteria | 4392 |
| 536 | Ga0307509_10042055 | 3300031507 | Bacteria | 4954 |
| 537 | Ga0307408_100008545 | 3300031548 | Bacteria | 6762 |
| 538 | Ga0307408_100008592 | 3300031548 | Bacteria | 6745 |
| 539 | Ga0307408_100366558 | 3300031548 | Bacteria | 1227 |
| 540 | Ga0307408_100409157 | 3300031548 | Bacteria | 1167 |
| 541 | Ga0307408_100633645 | 3300031548 | Bacteria | 954 |
| 542 | Ga0307408_100676087 | 3300031548 | Bacteria | 925 |
| 543 | Ga0307508_10005032 | 3300031616 | Bacteria | 12703 |
| 544 | Ga0307405_10041988 | 3300031731 | Bacteria | 2781 |
| 545 | Ga0307405_10137760 | 3300031731 | Bacteria | 1697 |
| 546 | Ga0307405_10285238 | 3300031731 | Bacteria | 1245 |
| 547 | Ga0307405_10355492 | 3300031731 | Bacteria | 1131 |
| 548 | Ga0307405_10491549 | 3300031731 | Bacteria | 982 |
| 549 | Ga0307405_10574013 | 3300031731 | Bacteria | 916 |
| 550 | Ga0307413_10034190 | 3300031824 | Bacteria | 2903 |
| 551 | Ga0307410_10376873 | 3300031852 | Bacteria | 1141 |
| 552 | Ga0307406_10002345 | 3300031901 | Bacteria | 10289 |
| 553 | Ga0307406_10138671 | 3300031901 | Bacteria | 1718 |
| 554 | Ga0307406_10400810 | 3300031901 | Bacteria | 1087 |
| 555 | Ga0307412_10000342 | 3300031911 | Bacteria | 29331 |
| 556 | Ga0307412_10003855 | 3300031911 | Bacteria | 8336 |
| 557 | Ga0307412_10014907 | 3300031911 | Bacteria | 4595 |
| 558 | Ga0307412_10026822 | 3300031911 | Bacteria | 3586 |
| 559 | Ga0307412_10052383 | 3300031911 | Bacteria | 2702 |
| 560 | Ga0307412_10064718 | 3300031911 | Bacteria | 2471 |
| 561 | Ga0307412_10065516 | 3300031911 | Bacteria | 2459 |
| 562 | Ga0307412_10157651 | 3300031911 | Bacteria | 1682 |
| 563 | Ga0307416_100110021 | 3300032002 | Bacteria | 2425 |
| 564 | Ga0307416_100532938 | 3300032002 | Bacteria | 1245 |
| 565 | Ga0307416_101011654 | 3300032002 | Bacteria | 934 |
| 566 | Ga0307414_10000239 | 3300032004 | Bacteria | 34941 |
| 567 | Ga0307414_10009181 | 3300032004 | Bacteria | 5665 |
| 568 | Ga0307414_10018842 | 3300032004 | Bacteria | 4262 |
| 569 | Ga0307414_10023279 | 3300032004 | Bacteria | 3926 |
| 570 | Ga0307414_10356668 | 3300032004 | Bacteria | 1257 |
| 571 | Ga0307414_10407337 | 3300032004 | Bacteria | 1183 |
| 572 | Ga0307414_10419870 | 3300032004 | Bacteria | 1166 |
| 573 | Ga0307414_10503440 | 3300032004 | Bacteria | 1072 |
| 574 | Ga0307411_10049357 | 3300032005 | Bacteria | 2734 |
| 575 | Ga0307411_10356223 | 3300032005 | Bacteria | 1195 |
| 576 | Ga0307510_10005677 | 3300033180 | Bacteria | 14872 |
| 577 | Ga0307510_10033362 | 3300033180 | Bacteria | 5782 |
| 578 | Ga0373923_0185193 | 3300035111 | Unclassified | 958 |
| 579 | Ga0373954_0032080 | 3300035118 | Bacteria | 2428 |
| 580 | Ga0373927_0096292 | 3300035695 | Bacteria | 1924 |
| 581 | Ga0373937_0432554 | 3300036401 | Bacteria | 1249 |
| 582 | Ga0395900_1030673 | 3300037418 | Bacteria | 742 |
| 583 | Ga0395905_0096269 | 3300037471 | Bacteria | 2779 |
| 584 | Ga0395905_0447278 | 3300037471 | Bacteria | 1190 |
| 585 | Ga0395905_1334915 | 3300037471 | Unclassified | 621 |
| 586 | Ga0436364_0752226 | 3300037853 | Bacteria | 1979 |
| 587 | Ga0436364_1409528 | 3300037853 | Bacteria | 22143 |
| 588 | Ga0395901_0029420 | 3300038443 | Bacteria | 5657 |
| 589 | Ga0395901_0040961 | 3300038443 | Bacteria | 4799 |
| 590 | Ga0395901_1258397 | 3300038443 | Bacteria | 703 |
| 591 | Ga0237819_03124 | 3300038705 | Bacteria | 3030 |
| 592 | Ga0436365_0062931 | 3300039437 | Bacteria | 52276 |
| 593 | Ga0436365_0340026 | 3300039437 | Bacteria | 1680 |
| 594 | Ga0436363_0901981 | 3300039450 | Bacteria | 1091 |
| 595 | Ga0439439_0064079 | 3300041406 | Bacteria | 979 |
| 596 | Ga0439465_0000267 | 3300041413 | Bacteria | 14538 |
| 597 | Ga0439465_0001572 | 3300041413 | Bacteria | 7418 |
| 598 | Ga0451789_0057199 | 3300041443 | Bacteria | 828 |
| 599 | Ga0451800_0410130 | 3300041459 | Bacteria | 728 |
| 600 | Ga0451802_2041707 | 3300041460 | Bacteria | 809 |
| 601 | Ga0451853_2935544 | 3300041512 | Bacteria | 701 |
| 602 | Ga0439431_0000273 | 3300041997 | Bacteria | 10607 |
| 603 | Ga0439431_0014648 | 3300041997 | Bacteria | 1819 |
| 604 | Ga0439442_009040 | 3300042002 | Bacteria | 2014 |
| 605 | Ga0439445_0000417 | 3300042004 | Bacteria | 8552 |
| 606 | Ga0439445_0008347 | 3300042004 | Bacteria | 2421 |
| 607 | Ga0439445_0024060 | 3300042004 | Bacteria | 1545 |
| 608 | Ga0439432_002453 | 3300042006 | Bacteria | 6983 |
| 609 | Ga0439449_0045533 | 3300042007 | Bacteria | 1626 |
| 610 | Ga0439452_020562 | 3300042010 | Bacteria | 1730 |
| 611 | Ga0439457_014047 | 3300042014 | Bacteria | 1795 |
| 612 | Ga0439462_0004232 | 3300042015 | Bacteria | 3491 |
| 613 | Ga0439446_0043431 | 3300042156 | Bacteria | 1328 |
| 614 | Ga0439434_0000488 | 3300042435 | Bacteria | 11259 |
| 615 | Ga0451577_1286555 | 3300042876 | Bacteria | 651 |
| 616 | Ga0451576_0005491 | 3300045051 | Bacteria | 15866 |
| 617 | Ga0495627_005422 | 3300046453 | Bacteria | 5143 |
| 618 | Ga0495590_0280425 | 3300046457 | Bacteria | 624 |
| 619 | Ga0495638_0000014 | 3300046460 | Bacteria | 417060 |
| 620 | Ga0495638_0000732 | 3300046460 | Bacteria | 35317 |
| 621 | Ga0495638_0004896 | 3300046460 | Bacteria | 10068 |
| 622 | Ga0495638_0054875 | 3300046460 | Bacteria | 2476 |
| 623 | Ga0495638_0238855 | 3300046460 | Bacteria | 1007 |
| 624 | Ga0495650_0000196 | 3300046471 | Bacteria | 131306 |
| 625 | Ga0495639_0354264 | 3300046475 | Bacteria | 737 |
| 626 | Ga0495662_0508846 | 3300046476 | Bacteria | 590 |
| 627 | Ga0495585_0000620 | 3300046492 | Bacteria | 33105 |
| 628 | Ga0495585_0039871 | 3300046492 | Bacteria | 2639 |
| 629 | Ga0495596_0028535 | 3300046500 | Bacteria | 2240 |
| 630 | Ga0495607_0037621 | 3300046501 | Bacteria | 2905 |
| 631 | Ga0495583_0000406 | 3300046506 | Bacteria | 65391 |
| 632 | Ga0495583_0000557 | 3300046506 | Bacteria | 52013 |
| 633 | Ga0495583_0001125 | 3300046506 | Bacteria | 29400 |
| 634 | Ga0495583_0007101 | 3300046506 | Bacteria | 7155 |
| 635 | Ga0495583_0015490 | 3300046506 | Bacteria | 4144 |
| 636 | Ga0495583_0046112 | 3300046506 | Bacteria | 2011 |
| 637 | Ga0495583_0087721 | 3300046506 | Bacteria | 1344 |
| 638 | Ga0495606_0000259 | 3300046507 | Bacteria | 93403 |
| 639 | Ga0495606_0000497 | 3300046507 | Bacteria | 64227 |
| 640 | Ga0495606_0022207 | 3300046507 | Bacteria | 4629 |
| 641 | Ga0495631_0085611 | 3300046518 | Bacteria | 1358 |
| 642 | Ga0495632_0000446 | 3300046519 | Bacteria | 39306 |
| 643 | Ga0495632_0188767 | 3300046519 | Bacteria | 942 |
| 644 | Ga0495637_0010269 | 3300046520 | Bacteria | 4535 |
| 645 | Ga0495637_0020660 | 3300046520 | Bacteria | 3027 |
| 646 | Ga0495637_0078074 | 3300046520 | Bacteria | 1324 |
| 647 | Ga0495643_0002033 | 3300046522 | Bacteria | 16829 |
| 648 | Ga0495643_0004844 | 3300046522 | Bacteria | 9274 |
| 649 | Ga0495643_0005462 | 3300046522 | Bacteria | 8595 |
| 650 | Ga0495643_0044540 | 3300046522 | Bacteria | 2411 |
| 651 | Ga0495643_0058007 | 3300046522 | Bacteria | 2061 |
| 652 | Ga0495648_0000021 | 3300046524 | Bacteria | 246945 |
| 653 | Ga0495648_0000114 | 3300046524 | Bacteria | 98677 |
| 654 | Ga0495648_0020266 | 3300046524 | Bacteria | 4642 |
| 655 | Ga0495648_0065607 | 3300046524 | Bacteria | 2133 |
| 656 | Ga0495648_0098124 | 3300046524 | Bacteria | 1623 |
| 657 | Ga0495663_0000369 | 3300046525 | Bacteria | 16622 |
| 658 | Ga0495663_0070503 | 3300046525 | Bacteria | 1112 |
| 659 | Ga0495642_0040137 | 3300046528 | Bacteria | 1900 |
| 660 | Ga0495654_0001113 | 3300046530 | Bacteria | 19393 |
| 661 | Ga0495654_0096529 | 3300046530 | Bacteria | 1366 |
| 662 | Ga0495609_0294533 | 3300046538 | Bacteria | 662 |
| 663 | Ga0495597_0013437 | 3300046542 | Bacteria | 3922 |
| 664 | Ga0495597_0103983 | 3300046542 | Bacteria | 1195 |
| 665 | Ga0495622_0021745 | 3300046557 | Bacteria | 2987 |
| 666 | Ga0495622_0033946 | 3300046557 | Bacteria | 2381 |
| 667 | Ga0495622_0067429 | 3300046557 | Bacteria | 1653 |
| 668 | Ga0495633_0000207 | 3300046558 | Bacteria | 74645 |
| 669 | Ga0495633_0010366 | 3300046558 | Bacteria | 5091 |
| 670 | Ga0495668_0000022 | 3300046616 | Bacteria | 363999 |
| 671 | Ga0495668_0000387 | 3300046616 | Bacteria | 58040 |
| 672 | Ga0495668_0012858 | 3300046616 | Bacteria | 4955 |
| 673 | Ga0495668_0017893 | 3300046616 | Bacteria | 4105 |
| 674 | Ga0495668_0042229 | 3300046616 | Bacteria | 2539 |
| 675 | Ga0495668_0069004 | 3300046616 | Bacteria | 1944 |
| 676 | Ga0495611_0002606 | 3300046648 | Bacteria | 8162 |
| 677 | Ga0495611_0052799 | 3300046648 | Bacteria | 1834 |
| 678 | Ga0495611_0129649 | 3300046648 | Bacteria | 1176 |
| 679 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 680 | Ga0495625_0000588 | 3300046660 | Bacteria | 52820 |
| 681 | Ga0495625_0002611 | 3300046660 | Bacteria | 19281 |
| 682 | Ga0495625_0002676 | 3300046660 | Bacteria | 18953 |
| 683 | Ga0495625_0011605 | 3300046660 | Bacteria | 7168 |
| 684 | Ga0495625_0013677 | 3300046660 | Bacteria | 6508 |
| 685 | Ga0495625_0270528 | 3300046660 | Bacteria | 1096 |
| 686 | Ga0495625_0448300 | 3300046660 | Bacteria | 798 |
| 687 | Ga0495661_0092822 | 3300046665 | Bacteria | 1714 |
| 688 | Ga0495661_0102062 | 3300046665 | Bacteria | 1613 |
| 689 | Ga0495669_0000047 | 3300046684 | Bacteria | 82672 |
| 690 | Ga0495669_0041952 | 3300046684 | Bacteria | 2033 |
| 691 | Ga0495670_0000016 | 3300046691 | Bacteria | 128045 |
| 692 | Ga0495670_0002882 | 3300046691 | Bacteria | 8474 |
| 693 | Ga0495670_0011648 | 3300046691 | Bacteria | 4327 |
| 694 | Ga0495670_0014291 | 3300046691 | Bacteria | 3905 |
| 695 | Ga0495671_0000028 | 3300046692 | Bacteria | 234938 |
| 696 | Ga0495671_0007026 | 3300046692 | Bacteria | 6452 |
| 697 | Ga0495671_0015741 | 3300046692 | Bacteria | 4046 |
| 698 | Ga0495671_0043874 | 3300046692 | Bacteria | 2244 |
| 699 | Ga0495671_0131335 | 3300046692 | Bacteria | 1221 |
| 700 | Ga0495671_0361940 | 3300046692 | Bacteria | 695 |
| 701 | Ga0495649_0228736 | 3300046694 | Bacteria | 960 |
| 702 | Ga0495589_0076479 | 3300046794 | Bacteria | 1632 |
| 703 | Ga0495600_0038150 | 3300046809 | Bacteria | 3125 |
| 704 | Ga0495660_0044172 | 3300046810 | Bacteria | 2453 |
| 705 | Ga0495660_0164844 | 3300046810 | Bacteria | 1084 |
| 706 | Ga0495683_0013776 | 3300047323 | Bacteria | 4221 |
| 707 | Ga0495687_000043 | 3300047443 | Bacteria | 216711 |
| 708 | Ga0495687_002080 | 3300047443 | Bacteria | 16814 |
| 709 | Ga0495677_0003536 | 3300047445 | Bacteria | 6063 |
| 710 | Ga0495673_0000058 | 3300047469 | Bacteria | 235044 |
| 711 | Ga0495673_0013172 | 3300047469 | Bacteria | 4353 |
| 712 | Ga0495681_0005101 | 3300047470 | Bacteria | 8854 |
| 713 | Ga0495686_0000139 | 3300047472 | Bacteria | 145796 |
| 714 | Ga0495686_0000523 | 3300047472 | Bacteria | 55456 |
| 715 | Ga0495686_0001582 | 3300047472 | Bacteria | 24064 |
| 716 | Ga0495686_0010788 | 3300047472 | Bacteria | 6479 |
| 717 | Ga0496100_0191427 | 3300048903 | Bacteria | 1485 |
| 718 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 719 | Ga0496102_0000034 | 3300048905 | Bacteria | 213826 |
| 720 | Ga0496102_0025183 | 3300048905 | Bacteria | 5293 |
| 721 | Ga0496102_0146484 | 3300048905 | Bacteria | 2216 |
| 722 | Ga0496102_0225699 | 3300048905 | Bacteria | 1766 |
| 723 | Ga0496102_0832373 | 3300048905 | Bacteria | 845 |
| 724 | Ga0496103_0000026 | 3300048906 | Bacteria | 213826 |
| 725 | Ga0496103_0000075 | 3300048906 | Bacteria | 114569 |
| 726 | Ga0496103_0002036 | 3300048906 | Bacteria | 12973 |
| 727 | Ga0496103_0014765 | 3300048906 | Bacteria | 4642 |
| 728 | Ga0496103_0460315 | 3300048906 | Unclassified | 816 |
| 729 | Ga0496104_0003920 | 3300048907 | Bacteria | 12878 |
| 730 | Ga0496104_0125628 | 3300048907 | Bacteria | 2463 |
| 731 | Ga0496105_0000847 | 3300048908 | Bacteria | 20846 |
| 732 | Ga0496105_0066116 | 3300048908 | Bacteria | 2984 |
| 733 | Ga0496107_0059004 | 3300048910 | Bacteria | 2776 |
| 734 | Ga0496107_0060780 | 3300048910 | Bacteria | 2735 |
| 735 | Ga0496108_0674775 | 3300048911 | Bacteria | 897 |
| 736 | Ga0496109_0230113 | 3300048912 | Bacteria | 1744 |
| 737 | Ga0496111_0018587 | 3300048914 | Bacteria | 4816 |
| 738 | Ga0496113_0030152 | 3300048916 | Bacteria | 3924 |
| 739 | Ga0496114_0006903 | 3300048917 | Bacteria | 8945 |
| 740 | Ga0496115_0000029 | 3300048918 | Bacteria | 141359 |
| 741 | Ga0496115_0000304 | 3300048918 | Bacteria | 41844 |
| 742 | Ga0496115_0256703 | 3300048918 | Bacteria | 1438 |
| 743 | Ga0496116_0001435 | 3300048919 | Bacteria | 26777 |
| 744 | Ga0496116_0002308 | 3300048919 | Bacteria | 20225 |
| 745 | Ga0496116_0020839 | 3300048919 | Bacteria | 4965 |
| 746 | Ga0496116_0290060 | 3300048919 | Bacteria | 786 |
| 747 | Ga0496117_0000072 | 3300048920 | Bacteria | 238366 |
| 748 | Ga0496117_0000260 | 3300048920 | Bacteria | 99636 |
| 749 | Ga0496117_0004000 | 3300048920 | Bacteria | 16644 |
| 750 | Ga0496117_0005912 | 3300048920 | Bacteria | 12633 |
| 751 | Ga0496117_0009616 | 3300048920 | Bacteria | 8952 |
| 752 | Ga0496117_0061114 | 3300048920 | Bacteria | 2592 |
| 753 | Ga0496117_0434779 | 3300048920 | Bacteria | 653 |
| 754 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 755 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 756 | Ga0496118_0002183 | 3300048921 | Bacteria | 27245 |
| 757 | Ga0496118_0002784 | 3300048921 | Bacteria | 22888 |
| 758 | Ga0496118_0030499 | 3300048921 | Bacteria | 4498 |
| 759 | Ga0496119_0011873 | 3300048922 | Bacteria | 7151 |
| 760 | Ga0496119_0019906 | 3300048922 | Bacteria | 4917 |
| 761 | Ga0496120_0011696 | 3300048923 | Bacteria | 6020 |
| 762 | Ga0496121_0000269 | 3300048924 | Bacteria | 108869 |
| 763 | Ga0496121_0255892 | 3300048924 | Bacteria | 1212 |
| 764 | Ga0496122_0000359 | 3300048925 | Bacteria | 97927 |
| 765 | Ga0496122_0072028 | 3300048925 | Bacteria | 2459 |
| 766 | Ga0496122_0114676 | 3300048925 | Bacteria | 1757 |
| 767 | Ga0496122_0173154 | 3300048925 | Bacteria | 1298 |
| 768 | Ga0496123_0002200 | 3300048926 | Bacteria | 24799 |
| 769 | Ga0496123_0010124 | 3300048926 | Bacteria | 8381 |
| 770 | Ga0496123_0017074 | 3300048926 | Bacteria | 5860 |
| 771 | Ga0496123_0071430 | 3300048926 | Bacteria | 2165 |
| 772 | Ga0496123_0113147 | 3300048926 | Bacteria | 1546 |
| 773 | Ga0496123_0134808 | 3300048926 | Bacteria | 1361 |
| 774 | Ga0496124_0000061 | 3300048927 | Bacteria | 238225 |
| 775 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 776 | Ga0496124_0000972 | 3300048927 | Bacteria | 45648 |
| 777 | Ga0496124_0009807 | 3300048927 | Bacteria | 9795 |
| 778 | Ga0496124_0060812 | 3300048927 | Bacteria | 3168 |
| 779 | Ga0496124_0210206 | 3300048927 | Bacteria | 1473 |
| 780 | Ga0496124_0259721 | 3300048927 | Bacteria | 1279 |
| 781 | Ga0496124_0366393 | 3300048927 | Bacteria | 1013 |
| 782 | Ga0496124_0384241 | 3300048927 | Bacteria | 981 |
| 783 | Ga0496125_0000505 | 3300048928 | Bacteria | 67726 |
| 784 | Ga0496125_0048947 | 3300048928 | Bacteria | 3518 |
| 785 | Ga0496125_0180549 | 3300048928 | Bacteria | 1407 |
| 786 | Ga0496125_0342270 | 3300048928 | Bacteria | 897 |
| 787 | Ga0496125_0392358 | 3300048928 | Bacteria | 814 |
| 788 | Ga0496125_0423031 | 3300048928 | Bacteria | 771 |
| 789 | Ga0496125_0424528 | 3300048928 | Bacteria | 769 |
| 790 | Ga0496126_0000469 | 3300048929 | Bacteria | 80156 |
| 791 | Ga0496126_0072263 | 3300048929 | Bacteria | 3069 |
| 792 | Ga0496126_0142042 | 3300048929 | Bacteria | 2066 |
| 793 | Ga0496126_0181775 | 3300048929 | Bacteria | 1786 |
| 794 | Ga0495678_067352 | 3300049459 | Bacteria | 1323 |
| 795 | Ga0495678_089306 | 3300049459 | Bacteria | 1089 |
| 796 | Ga0495682_0005472 | 3300049460 | Bacteria | 5269 |
| 797 | Ga0501290_010424 | 3300049513 | Bacteria | 1188 |
| 798 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 799 | Ga0501293_014882 | 3300049516 | Bacteria | 711 |
| 800 | Ga0501294_001507 | 3300049517 | Bacteria | 2331 |
| 801 | Ga0501300_000435 | 3300049523 | Bacteria | 6338 |
| 802 | Ga0501300_006309 | 3300049523 | Bacteria | 1747 |
| 803 | Ga0501031_0063333 | 3300049568 | Bacteria | 2409 |
| 804 | Ga0501032_0010092 | 3300049569 | Bacteria | 6817 |
| 805 | Ga0501032_0116551 | 3300049569 | Bacteria | 1766 |
| 806 | Ga0501033_0086928 | 3300049570 | Bacteria | 2288 |
| 807 | Ga0501033_0108351 | 3300049570 | Bacteria | 2023 |
| 808 | Ga0501034_0008195 | 3300049571 | Bacteria | 11079 |
| 809 | Ga0501034_0027966 | 3300049571 | Bacteria | 5734 |
| 810 | Ga0501034_0051809 | 3300049571 | Bacteria | 4138 |
| 811 | Ga0501034_0169871 | 3300049571 | Bacteria | 2148 |
| 812 | Ga0501036_0147928 | 3300049572 | Bacteria | 1981 |
| 813 | Ga0501036_0515586 | 3300049572 | Bacteria | 994 |
| 814 | Ga0501037_0635499 | 3300049573 | Bacteria | 714 |
| 815 | Ga0501038_0022352 | 3300049574 | Bacteria | 5669 |
| 816 | Ga0501039_0530071 | 3300049575 | Bacteria | 924 |
| 817 | Ga0501043_0057451 | 3300049579 | Bacteria | 3055 |
| 818 | Ga0501043_0135872 | 3300049579 | Bacteria | 1926 |
| 819 | Ga0501046_0132703 | 3300049580 | Bacteria | 1888 |
| 820 | Ga0501047_0001517 | 3300049581 | Bacteria | 22668 |
| 821 | Ga0501047_0200828 | 3300049581 | Bacteria | 1855 |
| 822 | Ga0501047_0372518 | 3300049581 | Bacteria | 1263 |
| 823 | Ga0501048_0119258 | 3300049582 | Bacteria | 1864 |
| 824 | Ga0501198_038966 | 3300049649 | Bacteria | 818 |
| 825 | Ga0501202_003716 | 3300049652 | Bacteria | 2629 |
| 826 | Ga0501206_004721 | 3300049653 | Bacteria | 1741 |
| 827 | Ga0501207_014963 | 3300049654 | Bacteria | 1190 |
| 828 | Ga0501222_000605 | 3300049662 | Bacteria | 5260 |
| 829 | Ga0501223_000090 | 3300049663 | Bacteria | 26538 |
| 830 | Ga0501223_002495 | 3300049663 | Bacteria | 4074 |
| 831 | Ga0501224_000025 | 3300049664 | Bacteria | 56130 |
| 832 | Ga0501224_001119 | 3300049664 | Bacteria | 3492 |
| 833 | Ga0501227_002177 | 3300049665 | Bacteria | 4333 |
| 834 | Ga0501233_000238 | 3300049668 | Bacteria | 8300 |
| 835 | Ga0501235_043485 | 3300049669 | Bacteria | 1031 |
| 836 | Ga0501242_023965 | 3300049674 | Bacteria | 798 |
| 837 | Ga0501249_000067 | 3300049679 | Bacteria | 37308 |
| 838 | Ga0501257_000019 | 3300049686 | Bacteria | 47149 |
| 839 | Ga0501257_009301 | 3300049686 | Bacteria | 2217 |
| 840 | Ga0501259_000022 | 3300049688 | Bacteria | 22627 |
| 841 | Ga0501261_000007 | 3300049690 | Bacteria | 60773 |
| 842 | Ga0501221_002092 | 3300049704 | Bacteria | 3321 |
| 843 | Ga0501221_017434 | 3300049704 | Bacteria | 1371 |
| 844 | Ga0501225_0000115 | 3300049705 | Bacteria | 24964 |
| 845 | Ga0501234_000307 | 3300049707 | Bacteria | 7144 |
| 846 | Ga0501245_017803 | 3300049708 | Bacteria | 1087 |
| 847 | Ga0501279_000082 | 3300049775 | Bacteria | 15759 |
| 848 | Ga0501280_000047 | 3300049776 | Bacteria | 35975 |
| 849 | Ga0501280_000638 | 3300049776 | Bacteria | 7890 |
| 850 | Ga0501281_00165 | 3300049777 | Bacteria | 7693 |
| 851 | Ga0501282_000814 | 3300049778 | Bacteria | 3580 |
| 852 | Ga0501035_0076990 | 3300049822 | Bacteria | 2948 |
| 853 | Ga0501035_0217406 | 3300049822 | Bacteria | 1633 |
| 854 | Ga0501035_0296075 | 3300049822 | Bacteria | 1364 |
| 855 | Ga0501035_0531848 | 3300049822 | Bacteria | 965 |
| 856 | Ga0501044_0153977 | 3300049823 | Bacteria | 2279 |
| 857 | Ga0501044_0232027 | 3300049823 | Bacteria | 1792 |
| 858 | Ga0501226_000020 | 3300049853 | Bacteria | 141193 |
| 859 | nmdc:mga0k408_167288_c1 | 3300050493 | Bacteria | 1310 |
| 860 | nmdc:mga07m45_62558_c1 | 3300050496 | Bacteria | 1663 |
| 861 | Ga0500610_0000075 | 3300053079 | Bacteria | 30153 |
| 862 | Ga0500643_000293 | 3300053087 | Bacteria | 42902 |
| 863 | Ga0500643_000709 | 3300053087 | Bacteria | 22105 |
| 864 | Ga0500643_000824 | 3300053087 | Bacteria | 20040 |
| 865 | Ga0500643_000847 | 3300053087 | Bacteria | 19541 |
| 866 | Ga0500643_017589 | 3300053087 | Bacteria | 2391 |
| 867 | Ga0500647_0067941 | 3300053091 | Bacteria | 1714 |
| 868 | Ga0500583_0330907 | 3300053092 | Bacteria | 741 |
| 869 | Ga0500651_0071175 | 3300053093 | Bacteria | 2164 |
| 870 | Ga0500566_0015005 | 3300053094 | Bacteria | 4549 |
| 871 | Ga0500566_0050704 | 3300053094 | Bacteria | 2376 |
| 872 | Ga0500641_0014638 | 3300053096 | Bacteria | 2897 |
| 873 | Ga0500641_0062406 | 3300053096 | Bacteria | 1554 |
| 874 | Ga0500555_000708 | 3300053103 | Bacteria | 12614 |
| 875 | Ga0500556_0081715 | 3300053104 | Bacteria | 1222 |
| 876 | Ga0500562_128708 | 3300053108 | Bacteria | 690 |
| 877 | Ga0500592_000543 | 3300053116 | Bacteria | 6225 |
| 878 | Ga0500592_000812 | 3300053116 | Bacteria | 5113 |
| 879 | Ga0500592_004915 | 3300053116 | Bacteria | 2122 |
| 880 | Ga0500592_015284 | 3300053116 | Bacteria | 1231 |
| 881 | Ga0500592_023894 | 3300053116 | Bacteria | 985 |
| 882 | Ga0500594_0008100 | 3300053118 | Bacteria | 2390 |
| 883 | Ga0500594_0020557 | 3300053118 | Bacteria | 1648 |
| 884 | Ga0500595_000789 | 3300053119 | Bacteria | 18477 |
| 885 | Ga0500595_004048 | 3300053119 | Bacteria | 6670 |
| 886 | Ga0500595_047484 | 3300053119 | Bacteria | 1345 |
| 887 | Ga0500597_002858 | 3300053120 | Bacteria | 4935 |
| 888 | Ga0500614_029717 | 3300053123 | Bacteria | 1328 |
| 889 | Ga0500618_011159 | 3300053125 | Bacteria | 2392 |
| 890 | Ga0500642_0002794 | 3300053130 | Bacteria | 5177 |
| 891 | Ga0500652_173387 | 3300053131 | Bacteria | 887 |
| 892 | Ga0500655_000411 | 3300053133 | Bacteria | 8997 |
| 893 | Ga0500658_0010536 | 3300053134 | Bacteria | 3409 |
| 894 | Ga0500658_0018148 | 3300053134 | Bacteria | 2634 |
| 895 | Ga0500658_0027407 | 3300053134 | Bacteria | 2203 |
| 896 | Ga0500658_0168690 | 3300053134 | Bacteria | 993 |
| 897 | Ga0500658_0343353 | 3300053134 | Bacteria | 685 |
| 898 | Ga0500559_0001245 | 3300053136 | Bacteria | 14977 |
| 899 | Ga0500559_0019742 | 3300053136 | Bacteria | 2848 |
| 900 | Ga0500559_0026803 | 3300053136 | Bacteria | 2457 |
| 901 | Ga0500568_0003154 | 3300053139 | Bacteria | 9393 |
| 902 | Ga0500568_0020227 | 3300053139 | Bacteria | 2882 |
| 903 | Ga0500568_0025795 | 3300053139 | Bacteria | 2474 |
| 904 | Ga0500568_0047498 | 3300053139 | Bacteria | 1700 |
| 905 | Ga0500568_0075216 | 3300053139 | Bacteria | 1288 |
| 906 | Ga0500573_0000041 | 3300053140 | Bacteria | 103805 |
| 907 | Ga0500590_002280 | 3300053148 | Bacteria | 8425 |
| 908 | Ga0500604_0030240 | 3300053151 | Bacteria | 1583 |
| 909 | Ga0500604_0164895 | 3300053151 | Bacteria | 756 |
| 910 | Ga0500616_0112681 | 3300053153 | Bacteria | 1311 |
| 911 | Ga0500616_0145388 | 3300053153 | Bacteria | 1103 |
| 912 | Ga0500624_000004 | 3300053157 | Bacteria | 196921 |
| 913 | Ga0500624_000095 | 3300053157 | Bacteria | 43267 |
| 914 | Ga0500624_016035 | 3300053157 | Bacteria | 1152 |
| 915 | Ga0500627_0000056 | 3300053158 | Bacteria | 53879 |
| 916 | Ga0500627_0000374 | 3300053158 | Bacteria | 12179 |
| 917 | Ga0500627_0000418 | 3300053158 | Bacteria | 11489 |
| 918 | Ga0500627_0036703 | 3300053158 | Bacteria | 2088 |
| 919 | Ga0500627_0105744 | 3300053158 | Bacteria | 1265 |
| 920 | Ga0500627_0155528 | 3300053158 | Bacteria | 1032 |
| 921 | Ga0500627_0165050 | 3300053158 | Bacteria | 999 |
| 922 | Ga0500636_0004155 | 3300053177 | Bacteria | 8192 |
| 923 | Ga0500636_0019811 | 3300053177 | Bacteria | 3978 |
| 924 | Ga0500636_0043398 | 3300053177 | Bacteria | 2655 |
| 925 | Ga0500636_0135147 | 3300053177 | Bacteria | 1370 |
| 926 | Ga0500637_0000454 | 3300053178 | Bacteria | 15762 |
| 927 | Ga0500570_000528 | 3300053724 | Bacteria | 14985 |
| 928 | Ga0500611_001307 | 3300053727 | Bacteria | 2703 |
| 929 | Ga0500645_000038 | 3300053730 | Bacteria | 112786 |
| 930 | Ga0500645_003201 | 3300053730 | Bacteria | 6792 |
| 931 | Ga0500645_103965 | 3300053730 | Bacteria | 799 |
| 932 | Ga0500596_000565 | 3300053735 | Bacteria | 7056 |
| 933 | Ga0500601_012482 | 3300053737 | Bacteria | 960 |
| 934 | 2585263300 | 2582581305 | Bacteria | 4895574 |
| 935 | 2600203137 | 2599185354 | Bacteria | 4398675 |
| 936 | 2600227134 | 2599185359 | Bacteria | 4772316 |
| 937 | 2643727822 | 2643221541 | Bacteria | 5498788 |
| 938 | 2643835339 | 2643221563 | Bacteria | 4726935 |
| 939 | 2644038937 | 2643221605 | Bacteria | 4772303 |
| 940 | 2644043228 | 2643221606 | Bacteria | 5588032 |
| 941 | 2644056265 | 2643221608 | Bacteria | 4724829 |
| 942 | 2644127386 | 2643221622 | Bacteria | 4212502 |
| 943 | 2644395341 | 2643221671 | Bacteria | 5496681 |
| 944 | 2753766557 | 2751185897 | Bacteria | 5322941 |
| 945 | 2819715414 | 2818991466 | Bacteria | 4748179 |
| 946 | 2830075873 | 2830075706 | Bacteria | 3855215 |
| 947 | 2852654927 | 2852653556 | Bacteria | 4050083 |
| 948 | 2852681730 | 2852680915 | Bacteria | 4100189 |
| 949 | 2879163245 | 2879163058 | Bacteria | 4223965 |
| 950 | 2885432402 | 2885429604 | Bacteria | 3642894 |
| 951 | 2928530843 | 2928526807 | Bacteria | 4760224 |
| 952 | 2928971083 | 2928968154 | Bacteria | 4633371 |
| 953 | 2946790433 | 2946787523 | Bacteria | 4366789 |
| 954 | 2990268352 | 2990265787 | Bacteria | 3943888 |
| 955 | 2993696616 | 2993693658 | Bacteria | 4040749 |
| 956 | 8057105483 | 8057101203 | Bacteria | 5034064 |
| 957 | Ga0105248_10000113 | |||
| 958 | SwRhRL3b_contig_2766702 | |||
| 959 | ARcpr5yngRDRAFT_c000749 | |||
| 960 | JGI24736J21556_1000083 | |||
| 961 | JGI24741J21665_1004664 | |||
| 962 | JGI24741J21665_1016602 | |||
| 963 | JGI24752J21851_1000379 | |||
| 964 | JGI24752J21851_1002368 | |||
| 965 | JGI24740J21852_10005913 | |||
| 966 | JGI24740J21852_10016144 | |||
| 967 | JGI24740J21852_10017375 | |||
| 968 | JGI24739J22299_10006876 | |||
| 969 | JGI24739J22299_10008728 | |||
| 970 | JGI24739J22299_10020919 | |||
| 971 | JGI24737J22298_10022130 | |||
| 972 | JGI24737J22298_10076137 | |||
| 973 | JGI24737J22298_10082606 | |||
| 974 | JGI24735J21928_10001347 | |||
| 975 | JGI24750J21931_1001923 | |||
| 976 | JGI24750J21931_1027918 | |||
| 977 | JGI24748J21848_1000124 | |||
| 978 | JGI24738J21930_10000970 | |||
| 979 | JGI24738J21930_10020685 | |||
| 980 | JGI24749J21850_1000179 | |||
| 981 | JGI24749J21850_1000879 | |||
| 982 | JGI24749J21850_1030677 | |||
| 983 | JGI24744J21845_10057570 | |||
| 984 | JGI24034J26672_10000048 | |||
| 985 | JGI24034J26672_10013219 | |||
| 986 | JGI24742J22300_10004390 | |||
| 987 | JGI24751J29686_10000022 | |||
| 988 | JGI24751J29686_10008525 | |||
| 989 | JGI24751J29686_10009785 | |||
| 990 | JGI25150J39212_1000336 | |||
| 991 | JGI25165J46597_1000010 | |||
| 992 | JGI25153J46596_10000045 | |||
| 993 | JGI25153J46596_10000055 | |||
| 994 | JGI25153J46596_10003282 | |||
| 995 | rootH2_10053686 | |||
| 996 | rootH1_10009798 | |||
| 997 | rootH1_10239172 | |||
| 998 | Ga0055539_1017913 | |||
| 999 | Ga0055525_1000080 | |||
| 1000 | Ga0055542_1000012 | |||
| 1001 | Ga0055529_1000002 | |||
| 1002 | Ga0055529_1000004 | |||
| 1003 | Ga0055526_1005851 | |||
| 1004 | Ga0055537_1003306 | |||
| 1005 | Ga0055524_1000405 | |||
| 1006 | Ga0055536_1002944 | |||
| 1007 | Ga0055536_1010300 | |||
| 1008 | Ga0055536_1019463 | |||
| 1009 | Ga0055534_1014749 | |||
| 1010 | Ga0055530_10000203 | |||
| 1011 | Ga0055530_10000915 | |||
| 1012 | Ga0055530_10006827 | |||
| 1013 | Ga0055530_10009074 | |||
| 1014 | Ga0055540_1004237 | |||
| 1015 | Ga0055531_10001375 | |||
| 1016 | Ga0055531_10005683 | |||
| 1017 | Ga0055531_10005973 | |||
| 1018 | Ga0055531_10006693 | |||
| 1019 | Ga0055531_10078366 | |||
| 1020 | Ga0055543_1034130 | |||
| 1021 | Ga0065165_1004742 | |||
| 1022 | Ga0065165_1018884 | |||
| 1023 | Ga0065707_10082321 | |||
| 1024 | Ga0065707_10250722 | |||
| 1025 | Ga0065707_10309846 | |||
| 1026 | Ga0065707_10316426 | |||
| 1027 | Ga0070658_10000003 | |||
| 1028 | Ga0070658_10002437 | |||
| 1029 | Ga0070658_10100600 | |||
| 1030 | Ga0070658_10359976 | |||
| 1031 | Ga0070676_10020378 | |||
| 1032 | Ga0070683_100104667 | |||
| 1033 | Ga0070683_100108350 | |||
| 1034 | Ga0070683_100577103 | |||
| 1035 | Ga0070690_100000016 | |||
| 1036 | Ga0070670_100000006 | |||
| 1037 | Ga0070670_100000292 | |||
| 1038 | Ga0070670_100002143 | |||
| 1039 | Ga0070670_100002325 | |||
| 1040 | Ga0070670_100061762 | |||
| 1041 | Ga0068869_100725405 | |||
| 1042 | Ga0068869_100897459 | |||
| 1043 | Ga0070666_10000011 | |||
| 1044 | Ga0070666_10000829 | |||
| 1045 | Ga0070682_100509515 | |||
| 1046 | Ga0070660_100002821 | |||
| 1047 | Ga0070660_100047738 | |||
| 1048 | Ga0070660_100309086 | |||
| 1049 | Ga0070660_100811019 | |||
| 1050 | Ga0070689_100045939 | |||
| 1051 | Ga0070687_100040703 | |||
| 1052 | Ga0070661_100000261 | |||
| 1053 | Ga0070661_100027201 | |||
| 1054 | Ga0070661_100085227 | |||
| 1055 | Ga0070661_100374564 | |||
| 1056 | Ga0070692_10005410 | |||
| 1057 | Ga0070668_100002152 | |||
| 1058 | Ga0070668_100004339 | |||
| 1059 | Ga0070668_100007957 | |||
| 1060 | Ga0070669_100000004 | |||
| 1061 | Ga0070669_100000009 | |||
| 1062 | Ga0070669_100000036 | |||
| 1063 | Ga0070669_100049847 | |||
| 1064 | Ga0070675_100985551 | |||
| 1065 | Ga0070671_100000004 | |||
| 1066 | Ga0070671_100000273 | |||
| 1067 | Ga0070671_100039735 | |||
| 1068 | Ga0070671_100094914 | |||
| 1069 | Ga0070671_100549088 | |||
| 1070 | Ga0070674_100001683 | |||
| 1071 | Ga0070674_100030244 | |||
| 1072 | Ga0070673_100248365 | |||
| 1073 | Ga0070673_100617176 | |||
| 1074 | Ga0070688_100001707 | |||
| 1075 | Ga0070688_101066772 | |||
| 1076 | Ga0070659_100001775 | |||
| 1077 | Ga0070659_100264976 | |||
| 1078 | Ga0070659_100727003 | |||
| 1079 | Ga0070667_100000298 | |||
| 1080 | Ga0070667_100000398 | |||
| 1081 | Ga0070667_100000415 | |||
| 1082 | Ga0070667_100002347 | |||
| 1083 | Ga0070667_100179436 | |||
| 1084 | Ga0070667_100256711 | |||
| 1085 | Ga0070705_100005751 | |||
| 1086 | Ga0070663_100046814 | |||
| 1087 | Ga0070663_100329966 | |||
| 1088 | Ga0070678_100000679 | |||
| 1089 | Ga0070678_100124729 | |||
| 1090 | Ga0070662_100043140 | |||
| 1091 | Ga0070662_100160195 | |||
| 1092 | Ga0070681_11001110 | |||
| 1093 | Ga0068867_100169110 | |||
| 1094 | Ga0068867_101393210 | |||
| 1095 | Ga0070685_10000186 | |||
| 1096 | Ga0070679_100199935 | |||
| 1097 | Ga0070679_100671658 | |||
| 1098 | Ga0070684_100093789 | |||
| 1099 | Ga0068853_100004467 | |||
| 1100 | Ga0068853_100016381 | |||
| 1101 | Ga0068853_100081684 | |||
| 1102 | Ga0068853_100467353 | |||
| 1103 | Ga0068853_100894298 | |||
| 1104 | Ga0070686_100000001 | |||
| 1105 | Ga0070665_100000004 | |||
| 1106 | Ga0070665_100000088 | |||
| 1107 | Ga0070665_100332902 | |||
| 1108 | Ga0070665_100471593 | |||
| 1109 | Ga0070665_100511047 | |||
| 1110 | Ga0070665_100667779 | |||
| 1111 | Ga0068855_100000667 | |||
| 1112 | Ga0068855_100099751 | |||
| 1113 | Ga0068855_100250360 | |||
| 1114 | Ga0068855_100346840 | |||
| 1115 | Ga0068855_101055868 | |||
| 1116 | Ga0068857_100017231 | |||
| 1117 | Ga0068857_100043041 | |||
| 1118 | Ga0068857_100204800 | |||
| 1119 | Ga0068857_100380072 | |||
| 1120 | Ga0068857_100555250 | |||
| 1121 | Ga0068854_100008336 | |||
| 1122 | Ga0068854_100074397 | |||
| 1123 | Ga0068854_100083318 | |||
| 1124 | Ga0068854_100908063 | |||
| 1125 | Ga0068856_100100701 | |||
| 1126 | Ga0068856_100123778 | |||
| 1127 | Ga0068852_100086066 | |||
| 1128 | Ga0068852_100090931 | |||
| 1129 | Ga0068852_100117605 | |||
| 1130 | Ga0068852_100160386 | |||
| 1131 | Ga0068859_100001079 | |||
| 1132 | Ga0068859_100003565 | |||
| 1133 | Ga0068859_100006631 | |||
| 1134 | Ga0068859_100007071 | |||
| 1135 | Ga0068859_100028197 | |||
| 1136 | Ga0068859_100948772 | |||
| 1137 | Ga0068864_100000014 | |||
| 1138 | Ga0068864_100000300 | |||
| 1139 | Ga0068864_100000544 | |||
| 1140 | Ga0068864_100001484 | |||
| 1141 | Ga0068864_100009598 | |||
| 1142 | Ga0068864_100014481 | |||
| 1143 | Ga0068861_100000203 | |||
| 1144 | Ga0068861_100003016 | |||
| 1145 | Ga0068861_100031375 | |||
| 1146 | Ga0068861_100434862 | |||
| 1147 | Ga0068851_10019572 | |||
| 1148 | Ga0068851_10077021 | |||
| 1149 | Ga0068851_10295787 | |||
| 1150 | Ga0068863_100000010 | |||
| 1151 | Ga0068863_100000073 | |||
| 1152 | Ga0068863_100015329 | |||
| 1153 | Ga0068863_100025444 | |||
| 1154 | Ga0068863_100053484 | |||
| 1155 | Ga0068858_100000360 | |||
| 1156 | Ga0068858_100000487 | |||
| 1157 | Ga0068858_100000782 | |||
| 1158 | Ga0068858_100000957 | |||
| 1159 | Ga0068858_100001582 | |||
| 1160 | Ga0068858_100072688 | |||
| 1161 | Ga0068860_100000030 | |||
| 1162 | Ga0068860_100000143 | |||
| 1163 | Ga0068860_100000412 | |||
| 1164 | Ga0068860_100001278 | |||
| 1165 | Ga0068860_100007681 | |||
| 1166 | Ga0068862_100000007 | |||
| 1167 | Ga0068862_100000014 | |||
| 1168 | Ga0068862_100000431 | |||
| 1169 | Ga0068862_100000462 | |||
| 1170 | Ga0068862_100000716 | |||
| 1171 | Ga0068862_100000810 | |||
| 1172 | Ga0068862_100012378 | |||
| 1173 | Ga0068862_100096973 | |||
| 1174 | Ga0068862_100292157 | |||
| 1175 | Ga0081455_10000405 | |||
| 1176 | Ga0075364_10061051 | |||
| 1177 | Ga0075366_10104846 | |||
| 1178 | Ga0075366_10445365 | |||
| 1179 | Ga0097621_100193783 | |||
| 1180 | Ga0097621_100385789 | |||
| 1181 | Ga0075370_10026022 | |||
| 1182 | Ga0075370_10174138 | |||
| 1183 | Ga0068871_100315503 | |||
| 1184 | Ga0068871_100784643 | |||
| 1185 | Ga0075429_100216459 | |||
| 1186 | Ga0097620_100001079 | |||
| 1187 | Ga0097620_100003566 | |||
| 1188 | Ga0097620_100006631 | |||
| 1189 | Ga0097620_100007071 | |||
| 1190 | Ga0097620_100028198 | |||
| 1191 | Ga0097620_100948790 | |||
| 1192 | Ga0105251_10000296 | |||
| 1193 | Ga0105251_10176357 | |||
| 1194 | Ga0105240_10110084 | |||
| 1195 | Ga0105240_10114767 | |||
| 1196 | Ga0105240_10445502 | |||
| 1197 | Ga0105240_10502904 | |||
| 1198 | Ga0105245_10005729 | |||
| 1199 | Ga0105247_10000874 | |||
| 1200 | Ga0105247_10024765 | |||
| 1201 | Ga0105247_10108150 | |||
| 1202 | Ga0105243_10001945 | |||
| 1203 | Ga0105241_10012572 | |||
| 1204 | Ga0105241_10077684 | |||
| 1205 | Ga0105241_10640398 | |||
| 1206 | Ga0105248_10000029 | |||
| 1207 | Ga0105248_10056147 | |||
| 1208 | Ga0105248_10123446 | |||
| 1209 | Ga0105248_10144662 | |||
| 1210 | Ga0105248_10222120 | |||
| 1211 | Ga0105248_10805215 | |||
| 1212 | Ga0105237_10009797 | |||
| 1213 | Ga0105237_10035288 | |||
| 1214 | Ga0105237_10951022 | |||
| 1215 | Ga0105238_10116166 | |||
| 1216 | Ga0105238_10226626 | |||
| 1217 | Ga0105238_11111161 | |||
| 1218 | Ga0105249_10000002 | |||
| 1219 | Ga0105249_10000016 | |||
| 1220 | Ga0105249_10000024 | |||
| 1221 | Ga0105249_10014933 | |||
| 1222 | Ga0105249_10687866 | |||
| 1223 | Ga0105239_10145283 | |||
| 1224 | Ga0105239_10332665 | |||
| 1225 | Ga0105239_11184609 | |||
| 1226 | Ga0105239_11299434 | |||
| 1227 | Ga0105239_11597561 | |||
| 1228 | Ga0105246_10118019 | |||
| 1229 | Ga0157317_1006477 | |||
| 1230 | Ga0157326_1003753 | |||
| 1231 | Ga0157373_10015634 | |||
| 1232 | Ga0157373_10066327 | |||
| 1233 | Ga0157371_10000290 | |||
| 1234 | Ga0157371_10100385 | |||
| 1235 | Ga0157370_10013637 | |||
| 1236 | Ga0157370_10260172 | |||
| 1237 | Ga0157370_10919005 | |||
| 1238 | Ga0157369_10006147 | |||
| 1239 | Ga0157369_10027424 | |||
| 1240 | Ga0157369_10493554 | |||
| 1241 | Ga0157369_11043934 | |||
| 1242 | Ga0157369_11240354 | |||
| 1243 | Ga0157369_11510405 | |||
| 1244 | Ga0157374_10033722 | |||
| 1245 | Ga0157378_10014680 | |||
| 1246 | Ga0157378_10131445 | |||
| 1247 | Ga0157378_10247544 | |||
| 1248 | Ga0163162_10001555 | |||
| 1249 | Ga0163162_10068722 | |||
| 1250 | Ga0163162_10609628 | |||
| 1251 | Ga0157372_10029722 | |||
| 1252 | Ga0157372_10195146 | |||
| 1253 | Ga0157372_10828150 | |||
| 1254 | Ga0157375_10840863 | |||
| 1255 | Ga0163163_10010448 | |||
| 1256 | Ga0163163_10015142 | |||
| 1257 | Ga0163163_10165587 | |||
| 1258 | Ga0157380_10000042 | |||
| 1259 | Ga0157380_10009001 | |||
| 1260 | Ga0157380_10072337 | |||
| 1261 | Ga0157380_10098586 | |||
| 1262 | Ga0157379_10010222 | |||
| 1263 | Ga0157379_10017701 | |||
| 1264 | Ga0183363_1003 | |||
| 1265 | Ga0163161_10000044 | |||
| 1266 | Ga0163161_10047151 | |||
| 1267 | Ga0163161_10138163 | |||
| 1268 | Ga0163161_10614660 | |||
| 1269 | Ga0213876_10001336 | |||
| 1270 | Ga0213875_10000820 | |||
| 1271 | Ga0207672_1001095 | |||
| 1272 | Ga0209563_100058 | |||
| 1273 | Ga0207425_1000005 | |||
| 1274 | Ga0207425_1003780 | |||
| 1275 | Ga0209646_1016590 | |||
| 1276 | Ga0209026_1023261 | |||
| 1277 | Ga0209677_105890 | |||
| 1278 | Ga0209148_1000008 | |||
| 1279 | Ga0209129_1001045 | |||
| 1280 | Ga0209233_1000044 | |||
| 1281 | Ga0209565_1000029 | |||
| 1282 | Ga0209565_1000272 | |||
| 1283 | Ga0209455_1000002 | |||
| 1284 | Ga0209455_1008948 | |||
| 1285 | Ga0209673_1001949 | |||
| 1286 | Ga0209673_1002970 | |||
| 1287 | Ga0209675_1000399 | |||
| 1288 | Ga0209675_1008112 | |||
| 1289 | Ga0209676_1000358 | |||
| 1290 | Ga0209676_1000829 | |||
| 1291 | Ga0209676_1001005 | |||
| 1292 | Ga0209025_1001074 | |||
| 1293 | Ga0209025_1017474 | |||
| 1294 | Ga0209564_1000949 | |||
| 1295 | Ga0209564_1038417 | |||
| 1296 | Ga0209758_1000002 | |||
| 1297 | Ga0209758_1000007 | |||
| 1298 | Ga0209758_1012238 | |||
| 1299 | Ga0209050_1000001 | |||
| 1300 | Ga0209050_1000167 | |||
| 1301 | Ga0209050_1000437 | |||
| 1302 | Ga0209050_1004286 | |||
| 1303 | Ga0209050_1020129 | |||
| 1304 | Ga0209050_1040150 | |||
| 1305 | Ga0209050_1040886 | |||
| 1306 | Ga0209256_1000008 | |||
| 1307 | Ga0207426_1025383 | |||
| 1308 | Ga0209051_1000364 | |||
| 1309 | Ga0209257_1000028 | |||
| 1310 | Ga0209257_1000328 | |||
| 1311 | Ga0209257_1004831 | |||
| 1312 | Ga0209257_1007735 | |||
| 1313 | Ga0209257_1008403 | |||
| 1314 | Ga0209257_1012636 | |||
| 1315 | Ga0209257_1017646 | |||
| 1316 | Ga0209257_1046897 | |||
| 1317 | Ga0207697_10003772 | |||
| 1318 | Ga0207656_10004100 | |||
| 1319 | Ga0207656_10008193 | |||
| 1320 | Ga0207656_10252561 | |||
| 1321 | Ga0207713_1002770 | |||
| 1322 | Ga0207710_10002774 | |||
| 1323 | Ga0207710_10018608 | |||
| 1324 | Ga0207710_10059562 | |||
| 1325 | Ga0207680_10000008 | |||
| 1326 | Ga0207680_10000253 | |||
| 1327 | Ga0207647_10001877 | |||
| 1328 | Ga0207647_10116105 | |||
| 1329 | Ga0207647_10132150 | |||
| 1330 | Ga0207705_10000005 | |||
| 1331 | Ga0207705_10000103 | |||
| 1332 | Ga0207705_10013836 | |||
| 1333 | Ga0207654_10000150 | |||
| 1334 | Ga0207654_10001270 | |||
| 1335 | Ga0207695_10008046 | |||
| 1336 | Ga0207695_10039997 | |||
| 1337 | Ga0207695_10052087 | |||
| 1338 | Ga0207695_10091029 | |||
| 1339 | Ga0207671_10001574 | |||
| 1340 | Ga0207671_10003457 | |||
| 1341 | Ga0207671_10174640 | |||
| 1342 | Ga0207671_10358640 | |||
| 1343 | Ga0207662_10080808 | |||
| 1344 | Ga0207657_10002670 | |||
| 1345 | Ga0207657_10146650 | |||
| 1346 | Ga0207657_10262423 | |||
| 1347 | Ga0207657_10420358 | |||
| 1348 | Ga0207649_10000016 | |||
| 1349 | Ga0207649_10000660 | |||
| 1350 | Ga0207649_10352116 | |||
| 1351 | Ga0207681_10000001 | |||
| 1352 | Ga0207681_10000010 | |||
| 1353 | Ga0207681_10000020 | |||
| 1354 | Ga0207681_10004630 | |||
| 1355 | Ga0207681_10625461 | |||
| 1356 | Ga0207694_10003254 | |||
| 1357 | Ga0207694_10046069 | |||
| 1358 | Ga0207694_10048382 | |||
| 1359 | Ga0207694_10104889 | |||
| 1360 | Ga0207694_10156022 | |||
| 1361 | Ga0207694_10774217 | |||
| 1362 | Ga0207650_10000023 | |||
| 1363 | Ga0207650_10000354 | |||
| 1364 | Ga0207650_10002062 | |||
| 1365 | Ga0207650_10093199 | |||
| 1366 | Ga0207687_10001020 | |||
| 1367 | Ga0207644_10000007 | |||
| 1368 | Ga0207644_10000283 | |||
| 1369 | Ga0207644_10008404 | |||
| 1370 | Ga0207690_10012099 | |||
| 1371 | Ga0207690_10033348 | |||
| 1372 | Ga0207690_10285539 | |||
| 1373 | Ga0207706_10010038 | |||
| 1374 | Ga0207706_10051291 | |||
| 1375 | Ga0207706_10263123 | |||
| 1376 | Ga0207709_10000005 | |||
| 1377 | Ga0207670_10032086 | |||
| 1378 | Ga0207669_10000322 | |||
| 1379 | Ga0207669_10001286 | |||
| 1380 | Ga0207691_10183964 | |||
| 1381 | Ga0207711_10000004 | |||
| 1382 | Ga0207711_10003287 | |||
| 1383 | Ga0207711_10011919 | |||
| 1384 | Ga0207711_10076009 | |||
| 1385 | Ga0207711_10116915 | |||
| 1386 | Ga0207711_10142200 | |||
| 1387 | Ga0207689_10737011 | |||
| 1388 | Ga0207661_10553420 | |||
| 1389 | Ga0207679_10802779 | |||
| 1390 | Ga0207679_10911472 | |||
| 1391 | Ga0207667_10000001 | |||
| 1392 | Ga0207667_10000603 | |||
| 1393 | Ga0207667_10024985 | |||
| 1394 | Ga0207667_10357351 | |||
| 1395 | Ga0207667_10823067 | |||
| 1396 | Ga0207667_10853012 | |||
| 1397 | Ga0207712_10000002 | |||
| 1398 | Ga0207712_10000009 | |||
| 1399 | Ga0207712_10000510 | |||
| 1400 | Ga0207712_10018856 | |||
| 1401 | Ga0207712_10458833 | |||
| 1402 | Ga0207668_10001363 | |||
| 1403 | Ga0207668_10002028 | |||
| 1404 | Ga0207668_10006578 | |||
| 1405 | Ga0207668_10039903 | |||
| 1406 | Ga0207640_10005130 | |||
| 1407 | Ga0207640_10006365 | |||
| 1408 | Ga0207640_10020510 | |||
| 1409 | Ga0207640_10367889 | |||
| 1410 | Ga0207640_10384262 | |||
| 1411 | Ga0207640_10599555 | |||
| 1412 | Ga0207640_10798783 | |||
| 1413 | Ga0207640_11174619 | |||
| 1414 | Ga0207658_10000026 | |||
| 1415 | Ga0207658_10000254 | |||
| 1416 | Ga0207658_10001005 | |||
| 1417 | Ga0207658_10001129 | |||
| 1418 | Ga0207658_10001394 | |||
| 1419 | Ga0207658_10001522 | |||
| 1420 | Ga0207658_10302095 | |||
| 1421 | Ga0207703_10000108 | |||
| 1422 | Ga0207703_10000845 | |||
| 1423 | Ga0207703_10001794 | |||
| 1424 | Ga0207703_10002095 | |||
| 1425 | Ga0207703_10007252 | |||
| 1426 | Ga0207639_10001679 | |||
| 1427 | Ga0207639_10003338 | |||
| 1428 | Ga0207639_10021197 | |||
| 1429 | Ga0207639_10035037 | |||
| 1430 | Ga0207639_10137934 | |||
| 1431 | Ga0207639_10430236 | |||
| 1432 | Ga0207678_10048806 | |||
| 1433 | Ga0207678_10111417 | |||
| 1434 | Ga0207678_10303638 | |||
| 1435 | Ga0207702_10000723 | |||
| 1436 | Ga0207702_10026646 | |||
| 1437 | Ga0207702_10065672 | |||
| 1438 | Ga0207702_10093967 | |||
| 1439 | Ga0207641_10000018 | |||
| 1440 | Ga0207641_10000346 | |||
| 1441 | Ga0207641_10000386 | |||
| 1442 | Ga0207641_10013111 | |||
| 1443 | Ga0207641_10017585 | |||
| 1444 | Ga0207641_10056278 | |||
| 1445 | Ga0207648_10647762 | |||
| 1446 | Ga0207676_10000017 | |||
| 1447 | Ga0207676_10000137 | |||
| 1448 | Ga0207676_10000276 | |||
| 1449 | Ga0207676_10001455 | |||
| 1450 | Ga0207676_10003438 | |||
| 1451 | Ga0207676_10022019 | |||
| 1452 | Ga0207674_10010611 | |||
| 1453 | Ga0207674_10025744 | |||
| 1454 | Ga0207674_10066737 | |||
| 1455 | Ga0207674_10074826 | |||
| 1456 | Ga0207674_10578482 | |||
| 1457 | Ga0207674_10659422 | |||
| 1458 | Ga0207675_100000110 | |||
| 1459 | Ga0207675_100000280 | |||
| 1460 | Ga0207675_100000329 | |||
| 1461 | Ga0207675_100689672 | |||
| 1462 | Ga0207683_10001013 | |||
| 1463 | Ga0207683_10196466 | |||
| 1464 | Ga0207698_10005044 | |||
| 1465 | Ga0207698_10006839 | |||
| 1466 | Ga0207698_10057071 | |||
| 1467 | Ga0207698_10116692 | |||
| 1468 | Ga0207698_10384683 | |||
| 1469 | Ga0268266_10000009 | |||
| 1470 | Ga0268266_10000074 | |||
| 1471 | Ga0268266_10241808 | |||
| 1472 | Ga0268266_10399215 | |||
| 1473 | Ga0268266_10497953 | |||
| 1474 | Ga0268265_10000002 | |||
| 1475 | Ga0268265_10000058 | |||
| 1476 | Ga0268265_10000097 | |||
| 1477 | Ga0268265_10000149 | |||
| 1478 | Ga0268265_10000607 | |||
| 1479 | Ga0268265_10001059 | |||
| 1480 | Ga0268265_10121344 | |||
| 1481 | Ga0268265_10192792 | |||
| 1482 | Ga0268264_10000003 | |||
| 1483 | Ga0268264_10000076 | |||
| 1484 | Ga0268264_10000083 | |||
| 1485 | Ga0268264_10000106 | |||
| 1486 | Ga0268264_10000634 | |||
| 1487 | Ga0307517_10013945 | |||
| 1488 | Ga0307517_10044893 | |||
| 1489 | Ga0307517_10231038 | |||
| 1490 | Ga0307513_10049071 | |||
| 1491 | Ga0307513_10052452 | |||
| 1492 | Ga0307509_10042055 | |||
| 1493 | Ga0307408_100008545 | |||
| 1494 | Ga0307408_100008592 | |||
| 1495 | Ga0307408_100366558 | |||
| 1496 | Ga0307408_100409157 | |||
| 1497 | Ga0307408_100633645 | |||
| 1498 | Ga0307408_100676087 | |||
| 1499 | Ga0307508_10005032 | |||
| 1500 | Ga0307405_10041988 | |||
| 1501 | Ga0307405_10137760 | |||
| 1502 | Ga0307405_10285238 | |||
| 1503 | Ga0307405_10355492 | |||
| 1504 | Ga0307405_10491549 | |||
| 1505 | Ga0307405_10574013 | |||
| 1506 | Ga0307413_10034190 | |||
| 1507 | Ga0307410_10376873 | |||
| 1508 | Ga0307406_10002345 | |||
| 1509 | Ga0307406_10138671 | |||
| 1510 | Ga0307406_10400810 | |||
| 1511 | Ga0307412_10000342 | |||
| 1512 | Ga0307412_10003855 | |||
| 1513 | Ga0307412_10014907 | |||
| 1514 | Ga0307412_10026822 | |||
| 1515 | Ga0307412_10052383 | |||
| 1516 | Ga0307412_10064718 | |||
| 1517 | Ga0307412_10065516 | |||
| 1518 | Ga0307412_10157651 | |||
| 1519 | Ga0307416_100110021 | |||
| 1520 | Ga0307416_100532938 | |||
| 1521 | Ga0307416_101011654 | |||
| 1522 | Ga0307414_10000239 | |||
| 1523 | Ga0307414_10009181 | |||
| 1524 | Ga0307414_10018842 | |||
| 1525 | Ga0307414_10023279 | |||
| 1526 | Ga0307414_10356668 | |||
| 1527 | Ga0307414_10407337 | |||
| 1528 | Ga0307414_10419870 | |||
| 1529 | Ga0307414_10503440 | |||
| 1530 | Ga0307411_10049357 | |||
| 1531 | Ga0307411_10356223 | |||
| 1532 | Ga0307510_10005677 | |||
| 1533 | Ga0307510_10033362 | |||
| 1534 | Ga0373923_0185193 | |||
| 1535 | Ga0373954_0032080 | |||
| 1536 | Ga0373927_0096292 | |||
| 1537 | Ga0373937_0432554 | |||
| 1538 | Ga0395900_1030673 | |||
| 1539 | Ga0395905_0096269 | |||
| 1540 | Ga0395905_0447278 | |||
| 1541 | Ga0395905_1334915 | |||
| 1542 | Ga0436364_0752226 | |||
| 1543 | Ga0436364_1409528 | |||
| 1544 | Ga0395901_0029420 | |||
| 1545 | Ga0395901_0040961 | |||
| 1546 | Ga0395901_1258397 | |||
| 1547 | Ga0237819_03124 | |||
| 1548 | Ga0436365_0062931 | |||
| 1549 | Ga0436365_0340026 | |||
| 1550 | Ga0436363_0901981 | |||
| 1551 | Ga0439439_0064079 | |||
| 1552 | Ga0439465_0000267 | |||
| 1553 | Ga0439465_0001572 | |||
| 1554 | Ga0451789_0057199 | |||
| 1555 | Ga0451800_0410130 | |||
| 1556 | Ga0451802_2041707 | |||
| 1557 | Ga0451853_2935544 | |||
| 1558 | Ga0439431_0000273 | |||
| 1559 | Ga0439431_0014648 | |||
| 1560 | Ga0439442_009040 | |||
| 1561 | Ga0439445_0000417 | |||
| 1562 | Ga0439445_0008347 | |||
| 1563 | Ga0439445_0024060 | |||
| 1564 | Ga0439432_002453 | |||
| 1565 | Ga0439449_0045533 | |||
| 1566 | Ga0439452_020562 | |||
| 1567 | Ga0439457_014047 | |||
| 1568 | Ga0439462_0004232 | |||
| 1569 | Ga0439446_0043431 | |||
| 1570 | Ga0439434_0000488 | |||
| 1571 | Ga0451577_1286555 | |||
| 1572 | Ga0451576_0005491 | |||
| 1573 | Ga0495627_005422 | |||
| 1574 | Ga0495590_0280425 | |||
| 1575 | Ga0495638_0000014 | |||
| 1576 | Ga0495638_0000732 | |||
| 1577 | Ga0495638_0004896 | |||
| 1578 | Ga0495638_0054875 | |||
| 1579 | Ga0495638_0238855 | |||
| 1580 | Ga0495650_0000196 | |||
| 1581 | Ga0495639_0354264 | |||
| 1582 | Ga0495662_0508846 | |||
| 1583 | Ga0495585_0000620 | |||
| 1584 | Ga0495585_0039871 | |||
| 1585 | Ga0495596_0028535 | |||
| 1586 | Ga0495607_0037621 | |||
| 1587 | Ga0495583_0000406 | |||
| 1588 | Ga0495583_0000557 | |||
| 1589 | Ga0495583_0001125 | |||
| 1590 | Ga0495583_0007101 | |||
| 1591 | Ga0495583_0015490 | |||
| 1592 | Ga0495583_0046112 | |||
| 1593 | Ga0495583_0087721 | |||
| 1594 | Ga0495606_0000259 | |||
| 1595 | Ga0495606_0000497 | |||
| 1596 | Ga0495606_0022207 | |||
| 1597 | Ga0495631_0085611 | |||
| 1598 | Ga0495632_0000446 | |||
| 1599 | Ga0495632_0188767 | |||
| 1600 | Ga0495637_0010269 | |||
| 1601 | Ga0495637_0020660 | |||
| 1602 | Ga0495637_0078074 | |||
| 1603 | Ga0495643_0002033 | |||
| 1604 | Ga0495643_0004844 | |||
| 1605 | Ga0495643_0005462 | |||
| 1606 | Ga0495643_0044540 | |||
| 1607 | Ga0495643_0058007 | |||
| 1608 | Ga0495648_0000021 | |||
| 1609 | Ga0495648_0000114 | |||
| 1610 | Ga0495648_0020266 | |||
| 1611 | Ga0495648_0065607 | |||
| 1612 | Ga0495648_0098124 | |||
| 1613 | Ga0495663_0000369 | |||
| 1614 | Ga0495663_0070503 | |||
| 1615 | Ga0495642_0040137 | |||
| 1616 | Ga0495654_0001113 | |||
| 1617 | Ga0495654_0096529 | |||
| 1618 | Ga0495609_0294533 | |||
| 1619 | Ga0495597_0013437 | |||
| 1620 | Ga0495597_0103983 | |||
| 1621 | Ga0495622_0021745 | |||
| 1622 | Ga0495622_0033946 | |||
| 1623 | Ga0495622_0067429 | |||
| 1624 | Ga0495633_0000207 | |||
| 1625 | Ga0495633_0010366 | |||
| 1626 | Ga0495668_0000022 | |||
| 1627 | Ga0495668_0000387 | |||
| 1628 | Ga0495668_0012858 | |||
| 1629 | Ga0495668_0017893 | |||
| 1630 | Ga0495668_0042229 | |||
| 1631 | Ga0495668_0069004 | |||
| 1632 | Ga0495611_0002606 | |||
| 1633 | Ga0495611_0052799 | |||
| 1634 | Ga0495611_0129649 | |||
| 1635 | Ga0495625_0000031 | |||
| 1636 | Ga0495625_0000588 | |||
| 1637 | Ga0495625_0002611 | |||
| 1638 | Ga0495625_0002676 | |||
| 1639 | Ga0495625_0011605 | |||
| 1640 | Ga0495625_0013677 | |||
| 1641 | Ga0495625_0270528 | |||
| 1642 | Ga0495625_0448300 | |||
| 1643 | Ga0495661_0092822 | |||
| 1644 | Ga0495661_0102062 | |||
| 1645 | Ga0495669_0000047 | |||
| 1646 | Ga0495669_0041952 | |||
| 1647 | Ga0495670_0000016 | |||
| 1648 | Ga0495670_0002882 | |||
| 1649 | Ga0495670_0011648 | |||
| 1650 | Ga0495670_0014291 | |||
| 1651 | Ga0495671_0000028 | |||
| 1652 | Ga0495671_0007026 | |||
| 1653 | Ga0495671_0015741 | |||
| 1654 | Ga0495671_0043874 | |||
| 1655 | Ga0495671_0131335 | |||
| 1656 | Ga0495671_0361940 | |||
| 1657 | Ga0495649_0228736 | |||
| 1658 | Ga0495589_0076479 | |||
| 1659 | Ga0495600_0038150 | |||
| 1660 | Ga0495660_0044172 | |||
| 1661 | Ga0495660_0164844 | |||
| 1662 | Ga0495683_0013776 | |||
| 1663 | Ga0495687_000043 | |||
| 1664 | Ga0495687_002080 | |||
| 1665 | Ga0495677_0003536 | |||
| 1666 | Ga0495673_0000058 | |||
| 1667 | Ga0495673_0013172 | |||
| 1668 | Ga0495681_0005101 | |||
| 1669 | Ga0495686_0000139 | |||
| 1670 | Ga0495686_0000523 | |||
| 1671 | Ga0495686_0001582 | |||
| 1672 | Ga0495686_0010788 | |||
| 1673 | Ga0496100_0191427 | |||
| 1674 | Ga0496102_0000022 | |||
| 1675 | Ga0496102_0000034 | |||
| 1676 | Ga0496102_0025183 | |||
| 1677 | Ga0496102_0146484 | |||
| 1678 | Ga0496102_0225699 | |||
| 1679 | Ga0496102_0832373 | |||
| 1680 | Ga0496103_0000026 | |||
| 1681 | Ga0496103_0000075 | |||
| 1682 | Ga0496103_0002036 | |||
| 1683 | Ga0496103_0014765 | |||
| 1684 | Ga0496103_0460315 | |||
| 1685 | Ga0496104_0003920 | |||
| 1686 | Ga0496104_0125628 | |||
| 1687 | Ga0496105_0000847 | |||
| 1688 | Ga0496105_0066116 | |||
| 1689 | Ga0496107_0059004 | |||
| 1690 | Ga0496107_0060780 | |||
| 1691 | Ga0496108_0674775 | |||
| 1692 | Ga0496109_0230113 | |||
| 1693 | Ga0496111_0018587 | |||
| 1694 | Ga0496113_0030152 | |||
| 1695 | Ga0496114_0006903 | |||
| 1696 | Ga0496115_0000029 | |||
| 1697 | Ga0496115_0000304 | |||
| 1698 | Ga0496115_0256703 | |||
| 1699 | Ga0496116_0001435 | |||
| 1700 | Ga0496116_0002308 | |||
| 1701 | Ga0496116_0020839 | |||
| 1702 | Ga0496116_0290060 | |||
| 1703 | Ga0496117_0000072 | |||
| 1704 | Ga0496117_0000260 | |||
| 1705 | Ga0496117_0004000 | |||
| 1706 | Ga0496117_0005912 | |||
| 1707 | Ga0496117_0009616 | |||
| 1708 | Ga0496117_0061114 | |||
| 1709 | Ga0496117_0434779 | |||
| 1710 | Ga0496118_0000030 | |||
| 1711 | Ga0496118_0000039 | |||
| 1712 | Ga0496118_0002183 | |||
| 1713 | Ga0496118_0002784 | |||
| 1714 | Ga0496118_0030499 | |||
| 1715 | Ga0496119_0011873 | |||
| 1716 | Ga0496119_0019906 | |||
| 1717 | Ga0496120_0011696 | |||
| 1718 | Ga0496121_0000269 | |||
| 1719 | Ga0496121_0255892 | |||
| 1720 | Ga0496122_0000359 | |||
| 1721 | Ga0496122_0072028 | |||
| 1722 | Ga0496122_0114676 | |||
| 1723 | Ga0496122_0173154 | |||
| 1724 | Ga0496123_0002200 | |||
| 1725 | Ga0496123_0010124 | |||
| 1726 | Ga0496123_0017074 | |||
| 1727 | Ga0496123_0071430 | |||
| 1728 | Ga0496123_0113147 | |||
| 1729 | Ga0496123_0134808 | |||
| 1730 | Ga0496124_0000061 | |||
| 1731 | Ga0496124_0000076 | |||
| 1732 | Ga0496124_0000972 | |||
| 1733 | Ga0496124_0009807 | |||
| 1734 | Ga0496124_0060812 | |||
| 1735 | Ga0496124_0210206 | |||
| 1736 | Ga0496124_0259721 | |||
| 1737 | Ga0496124_0366393 | |||
| 1738 | Ga0496124_0384241 | |||
| 1739 | Ga0496125_0000505 | |||
| 1740 | Ga0496125_0048947 | |||
| 1741 | Ga0496125_0180549 | |||
| 1742 | Ga0496125_0342270 | |||
| 1743 | Ga0496125_0392358 | |||
| 1744 | Ga0496125_0423031 | |||
| 1745 | Ga0496125_0424528 | |||
| 1746 | Ga0496126_0000469 | |||
| 1747 | Ga0496126_0072263 | |||
| 1748 | Ga0496126_0142042 | |||
| 1749 | Ga0496126_0181775 | |||
| 1750 | Ga0495678_067352 | |||
| 1751 | Ga0495678_089306 | |||
| 1752 | Ga0495682_0005472 | |||
| 1753 | Ga0501290_010424 | |||
| 1754 | Ga0501292_000003 | |||
| 1755 | Ga0501293_014882 | |||
| 1756 | Ga0501294_001507 | |||
| 1757 | Ga0501300_000435 | |||
| 1758 | Ga0501300_006309 | |||
| 1759 | Ga0501031_0063333 | |||
| 1760 | Ga0501032_0010092 | |||
| 1761 | Ga0501032_0116551 | |||
| 1762 | Ga0501033_0086928 | |||
| 1763 | Ga0501033_0108351 | |||
| 1764 | Ga0501034_0008195 | |||
| 1765 | Ga0501034_0027966 | |||
| 1766 | Ga0501034_0051809 | |||
| 1767 | Ga0501034_0169871 | |||
| 1768 | Ga0501036_0147928 | |||
| 1769 | Ga0501036_0515586 | |||
| 1770 | Ga0501037_0635499 | |||
| 1771 | Ga0501038_0022352 | |||
| 1772 | Ga0501039_0530071 | |||
| 1773 | Ga0501043_0057451 | |||
| 1774 | Ga0501043_0135872 | |||
| 1775 | Ga0501046_0132703 | |||
| 1776 | Ga0501047_0001517 | |||
| 1777 | Ga0501047_0200828 | |||
| 1778 | Ga0501047_0372518 | |||
| 1779 | Ga0501048_0119258 | |||
| 1780 | Ga0501198_038966 | |||
| 1781 | Ga0501202_003716 | |||
| 1782 | Ga0501206_004721 | |||
| 1783 | Ga0501207_014963 | |||
| 1784 | Ga0501222_000605 | |||
| 1785 | Ga0501223_000090 | |||
| 1786 | Ga0501223_002495 | |||
| 1787 | Ga0501224_000025 | |||
| 1788 | Ga0501224_001119 | |||
| 1789 | Ga0501227_002177 | |||
| 1790 | Ga0501233_000238 | |||
| 1791 | Ga0501235_043485 | |||
| 1792 | Ga0501242_023965 | |||
| 1793 | Ga0501249_000067 | |||
| 1794 | Ga0501257_000019 | |||
| 1795 | Ga0501257_009301 | |||
| 1796 | Ga0501259_000022 | |||
| 1797 | Ga0501261_000007 | |||
| 1798 | Ga0501221_002092 | |||
| 1799 | Ga0501221_017434 | |||
| 1800 | Ga0501225_0000115 | |||
| 1801 | Ga0501234_000307 | |||
| 1802 | Ga0501245_017803 | |||
| 1803 | Ga0501279_000082 | |||
| 1804 | Ga0501280_000047 | |||
| 1805 | Ga0501280_000638 | |||
| 1806 | Ga0501281_00165 | |||
| 1807 | Ga0501282_000814 | |||
| 1808 | Ga0501035_0076990 | |||
| 1809 | Ga0501035_0217406 | |||
| 1810 | Ga0501035_0296075 | |||
| 1811 | Ga0501035_0531848 | |||
| 1812 | Ga0501044_0153977 | |||
| 1813 | Ga0501044_0232027 | |||
| 1814 | Ga0501226_000020 | |||
| 1815 | nmdc:mga0k408_167288_c1 | |||
| 1816 | nmdc:mga07m45_62558_c1 | |||
| 1817 | Ga0500610_0000075 | |||
| 1818 | Ga0500643_000293 | |||
| 1819 | Ga0500643_000709 | |||
| 1820 | Ga0500643_000824 | |||
| 1821 | Ga0500643_000847 | |||
| 1822 | Ga0500643_017589 | |||
| 1823 | Ga0500647_0067941 | |||
| 1824 | Ga0500583_0330907 | |||
| 1825 | Ga0500651_0071175 | |||
| 1826 | Ga0500566_0015005 | |||
| 1827 | Ga0500566_0050704 | |||
| 1828 | Ga0500641_0014638 | |||
| 1829 | Ga0500641_0062406 | |||
| 1830 | Ga0500555_000708 | |||
| 1831 | Ga0500556_0081715 | |||
| 1832 | Ga0500562_128708 | |||
| 1833 | Ga0500592_000543 | |||
| 1834 | Ga0500592_000812 | |||
| 1835 | Ga0500592_004915 | |||
| 1836 | Ga0500592_015284 | |||
| 1837 | Ga0500592_023894 | |||
| 1838 | Ga0500594_0008100 | |||
| 1839 | Ga0500594_0020557 | |||
| 1840 | Ga0500595_000789 | |||
| 1841 | Ga0500595_004048 | |||
| 1842 | Ga0500595_047484 | |||
| 1843 | Ga0500597_002858 | |||
| 1844 | Ga0500614_029717 | |||
| 1845 | Ga0500618_011159 | |||
| 1846 | Ga0500642_0002794 | |||
| 1847 | Ga0500652_173387 | |||
| 1848 | Ga0500655_000411 | |||
| 1849 | Ga0500658_0010536 | |||
| 1850 | Ga0500658_0018148 | |||
| 1851 | Ga0500658_0027407 | |||
| 1852 | Ga0500658_0168690 | |||
| 1853 | Ga0500658_0343353 | |||
| 1854 | Ga0500559_0001245 | |||
| 1855 | Ga0500559_0019742 | |||
| 1856 | Ga0500559_0026803 | |||
| 1857 | Ga0500568_0003154 | |||
| 1858 | Ga0500568_0020227 | |||
| 1859 | Ga0500568_0025795 | |||
| 1860 | Ga0500568_0047498 | |||
| 1861 | Ga0500568_0075216 | |||
| 1862 | Ga0500573_0000041 | |||
| 1863 | Ga0500590_002280 | |||
| 1864 | Ga0500604_0030240 | |||
| 1865 | Ga0500604_0164895 | |||
| 1866 | Ga0500616_0112681 | |||
| 1867 | Ga0500616_0145388 | |||
| 1868 | Ga0500624_000004 | |||
| 1869 | Ga0500624_000095 | |||
| 1870 | Ga0500624_016035 | |||
| 1871 | Ga0500627_0000056 | |||
| 1872 | Ga0500627_0000374 | |||
| 1873 | Ga0500627_0000418 | |||
| 1874 | Ga0500627_0036703 | |||
| 1875 | Ga0500627_0105744 | |||
| 1876 | Ga0500627_0155528 | |||
| 1877 | Ga0500627_0165050 | |||
| 1878 | Ga0500636_0004155 | |||
| 1879 | Ga0500636_0019811 | |||
| 1880 | Ga0500636_0043398 | |||
| 1881 | Ga0500636_0135147 | |||
| 1882 | Ga0500637_0000454 | |||
| 1883 | Ga0500570_000528 | |||
| 1884 | Ga0500611_001307 | |||
| 1885 | Ga0500645_000038 | |||
| 1886 | Ga0500645_003201 | |||
| 1887 | Ga0500645_103965 | |||
| 1888 | Ga0500596_000565 | |||
| 1889 | Ga0500601_012482 | |||
| 1890 | 2585263300 | |||
| 1891 | 2600203137 | |||
| 1892 | 2600227134 | |||
| 1893 | 2643727822 | |||
| 1894 | 2643835339 | |||
| 1895 | 2644038937 | |||
| 1896 | 2644043228 | |||
| 1897 | 2644056265 | |||
| 1898 | 2644127386 | |||
| 1899 | 2644395341 | |||
| 1900 | 2753766557 | |||
| 1901 | 2819715414 | |||
| 1902 | 2830075873 | |||
| 1903 | 2852654927 | |||
| 1904 | 2852681730 | |||
| 1905 | 2879163245 | |||
| 1906 | 2885432402 | |||
| 1907 | 2928530843 | |||
| 1908 | 2928971083 | |||
| 1909 | 2946790433 | |||
| 1910 | 2990268352 | |||
| 1911 | 2993696616 | |||
| 1912 | 8057105483 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rfl-assembly5.cif.gz_E | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.9027 | 2 | 168 |
| 2rfl-assembly2.cif.gz_B | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.8991 | 2 | 168 |
| 2rfl-assembly7.cif.gz_G | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.8981 | 2 | 168 |
| 2rfl-assembly3.cif.gz_C | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.8925 | 2 | 168 |
| 2rfl-assembly6.cif.gz_F | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.8886 | 2 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGF9_1_158_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9205 | 8 | 169 | 3.40.50.1240 |
| af_P9WGF9_1_158_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9094 | 8 | 169 | 3.40.50.1240 |
| 4hbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8769 | 2 | 168 | 3.40.50.1240 |
| 2rflF00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8687 | 2 | 166 | 3.40.50.1240 |
| af_I1L079_52_229_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8596 | 2 | 168 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H0GC17-F1-model_v4 | deleted | 0.9809 | 1 | 171 |
|
| AF-A0A537MJY4-F1-model_v4 | Histidine phosphatase family protein | 0.9761 | 1 | 171 |
|
| AF-A0A7H0GC17-F1-model_v4 | deleted | 0.9752 | 1 | 171 |
|
| AF-A0A1L3JAK2-F1-model_v4 | Histidine phosphatase family protein | 0.9738 | 1 | 180 |
|
| AF-A0A1B2AGG6-F1-model_v4 | Histidine phosphatase superfamily (Branch 1) | 0.9685 | 1 | 177 |
|