F486747

General Info

Members Datasets Scaffolds Average Seq Length
956 411 956 221

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0090311|Ga0373944_0090311_141_944
Length 267
Sequence MLSPCSAPWPNKRQTCARRNSASTDAIEVALSERKKKENIMAKQRISYVPLEKMDAEMRKEMERCQREGTPRPESSAVRAHVPAAFWFFANSWHDLFRNGVLDHPIKELCRLYVSRSVQCEYCGNQRSVKATTSGALIEDHVMDLLNFEKSTTYNERQKAALAYAEAITWHLNTDDAFWDRMHKQFSEPELVELGCMIGLTLGQQSWLRLLNIEHHEVMAGTSASMAPGYEDSQKLKQTKSAPDYWAQSKNAERSGQDVDRSNAAGR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
245 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
251 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
306 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
307 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0
Rhizoplane 8.79
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1015158 3300001904 Bacteria 1236
2 JGI24746J21847_1000854 3300001977 Unclassified 4726
3 JGI24747J21853_1000051 3300001978 Unclassified 4510
4 JGI24739J22299_10000369 3300001989 Bacteria 15453
5 JGI24737J22298_10000226 3300001990 Bacteria 18591
6 JGI24737J22298_10014093 3300001990 Bacteria 2597
7 JGI24743J22301_10012087 3300001991 Bacteria 1565
8 JGI24750J21931_1000087 3300002070 Bacteria 13918
9 JGI24750J21931_1002087 3300002070 Bacteria 2432
10 JGI24745J21846_1000024 3300002073 Bacteria 9632
11 JGI24745J21846_1008193 3300002073 Bacteria 1175
12 JGI24748J21848_1000154 3300002074 Bacteria 10563
13 JGI24738J21930_10000105 3300002075 Bacteria 19444
14 JGI24738J21930_10010784 3300002075 Bacteria 2025
15 JGI24749J21850_1000463 3300002076 Bacteria 5994
16 JGI24744J21845_10000489 3300002077 Bacteria 7037
17 JGI24035J26624_1000284 3300002126 Bacteria 4707
18 JGI24033J26618_1000269 3300002155 Bacteria 5716
19 JGI24034J26672_10000118 3300002239 Bacteria 12125
20 JGI24034J26672_10003762 3300002239 Bacteria 2125
21 JGI24742J22300_10001512 3300002244 Bacteria 3684
22 JGI24742J22300_10007049 3300002244 Unclassified 1853
23 JGI24751J29686_10034246 3300002459 Bacteria 1053
24 JGI25404J52841_10022171 3300003659 Bacteria 1373
25 JGI25405J52794_10048493 3300003911 Bacteria 908
26 Ga0065712_10071547 3300005290 Bacteria 5198
27 Ga0065712_10081467 3300005290 Bacteria 3000
28 Ga0065715_10000418 3300005293 Bacteria 15259
29 Ga0065715_10139317 3300005293 Unclassified 1860
30 Ga0070658_10018800 3300005327 Bacteria 5535
31 Ga0070658_10039788 3300005327 Bacteria 3793
32 Ga0070658_10187057 3300005327 Bacteria 1745
33 Ga0070676_10002237 3300005328 Bacteria 9874
34 Ga0070683_100000603 3300005329 Bacteria 25755
35 Ga0070683_100022410 3300005329 Bacteria 5645
36 Ga0070683_100201757 3300005329 Unclassified 1889
37 Ga0070683_100229283 3300005329 Bacteria 1765
38 Ga0070690_100000295 3300005330 Bacteria 25627
39 Ga0070690_100050293 3300005330 Bacteria 2658
40 Ga0070690_100057076 3300005330 Bacteria 2505
41 Ga0070690_100085675 3300005330 Bacteria 2067
42 Ga0070670_100003650 3300005331 Bacteria 12821
43 Ga0070670_100148307 3300005331 Unclassified 2030
44 Ga0070670_100230467 3300005331 Unclassified 1612
45 Ga0070677_10000052 3300005333 Bacteria 35523
46 Ga0068869_100000872 3300005334 Bacteria 17364
47 Ga0068869_100012626 3300005334 Bacteria 5586
48 Ga0070666_10024897 3300005335 Unclassified 3901
49 Ga0070666_10043795 3300005335 Bacteria 2998
50 Ga0070666_10176454 3300005335 Bacteria 1498
51 Ga0070680_100002210 3300005336 Bacteria 14337
52 Ga0070680_100010429 3300005336 Bacteria 7164
53 Ga0070680_100023502 3300005336 Bacteria 4916
54 Ga0070680_100071963 3300005336 Bacteria 2842
55 Ga0070680_100238893 3300005336 Bacteria 1535
56 Ga0070680_100284951 3300005336 Bacteria 1400
57 Ga0070680_100377619 3300005336 Unclassified 1206
58 Ga0070682_100000952 3300005337 Bacteria 16844
59 Ga0070682_100041992 3300005337 Unclassified 2821
60 Ga0068868_100000382 3300005338 Bacteria 30225
61 Ga0068868_100013269 3300005338 Bacteria 6037
62 Ga0068868_100048416 3300005338 Bacteria 3334
63 Ga0070660_100001046 3300005339 Bacteria 18601
64 Ga0070660_100004081 3300005339 Bacteria 10079
65 Ga0070660_100217681 3300005339 Unclassified 1552
66 Ga0070689_100000893 3300005340 Bacteria 18603
67 Ga0070689_100652330 3300005340 Unclassified 915
68 Ga0070691_10007217 3300005341 Bacteria 5088
69 Ga0070691_10177528 3300005341 Bacteria 1107
70 Ga0070687_100000133 3300005343 Bacteria 25644
71 Ga0070687_100007639 3300005343 Bacteria 4523
72 Ga0070687_100084047 3300005343 Bacteria 1744
73 Ga0070661_100000227 3300005344 Bacteria 46632
74 Ga0070661_100066522 3300005344 Unclassified 2648
75 Ga0070661_100438494 3300005344 Bacteria 1038
76 Ga0070692_10000036 3300005345 Bacteria 25648
77 Ga0070692_10007567 3300005345 Bacteria 4791
78 Ga0070668_100000502 3300005347 Bacteria 25827
79 Ga0070668_100003914 3300005347 Bacteria 10999
80 Ga0070669_100001485 3300005353 Bacteria 16965
81 Ga0070669_100716280 3300005353 Bacteria 846
82 Ga0070675_100000549 3300005354 Bacteria 25774
83 Ga0070675_100028863 3300005354 Bacteria 4469
84 Ga0070671_100003505 3300005355 Bacteria 12256
85 Ga0070671_100164315 3300005355 Bacteria 1877
86 Ga0070674_100001796 3300005356 Bacteria 11640
87 Ga0070674_100006336 3300005356 Bacteria 6895
88 Ga0070673_100000307 3300005364 Bacteria 25632
89 Ga0070673_100032250 3300005364 Bacteria 3942
90 Ga0070673_100305049 3300005364 Bacteria 1403
91 Ga0070688_100006306 3300005365 Bacteria 6331
92 Ga0070688_100017651 3300005365 Bacteria 4099
93 Ga0070688_100406180 3300005365 Bacteria 1009
94 Ga0070659_100001361 3300005366 Bacteria 17602
95 Ga0070659_100020664 3300005366 Bacteria 5005
96 Ga0070667_100002130 3300005367 Bacteria 17462
97 Ga0070667_100406309 3300005367 Bacteria 1240
98 Ga0070703_10006103 3300005406 Bacteria 3373
99 Ga0070709_10209208 3300005434 Bacteria 1386
100 Ga0070709_10447850 3300005434 Bacteria 972
101 Ga0070709_10480368 3300005434 Bacteria 941
102 Ga0070714_100048873 3300005435 Bacteria 3599
103 Ga0070714_100498909 3300005435 Unclassified 1161
104 Ga0070713_100108527 3300005436 Unclassified 2417
105 Ga0070713_100240353 3300005436 Unclassified 1649
106 Ga0070713_100693448 3300005436 Bacteria 972
107 Ga0070701_10001033 3300005438 Bacteria 10142
108 Ga0070711_100041039 3300005439 Bacteria 3124
109 Ga0070711_100046185 3300005439 Unclassified 2966
110 Ga0070705_100001145 3300005440 Bacteria 14622
111 Ga0070705_100121865 3300005440 Bacteria 1685
112 Ga0070705_100771827 3300005440 Bacteria 762
113 Ga0070700_100000299 3300005441 Bacteria 25918
114 Ga0070700_100105524 3300005441 Unclassified 1863
115 Ga0070694_100001042 3300005444 Bacteria 15819
116 Ga0070694_100103422 3300005444 Bacteria 2018
117 Ga0070694_100281728 3300005444 Unclassified 1268
118 Ga0070708_100050297 3300005445 Unclassified 3690
119 Ga0070663_100000229 3300005455 Bacteria 28301
120 Ga0070663_100004867 3300005455 Bacteria 7923
121 Ga0070663_100403681 3300005455 Bacteria 1118
122 Ga0070678_100000314 3300005456 Bacteria 22590
123 Ga0070678_100154305 3300005456 Unclassified 1853
124 Ga0070662_100000997 3300005457 Bacteria 17311
125 Ga0070681_10000842 3300005458 Bacteria 25737
126 Ga0070681_10028791 3300005458 Bacteria 5583
127 Ga0070681_10100415 3300005458 Bacteria 2840
128 Ga0070681_10107291 3300005458 Bacteria 2733
129 Ga0070681_10149479 3300005458 Bacteria 2263
130 Ga0070681_10290616 3300005458 Bacteria 1544
131 Ga0070681_10351781 3300005458 Bacteria 1384
132 Ga0070681_10359384 3300005458 Bacteria 1366
133 Ga0070681_10815324 3300005458 Unclassified 850
134 Ga0068867_100001094 3300005459 Bacteria 18496
135 Ga0068867_100052105 3300005459 Bacteria 3019
136 Ga0070685_10000472 3300005466 Bacteria 23522
137 Ga0070685_10003880 3300005466 Bacteria 7561
138 Ga0070679_100000901 3300005530 Bacteria 25778
139 Ga0070679_100043010 3300005530 Bacteria 4499
140 Ga0070679_100113686 3300005530 Bacteria 2692
141 Ga0070679_100170845 3300005530 Bacteria 2147
142 Ga0070679_100233869 3300005530 Bacteria 1797
143 Ga0070679_100238842 3300005530 Unclassified 1775
144 Ga0070679_100451749 3300005530 Unclassified 1230
145 Ga0070679_100497265 3300005530 Bacteria 1163
146 Ga0070679_100859558 3300005530 Unclassified 850
147 Ga0070684_100001807 3300005535 Bacteria 15660
148 Ga0070684_100208472 3300005535 Bacteria 1781
149 Ga0070684_100253295 3300005535 Bacteria 1609
150 Ga0068853_100000604 3300005539 Bacteria 24652
151 Ga0068853_100049760 3300005539 Bacteria 3602
152 Ga0068853_101104011 3300005539 Bacteria 765
153 Ga0070672_100000441 3300005543 Bacteria 24250
154 Ga0070672_100120036 3300005543 Bacteria 2151
155 Ga0070686_100000472 3300005544 Bacteria 24336
156 Ga0070686_100007854 3300005544 Bacteria 5964
157 Ga0070686_100112284 3300005544 Unclassified 1859
158 Ga0070695_100001750 3300005545 Bacteria 12218
159 Ga0070695_100176352 3300005545 Bacteria 1511
160 Ga0070695_100266134 3300005545 Bacteria 1254
161 Ga0070696_100015450 3300005546 Bacteria 5126
162 Ga0070696_100148781 3300005546 Bacteria 1717
163 Ga0070696_100344800 3300005546 Bacteria 1152
164 Ga0070693_100000802 3300005547 Bacteria 13898
165 Ga0070693_100191504 3300005547 Bacteria 1323
166 Ga0070665_100057497 3300005548 Unclassified 3899
167 Ga0070665_101192653 3300005548 Bacteria 772
168 Ga0070704_100000249 3300005549 Bacteria 23286
169 Ga0070704_100155519 3300005549 Bacteria 1803
170 Ga0070704_100205356 3300005549 Unclassified 1593
171 Ga0070704_100495282 3300005549 Unclassified 1060
172 Ga0070704_100589278 3300005549 Bacteria 976
173 Ga0068855_100043683 3300005563 Bacteria 5307
174 Ga0068855_100100907 3300005563 Bacteria 3322
175 Ga0068855_100339620 3300005563 Bacteria 1656
176 Ga0068855_100368481 3300005563 Unclassified 1579
177 Ga0068855_100375293 3300005563 Bacteria 1562
178 Ga0068855_100375542 3300005563 Unclassified 1562
179 Ga0068855_100510372 3300005563 Bacteria 1305
180 Ga0070664_100002205 3300005564 Bacteria 15660
181 Ga0070664_100216049 3300005564 Bacteria 1714
182 Ga0068857_100001686 3300005577 Bacteria 17746
183 Ga0068857_100105868 3300005577 Bacteria 2526
184 Ga0068854_100000537 3300005578 Bacteria 22913
185 Ga0068854_100012521 3300005578 Bacteria 5559
186 Ga0068854_100066223 3300005578 Bacteria 2629
187 Ga0068854_100066694 3300005578 Bacteria 2620
188 Ga0068856_100001201 3300005614 Bacteria 27274
189 Ga0068856_100061509 3300005614 Bacteria 3709
190 Ga0068856_100072446 3300005614 Unclassified 3411
191 Ga0068856_100387849 3300005614 Bacteria 1416
192 Ga0068856_100842825 3300005614 Bacteria 936
193 Ga0070702_100000515 3300005615 Bacteria 13912
194 Ga0070702_100001258 3300005615 Bacteria 10284
195 Ga0068852_100002309 3300005616 Bacteria 13105
196 Ga0068852_100004218 3300005616 Bacteria 10143
197 Ga0068852_100156312 3300005616 Unclassified 2125
198 Ga0068852_100259708 3300005616 Bacteria 1667
199 Ga0068859_100005362 3300005617 Bacteria 13049
200 Ga0068859_100054148 3300005617 Bacteria 4035
201 Ga0068864_100001021 3300005618 Bacteria 23437
202 Ga0068864_100013595 3300005618 Bacteria 6748
203 Ga0068864_100160385 3300005618 Unclassified 2044
204 Ga0068866_10000236 3300005718 Bacteria 26032
205 Ga0068866_10005171 3300005718 Bacteria 5376
206 Ga0068861_100002864 3300005719 Bacteria 11361
207 Ga0068861_100192642 3300005719 Bacteria 1705
208 Ga0068851_10438477 3300005834 Bacteria 774
209 Ga0068870_10000078 3300005840 Bacteria 31290
210 Ga0068870_10012275 3300005840 Bacteria 3999
211 Ga0068863_100002772 3300005841 Bacteria 17364
212 Ga0068863_100010880 3300005841 Bacteria 8821
213 Ga0068863_100282226 3300005841 Bacteria 1609
214 Ga0068858_100001533 3300005842 Bacteria 23707
215 Ga0068858_100110205 3300005842 Bacteria 2570
216 Ga0068858_100121772 3300005842 Bacteria 2440
217 Ga0068858_100230438 3300005842 Bacteria 1756
218 Ga0068860_100003739 3300005843 Bacteria 15660
219 Ga0068860_100079739 3300005843 Bacteria 3113
220 Ga0068860_100153192 3300005843 Unclassified 2221
221 Ga0068860_100449551 3300005843 Bacteria 1281
222 Ga0068860_100524217 3300005843 Bacteria 1185
223 Ga0068862_100001100 3300005844 Bacteria 25658
224 Ga0068862_100138980 3300005844 Bacteria 2155
225 Ga0081455_10000101 3300005937 Bacteria 94120
226 Ga0081455_10039008 3300005937 Bacteria 4202
227 Ga0081455_10235698 3300005937 Bacteria 1348
228 Ga0081538_10017363 3300005981 Bacteria 5465
229 Ga0081540_1000381 3300005983 Bacteria 44497
230 Ga0081539_10164272 3300005985 Unclassified 1055
231 Ga0070717_10134213 3300006028 Bacteria 2130
232 Ga0070717_10350054 3300006028 Bacteria 1321
233 Ga0070717_10592195 3300006028 Unclassified 1006
234 Ga0070717_10653955 3300006028 Bacteria 954
235 Ga0075365_10005268 3300006038 Bacteria 6958
236 Ga0075365_10007874 3300006038 Bacteria 6003
237 Ga0075365_10056258 3300006038 Bacteria 2614
238 Ga0075365_10109356 3300006038 Bacteria 1899
239 Ga0075365_10132086 3300006038 Bacteria 1728
240 Ga0075365_10150080 3300006038 Bacteria 1621
241 Ga0075368_10023670 3300006042 Bacteria 2348
242 Ga0075363_100093767 3300006048 Bacteria 1655
243 Ga0075432_10009321 3300006058 Bacteria 3342
244 Ga0070716_100016639 3300006173 Bacteria 3800
245 Ga0070712_100006230 3300006175 Bacteria 7386
246 Ga0070712_100334428 3300006175 Bacteria 1235
247 Ga0075362_10013028 3300006177 Bacteria 3318
248 Ga0075362_10018695 3300006177 Bacteria 2871
249 Ga0075362_10376452 3300006177 Bacteria 713
250 Ga0075367_10029844 3300006178 Unclassified 3122
251 Ga0075367_10040861 3300006178 Bacteria 2709
252 Ga0075367_10052759 3300006178 Bacteria 2408
253 Ga0075367_10063889 3300006178 Bacteria 2201
254 Ga0075367_10125685 3300006178 Bacteria 1583
255 Ga0075367_10229761 3300006178 Bacteria 1162
256 Ga0075369_10013939 3300006186 Bacteria 3202
257 Ga0075366_10000790 3300006195 Bacteria 15141
258 Ga0097621_100000019 3300006237 Bacteria 88022
259 Ga0075370_10246300 3300006353 Bacteria 1059
260 Ga0068871_100000116 3300006358 Bacteria 49377
261 Ga0068871_100089342 3300006358 Bacteria 2564
262 Ga0068871_100959318 3300006358 Bacteria 795
263 Ga0075428_100036400 3300006844 Bacteria 5421
264 Ga0075428_100987142 3300006844 Unclassified 892
265 Ga0075430_100115497 3300006846 Bacteria 2236
266 Ga0075431_100034133 3300006847 Bacteria 5242
267 Ga0075431_100184245 3300006847 Bacteria 2142
268 Ga0075433_10003904 3300006852 Bacteria 11539
269 Ga0075434_100000042 3300006871 Bacteria 59376
270 Ga0075434_100632417 3300006871 Bacteria 1089
271 Ga0068865_100000344 3300006881 Bacteria 25774
272 Ga0075436_100046321 3300006914 Bacteria 2999
273 Ga0097620_100005362 3300006931 Bacteria 13049
274 Ga0097620_100054148 3300006931 Bacteria 4035
275 Ga0075435_100399154 3300007076 Bacteria 1182
276 Ga0099794_10025438 3300007265 Bacteria 2727
277 Ga0099795_10064464 3300007788 Bacteria 1368
278 Ga0105244_10012496 3300009036 Bacteria 5013
279 Ga0105250_10053699 3300009092 Bacteria 1617
280 Ga0105250_10062212 3300009092 Bacteria 1501
281 Ga0105240_10032177 3300009093 Bacteria 6793
282 Ga0105240_10083906 3300009093 Bacteria 3908
283 Ga0105240_10102263 3300009093 Bacteria 3483
284 Ga0105240_10693439 3300009093 Bacteria 1112
285 Ga0105240_10713413 3300009093 Bacteria 1094
286 Ga0105240_11059642 3300009093 Bacteria 864
287 Ga0111539_10002257 3300009094 Bacteria 25690
288 Ga0111539_10030036 3300009094 Bacteria 6612
289 Ga0105245_10000142 3300009098 Bacteria 68105
290 Ga0105245_10022285 3300009098 Bacteria 5559
291 Ga0105245_10031740 3300009098 Bacteria 4676
292 Ga0105245_10594239 3300009098 Bacteria 1133
293 Ga0105247_10001283 3300009101 Bacteria 18534
294 Ga0105247_10012239 3300009101 Bacteria 5155
295 Ga0105247_10022157 3300009101 Bacteria 3824
296 Ga0105247_10070770 3300009101 Bacteria 2180
297 Ga0114129_10018704 3300009147 Bacteria 9867
298 Ga0114129_10570990 3300009147 Unclassified 1469
299 Ga0105243_10001269 3300009148 Bacteria 22672
300 Ga0105243_10084350 3300009148 Unclassified 2602
301 Ga0105243_11402601 3300009148 Bacteria 719
302 Ga0105241_10000867 3300009174 Bacteria 22936
303 Ga0105241_10146766 3300009174 Bacteria 1925
304 Ga0105241_10346279 3300009174 Unclassified 1289
305 Ga0105242_10000723 3300009176 Bacteria 25835
306 Ga0105242_10094039 3300009176 Bacteria 2527
307 Ga0105242_10228251 3300009176 Unclassified 1667
308 Ga0105242_10370117 3300009176 Bacteria 1329
309 Ga0105242_10784657 3300009176 Bacteria 941
310 Ga0105248_10001535 3300009177 Bacteria 25727
311 Ga0105248_10031227 3300009177 Bacteria 5954
312 Ga0105248_10065376 3300009177 Bacteria 4084
313 Ga0105248_10100303 3300009177 Bacteria 3263
314 Ga0105248_10652751 3300009177 Bacteria 1187
315 Ga0105237_10002792 3300009545 Bacteria 21210
316 Ga0105238_10029000 3300009551 Bacteria 5637
317 Ga0105238_10066561 3300009551 Bacteria 3604
318 Ga0105238_10098234 3300009551 Bacteria 2912
319 Ga0105238_10314643 3300009551 Bacteria 1551
320 Ga0105238_10317439 3300009551 Bacteria 1544
321 Ga0105249_10002090 3300009553 Bacteria 17314
322 Ga0105249_10104222 3300009553 Bacteria 2672
323 Ga0105249_10392555 3300009553 Bacteria 1416
324 Ga0099796_10143375 3300010159 Bacteria 935
325 Ga0105239_10000656 3300010375 Bacteria 49301
326 Ga0105239_10421183 3300010375 Bacteria 1513
327 Ga0105239_10789794 3300010375 Bacteria 1087
328 Ga0105246_10000027 3300011119 Bacteria 53374
329 Ga0105246_10067310 3300011119 Bacteria 2509
330 Ga0105246_10198138 3300011119 Bacteria 1559
331 Ga0105246_11004835 3300011119 Bacteria 755
332 Ga0157373_10001829 3300013100 Bacteria 16201
333 Ga0157373_10130104 3300013100 Bacteria 1770
334 Ga0157371_10049537 3300013102 Bacteria 2984
335 Ga0157371_10076097 3300013102 Bacteria 2377
336 Ga0157371_10139602 3300013102 Bacteria 1726
337 Ga0157370_10016516 3300013104 Bacteria 7469
338 Ga0157370_10016577 3300013104 Bacteria 7454
339 Ga0157370_10035742 3300013104 Bacteria 4826
340 Ga0157369_10017832 3300013105 Bacteria 7969
341 Ga0157369_10215308 3300013105 Bacteria 2012
342 Ga0157369_10424242 3300013105 Unclassified 1379
343 Ga0157369_11316637 3300013105 Bacteria 736
344 Ga0157374_10003115 3300013296 Bacteria 13923
345 Ga0157378_10001009 3300013297 Bacteria 25788
346 Ga0157378_10255655 3300013297 Bacteria 1679
347 Ga0157378_10382848 3300013297 Bacteria 1382
348 Ga0157378_10503565 3300013297 Bacteria 1210
349 Ga0163162_10001974 3300013306 Bacteria 19266
350 Ga0163162_10131582 3300013306 Bacteria 2610
351 Ga0163162_10982340 3300013306 Bacteria 954
352 Ga0157372_10011452 3300013307 Bacteria 9429
353 Ga0157372_10210826 3300013307 Bacteria 2251
354 Ga0157375_10001521 3300013308 Bacteria 19961
355 Ga0157375_10019190 3300013308 Bacteria 6212
356 Ga0157375_10308728 3300013308 Bacteria 1746
357 Ga0163163_10000820 3300014325 Bacteria 26488
358 Ga0163163_10003436 3300014325 Bacteria 13461
359 Ga0163163_10004470 3300014325 Bacteria 11926
360 Ga0163163_10011021 3300014325 Bacteria 8174
361 Ga0157380_10000425 3300014326 Bacteria 25649
362 Ga0157380_10101484 3300014326 Bacteria 2397
363 Ga0157380_10195477 3300014326 Bacteria 1790
364 Ga0182008_10042777 3300014497 Bacteria 2256
365 Ga0157377_10000136 3300014745 Bacteria 47102
366 Ga0157377_10011195 3300014745 Bacteria 4470
367 Ga0157379_10002085 3300014968 Bacteria 16604
368 Ga0157379_10007724 3300014968 Bacteria 9309
369 Ga0157379_10095217 3300014968 Unclassified 2672
370 Ga0157379_10522464 3300014968 Unclassified 1102
371 Ga0157376_10000073 3300014969 Bacteria 76981
372 Ga0163161_10000501 3300017792 Bacteria 32101
373 Ga0206356_10899486 3300020070 Bacteria 1513
374 Ga0206353_10581821 3300020082 Bacteria 1276
375 Ga0213876_10015945 3300021384 Bacteria 3976
376 Ga0224712_10256067 3300022467 Bacteria 810
377 Ga0207666_1000065 3300025271 Bacteria 18800
378 Ga0207673_1000020 3300025290 Bacteria 12098
379 Ga0207697_10000738 3300025315 Bacteria 18567
380 Ga0207697_10041384 3300025315 Unclassified 1893
381 Ga0207653_10000595 3300025885 Bacteria 12811
382 Ga0207682_10000083 3300025893 Bacteria 42123
383 Ga0207692_10313998 3300025898 Bacteria 957
384 Ga0207642_10000826 3300025899 Bacteria 9629
385 Ga0207710_10002789 3300025900 Bacteria 7981
386 Ga0207710_10007039 3300025900 Bacteria 4778
387 Ga0207710_10045064 3300025900 Bacteria 1966
388 Ga0207688_10000170 3300025901 Bacteria 28720
389 Ga0207688_10001718 3300025901 Bacteria 11619
390 Ga0207680_10006169 3300025903 Bacteria 5783
391 Ga0207647_10005586 3300025904 Bacteria 9196
392 Ga0207699_10225643 3300025906 Bacteria 1281
393 Ga0207699_10299458 3300025906 Bacteria 1122
394 Ga0207645_10000256 3300025907 Bacteria 43892
395 Ga0207645_10054338 3300025907 Unclassified 2557
396 Ga0207643_10000116 3300025908 Bacteria 54500
397 Ga0207643_10001175 3300025908 Bacteria 15558
398 Ga0207705_10003149 3300025909 Bacteria 12561
399 Ga0207654_10000984 3300025911 Bacteria 15635
400 Ga0207707_10001987 3300025912 Bacteria 18578
401 Ga0207707_10329416 3300025912 Bacteria 1317
402 Ga0207707_10425069 3300025912 Bacteria 1139
403 Ga0207707_10676582 3300025912 Bacteria 868
404 Ga0207695_10166436 3300025913 Bacteria 2133
405 Ga0207695_10233896 3300025913 Bacteria 1741
406 Ga0207695_10632964 3300025913 Bacteria 951
407 Ga0207671_10008772 3300025914 Bacteria 8516
408 Ga0207693_10004856 3300025915 Bacteria 11313
409 Ga0207693_10013979 3300025915 Bacteria 6464
410 Ga0207693_10050358 3300025915 Bacteria 3271
411 Ga0207663_10035608 3300025916 Unclassified 2988
412 Ga0207663_10164720 3300025916 Bacteria 1569
413 Ga0207663_10221732 3300025916 Bacteria 1376
414 Ga0207660_10000043 3300025917 Bacteria 62068
415 Ga0207660_10045251 3300025917 Bacteria 3100
416 Ga0207660_10092168 3300025917 Bacteria 2249
417 Ga0207660_10327407 3300025917 Bacteria 1224
418 Ga0207660_10439545 3300025917 Bacteria 1054
419 Ga0207662_10000137 3300025918 Bacteria 35143
420 Ga0207662_10001037 3300025918 Bacteria 13011
421 Ga0207657_10001419 3300025919 Bacteria 25588
422 Ga0207657_10063434 3300025919 Bacteria 3159
423 Ga0207657_10315559 3300025919 Bacteria 1237
424 Ga0207649_10000735 3300025920 Bacteria 21570
425 Ga0207649_10194958 3300025920 Unclassified 1427
426 Ga0207652_10000389 3300025921 Bacteria 45878
427 Ga0207652_10056665 3300025921 Bacteria 3374
428 Ga0207652_10149984 3300025921 Bacteria 2087
429 Ga0207652_10267808 3300025921 Unclassified 1541
430 Ga0207652_10399437 3300025921 Unclassified 1240
431 Ga0207681_10000066 3300025923 Bacteria 98794
432 Ga0207694_10032288 3300025924 Bacteria 4006
433 Ga0207694_10096671 3300025924 Bacteria 2336
434 Ga0207694_10379544 3300025924 Bacteria 1173
435 Ga0207650_10001332 3300025925 Bacteria 17873
436 Ga0207650_10147517 3300025925 Bacteria 1854
437 Ga0207650_10170233 3300025925 Bacteria 1731
438 Ga0207659_10000100 3300025926 Bacteria 50549
439 Ga0207659_10070603 3300025926 Bacteria 2547
440 Ga0207687_10000052 3300025927 Bacteria 90736
441 Ga0207687_10018933 3300025927 Bacteria 4554
442 Ga0207687_10798680 3300025927 Bacteria 805
443 Ga0207700_10049242 3300025928 Bacteria 3133
444 Ga0207700_10367177 3300025928 Bacteria 1256
445 Ga0207664_10297699 3300025929 Bacteria 1419
446 Ga0207664_10423897 3300025929 Bacteria 1185
447 Ga0207644_10002133 3300025931 Bacteria 12833
448 Ga0207690_10001339 3300025932 Bacteria 15479
449 Ga0207690_10137473 3300025932 Unclassified 1796
450 Ga0207706_10002322 3300025933 Bacteria 18571
451 Ga0207706_10002700 3300025933 Bacteria 17297
452 Ga0207686_10001022 3300025934 Bacteria 16567
453 Ga0207686_10032159 3300025934 Bacteria 3121
454 Ga0207686_10526018 3300025934 Unclassified 921
455 Ga0207709_10000243 3300025935 Bacteria 67001
456 Ga0207709_10066388 3300025935 Bacteria 2272
457 Ga0207709_10712133 3300025935 Bacteria 804
458 Ga0207670_10000121 3300025936 Bacteria 52272
459 Ga0207670_10709457 3300025936 Bacteria 833
460 Ga0207669_10000034 3300025937 Bacteria 82098
461 Ga0207704_10000095 3300025938 Bacteria 50515
462 Ga0207704_10299016 3300025938 Bacteria 1232
463 Ga0207665_10017519 3300025939 Bacteria 4708
464 Ga0207665_10019636 3300025939 Bacteria 4444
465 Ga0207665_10189333 3300025939 Bacteria 1494
466 Ga0207665_10206129 3300025939 Bacteria 1434
467 Ga0207691_10001151 3300025940 Bacteria 26271
468 Ga0207691_10002238 3300025940 Bacteria 18948
469 Ga0207711_10001119 3300025941 Bacteria 25644
470 Ga0207711_10018088 3300025941 Bacteria 5860
471 Ga0207711_10050447 3300025941 Bacteria 3563
472 Ga0207711_10572094 3300025941 Bacteria 1054
473 Ga0207689_10000621 3300025942 Bacteria 33915
474 Ga0207689_10012057 3300025942 Bacteria 7407
475 Ga0207661_10000113 3300025944 Bacteria 51519
476 Ga0207661_10081250 3300025944 Bacteria 2677
477 Ga0207661_10161906 3300025944 Unclassified 1942
478 Ga0207679_10000052 3300025945 Bacteria 110612
479 Ga0207679_10207197 3300025945 Unclassified 1642
480 Ga0207679_10519730 3300025945 Bacteria 1064
481 Ga0207667_10008923 3300025949 Bacteria 11860
482 Ga0207667_10028470 3300025949 Bacteria 6069
483 Ga0207667_10295179 3300025949 Bacteria 1656
484 Ga0207651_10000260 3300025960 Bacteria 22573
485 Ga0207651_10293884 3300025960 Bacteria 1348
486 Ga0207712_10002918 3300025961 Bacteria 10922
487 Ga0207712_10054805 3300025961 Bacteria 2802
488 Ga0207668_10001504 3300025972 Bacteria 13623
489 Ga0207640_10000129 3300025981 Bacteria 57276
490 Ga0207640_10054497 3300025981 Unclassified 2615
491 Ga0207640_10055136 3300025981 Bacteria 2602
492 Ga0207640_10090814 3300025981 Bacteria 2114
493 Ga0207658_10000992 3300025986 Bacteria 23319
494 Ga0207658_10056368 3300025986 Bacteria 2916
495 Ga0207658_10337929 3300025986 Bacteria 1308
496 Ga0207677_10000475 3300026023 Bacteria 26385
497 Ga0207677_10006628 3300026023 Bacteria 6354
498 Ga0207677_10121259 3300026023 Bacteria 1967
499 Ga0207703_10018841 3300026035 Bacteria 5390
500 Ga0207703_10026797 3300026035 Bacteria 4541
501 Ga0207703_10731676 3300026035 Bacteria 942
502 Ga0207639_10781414 3300026041 Bacteria 889
503 Ga0207678_10001680 3300026067 Bacteria 20315
504 Ga0207678_10002756 3300026067 Bacteria 15914
505 Ga0207678_10174194 3300026067 Bacteria 1837
506 Ga0207678_10607075 3300026067 Bacteria 959
507 Ga0207708_10001334 3300026075 Bacteria 18571
508 Ga0207708_10006771 3300026075 Bacteria 8480
509 Ga0207702_10003304 3300026078 Bacteria 14856
510 Ga0207702_10503223 3300026078 Bacteria 1181
511 Ga0207641_10000351 3300026088 Bacteria 55068
512 Ga0207648_10000448 3300026089 Bacteria 45620
513 Ga0207648_10002791 3300026089 Bacteria 18524
514 Ga0207676_10000335 3300026095 Bacteria 40477
515 Ga0207676_10005493 3300026095 Bacteria 8974
516 Ga0207676_10147149 3300026095 Unclassified 2024
517 Ga0207674_10000639 3300026116 Bacteria 45600
518 Ga0207674_10033527 3300026116 Bacteria 5376
519 Ga0207674_10218230 3300026116 Bacteria 1855
520 Ga0207675_100001986 3300026118 Bacteria 20396
521 Ga0207675_100002394 3300026118 Bacteria 18567
522 Ga0207683_10000048 3300026121 Bacteria 88501
523 Ga0207683_10653284 3300026121 Bacteria 974
524 Ga0207698_10000422 3300026142 Bacteria 24392
525 Ga0209179_1021066 3300027512 Bacteria 1270
526 Ga0209970_1006018 3300027614 Bacteria 1990
527 Ga0210002_1000173 3300027617 Bacteria 9401
528 Ga0209971_1002938 3300027682 Unclassified 4073
529 Ga0209966_1001936 3300027695 Bacteria 3474
530 Ga0209998_10002006 3300027717 Bacteria 4773
531 Ga0209974_10001951 3300027876 Bacteria 7529
532 Ga0209974_10074927 3300027876 Bacteria 1159
533 Ga0207428_10000247 3300027907 Bacteria 73484
534 Ga0207428_10047373 3300027907 Bacteria 3452
535 Ga0268266_10045357 3300028379 Unclassified 3761
536 Ga0268265_10001999 3300028380 Bacteria 16092
537 Ga0268265_10056973 3300028380 Bacteria 2976
538 Ga0268264_10000564 3300028381 Bacteria 45526
539 Ga0268264_10036437 3300028381 Bacteria 4053
540 Ga0268264_10153281 3300028381 Bacteria 2068
541 Ga0268264_10376184 3300028381 Bacteria 1359
542 Ga0268264_10593994 3300028381 Bacteria 1090
543 Ga0265338_10012695 3300028800 Bacteria 9587
544 Ga0265338_10023891 3300028800 Bacteria 6266
545 Ga0265338_10485846 3300028800 Bacteria 871
546 Ga0265340_10018333 3300031247 Bacteria 3611
547 Ga0265340_10079540 3300031247 Bacteria 1545
548 Ga0265339_10000060 3300031249 Bacteria 97276
549 Ga0265316_10284359 3300031344 Bacteria 1208
550 Ga0265313_10000094 3300031595 Bacteria 89774
551 Ga0265342_10179103 3300031712 Bacteria 1162
552 Ga0307405_10444091 3300031731 Unclassified 1027
553 Ga0373930_0002443 3300034816 Unclassified 2873
554 Ga0373958_0000304 3300034819 Bacteria 5915
555 Ga0373938_0000876 3300034957 Bacteria 4842
556 Ga0373926_0014401 3300035083 Bacteria 2689
557 Ga0373926_0021575 3300035083 Bacteria 2230
558 Ga0373928_0001282 3300035084 Bacteria 4947
559 Ga0373934_0000513 3300035086 Bacteria 13587
560 Ga0373934_0061466 3300035086 Bacteria 1496
561 Ga0373934_0066722 3300035086 Bacteria 1437
562 Ga0373940_0000824 3300035088 Bacteria 5153
563 Ga0373944_0033149 3300035089 Bacteria 1564
564 Ga0373944_0080266 3300035089 Bacteria 1076
565 Ga0373944_0090311 3300035089 Bacteria 1023
566 Ga0373949_0001785 3300035090 Bacteria 5901
567 Ga0373951_0003707 3300035091 Unclassified 3687
568 Ga0373952_0000082 3300035092 Bacteria 12573
569 Ga0373923_0246503 3300035111 Unclassified 835
570 Ga0373932_0000213 3300035112 Bacteria 17134
571 Ga0373936_0012907 3300035113 Bacteria 3185
572 Ga0373936_0166659 3300035113 Unclassified 962
573 Ga0373939_0000242 3300035114 Bacteria 14717
574 Ga0373941_0000041 3300035115 Bacteria 18505
575 Ga0373945_0001500 3300035116 Bacteria 7135
576 Ga0373945_0099281 3300035116 Bacteria 1137
577 Ga0373953_0011423 3300035117 Bacteria 3117
578 Ga0373954_0000396 3300035118 Bacteria 16310
579 Ga0373954_0003051 3300035118 Bacteria 7070
580 Ga0373954_0145410 3300035118 Bacteria 1157
581 Ga0373956_0000242 3300035119 Bacteria 21615
582 Ga0373957_0185848 3300035120 Bacteria 862
583 Ga0373960_0000642 3300035121 Bacteria 7175
584 Ga0373943_0001081 3300035170 Bacteria 12136
585 Ga0373943_0011836 3300035170 Bacteria 3925
586 Ga0373943_0022057 3300035170 Bacteria 2945
587 Ga0373946_0001838 3300035171 Bacteria 7420
588 Ga0373946_0064252 3300035171 Bacteria 1569
589 Ga0373946_0115877 3300035171 Bacteria 1218
590 Ga0373946_0301741 3300035171 Bacteria 792
591 Ga0373955_0015919 3300035172 Bacteria 3691
592 Ga0373942_0002012 3300035207 Bacteria 5056
593 Ga0373961_0003390 3300035241 Unclassified 3949
594 Ga0373961_0014481 3300035241 Bacteria 2004
595 Ga0373962_0000491 3300035242 Bacteria 8782
596 Ga0373924_0028819 3300035410 Bacteria 2214
597 Ga0373931_0001585 3300035691 Bacteria 9818
598 Ga0373935_0012375 3300035692 Bacteria 5134
599 Ga0373935_0049384 3300035692 Unclassified 2666
600 Ga0373935_0051894 3300035692 Bacteria 2605
601 Ga0373935_0117401 3300035692 Bacteria 1773
602 Ga0373935_0267566 3300035692 Bacteria 1200
603 Ga0373927_0000700 3300035695 Bacteria 25687
604 Ga0373927_0008415 3300035695 Bacteria 6940
605 Ga0373927_0077823 3300035695 Bacteria 2148
606 Ga0373927_0179780 3300035695 Bacteria 1387
607 Ga0373933_0144890 3300035724 Bacteria 1501
608 Ga0373947_0000333 3300035725 Bacteria 26541
609 Ga0373947_0017969 3300035725 Unclassified 4069
610 Ga0373947_0029365 3300035725 Bacteria 3226
611 Ga0373947_0048420 3300035725 Bacteria 2550
612 Ga0373947_0057193 3300035725 Bacteria 2359
613 Ga0373947_0069688 3300035725 Bacteria 2153
614 Ga0373947_0194876 3300035725 Bacteria 1323
615 Ga0373947_0695521 3300035725 Bacteria 694
616 Ga0373937_0002476 3300036401 Bacteria 15359
617 Ga0373937_0075179 3300036401 Bacteria 3118
618 Ga0373937_0630645 3300036401 Bacteria 1017
619 Ga0373925_0004318 3300037068 Bacteria 10760
620 Ga0373925_0009528 3300037068 Bacteria 7070
621 Ga0373925_0051550 3300037068 Bacteria 3072
622 Ga0373925_0094240 3300037068 Bacteria 2292
623 Ga0373925_0099152 3300037068 Bacteria 2237
624 Ga0373925_0107216 3300037068 Bacteria 2154
625 Ga0373925_0483806 3300037068 Bacteria 1015
626 Ga0395899_0068653 3300037312 Bacteria 2598
627 Ga0395899_0385710 3300037312 Bacteria 930
628 Ga0395900_0018108 3300037418 Bacteria 7187
629 Ga0395900_0065354 3300037418 Bacteria 3737
630 Ga0395900_0069692 3300037418 Plasmid 3614
631 Ga0395898_0012337 3300037466 Bacteria 8838
632 Ga0395898_0027665 3300037466 Bacteria 5687
633 Ga0395898_0104687 3300037466 Bacteria 2714
634 Ga0395901_0013142 3300038443 Bacteria 8404
635 Ga0395901_0014693 3300038443 Bacteria 7956
636 Ga0395901_0892457 3300038443 Bacteria 871
637 Ga0436365_0803561 3300039437 Bacteria 3191
638 Ga0436360_0328054 3300039438 Unclassified 2104
639 Ga0439460_0078293 3300042461 Bacteria 1034
640 Ga0466969_0231253 3300044656 Bacteria 840
641 Ga0466961_0038384 3300044693 Bacteria 3072
642 Ga0466963_0005297 3300044694 Bacteria 7538
643 Ga0466963_0139748 3300044694 Bacteria 1677
644 Ga0466971_0069800 3300044719 Bacteria 1595
645 Ga0466957_0006725 3300044842 Bacteria 6501
646 Ga0466957_0035063 3300044842 Bacteria 3011
647 Ga0466957_0103148 3300044842 Bacteria 1800
648 Ga0466957_0385732 3300044842 Unclassified 956
649 Ga0466959_0202429 3300045049 Bacteria 1382
650 Ga0451576_0638992 3300045051 Unclassified 1118
651 Ga0466958_0038915 3300045836 Bacteria 2855
652 Ga0466967_0002469 3300045976 Bacteria 11524
653 Ga0466967_0861582 3300045976 Bacteria 900
654 Ga0466967_1066149 3300045976 Unclassified 805
655 Ga0495592_0003584 3300046454 Bacteria 11159
656 Ga0495592_0010697 3300046454 Bacteria 6919
657 Ga0495592_0022246 3300046454 Bacteria 4822
658 Ga0495592_0037902 3300046454 Bacteria 3628
659 Ga0495603_0012903 3300046455 Bacteria 5051
660 Ga0495603_0038160 3300046455 Bacteria 2881
661 Ga0495629_0158784 3300046459 Bacteria 1571
662 Ga0495638_0147517 3300046460 Bacteria 1367
663 Ga0495641_0031975 3300046461 Bacteria 2509
664 Ga0495641_0070604 3300046461 Bacteria 1568
665 Ga0495641_0150386 3300046461 Bacteria 1040
666 Ga0495651_0013606 3300046462 Bacteria 6289
667 Ga0495651_0060176 3300046462 Bacteria 2910
668 Ga0495651_0121856 3300046462 Bacteria 1915
669 Ga0495651_0273646 3300046462 Bacteria 1144
670 Ga0495653_0027954 3300046463 Bacteria 4514
671 Ga0495580_0053428 3300046472 Bacteria 2850
672 Ga0495580_0142546 3300046472 Bacteria 1661
673 Ga0495582_0056326 3300046473 Bacteria 2166
674 Ga0495639_0033294 3300046475 Bacteria 2301
675 Ga0495639_0147411 3300046475 Bacteria 1134
676 Ga0495662_0021978 3300046476 Unclassified 3082
677 Ga0495662_0068074 3300046476 Bacteria 1724
678 Ga0495664_0003181 3300046477 Bacteria 8918
679 Ga0495584_0062703 3300046491 Bacteria 1868
680 Ga0495584_0144516 3300046491 Bacteria 1208
681 Ga0495584_0165797 3300046491 Bacteria 1123
682 Ga0495585_0059833 3300046492 Bacteria 2098
683 Ga0495585_0256567 3300046492 Bacteria 871
684 Ga0495594_0054448 3300046499 Bacteria 2205
685 Ga0495608_0228826 3300046511 Bacteria 1164
686 Ga0495608_0273225 3300046511 Bacteria 1050
687 Ga0495616_0068675 3300046513 Unclassified 1720
688 Ga0495618_0011939 3300046514 Bacteria 5271
689 Ga0495628_0004458 3300046516 Bacteria 12415
690 Ga0495628_0005852 3300046516 Bacteria 10772
691 Ga0495628_0021108 3300046516 Bacteria 5362
692 Ga0495628_0129667 3300046516 Bacteria 1930
693 Ga0495628_0154201 3300046516 Bacteria 1748
694 Ga0495630_0007513 3300046517 Bacteria 7787
695 Ga0495630_0021008 3300046517 Unclassified 4819
696 Ga0495630_0045190 3300046517 Bacteria 3290
697 Ga0495630_0077789 3300046517 Bacteria 2501
698 Ga0495630_0239667 3300046517 Bacteria 1386
699 Ga0495644_0015917 3300046523 Bacteria 2882
700 Ga0495644_0027880 3300046523 Bacteria 2139
701 Ga0495666_0014190 3300046526 Bacteria 3970
702 Ga0495642_0032023 3300046528 Bacteria 2109
703 Ga0495652_0011879 3300046529 Bacteria 7871
704 Ga0495652_0021842 3300046529 Bacteria 5688
705 Ga0495652_0156952 3300046529 Bacteria 1771
706 Ga0495665_0005724 3300046531 Bacteria 6707
707 Ga0495665_0024147 3300046531 Bacteria 3266
708 Ga0495665_0046947 3300046531 Bacteria 2292
709 Ga0495640_0002127 3300046533 Bacteria 15810
710 Ga0495640_0046905 3300046533 Bacteria 2991
711 Ga0495640_0098835 3300046533 Bacteria 1918
712 Ga0495640_0182000 3300046533 Bacteria 1339
713 Ga0495640_0212913 3300046533 Bacteria 1221
714 Ga0495640_0226650 3300046533 Bacteria 1177
715 Ga0495586_0004892 3300046535 Bacteria 7164
716 Ga0495586_0134079 3300046535 Bacteria 1387
717 Ga0495587_0022791 3300046536 Bacteria 3853
718 Ga0495587_0087547 3300046536 Unclassified 1802
719 Ga0495587_0240327 3300046536 Bacteria 1019
720 Ga0495645_0001047 3300046543 Bacteria 18846
721 Ga0495645_0007054 3300046543 Bacteria 7818
722 Ga0495645_0103121 3300046543 Unclassified 2027
723 Ga0495622_0121881 3300046557 Bacteria 1190
724 Ga0495667_0009542 3300046559 Bacteria 6578
725 Ga0495667_0113968 3300046559 Bacteria 1747
726 Ga0495656_0053462 3300046615 Bacteria 1735
727 Ga0495634_0008365 3300046642 Bacteria 7711
728 Ga0495634_0008703 3300046642 Bacteria 7529
729 Ga0495634_0024228 3300046642 Bacteria 4261
730 Ga0495635_0003183 3300046663 Bacteria 11305
731 Ga0495635_0025747 3300046663 Bacteria 4098
732 Ga0495659_0050730 3300046664 Bacteria 1510
733 Ga0495588_0024145 3300046674 Bacteria 3018
734 Ga0495657_0010037 3300046675 Bacteria 7142
735 Ga0495657_0191321 3300046675 Bacteria 1250
736 Ga0495657_0439279 3300046675 Bacteria 765
737 Ga0495599_0000231 3300046678 Bacteria 35177
738 Ga0495599_0006433 3300046678 Bacteria 7087
739 Ga0495599_0012765 3300046678 Bacteria 5183
740 Ga0495599_0061086 3300046678 Bacteria 2355
741 Ga0495623_0019120 3300046679 Bacteria 4425
742 Ga0495646_0075016 3300046680 Unclassified 1984
743 Ga0495646_0169997 3300046680 Bacteria 1202
744 Ga0495647_0014652 3300046681 Bacteria 2735
745 Ga0495647_0042092 3300046681 Bacteria 1742
746 Ga0495647_0202208 3300046681 Bacteria 871
747 Ga0495658_0078064 3300046683 Bacteria 1937
748 Ga0495658_0101361 3300046683 Bacteria 1719
749 Ga0495658_0278028 3300046683 Unclassified 1056
750 Ga0495669_0033233 3300046684 Bacteria 2270
751 Ga0495613_0033990 3300046689 Bacteria 3787
752 Ga0495613_0044148 3300046689 Unclassified 3298
753 Ga0495613_0102775 3300046689 Bacteria 2063
754 Ga0495613_0167425 3300046689 Bacteria 1561
755 Ga0495624_0006737 3300046690 Bacteria 8117
756 Ga0495624_0064046 3300046690 Unclassified 2298
757 Ga0495624_0130531 3300046690 Bacteria 1540
758 Ga0495624_0158217 3300046690 Bacteria 1384
759 Ga0495624_0272749 3300046690 Bacteria 1022
760 Ga0495649_0239852 3300046694 Bacteria 934
761 Ga0495600_0046307 3300046809 Bacteria 2838
762 Ga0495581_0006878 3300047315 Bacteria 6597
763 Ga0495581_0142109 3300047315 Bacteria 1400
764 Ga0495581_0184091 3300047315 Bacteria 1222
765 Ga0495604_0027933 3300047317 Bacteria 4487
766 Ga0495604_0041001 3300047317 Bacteria 3632
767 Ga0495604_0203740 3300047317 Bacteria 1371
768 Ga0495604_0361736 3300047317 Bacteria 962
769 Ga0495674_0006095 3300047319 Bacteria 11576
770 Ga0495674_0022167 3300047319 Bacteria 5860
771 Ga0495674_0221364 3300047319 Bacteria 1564
772 Ga0495674_0323045 3300047319 Bacteria 1257
773 Ga0495674_0402114 3300047319 Bacteria 1105
774 Ga0495674_0699173 3300047319 Bacteria 796
775 Ga0495676_0005365 3300047321 Bacteria 11742
776 Ga0495676_0077206 3300047321 Bacteria 2540
777 Ga0495676_0084861 3300047321 Bacteria 2388
778 Ga0495676_0275083 3300047321 Bacteria 1141
779 Ga0495680_0022525 3300047322 Bacteria 5247
780 Ga0495680_0109802 3300047322 Bacteria 2045
781 Ga0495680_0425235 3300047322 Bacteria 913
782 Ga0495680_0618145 3300047322 Bacteria 723
783 Ga0495675_0012333 3300047444 Bacteria 5379
784 Ga0495675_0052367 3300047444 Bacteria 2592
785 Ga0495675_0292704 3300047444 Unclassified 969
786 Ga0495684_0017403 3300047471 Bacteria 5533
787 Ga0495684_0024906 3300047471 Unclassified 4602
788 Ga0495684_0035789 3300047471 Unclassified 3806
789 Ga0495684_0044619 3300047471 Bacteria 3394
790 Ga0495684_0115615 3300047471 Bacteria 2023
791 Ga0495593_0031532 3300047673 Bacteria 2895
792 Ga0495593_0039687 3300047673 Bacteria 2537
793 Ga0495593_0047844 3300047673 Bacteria 2274
794 Ga0495602_0005877 3300048088 Bacteria 12883
795 Ga0495614_0051892 3300048089 Bacteria 1758
796 Ga0495615_0075150 3300048090 Bacteria 918
797 Ga0495626_0122607 3300048091 Bacteria 1116
798 Ga0496100_0000192 3300048903 Bacteria 33910
799 Ga0496100_0028248 3300048903 Bacteria 3458
800 Ga0496100_0087085 3300048903 Bacteria 2123
801 Ga0496100_0146987 3300048903 Bacteria 1677
802 Ga0496100_0394772 3300048903 Unclassified 1053
803 Ga0496101_0000274 3300048904 Bacteria 36445
804 Ga0496101_0038835 3300048904 Bacteria 3382
805 Ga0496101_0051031 3300048904 Bacteria 2980
806 Ga0496101_0703555 3300048904 Bacteria 798
807 Ga0496102_0022670 3300048905 Bacteria 5564
808 Ga0496102_0079661 3300048905 Unclassified 3016
809 Ga0496102_0215432 3300048905 Bacteria 1810
810 Ga0496103_0000937 3300048906 Bacteria 20909
811 Ga0496103_0016137 3300048906 Bacteria 4457
812 Ga0496103_0033832 3300048906 Bacteria 3123
813 Ga0496103_0048388 3300048906 Bacteria 2628
814 Ga0496104_0000086 3300048907 Bacteria 89916
815 Ga0496104_0000202 3300048907 Bacteria 53215
816 Ga0496104_0010983 3300048907 Bacteria 8103
817 Ga0496104_0048302 3300048907 Bacteria 4012
818 Ga0496104_0076993 3300048907 Unclassified 3178
819 Ga0496104_0107904 3300048907 Unclassified 2668
820 Ga0496104_0370140 3300048907 Bacteria 1346
821 Ga0496104_0963185 3300048907 Unclassified 758
822 Ga0496105_0000126 3300048908 Bacteria 51169
823 Ga0496105_0005688 3300048908 Bacteria 9488
824 Ga0496105_0008767 3300048908 Bacteria 7871
825 Ga0496105_0061668 3300048908 Bacteria 3094
826 Ga0496105_0101616 3300048908 Bacteria 2374
827 Ga0496105_0151645 3300048908 Bacteria 1905
828 Ga0496105_0239181 3300048908 Bacteria 1474
829 Ga0496105_0304425 3300048908 Unclassified 1281
830 Ga0496105_0332855 3300048908 Bacteria 1215
831 Ga0496106_0000165 3300048909 Bacteria 47763
832 Ga0496106_0019452 3300048909 Bacteria 5036
833 Ga0496106_0051204 3300048909 Bacteria 3113
834 Ga0496106_0065473 3300048909 Bacteria 2767
835 Ga0496106_0554453 3300048909 Bacteria 922
836 Ga0496107_0000591 3300048910 Bacteria 20234
837 Ga0496107_0008336 3300048910 Bacteria 7170
838 Ga0496107_0120684 3300048910 Bacteria 1931
839 Ga0496107_0236410 3300048910 Unclassified 1360
840 Ga0496107_0400798 3300048910 Bacteria 1020
841 Ga0496108_0000491 3300048911 Bacteria 31627
842 Ga0496108_0002693 3300048911 Bacteria 14213
843 Ga0496108_0010074 3300048911 Bacteria 7668
844 Ga0496108_0036494 3300048911 Bacteria 4090
845 Ga0496108_0098177 3300048911 Bacteria 2496
846 Ga0496109_0000588 3300048912 Bacteria 30434
847 Ga0496109_0006833 3300048912 Bacteria 9619
848 Ga0496109_0022279 3300048912 Bacteria 5611
849 Ga0496109_0086909 3300048912 Bacteria 2888
850 Ga0496109_0203492 3300048912 Bacteria 1861
851 Ga0496109_0282101 3300048912 Unclassified 1565
852 Ga0496109_0306920 3300048912 Bacteria 1497
853 Ga0496109_0694555 3300048912 Bacteria 955
854 Ga0496110_0012829 3300048913 Bacteria 6903
855 Ga0496110_0031862 3300048913 Bacteria 4550
856 Ga0496110_0232297 3300048913 Unclassified 1677
857 Ga0496111_0006996 3300048914 Bacteria 7364
858 Ga0496111_0009533 3300048914 Bacteria 6488
859 Ga0496112_0031885 3300048915 Bacteria 5114
860 Ga0496112_0062470 3300048915 Bacteria 3674
861 Ga0496112_0116495 3300048915 Bacteria 2642
862 Ga0496112_0133543 3300048915 Unclassified 2452
863 Ga0496112_0156354 3300048915 Bacteria 2247
864 Ga0496112_0241465 3300048915 Bacteria 1759
865 Ga0496112_0612391 3300048915 Bacteria 1020
866 Ga0496112_0647987 3300048915 Bacteria 986
867 Ga0496113_0000939 3300048916 Bacteria 15474
868 Ga0496113_0003195 3300048916 Bacteria 9762
869 Ga0496113_0039374 3300048916 Bacteria 3479
870 Ga0496113_0142170 3300048916 Bacteria 1889
871 Ga0496113_0314422 3300048916 Bacteria 1255
872 Ga0496114_0001943 3300048917 Bacteria 15729
873 Ga0496114_0027710 3300048917 Bacteria 4644
874 Ga0496114_0112142 3300048917 Bacteria 2337
875 Ga0496114_0140673 3300048917 Bacteria 2089
876 Ga0496115_0003886 3300048918 Bacteria 10773
877 Ga0496115_0010659 3300048918 Bacteria 6874
878 Ga0496115_0033362 3300048918 Bacteria 4065
879 Ga0496115_0054085 3300048918 Bacteria 3223
880 Ga0496115_0194128 3300048918 Unclassified 1677
881 Ga0496115_0213928 3300048918 Unclassified 1592
882 Ga0496121_0347084 3300048924 Bacteria 990
883 Ga0501031_0012752 3300049568 Bacteria 5492
884 Ga0501032_0059440 3300049569 Bacteria 2565
885 Ga0501034_0433447 3300049571 Unclassified 1234
886 Ga0501034_0711135 3300049571 Unclassified 902
887 Ga0501036_0083007 3300049572 Unclassified 2708
888 Ga0501037_0006156 3300049573 Bacteria 8765
889 Ga0501039_0048300 3300049575 Bacteria 3290
890 Ga0501043_0183551 3300049579 Bacteria 1629
891 Ga0501046_0222584 3300049580 Bacteria 1396
892 Ga0501047_0211125 3300049581 Bacteria 1800
893 Ga0501047_0495661 3300049581 Unclassified 1048
894 Ga0501048_0037905 3300049582 Bacteria 3461
895 Ga0501068_0029641 3300049584 Bacteria 3241
896 Ga0501069_0025872 3300049585 Bacteria 3210
897 Ga0501070_0361427 3300049586 Bacteria 1177
898 Ga0501071_0087257 3300049587 Bacteria 2289
899 Ga0501073_0040424 3300049589 Bacteria 3300
900 Ga0501074_0012373 3300049590 Bacteria 6203
901 Ga0501079_0055351 3300049741 Unclassified 3061
902 Ga0501080_0021916 3300049742 Bacteria 5917
903 Ga0501083_0038612 3300049744 Bacteria 3245
904 Ga0501044_0000318 3300049823 Bacteria 60931
905 nmdc:mga03683_268118_c1 3300050489 Bacteria 796
906 nmdc:mga03683_7449_c1 3300050489 Bacteria 3800
907 nmdc:mga03n38_117486_c1 3300050490 Bacteria 1303
908 nmdc:mga00v17_47124_c1 3300050491 Bacteria 2610
909 nmdc:mga0yw44_1853_c1 3300050492 Bacteria 8685
910 nmdc:mga0yw44_25304_c1 3300050492 Bacteria 1452
911 nmdc:mga0yw44_52683_c1 3300050492 Bacteria 2468
912 nmdc:mga0yw44_5359_c1 3300050492 Bacteria 6042
913 nmdc:mga0yw44_55125_c1 3300050492 Bacteria 2418
914 nmdc:mga0k408_39155_c1 3300050493 Bacteria 2723
915 nmdc:mga06z11_166532_c1 3300050494 Bacteria 1263
916 nmdc:mga06z11_244789_c1 3300050494 Bacteria 1054
917 nmdc:mga06z11_271443_c1 3300050494 Bacteria 1003
918 nmdc:mga06z11_339765_c1 3300050494 Bacteria 898
919 nmdc:mga06z11_4182_c1 3300050494 Bacteria 5650
920 nmdc:mga06z11_86298_c1 3300050494 Bacteria 1695
921 nmdc:mga06z11_8831_c2 3300050494 Bacteria 3082
922 nmdc:mga07m45_234028_c1 3300050496 Bacteria 1069
923 nmdc:mga0qj67_59703_c1 3300050509 Bacteria 3025
924 nmdc:mga06r32_355490_c1 3300050510 Bacteria 1449
925 nmdc:mga08y16_365734_c1 3300050511 Bacteria 1480
926 nmdc:mga08y16_937_c1 3300050511 Bacteria 28325
927 nmdc:mga0n895_340004_c1 3300050512 Bacteria 1520
928 nmdc:mga0n895_442399_c1 3300050512 Bacteria 1313
929 nmdc:mga0n895_44_c1 3300050512 Bacteria 74241
930 nmdc:mga0n895_577698_c1 3300050512 Bacteria 1128
931 nmdc:mga0rr50_25154_c1 3300050513 Unclassified 4135
932 nmdc:mga0rr50_356857_c1 3300050513 Bacteria 1230
933 nmdc:mga0rr50_402688_c1 3300050513 Bacteria 1156
934 nmdc:mga08x19_53466_c2 3300050514 Unclassified 1223
935 nmdc:mga0a205_5361_c1 3300050515 Bacteria 11558
936 Ga0495601_0000234 3300053077 Bacteria 29745
937 Ga0495601_0000334 3300053077 Bacteria 24822
938 Ga0495601_0001851 3300053077 Bacteria 11771
939 Ga0495601_0005421 3300053077 Bacteria 7428
940 Ga0495601_0130064 3300053077 Bacteria 1639
941 Ga0495601_0245023 3300053077 Bacteria 1170
942 Ga0495601_0500224 3300053077 Bacteria 784
943 Ga0495612_0000551 3300053078 Bacteria 15054
944 Ga0495612_0036235 3300053078 Bacteria 2002
945 Ga0495612_0126802 3300053078 Bacteria 1101
946 Ga0495595_0002263 3300053084 Bacteria 7495
947 Ga0495619_0000409 3300053085 Bacteria 29227
948 Ga0495619_0012959 3300053085 Bacteria 5252
949 Ga0495619_0137189 3300053085 Bacteria 1683
950 Ga0495619_0163128 3300053085 Bacteria 1539
951 Ga0500641_0036854 3300053096 Unclassified 1958
952 Ga0500652_000029 3300053131 Bacteria 91212
953 Ga0501084_0165834 3300054114 Bacteria 1864
954 Ga0501084_0184753 3300054114 Bacteria 1760
955 Ga0501082_0095283 3300060353 Bacteria 2572
956 Ga0466962_0269385 3300061719 Bacteria 839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0695521 Ga0373947_0695521_23_667 205
2 3300046455 Ga0495603_0038160 Ga0495603_0038160_2219_2863 205
3 3300046461 Ga0495641_0031975 Ga0495641_0031975_1829_2473 205
4 3300046615 Ga0495656_0053462 Ga0495656_0053462_1080_1724 205
5 3300025916 Ga0207663_10164720 Ga0207663_101647202 210
6 3300005530 Ga0070679_100043010 Ga0070679_1000430103 212
7 3300047673 Ga0495593_0031532 Ga0495593_0031532_339_986 212
8 3300005327 Ga0070658_10018800 Ga0070658_100188004 213
9 3300005327 Ga0070658_10187057 Ga0070658_101870572 213
10 3300005329 Ga0070683_100229283 Ga0070683_1002292832 213
11 3300005336 Ga0070680_100023502 Ga0070680_1000235024 213
12 3300005339 Ga0070660_100217681 Ga0070660_1002176812 213
13 3300005458 Ga0070681_10107291 Ga0070681_101072911 213
14 3300005458 Ga0070681_10815324 Ga0070681_108153241 213
15 3300005530 Ga0070679_100113686 Ga0070679_1001136862 213
16 3300005530 Ga0070679_100859558 Ga0070679_1008595581 213
17 3300005535 Ga0070684_100208472 Ga0070684_1002084721 213
18 3300005563 Ga0068855_100100907 Ga0068855_1001009073 213
19 3300005563 Ga0068855_100339620 Ga0068855_1003396202 213
20 3300005563 Ga0068855_100368481 Ga0068855_1003684811 213
21 3300005563 Ga0068855_100510372 Ga0068855_1005103722 213
22 3300005578 Ga0068854_100012521 Ga0068854_1000125216 213
23 3300005614 Ga0068856_100387849 Ga0068856_1003878492 213
24 3300005614 Ga0068856_100842825 Ga0068856_1008428251 213
25 3300005616 Ga0068852_100156312 Ga0068852_1001563122 213
26 3300005616 Ga0068852_100259708 Ga0068852_1002597082 213
27 3300006028 Ga0070717_10592195 Ga0070717_105921952 213
28 3300009093 Ga0105240_10083906 Ga0105240_100839062 213
29 3300009551 Ga0105238_10066561 Ga0105238_100665613 213
30 3300013104 Ga0157370_10016577 Ga0157370_100165773 213
31 3300013105 Ga0157369_10424242 Ga0157369_104242422 213
32 3300013105 Ga0157369_11316637 Ga0157369_113166371 213
33 3300013307 Ga0157372_10210826 Ga0157372_102108262 213
34 3300035086 Ga0373934_0000513 Ga0373934_0000513_12867_13511 213
35 3300035118 Ga0373954_0145410 Ga0373954_0145410_450_1094 213
36 3300035119 Ga0373956_0000242 Ga0373956_0000242_9931_10575 213
37 3300035172 Ga0373955_0015919 Ga0373955_0015919_210_854 213
38 3300036401 Ga0373937_0002476 Ga0373937_0002476_1859_2503 213
39 3300037068 Ga0373925_0107216 Ga0373925_0107216_944_1591 213
40 3300046462 Ga0495651_0013606 Ga0495651_0013606_3193_3837 213
41 3300047322 Ga0495680_0618145 Ga0495680_0618145_67_711 213
42 3300005336 Ga0070680_100010429 Ga0070680_1000104296 214
43 3300005339 Ga0070660_100004081 Ga0070660_1000040816 214
44 3300005341 Ga0070691_10177528 Ga0070691_101775282 214
45 3300005435 Ga0070714_100048873 Ga0070714_1000488734 214
46 3300005458 Ga0070681_10351781 Ga0070681_103517812 214
47 3300005458 Ga0070681_10359384 Ga0070681_103593842 214
48 3300005530 Ga0070679_100233869 Ga0070679_1002338692 214
49 3300005548 Ga0070665_101192653 Ga0070665_1011926531 214
50 3300006028 Ga0070717_10653955 Ga0070717_106539552 214
51 3300006175 Ga0070712_100334428 Ga0070712_1003344282 214
52 3300007788 Ga0099795_10064464 Ga0099795_100644642 214
53 3300009093 Ga0105240_10032177 Ga0105240_100321777 214
54 3300009553 Ga0105249_10392555 Ga0105249_103925552 214
55 3300013102 Ga0157371_10139602 Ga0157371_101396022 214
56 3300013104 Ga0157370_10035742 Ga0157370_100357422 214
57 3300013105 Ga0157369_10017832 Ga0157369_100178323 214
58 3300014326 Ga0157380_10101484 Ga0157380_101014842 214
59 3300025909 Ga0207705_10003149 Ga0207705_100031494 214
60 3300025913 Ga0207695_10166436 Ga0207695_101664362 214
61 3300025916 Ga0207663_10221732 Ga0207663_102217321 214
62 3300025917 Ga0207660_10045251 Ga0207660_100452514 214
63 3300025919 Ga0207657_10063434 Ga0207657_100634342 214
64 3300025921 Ga0207652_10056665 Ga0207652_100566654 214
65 3300025928 Ga0207700_10367177 Ga0207700_103671773 214
66 3300025929 Ga0207664_10297699 Ga0207664_102976992 214
67 3300025935 Ga0207709_10712133 Ga0207709_107121331 214
68 3300025939 Ga0207665_10189333 Ga0207665_101893332 214
69 3300025949 Ga0207667_10028470 Ga0207667_100284704 214
70 3300025981 Ga0207640_10055136 Ga0207640_100551362 214
71 3300035118 Ga0373954_0000396 Ga0373954_0000396_2374_3021 214
72 3300035118 Ga0373954_0003051 Ga0373954_0003051_4879_5526 214
73 3300039438 Ga0436360_0328054 Ga0436360_0328054_1443_2090 214
74 3300046454 Ga0495592_0037902 Ga0495592_0037902_741_1388 214
75 3300046462 Ga0495651_0273646 Ga0495651_0273646_54_701 214
76 3300046516 Ga0495628_0154201 Ga0495628_0154201_873_1520 214
77 3300046536 Ga0495587_0240327 Ga0495587_0240327_321_968 214
78 3300047319 Ga0495674_0323045 Ga0495674_0323045_290_937 214
79 3300048904 Ga0496101_0703555 Ga0496101_0703555_11_658 214
80 3300048907 Ga0496104_0370140 Ga0496104_0370140_274_921 214
81 3300048908 Ga0496105_0151645 Ga0496105_0151645_398_1045 214
82 3300048909 Ga0496106_0065473 Ga0496106_0065473_1937_2584 214
83 3300048911 Ga0496108_0098177 Ga0496108_0098177_824_1471 214
84 3300048912 Ga0496109_0086909 Ga0496109_0086909_1354_2001 214
85 3300048912 Ga0496109_0306920 Ga0496109_0306920_561_1211 214
86 3300005327 Ga0070658_10039788 Ga0070658_100397884 215
87 3300005435 Ga0070714_100498909 Ga0070714_1004989092 215
88 3300005436 Ga0070713_100240353 Ga0070713_1002403532 215
89 3300005458 Ga0070681_10028791 Ga0070681_100287914 215
90 3300005458 Ga0070681_10290616 Ga0070681_102906161 215
91 3300005530 Ga0070679_100497265 Ga0070679_1004972652 215
92 3300005841 Ga0068863_100282226 Ga0068863_1002822262 215
93 3300005843 Ga0068860_100153192 Ga0068860_1001531922 215
94 3300006028 Ga0070717_10134213 Ga0070717_101342132 215
95 3300013297 Ga0157378_10382848 Ga0157378_103828482 215
96 3300014497 Ga0182008_10042777 Ga0182008_100427772 215
97 3300025912 Ga0207707_10329416 Ga0207707_103294162 215
98 3300025912 Ga0207707_10676582 Ga0207707_106765822 215
99 3300025917 Ga0207660_10327407 Ga0207660_103274072 215
100 3300025921 Ga0207652_10149984 Ga0207652_101499841 215
101 3300025928 Ga0207700_10049242 Ga0207700_100492422 215
102 3300026121 Ga0207683_10653284 Ga0207683_106532841 215
103 3300028381 Ga0268264_10153281 Ga0268264_101532811 215
104 3300035086 Ga0373934_0061466 Ga0373934_0061466_666_1316 215
105 3300035086 Ga0373934_0066722 Ga0373934_0066722_705_1355 215
106 3300035089 Ga0373944_0033149 Ga0373944_0033149_476_1126 215
107 3300035113 Ga0373936_0012907 Ga0373936_0012907_1933_2583 215
108 3300035120 Ga0373957_0185848 Ga0373957_0185848_77_727 215
109 3300035171 Ga0373946_0115877 Ga0373946_0115877_255_905 215
110 3300035410 Ga0373924_0028819 Ga0373924_0028819_583_1233 215
111 3300035692 Ga0373935_0012375 Ga0373935_0012375_2079_2729 215
112 3300035695 Ga0373927_0077823 Ga0373927_0077823_623_1273 215
113 3300035724 Ga0373933_0144890 Ga0373933_0144890_569_1219 215
114 3300037068 Ga0373925_0094240 Ga0373925_0094240_298_948 215
115 3300046454 Ga0495592_0003584 Ga0495592_0003584_1525_2175 215
116 3300046454 Ga0495592_0022246 Ga0495592_0022246_3836_4486 215
117 3300046461 Ga0495641_0150386 Ga0495641_0150386_353_1003 215
118 3300046463 Ga0495653_0027954 Ga0495653_0027954_404_1054 215
119 3300046472 Ga0495580_0053428 Ga0495580_0053428_690_1340 215
120 3300046511 Ga0495608_0228826 Ga0495608_0228826_200_850 215
121 3300046516 Ga0495628_0004458 Ga0495628_0004458_10589_11239 215
122 3300046516 Ga0495628_0021108 Ga0495628_0021108_4552_5202 215
123 3300046517 Ga0495630_0045190 Ga0495630_0045190_1659_2309 215
124 3300046529 Ga0495652_0011879 Ga0495652_0011879_4643_5293 215
125 3300046531 Ga0495665_0024147 Ga0495665_0024147_2407_3057 215
126 3300046535 Ga0495586_0004892 Ga0495586_0004892_5764_6414 215
127 3300046535 Ga0495586_0134079 Ga0495586_0134079_187_837 215
128 3300046536 Ga0495587_0087547 Ga0495587_0087547_942_1592 215
129 3300046543 Ga0495645_0001047 Ga0495645_0001047_3673_4323 215
130 3300046557 Ga0495622_0121881 Ga0495622_0121881_226_876 215
131 3300046675 Ga0495657_0191321 Ga0495657_0191321_76_726 215
132 3300046678 Ga0495599_0000231 Ga0495599_0000231_3839_4489 215
133 3300046678 Ga0495599_0012765 Ga0495599_0012765_641_1291 215
134 3300046678 Ga0495599_0061086 Ga0495599_0061086_1122_1772 215
135 3300046681 Ga0495647_0042092 Ga0495647_0042092_779_1429 215
136 3300046689 Ga0495613_0033990 Ga0495613_0033990_562_1212 215
137 3300047317 Ga0495604_0041001 Ga0495604_0041001_631_1281 215
138 3300047319 Ga0495674_0022167 Ga0495674_0022167_4269_4919 215
139 3300047444 Ga0495675_0012333 Ga0495675_0012333_2501_3151 215
140 3300047444 Ga0495675_0292704 Ga0495675_0292704_39_689 215
141 3300048903 Ga0496100_0394772 Ga0496100_0394772_386_1033 215
142 3300048907 Ga0496104_0000202 Ga0496104_0000202_9756_10403 215
143 3300048907 Ga0496104_0963185 Ga0496104_0963185_33_680 215
144 3300048908 Ga0496105_0101616 Ga0496105_0101616_1106_1753 215
145 3300048908 Ga0496105_0304425 Ga0496105_0304425_196_843 215
146 3300048911 Ga0496108_0036494 Ga0496108_0036494_1819_2466 215
147 3300048915 Ga0496112_0612391 Ga0496112_0612391_264_911 215
148 3300048918 Ga0496115_0010659 Ga0496115_0010659_2551_3198 215
149 3300053077 Ga0495601_0001851 Ga0495601_0001851_3789_4439 215
150 3300053077 Ga0495601_0130064 Ga0495601_0130064_223_873 215
151 3300053078 Ga0495612_0126802 Ga0495612_0126802_210_860 215
152 3300053085 Ga0495619_0163128 Ga0495619_0163128_711_1361 215
153 3300061719 Ga0466962_0269385 Ga0466962_0269385_49_699 215
154 3300025939 Ga0207665_10206129 Ga0207665_102061292 216
155 3300031249 Ga0265339_10000060 Ga0265339_1000006030 216
156 3300031595 Ga0265313_10000094 Ga0265313_1000009426 216
157 3300031712 Ga0265342_10179103 Ga0265342_101791031 216
158 3300031731 Ga0307405_10444091 Ga0307405_104440911 216
159 3300047319 Ga0495674_0699173 Ga0495674_0699173_45_695 216
160 3300048912 Ga0496109_0694555 Ga0496109_0694555_32_682 216
161 3300048915 Ga0496112_0647987 Ga0496112_0647987_107_757 216
162 3300048918 Ga0496115_0054085 Ga0496115_0054085_2182_2832 216
163 3300003911 JGI25405J52794_10048493 JGI25405J52794_100484932 217
164 3300005336 Ga0070680_100071963 Ga0070680_1000719633 217
165 3300005336 Ga0070680_100284951 Ga0070680_1002849512 217
166 3300005434 Ga0070709_10480368 Ga0070709_104803682 217
167 3300005436 Ga0070713_100693448 Ga0070713_1006934481 217
168 3300005440 Ga0070705_100121865 Ga0070705_1001218651 217
169 3300005530 Ga0070679_100170845 Ga0070679_1001708452 217
170 3300005530 Ga0070679_100238842 Ga0070679_1002388422 217
171 3300005539 Ga0068853_101104011 Ga0068853_1011040111 217
172 3300005545 Ga0070695_100176352 Ga0070695_1001763521 217
173 3300005546 Ga0070696_100148781 Ga0070696_1001487812 217
174 3300005546 Ga0070696_100344800 Ga0070696_1003448002 217
175 3300005549 Ga0070704_100205356 Ga0070704_1002053561 217
176 3300005549 Ga0070704_100589278 Ga0070704_1005892781 217
177 3300005937 Ga0081455_10000101 Ga0081455_1000010135 217
178 3300005937 Ga0081455_10039008 Ga0081455_100390082 217
179 3300005981 Ga0081538_10017363 Ga0081538_100173631 217
180 3300006038 Ga0075365_10005268 Ga0075365_100052685 217
181 3300006038 Ga0075365_10007874 Ga0075365_100078743 217
182 3300006038 Ga0075365_10109356 Ga0075365_101093562 217
183 3300006038 Ga0075365_10132086 Ga0075365_101320862 217
184 3300006042 Ga0075368_10023670 Ga0075368_100236701 217
185 3300006173 Ga0070716_100016639 Ga0070716_1000166393 217
186 3300006177 Ga0075362_10013028 Ga0075362_100130284 217
187 3300006177 Ga0075362_10018695 Ga0075362_100186952 217
188 3300006177 Ga0075362_10376452 Ga0075362_103764521 217
189 3300006178 Ga0075367_10040861 Ga0075367_100408611 217
190 3300006178 Ga0075367_10063889 Ga0075367_100638893 217
191 3300006178 Ga0075367_10229761 Ga0075367_102297612 217
192 3300006186 Ga0075369_10013939 Ga0075369_100139392 217
193 3300006844 Ga0075428_100987142 Ga0075428_1009871421 217
194 3300006846 Ga0075430_100115497 Ga0075430_1001154972 217
195 3300006847 Ga0075431_100034133 Ga0075431_1000341335 217
196 3300006847 Ga0075431_100184245 Ga0075431_1001842451 217
197 3300006871 Ga0075434_100632417 Ga0075434_1006324172 217
198 3300006914 Ga0075436_100046321 Ga0075436_1000463213 217
199 3300007076 Ga0075435_100399154 Ga0075435_1003991542 217
200 3300007265 Ga0099794_10025438 Ga0099794_100254383 217
201 3300009093 Ga0105240_10102263 Ga0105240_101022634 217
202 3300009147 Ga0114129_10570990 Ga0114129_105709901 217
203 3300009551 Ga0105238_10029000 Ga0105238_100290007 217
204 3300010159 Ga0099796_10143375 Ga0099796_101433751 217
205 3300013104 Ga0157370_10016516 Ga0157370_100165167 217
206 3300021384 Ga0213876_10015945 Ga0213876_100159452 217
207 3300025906 Ga0207699_10225643 Ga0207699_102256432 217
208 3300025906 Ga0207699_10299458 Ga0207699_102994582 217
209 3300025913 Ga0207695_10632964 Ga0207695_106329642 217
210 3300025915 Ga0207693_10050358 Ga0207693_100503582 217
211 3300025917 Ga0207660_10092168 Ga0207660_100921681 217
212 3300025924 Ga0207694_10032288 Ga0207694_100322882 217
213 3300025939 Ga0207665_10019636 Ga0207665_100196363 217
214 3300025944 Ga0207661_10081250 Ga0207661_100812502 217
215 3300026041 Ga0207639_10781414 Ga0207639_107814141 217
216 3300027512 Ga0209179_1021066 Ga0209179_10210661 217
217 3300028800 Ga0265338_10012695 Ga0265338_100126957 217
218 3300031247 Ga0265340_10018333 Ga0265340_100183333 217
219 3300035089 Ga0373944_0080266 Ga0373944_0080266_333_986 217
220 3300035117 Ga0373953_0011423 Ga0373953_0011423_1590_2243 217
221 3300035171 Ga0373946_0301741 Ga0373946_0301741_17_670 217
222 3300035241 Ga0373961_0014481 Ga0373961_0014481_1257_1913 217
223 3300035725 Ga0373947_0057193 Ga0373947_0057193_854_1507 217
224 3300036401 Ga0373937_0075179 Ga0373937_0075179_784_1437 217
225 3300037068 Ga0373925_0099152 Ga0373925_0099152_67_720 217
226 3300039437 Ga0436365_0803561 Ga0436365_0803561_1612_2265 217
227 3300045049 Ga0466959_0202429 Ga0466959_0202429_334_993 217
228 3300046454 Ga0495592_0010697 Ga0495592_0010697_3786_4439 217
229 3300046460 Ga0495638_0147517 Ga0495638_0147517_527_1180 217
230 3300046462 Ga0495651_0060176 Ga0495651_0060176_774_1427 217
231 3300046491 Ga0495584_0144516 Ga0495584_0144516_137_790 217
232 3300046516 Ga0495628_0005852 Ga0495628_0005852_3046_3699 217
233 3300046529 Ga0495652_0021842 Ga0495652_0021842_878_1531 217
234 3300046536 Ga0495587_0022791 Ga0495587_0022791_52_705 217
235 3300046543 Ga0495645_0007054 Ga0495645_0007054_2755_3408 217
236 3300046559 Ga0495667_0009542 Ga0495667_0009542_2661_3314 217
237 3300046675 Ga0495657_0010037 Ga0495657_0010037_3351_4004 217
238 3300046678 Ga0495599_0006433 Ga0495599_0006433_3015_3668 217
239 3300046679 Ga0495623_0019120 Ga0495623_0019120_999_1652 217
240 3300046683 Ga0495658_0101361 Ga0495658_0101361_864_1517 217
241 3300046809 Ga0495600_0046307 Ga0495600_0046307_1050_1703 217
242 3300047317 Ga0495604_0027933 Ga0495604_0027933_3607_4260 217
243 3300047322 Ga0495680_0022525 Ga0495680_0022525_1500_2153 217
244 3300047444 Ga0495675_0052367 Ga0495675_0052367_1113_1766 217
245 3300047471 Ga0495684_0044619 Ga0495684_0044619_1078_1731 217
246 3300048088 Ga0495602_0005877 Ga0495602_0005877_10550_11203 217
247 3300048907 Ga0496104_0000086 Ga0496104_0000086_37113_37766 217
248 3300048907 Ga0496104_0010983 Ga0496104_0010983_137_790 217
249 3300048908 Ga0496105_0000126 Ga0496105_0000126_31571_32224 217
250 3300048908 Ga0496105_0008767 Ga0496105_0008767_7202_7855 217
251 3300048912 Ga0496109_0022279 Ga0496109_0022279_2314_2967 217
252 3300048916 Ga0496113_0314422 Ga0496113_0314422_540_1193 217
253 3300048918 Ga0496115_0213928 Ga0496115_0213928_570_1232 217
254 3300048924 Ga0496121_0347084 Ga0496121_0347084_217_879 217
255 3300049568 Ga0501031_0012752 Ga0501031_0012752_1532_2185 217
256 3300049569 Ga0501032_0059440 Ga0501032_0059440_612_1265 217
257 3300049571 Ga0501034_0433447 Ga0501034_0433447_537_1190 217
258 3300049571 Ga0501034_0711135 Ga0501034_0711135_118_771 217
259 3300049572 Ga0501036_0083007 Ga0501036_0083007_1819_2472 217
260 3300049573 Ga0501037_0006156 Ga0501037_0006156_7501_8154 217
261 3300049575 Ga0501039_0048300 Ga0501039_0048300_806_1459 217
262 3300049579 Ga0501043_0183551 Ga0501043_0183551_612_1265 217
263 3300049580 Ga0501046_0222584 Ga0501046_0222584_132_785 217
264 3300049581 Ga0501047_0211125 Ga0501047_0211125_484_1137 217
265 3300049581 Ga0501047_0495661 Ga0501047_0495661_269_922 217
266 3300049582 Ga0501048_0037905 Ga0501048_0037905_1563_2216 217
267 3300049584 Ga0501068_0029641 Ga0501068_0029641_1150_1803 217
268 3300049585 Ga0501069_0025872 Ga0501069_0025872_1564_2217 217
269 3300049586 Ga0501070_0361427 Ga0501070_0361427_324_977 217
270 3300049587 Ga0501071_0087257 Ga0501071_0087257_966_1619 217
271 3300049589 Ga0501073_0040424 Ga0501073_0040424_839_1492 217
272 3300049590 Ga0501074_0012373 Ga0501074_0012373_1708_2361 217
273 3300049741 Ga0501079_0055351 Ga0501079_0055351_1920_2573 217
274 3300049742 Ga0501080_0021916 Ga0501080_0021916_3408_4061 217
275 3300049744 Ga0501083_0038612 Ga0501083_0038612_1752_2405 217
276 3300049823 Ga0501044_0000318 Ga0501044_0000318_49075_49728 217
277 3300050489 nmdc:mga03683_268118_c1 nmdc:mga03683_268118_c1_80_745 217
278 3300050489 nmdc:mga03683_7449_c1 nmdc:mga03683_7449_c1_293_991 217
279 3300050490 nmdc:mga03n38_117486_c1 nmdc:mga03n38_117486_c1_85_750 217
280 3300050491 nmdc:mga00v17_47124_c1 nmdc:mga00v17_47124_c1_477_1175 217
281 3300050492 nmdc:mga0yw44_1853_c1 nmdc:mga0yw44_1853_c1_4082_4780 217
282 3300050492 nmdc:mga0yw44_5359_c1 nmdc:mga0yw44_5359_c1_2452_3129 217
283 3300050492 nmdc:mga0yw44_55125_c1 nmdc:mga0yw44_55125_c1_503_1156 217
284 3300050494 nmdc:mga06z11_339765_c1 nmdc:mga06z11_339765_c1_50_715 217
285 3300050494 nmdc:mga06z11_86298_c1 nmdc:mga06z11_86298_c1_729_1406 217
286 3300050509 nmdc:mga0qj67_59703_c1 nmdc:mga0qj67_59703_c1_1634_2287 217
287 3300050510 nmdc:mga06r32_355490_c1 nmdc:mga06r32_355490_c1_749_1402 217
288 3300050511 nmdc:mga08y16_365734_c1 nmdc:mga08y16_365734_c1_197_895 217
289 3300050512 nmdc:mga0n895_340004_c1 nmdc:mga0n895_340004_c1_635_1291 217
290 3300050512 nmdc:mga0n895_442399_c1 nmdc:mga0n895_442399_c1_405_1058 217
291 3300050513 nmdc:mga0rr50_402688_c1 nmdc:mga0rr50_402688_c1_342_995 217
292 3300050514 nmdc:mga08x19_53466_c2 nmdc:mga08x19_53466_c2_231_887 217
293 3300053077 Ga0495601_0000234 Ga0495601_0000234_28436_29089 217
294 3300053078 Ga0495612_0036235 Ga0495612_0036235_437_1090 217
295 3300053084 Ga0495595_0002263 Ga0495595_0002263_777_1430 217
296 3300053085 Ga0495619_0000409 Ga0495619_0000409_20517_21170 217
297 3300053096 Ga0500641_0036854 Ga0500641_0036854_1166_1831 217
298 3300054114 Ga0501084_0165834 Ga0501084_0165834_364_1017 217
299 3300060353 Ga0501082_0095283 Ga0501082_0095283_864_1517 217
300 3300001904 JGI24736J21556_1015158 JGI24736J21556_10151581 218
301 3300001977 JGI24746J21847_1000854 JGI24746J21847_10008543 218
302 3300001978 JGI24747J21853_1000051 JGI24747J21853_10000514 218
303 3300001989 JGI24739J22299_10000369 JGI24739J22299_1000036914 218
304 3300001990 JGI24737J22298_10000226 JGI24737J22298_100002265 218
305 3300001990 JGI24737J22298_10014093 JGI24737J22298_100140931 218
306 3300001991 JGI24743J22301_10012087 JGI24743J22301_100120872 218
307 3300002070 JGI24750J21931_1000087 JGI24750J21931_10000875 218
308 3300002070 JGI24750J21931_1002087 JGI24750J21931_10020874 218
309 3300002073 JGI24745J21846_1000024 JGI24745J21846_10000248 218
310 3300002073 JGI24745J21846_1008193 JGI24745J21846_10081932 218
311 3300002074 JGI24748J21848_1000154 JGI24748J21848_10001546 218
312 3300002075 JGI24738J21930_10000105 JGI24738J21930_1000010512 218
313 3300002075 JGI24738J21930_10010784 JGI24738J21930_100107842 218
314 3300002076 JGI24749J21850_1000463 JGI24749J21850_10004635 218
315 3300002077 JGI24744J21845_10000489 JGI24744J21845_100004893 218
316 3300002126 JGI24035J26624_1000284 JGI24035J26624_10002845 218
317 3300002155 JGI24033J26618_1000269 JGI24033J26618_10002695 218
318 3300002239 JGI24034J26672_10000118 JGI24034J26672_100001184 218
319 3300002239 JGI24034J26672_10003762 JGI24034J26672_100037623 218
320 3300002244 JGI24742J22300_10001512 JGI24742J22300_100015124 218
321 3300002244 JGI24742J22300_10007049 JGI24742J22300_100070492 218
322 3300002459 JGI24751J29686_10034246 JGI24751J29686_100342462 218
323 3300003659 JGI25404J52841_10022171 JGI25404J52841_100221712 218
324 3300005290 Ga0065712_10071547 Ga0065712_100715474 218
325 3300005290 Ga0065712_10081467 Ga0065712_100814671 218
326 3300005293 Ga0065715_10000418 Ga0065715_100004187 218
327 3300005293 Ga0065715_10139317 Ga0065715_101393172 218
328 3300005328 Ga0070676_10002237 Ga0070676_100022374 218
329 3300005329 Ga0070683_100000603 Ga0070683_10000060310 218
330 3300005329 Ga0070683_100022410 Ga0070683_1000224106 218
331 3300005329 Ga0070683_100201757 Ga0070683_1002017572 218
332 3300005330 Ga0070690_100000295 Ga0070690_10000029510 218
333 3300005330 Ga0070690_100050293 Ga0070690_1000502932 218
334 3300005330 Ga0070690_100057076 Ga0070690_1000570763 218
335 3300005330 Ga0070690_100085675 Ga0070690_1000856753 218
336 3300005331 Ga0070670_100003650 Ga0070670_1000036504 218
337 3300005331 Ga0070670_100148307 Ga0070670_1001483072 218
338 3300005331 Ga0070670_100230467 Ga0070670_1002304672 218
339 3300005333 Ga0070677_10000052 Ga0070677_1000005229 218
340 3300005334 Ga0068869_100000872 Ga0068869_1000008728 218
341 3300005334 Ga0068869_100012626 Ga0068869_1000126263 218
342 3300005335 Ga0070666_10024897 Ga0070666_100248973 218
343 3300005335 Ga0070666_10043795 Ga0070666_100437952 218
344 3300005335 Ga0070666_10176454 Ga0070666_101764542 218
345 3300005336 Ga0070680_100002210 Ga0070680_1000022109 218
346 3300005336 Ga0070680_100238893 Ga0070680_1002388932 218
347 3300005336 Ga0070680_100377619 Ga0070680_1003776192 218
348 3300005337 Ga0070682_100000952 Ga0070682_1000009523 218
349 3300005337 Ga0070682_100041992 Ga0070682_1000419923 218
350 3300005338 Ga0068868_100000382 Ga0068868_10000038222 218
351 3300005338 Ga0068868_100013269 Ga0068868_1000132692 218
352 3300005338 Ga0068868_100048416 Ga0068868_1000484162 218
353 3300005339 Ga0070660_100001046 Ga0070660_10000104616 218
354 3300005340 Ga0070689_100000893 Ga0070689_1000008935 218
355 3300005340 Ga0070689_100652330 Ga0070689_1006523301 218
356 3300005341 Ga0070691_10007217 Ga0070691_100072174 218
357 3300005343 Ga0070687_100000133 Ga0070687_10000013316 218
358 3300005343 Ga0070687_100007639 Ga0070687_1000076393 218
359 3300005343 Ga0070687_100084047 Ga0070687_1000840472 218
360 3300005344 Ga0070661_100000227 Ga0070661_10000022710 218
361 3300005344 Ga0070661_100066522 Ga0070661_1000665222 218
362 3300005344 Ga0070661_100438494 Ga0070661_1004384942 218
363 3300005345 Ga0070692_10000036 Ga0070692_1000003617 218
364 3300005345 Ga0070692_10007567 Ga0070692_100075674 218
365 3300005347 Ga0070668_100000502 Ga0070668_10000050216 218
366 3300005347 Ga0070668_100003914 Ga0070668_1000039148 218
367 3300005353 Ga0070669_100001485 Ga0070669_10000148516 218
368 3300005353 Ga0070669_100716280 Ga0070669_1007162801 218
369 3300005354 Ga0070675_100000549 Ga0070675_10000054916 218
370 3300005354 Ga0070675_100028863 Ga0070675_1000288634 218
371 3300005355 Ga0070671_100003505 Ga0070671_10000350510 218
372 3300005355 Ga0070671_100164315 Ga0070671_1001643151 218
373 3300005356 Ga0070674_100001796 Ga0070674_1000017962 218
374 3300005356 Ga0070674_100006336 Ga0070674_1000063364 218
375 3300005364 Ga0070673_100000307 Ga0070673_10000030710 218
376 3300005364 Ga0070673_100032250 Ga0070673_1000322504 218
377 3300005364 Ga0070673_100305049 Ga0070673_1003050492 218
378 3300005365 Ga0070688_100006306 Ga0070688_1000063064 218
379 3300005365 Ga0070688_100017651 Ga0070688_1000176512 218
380 3300005365 Ga0070688_100406180 Ga0070688_1004061802 218
381 3300005366 Ga0070659_100001361 Ga0070659_1000013619 218
382 3300005366 Ga0070659_100020664 Ga0070659_1000206644 218
383 3300005367 Ga0070667_100002130 Ga0070667_10000213011 218
384 3300005367 Ga0070667_100406309 Ga0070667_1004063092 218
385 3300005406 Ga0070703_10006103 Ga0070703_100061032 218
386 3300005434 Ga0070709_10209208 Ga0070709_102092081 218
387 3300005434 Ga0070709_10447850 Ga0070709_104478501 218
388 3300005436 Ga0070713_100108527 Ga0070713_1001085273 218
389 3300005438 Ga0070701_10001033 Ga0070701_100010335 218
390 3300005439 Ga0070711_100041039 Ga0070711_1000410392 218
391 3300005439 Ga0070711_100046185 Ga0070711_1000461853 218
392 3300005440 Ga0070705_100001145 Ga0070705_1000011455 218
393 3300005440 Ga0070705_100771827 Ga0070705_1007718271 218
394 3300005441 Ga0070700_100000299 Ga0070700_10000029916 218
395 3300005441 Ga0070700_100105524 Ga0070700_1001055242 218
396 3300005444 Ga0070694_100001042 Ga0070694_1000010425 218
397 3300005444 Ga0070694_100103422 Ga0070694_1001034221 218
398 3300005444 Ga0070694_100281728 Ga0070694_1002817282 218
399 3300005445 Ga0070708_100050297 Ga0070708_1000502971 218
400 3300005455 Ga0070663_100000229 Ga0070663_1000002298 218
401 3300005455 Ga0070663_100004867 Ga0070663_1000048675 218
402 3300005455 Ga0070663_100403681 Ga0070663_1004036812 218
403 3300005456 Ga0070678_100000314 Ga0070678_1000003148 218
404 3300005456 Ga0070678_100154305 Ga0070678_1001543053 218
405 3300005457 Ga0070662_100000997 Ga0070662_1000009978 218
406 3300005458 Ga0070681_10000842 Ga0070681_1000084210 218
407 3300005458 Ga0070681_10100415 Ga0070681_101004152 218
408 3300005458 Ga0070681_10149479 Ga0070681_101494792 218
409 3300005459 Ga0068867_100001094 Ga0068867_10000109415 218
410 3300005459 Ga0068867_100052105 Ga0068867_1000521052 218
411 3300005466 Ga0070685_10000472 Ga0070685_1000047210 218
412 3300005466 Ga0070685_10003880 Ga0070685_100038802 218
413 3300005530 Ga0070679_100000901 Ga0070679_10000090117 218
414 3300005530 Ga0070679_100451749 Ga0070679_1004517492 218
415 3300005535 Ga0070684_100001807 Ga0070684_1000018079 218
416 3300005535 Ga0070684_100253295 Ga0070684_1002532951 218
417 3300005539 Ga0068853_100000604 Ga0068853_10000060410 218
418 3300005539 Ga0068853_100049760 Ga0068853_1000497603 218
419 3300005543 Ga0070672_100000441 Ga0070672_10000044116 218
420 3300005543 Ga0070672_100120036 Ga0070672_1001200363 218
421 3300005544 Ga0070686_100000472 Ga0070686_10000047215 218
422 3300005544 Ga0070686_100007854 Ga0070686_1000078545 218
423 3300005544 Ga0070686_100112284 Ga0070686_1001122841 218
424 3300005545 Ga0070695_100001750 Ga0070695_10000175012 218
425 3300005545 Ga0070695_100266134 Ga0070695_1002661342 218
426 3300005546 Ga0070696_100015450 Ga0070696_1000154502 218
427 3300005547 Ga0070693_100000802 Ga0070693_10000080210 218
428 3300005547 Ga0070693_100191504 Ga0070693_1001915042 218
429 3300005548 Ga0070665_100057497 Ga0070665_1000574972 218
430 3300005549 Ga0070704_100000249 Ga0070704_10000024914 218
431 3300005549 Ga0070704_100155519 Ga0070704_1001555192 218
432 3300005549 Ga0070704_100495282 Ga0070704_1004952821 218
433 3300005563 Ga0068855_100043683 Ga0068855_1000436835 218
434 3300005563 Ga0068855_100375293 Ga0068855_1003752932 218
435 3300005563 Ga0068855_100375542 Ga0068855_1003755422 218
436 3300005564 Ga0070664_100002205 Ga0070664_1000022059 218
437 3300005564 Ga0070664_100216049 Ga0070664_1002160492 218
438 3300005577 Ga0068857_100001686 Ga0068857_10000168611 218
439 3300005577 Ga0068857_100105868 Ga0068857_1001058683 218
440 3300005578 Ga0068854_100000537 Ga0068854_10000053714 218
441 3300005578 Ga0068854_100066223 Ga0068854_1000662233 218
442 3300005578 Ga0068854_100066694 Ga0068854_1000666942 218
443 3300005614 Ga0068856_100001201 Ga0068856_10000120112 218
444 3300005614 Ga0068856_100061509 Ga0068856_1000615094 218
445 3300005614 Ga0068856_100072446 Ga0068856_1000724462 218
446 3300005615 Ga0070702_100000515 Ga0070702_10000051510 218
447 3300005615 Ga0070702_100001258 Ga0070702_1000012586 218
448 3300005616 Ga0068852_100002309 Ga0068852_1000023093 218
449 3300005616 Ga0068852_100004218 Ga0068852_1000042188 218
450 3300005617 Ga0068859_100005362 Ga0068859_10000536210 218
451 3300005617 Ga0068859_100054148 Ga0068859_1000541483 218
452 3300005618 Ga0068864_100001021 Ga0068864_10000102110 218
453 3300005618 Ga0068864_100013595 Ga0068864_1000135953 218
454 3300005618 Ga0068864_100160385 Ga0068864_1001603852 218
455 3300005718 Ga0068866_10000236 Ga0068866_1000023617 218
456 3300005718 Ga0068866_10005171 Ga0068866_100051713 218
457 3300005719 Ga0068861_100002864 Ga0068861_1000028648 218
458 3300005719 Ga0068861_100192642 Ga0068861_1001926421 218
459 3300005834 Ga0068851_10438477 Ga0068851_104384771 218
460 3300005840 Ga0068870_10000078 Ga0068870_1000007817 218
461 3300005840 Ga0068870_10012275 Ga0068870_100122754 218
462 3300005841 Ga0068863_100002772 Ga0068863_1000027728 218
463 3300005841 Ga0068863_100010880 Ga0068863_1000108807 218
464 3300005842 Ga0068858_100001533 Ga0068858_10000153317 218
465 3300005842 Ga0068858_100110205 Ga0068858_1001102053 218
466 3300005842 Ga0068858_100121772 Ga0068858_1001217723 218
467 3300005842 Ga0068858_100230438 Ga0068858_1002304382 218
468 3300005843 Ga0068860_100003739 Ga0068860_1000037398 218
469 3300005843 Ga0068860_100079739 Ga0068860_1000797393 218
470 3300005843 Ga0068860_100449551 Ga0068860_1004495512 218
471 3300005843 Ga0068860_100524217 Ga0068860_1005242171 218
472 3300005844 Ga0068862_100001100 Ga0068862_10000110016 218
473 3300005844 Ga0068862_100138980 Ga0068862_1001389803 218
474 3300005937 Ga0081455_10235698 Ga0081455_102356982 218
475 3300005983 Ga0081540_1000381 Ga0081540_100038125 218
476 3300005985 Ga0081539_10164272 Ga0081539_101642722 218
477 3300006028 Ga0070717_10350054 Ga0070717_103500541 218
478 3300006038 Ga0075365_10056258 Ga0075365_100562582 218
479 3300006038 Ga0075365_10150080 Ga0075365_101500802 218
480 3300006048 Ga0075363_100093767 Ga0075363_1000937672 218
481 3300006058 Ga0075432_10009321 Ga0075432_100093214 218
482 3300006175 Ga0070712_100006230 Ga0070712_10000623011 218
483 3300006178 Ga0075367_10029844 Ga0075367_100298442 218
484 3300006178 Ga0075367_10052759 Ga0075367_100527592 218
485 3300006178 Ga0075367_10125685 Ga0075367_101256852 218
486 3300006195 Ga0075366_10000790 Ga0075366_100007902 218
487 3300006237 Ga0097621_100000019 Ga0097621_10000001930 218
488 3300006353 Ga0075370_10246300 Ga0075370_102463002 218
489 3300006358 Ga0068871_100000116 Ga0068871_10000011638 218
490 3300006358 Ga0068871_100089342 Ga0068871_1000893422 218
491 3300006358 Ga0068871_100959318 Ga0068871_1009593181 218
492 3300006844 Ga0075428_100036400 Ga0075428_1000364003 218
493 3300006852 Ga0075433_10003904 Ga0075433_100039042 218
494 3300006871 Ga0075434_100000042 Ga0075434_10000004242 218
495 3300006881 Ga0068865_100000344 Ga0068865_10000034416 218
496 3300006931 Ga0097620_100005362 Ga0097620_1000053623 218
497 3300006931 Ga0097620_100054148 Ga0097620_1000541483 218
498 3300009036 Ga0105244_10012496 Ga0105244_100124962 218
499 3300009092 Ga0105250_10053699 Ga0105250_100536992 218
500 3300009092 Ga0105250_10062212 Ga0105250_100622121 218
501 3300009093 Ga0105240_10693439 Ga0105240_106934392 218
502 3300009093 Ga0105240_10713413 Ga0105240_107134132 218
503 3300009093 Ga0105240_11059642 Ga0105240_110596422 218
504 3300009094 Ga0111539_10002257 Ga0111539_1000225716 218
505 3300009094 Ga0111539_10030036 Ga0111539_100300365 218
506 3300009098 Ga0105245_10000142 Ga0105245_1000014216 218
507 3300009098 Ga0105245_10022285 Ga0105245_100222852 218
508 3300009098 Ga0105245_10031740 Ga0105245_100317402 218
509 3300009098 Ga0105245_10594239 Ga0105245_105942392 218
510 3300009101 Ga0105247_10001283 Ga0105247_100012837 218
511 3300009101 Ga0105247_10012239 Ga0105247_100122392 218
512 3300009101 Ga0105247_10022157 Ga0105247_100221573 218
513 3300009101 Ga0105247_10070770 Ga0105247_100707702 218
514 3300009147 Ga0114129_10018704 Ga0114129_100187042 218
515 3300009148 Ga0105243_10001269 Ga0105243_1000126914 218
516 3300009148 Ga0105243_10084350 Ga0105243_100843502 218
517 3300009148 Ga0105243_11402601 Ga0105243_114026011 218
518 3300009174 Ga0105241_10000867 Ga0105241_1000086710 218
519 3300009174 Ga0105241_10146766 Ga0105241_101467662 218
520 3300009174 Ga0105241_10346279 Ga0105241_103462792 218
521 3300009176 Ga0105242_10000723 Ga0105242_1000072316 218
522 3300009176 Ga0105242_10094039 Ga0105242_100940392 218
523 3300009176 Ga0105242_10228251 Ga0105242_102282512 218
524 3300009176 Ga0105242_10370117 Ga0105242_103701172 218
525 3300009176 Ga0105242_10784657 Ga0105242_107846571 218
526 3300009177 Ga0105248_10001535 Ga0105248_1000153516 218
527 3300009177 Ga0105248_10031227 Ga0105248_100312272 218
528 3300009177 Ga0105248_10065376 Ga0105248_100653764 218
529 3300009177 Ga0105248_10100303 Ga0105248_101003031 218
530 3300009177 Ga0105248_10652751 Ga0105248_106527512 218
531 3300009545 Ga0105237_10002792 Ga0105237_1000279216 218
532 3300009551 Ga0105238_10098234 Ga0105238_100982343 218
533 3300009551 Ga0105238_10314643 Ga0105238_103146432 218
534 3300009551 Ga0105238_10317439 Ga0105238_103174391 218
535 3300009553 Ga0105249_10002090 Ga0105249_100020908 218
536 3300009553 Ga0105249_10104222 Ga0105249_101042221 218
537 3300010375 Ga0105239_10000656 Ga0105239_1000065634 218
538 3300010375 Ga0105239_10421183 Ga0105239_104211832 218
539 3300010375 Ga0105239_10789794 Ga0105239_107897942 218
540 3300011119 Ga0105246_10000027 Ga0105246_100000273 218
541 3300011119 Ga0105246_10067310 Ga0105246_100673103 218
542 3300011119 Ga0105246_10198138 Ga0105246_101981382 218
543 3300011119 Ga0105246_11004835 Ga0105246_110048351 218
544 3300013100 Ga0157373_10001829 Ga0157373_100018291 218
545 3300013100 Ga0157373_10130104 Ga0157373_101301042 218
546 3300013102 Ga0157371_10049537 Ga0157371_100495374 218
547 3300013102 Ga0157371_10076097 Ga0157371_100760972 218
548 3300013105 Ga0157369_10215308 Ga0157369_102153082 218
549 3300013296 Ga0157374_10003115 Ga0157374_1000311512 218
550 3300013297 Ga0157378_10001009 Ga0157378_1000100916 218
551 3300013297 Ga0157378_10255655 Ga0157378_102556552 218
552 3300013297 Ga0157378_10503565 Ga0157378_105035652 218
553 3300013306 Ga0163162_10001974 Ga0163162_1000197416 218
554 3300013306 Ga0163162_10131582 Ga0163162_101315822 218
555 3300013306 Ga0163162_10982340 Ga0163162_109823402 218
556 3300013307 Ga0157372_10011452 Ga0157372_1001145210 218
557 3300013308 Ga0157375_10001521 Ga0157375_1000152110 218
558 3300013308 Ga0157375_10019190 Ga0157375_100191902 218
559 3300013308 Ga0157375_10308728 Ga0157375_103087282 218
560 3300014325 Ga0163163_10000820 Ga0163163_1000082012 218
561 3300014325 Ga0163163_10003436 Ga0163163_100034368 218
562 3300014325 Ga0163163_10004470 Ga0163163_1000447014 218
563 3300014325 Ga0163163_10011021 Ga0163163_100110215 218
564 3300014326 Ga0157380_10000425 Ga0157380_1000042516 218
565 3300014326 Ga0157380_10195477 Ga0157380_101954772 218
566 3300014745 Ga0157377_10000136 Ga0157377_1000013614 218
567 3300014745 Ga0157377_10011195 Ga0157377_100111953 218
568 3300014968 Ga0157379_10002085 Ga0157379_1000208510 218
569 3300014968 Ga0157379_10007724 Ga0157379_100077248 218
570 3300014968 Ga0157379_10095217 Ga0157379_100952173 218
571 3300014968 Ga0157379_10522464 Ga0157379_105224641 218
572 3300014969 Ga0157376_10000073 Ga0157376_1000007329 218
573 3300017792 Ga0163161_10000501 Ga0163161_100005019 218
574 3300020070 Ga0206356_10899486 Ga0206356_108994862 218
575 3300020082 Ga0206353_10581821 Ga0206353_105818212 218
576 3300022467 Ga0224712_10256067 Ga0224712_102560671 218
577 3300025271 Ga0207666_1000065 Ga0207666_10000659 218
578 3300025290 Ga0207673_1000020 Ga0207673_10000207 218
579 3300025315 Ga0207697_10000738 Ga0207697_1000073816 218
580 3300025315 Ga0207697_10041384 Ga0207697_100413842 218
581 3300025885 Ga0207653_10000595 Ga0207653_100005957 218
582 3300025893 Ga0207682_10000083 Ga0207682_100000832 218
583 3300025898 Ga0207692_10313998 Ga0207692_103139982 218
584 3300025899 Ga0207642_10000826 Ga0207642_100008264 218
585 3300025900 Ga0207710_10002789 Ga0207710_100027892 218
586 3300025900 Ga0207710_10007039 Ga0207710_100070394 218
587 3300025900 Ga0207710_10045064 Ga0207710_100450642 218
588 3300025901 Ga0207688_10000170 Ga0207688_1000017026 218
589 3300025901 Ga0207688_10001718 Ga0207688_100017183 218
590 3300025903 Ga0207680_10006169 Ga0207680_100061693 218
591 3300025904 Ga0207647_10005586 Ga0207647_1000558610 218
592 3300025907 Ga0207645_10000256 Ga0207645_1000025632 218
593 3300025907 Ga0207645_10054338 Ga0207645_100543383 218
594 3300025908 Ga0207643_10000116 Ga0207643_1000011625 218
595 3300025908 Ga0207643_10001175 Ga0207643_100011757 218
596 3300025911 Ga0207654_10000984 Ga0207654_100009845 218
597 3300025912 Ga0207707_10001987 Ga0207707_100019875 218
598 3300025912 Ga0207707_10425069 Ga0207707_104250692 218
599 3300025913 Ga0207695_10233896 Ga0207695_102338962 218
600 3300025914 Ga0207671_10008772 Ga0207671_100087722 218
601 3300025915 Ga0207693_10004856 Ga0207693_100048567 218
602 3300025915 Ga0207693_10013979 Ga0207693_100139796 218
603 3300025916 Ga0207663_10035608 Ga0207663_100356083 218
604 3300025917 Ga0207660_10000043 Ga0207660_1000004344 218
605 3300025917 Ga0207660_10439545 Ga0207660_104395451 218
606 3300025918 Ga0207662_10000137 Ga0207662_100001375 218
607 3300025918 Ga0207662_10001037 Ga0207662_100010379 218
608 3300025919 Ga0207657_10001419 Ga0207657_1000141910 218
609 3300025919 Ga0207657_10315559 Ga0207657_103155592 218
610 3300025920 Ga0207649_10000735 Ga0207649_1000073510 218
611 3300025920 Ga0207649_10194958 Ga0207649_101949582 218
612 3300025921 Ga0207652_10000389 Ga0207652_1000038928 218
613 3300025921 Ga0207652_10267808 Ga0207652_102678082 218
614 3300025921 Ga0207652_10399437 Ga0207652_103994372 218
615 3300025923 Ga0207681_10000066 Ga0207681_1000006637 218
616 3300025924 Ga0207694_10096671 Ga0207694_100966712 218
617 3300025924 Ga0207694_10379544 Ga0207694_103795441 218
618 3300025925 Ga0207650_10001332 Ga0207650_100013324 218
619 3300025925 Ga0207650_10147517 Ga0207650_101475172 218
620 3300025925 Ga0207650_10170233 Ga0207650_101702332 218
621 3300025926 Ga0207659_10000100 Ga0207659_1000010018 218
622 3300025926 Ga0207659_10070603 Ga0207659_100706033 218
623 3300025927 Ga0207687_10000052 Ga0207687_1000005231 218
624 3300025927 Ga0207687_10018933 Ga0207687_100189331 218
625 3300025927 Ga0207687_10798680 Ga0207687_107986801 218
626 3300025929 Ga0207664_10423897 Ga0207664_104238971 218
627 3300025931 Ga0207644_10002133 Ga0207644_100021335 218
628 3300025932 Ga0207690_10001339 Ga0207690_100013396 218
629 3300025932 Ga0207690_10137473 Ga0207690_101374732 218
630 3300025933 Ga0207706_10002322 Ga0207706_1000232216 218
631 3300025933 Ga0207706_10002700 Ga0207706_1000270011 218
632 3300025934 Ga0207686_10001022 Ga0207686_1000102214 218
633 3300025934 Ga0207686_10032159 Ga0207686_100321592 218
634 3300025934 Ga0207686_10526018 Ga0207686_105260182 218
635 3300025935 Ga0207709_10000243 Ga0207709_1000024318 218
636 3300025935 Ga0207709_10066388 Ga0207709_100663882 218
637 3300025936 Ga0207670_10000121 Ga0207670_1000012141 218
638 3300025936 Ga0207670_10709457 Ga0207670_107094571 218
639 3300025937 Ga0207669_10000034 Ga0207669_1000003444 218
640 3300025938 Ga0207704_10000095 Ga0207704_1000009536 218
641 3300025938 Ga0207704_10299016 Ga0207704_102990162 218
642 3300025939 Ga0207665_10017519 Ga0207665_100175194 218
643 3300025940 Ga0207691_10001151 Ga0207691_1000115125 218
644 3300025940 Ga0207691_10002238 Ga0207691_100022383 218
645 3300025941 Ga0207711_10001119 Ga0207711_1000111910 218
646 3300025941 Ga0207711_10018088 Ga0207711_100180882 218
647 3300025941 Ga0207711_10050447 Ga0207711_100504472 218
648 3300025941 Ga0207711_10572094 Ga0207711_105720942 218
649 3300025942 Ga0207689_10000621 Ga0207689_1000062110 218
650 3300025942 Ga0207689_10012057 Ga0207689_100120574 218
651 3300025944 Ga0207661_10000113 Ga0207661_1000011314 218
652 3300025944 Ga0207661_10161906 Ga0207661_101619062 218
653 3300025945 Ga0207679_10000052 Ga0207679_1000005251 218
654 3300025945 Ga0207679_10207197 Ga0207679_102071972 218
655 3300025945 Ga0207679_10519730 Ga0207679_105197302 218
656 3300025949 Ga0207667_10008923 Ga0207667_100089234 218
657 3300025949 Ga0207667_10295179 Ga0207667_102951792 218
658 3300025960 Ga0207651_10000260 Ga0207651_1000026011 218
659 3300025960 Ga0207651_10293884 Ga0207651_102938842 218
660 3300025961 Ga0207712_10002918 Ga0207712_100029182 218
661 3300025961 Ga0207712_10054805 Ga0207712_100548053 218
662 3300025972 Ga0207668_10001504 Ga0207668_100015044 218
663 3300025981 Ga0207640_10000129 Ga0207640_1000012942 218
664 3300025981 Ga0207640_10054497 Ga0207640_100544972 218
665 3300025981 Ga0207640_10090814 Ga0207640_100908141 218
666 3300025986 Ga0207658_10000992 Ga0207658_1000099214 218
667 3300025986 Ga0207658_10056368 Ga0207658_100563683 218
668 3300025986 Ga0207658_10337929 Ga0207658_103379292 218
669 3300026023 Ga0207677_10000475 Ga0207677_1000047510 218
670 3300026023 Ga0207677_10006628 Ga0207677_100066285 218
671 3300026023 Ga0207677_10121259 Ga0207677_101212592 218
672 3300026035 Ga0207703_10018841 Ga0207703_100188416 218
673 3300026035 Ga0207703_10026797 Ga0207703_100267972 218
674 3300026035 Ga0207703_10731676 Ga0207703_107316762 218
675 3300026067 Ga0207678_10001680 Ga0207678_100016806 218
676 3300026067 Ga0207678_10002756 Ga0207678_1000275611 218
677 3300026067 Ga0207678_10174194 Ga0207678_101741941 218
678 3300026067 Ga0207678_10607075 Ga0207678_106070752 218
679 3300026075 Ga0207708_10001334 Ga0207708_100013345 218
680 3300026075 Ga0207708_10006771 Ga0207708_100067719 218
681 3300026078 Ga0207702_10003304 Ga0207702_100033046 218
682 3300026078 Ga0207702_10503223 Ga0207702_105032231 218
683 3300026088 Ga0207641_10000351 Ga0207641_1000035136 218
684 3300026089 Ga0207648_10000448 Ga0207648_1000044810 218
685 3300026089 Ga0207648_10002791 Ga0207648_1000279116 218
686 3300026095 Ga0207676_10000335 Ga0207676_1000033529 218
687 3300026095 Ga0207676_10005493 Ga0207676_100054938 218
688 3300026095 Ga0207676_10147149 Ga0207676_101471492 218
689 3300026116 Ga0207674_10000639 Ga0207674_1000063931 218
690 3300026116 Ga0207674_10033527 Ga0207674_100335272 218
691 3300026116 Ga0207674_10218230 Ga0207674_102182302 218
692 3300026118 Ga0207675_100001986 Ga0207675_10000198613 218
693 3300026118 Ga0207675_100002394 Ga0207675_1000023945 218
694 3300026121 Ga0207683_10000048 Ga0207683_1000004829 218
695 3300026142 Ga0207698_10000422 Ga0207698_1000042212 218
696 3300027614 Ga0209970_1006018 Ga0209970_10060182 218
697 3300027617 Ga0210002_1000173 Ga0210002_10001732 218
698 3300027682 Ga0209971_1002938 Ga0209971_10029384 218
699 3300027695 Ga0209966_1001936 Ga0209966_10019361 218
700 3300027717 Ga0209998_10002006 Ga0209998_100020062 218
701 3300027876 Ga0209974_10001951 Ga0209974_100019515 218
702 3300027876 Ga0209974_10074927 Ga0209974_100749272 218
703 3300027907 Ga0207428_10000247 Ga0207428_1000024751 218
704 3300027907 Ga0207428_10047373 Ga0207428_100473733 218
705 3300028379 Ga0268266_10045357 Ga0268266_100453572 218
706 3300028380 Ga0268265_10001999 Ga0268265_1000199914 218
707 3300028380 Ga0268265_10056973 Ga0268265_100569733 218
708 3300028381 Ga0268264_10000564 Ga0268264_100005649 218
709 3300028381 Ga0268264_10036437 Ga0268264_100364373 218
710 3300028381 Ga0268264_10376184 Ga0268264_103761842 218
711 3300028381 Ga0268264_10593994 Ga0268264_105939941 218
712 3300028800 Ga0265338_10023891 Ga0265338_100238916 218
713 3300028800 Ga0265338_10485846 Ga0265338_104858461 218
714 3300031247 Ga0265340_10079540 Ga0265340_100795402 218
715 3300031344 Ga0265316_10284359 Ga0265316_102843592 218
716 3300034816 Ga0373930_0002443 Ga0373930_0002443_1109_1765 218
717 3300034819 Ga0373958_0000304 Ga0373958_0000304_4061_4717 218
718 3300034957 Ga0373938_0000876 Ga0373938_0000876_3723_4379 218
719 3300035083 Ga0373926_0014401 Ga0373926_0014401_1886_2545 218
720 3300035083 Ga0373926_0021575 Ga0373926_0021575_785_1477 218
721 3300035084 Ga0373928_0001282 Ga0373928_0001282_988_1644 218
722 3300035088 Ga0373940_0000824 Ga0373940_0000824_1273_1929 218
723 3300035089 Ga0373944_0090311 Ga0373944_0090311_141_944 218
724 3300035090 Ga0373949_0001785 Ga0373949_0001785_4334_4990 218
725 3300035091 Ga0373951_0003707 Ga0373951_0003707_2221_2877 218
726 3300035092 Ga0373952_0000082 Ga0373952_0000082_9563_10219 218
727 3300035111 Ga0373923_0246503 Ga0373923_0246503_76_768 218
728 3300035112 Ga0373932_0000213 Ga0373932_0000213_6549_7205 218
729 3300035113 Ga0373936_0166659 Ga0373936_0166659_51_833 218
730 3300035114 Ga0373939_0000242 Ga0373939_0000242_9101_9757 218
731 3300035115 Ga0373941_0000041 Ga0373941_0000041_7192_7848 218
732 3300035116 Ga0373945_0001500 Ga0373945_0001500_440_1132 218
733 3300035116 Ga0373945_0099281 Ga0373945_0099281_32_715 218
734 3300035121 Ga0373960_0000642 Ga0373960_0000642_4123_4779 218
735 3300035170 Ga0373943_0001081 Ga0373943_0001081_6967_7659 218
736 3300035170 Ga0373943_0011836 Ga0373943_0011836_2599_3282 218
737 3300035170 Ga0373943_0022057 Ga0373943_0022057_1978_2661 218
738 3300035171 Ga0373946_0001838 Ga0373946_0001838_589_1281 218
739 3300035171 Ga0373946_0064252 Ga0373946_0064252_285_968 218
740 3300035207 Ga0373942_0002012 Ga0373942_0002012_3720_4376 218
741 3300035241 Ga0373961_0003390 Ga0373961_0003390_91_747 218
742 3300035242 Ga0373962_0000491 Ga0373962_0000491_7583_8239 218
743 3300035691 Ga0373931_0001585 Ga0373931_0001585_612_1268 218
744 3300035692 Ga0373935_0049384 Ga0373935_0049384_1035_1727 218
745 3300035692 Ga0373935_0051894 Ga0373935_0051894_1353_2045 218
746 3300035692 Ga0373935_0117401 Ga0373935_0117401_67_750 218
747 3300035692 Ga0373935_0267566 Ga0373935_0267566_85_741 218
748 3300035695 Ga0373927_0000700 Ga0373927_0000700_16446_17138 218
749 3300035695 Ga0373927_0008415 Ga0373927_0008415_2633_3325 218
750 3300035695 Ga0373927_0179780 Ga0373927_0179780_559_1242 218
751 3300035725 Ga0373947_0000333 Ga0373947_0000333_16844_17536 218
752 3300035725 Ga0373947_0017969 Ga0373947_0017969_2326_3018 218
753 3300035725 Ga0373947_0029365 Ga0373947_0029365_2306_2989 218
754 3300035725 Ga0373947_0048420 Ga0373947_0048420_713_1369 218
755 3300035725 Ga0373947_0069688 Ga0373947_0069688_1367_2023 218
756 3300035725 Ga0373947_0194876 Ga0373947_0194876_377_1060 218
757 3300036401 Ga0373937_0630645 Ga0373937_0630645_308_964 218
758 3300037068 Ga0373925_0004318 Ga0373925_0004318_1585_2277 218
759 3300037068 Ga0373925_0009528 Ga0373925_0009528_5736_6419 218
760 3300037068 Ga0373925_0051550 Ga0373925_0051550_1368_2024 218
761 3300037068 Ga0373925_0483806 Ga0373925_0483806_37_720 218
762 3300037312 Ga0395899_0068653 Ga0395899_0068653_1013_1693 218
763 3300037312 Ga0395899_0385710 Ga0395899_0385710_25_681 218
764 3300037418 Ga0395900_0018108 Ga0395900_0018108_2163_2819 218
765 3300037418 Ga0395900_0065354 Ga0395900_0065354_228_884 218
766 3300037418 Ga0395900_0069692 Ga0395900_0069692_788_1468 218
767 3300037466 Ga0395898_0012337 Ga0395898_0012337_2458_3114 218
768 3300037466 Ga0395898_0027665 Ga0395898_0027665_4763_5443 218
769 3300037466 Ga0395898_0104687 Ga0395898_0104687_280_936 218
770 3300038443 Ga0395901_0013142 Ga0395901_0013142_5062_5718 218
771 3300038443 Ga0395901_0014693 Ga0395901_0014693_5450_6130 218
772 3300038443 Ga0395901_0892457 Ga0395901_0892457_50_706 218
773 3300042461 Ga0439460_0078293 Ga0439460_0078293_239_895 218
774 3300044656 Ga0466969_0231253 Ga0466969_0231253_44_700 218
775 3300044693 Ga0466961_0038384 Ga0466961_0038384_403_1059 218
776 3300044694 Ga0466963_0005297 Ga0466963_0005297_6750_7406 218
777 3300044694 Ga0466963_0139748 Ga0466963_0139748_37_693 218
778 3300044719 Ga0466971_0069800 Ga0466971_0069800_152_808 218
779 3300044842 Ga0466957_0006725 Ga0466957_0006725_2917_3573 218
780 3300044842 Ga0466957_0035063 Ga0466957_0035063_314_970 218
781 3300044842 Ga0466957_0103148 Ga0466957_0103148_1054_1710 218
782 3300044842 Ga0466957_0385732 Ga0466957_0385732_72_728 218
783 3300045051 Ga0451576_0638992 Ga0451576_0638992_291_950 218
784 3300045836 Ga0466958_0038915 Ga0466958_0038915_1625_2281 218
785 3300045976 Ga0466967_0002469 Ga0466967_0002469_2058_2714 218
786 3300045976 Ga0466967_0861582 Ga0466967_0861582_57_713 218
787 3300045976 Ga0466967_1066149 Ga0466967_1066149_109_765 218
788 3300046455 Ga0495603_0012903 Ga0495603_0012903_3527_4210 218
789 3300046459 Ga0495629_0158784 Ga0495629_0158784_624_1280 218
790 3300046461 Ga0495641_0070604 Ga0495641_0070604_675_1358 218
791 3300046462 Ga0495651_0121856 Ga0495651_0121856_767_1423 218
792 3300046472 Ga0495580_0142546 Ga0495580_0142546_758_1441 218
793 3300046473 Ga0495582_0056326 Ga0495582_0056326_1409_2092 218
794 3300046475 Ga0495639_0033294 Ga0495639_0033294_34_717 218
795 3300046475 Ga0495639_0147411 Ga0495639_0147411_246_938 218
796 3300046476 Ga0495662_0021978 Ga0495662_0021978_2022_2714 218
797 3300046476 Ga0495662_0068074 Ga0495662_0068074_610_1269 218
798 3300046477 Ga0495664_0003181 Ga0495664_0003181_2398_3090 218
799 3300046491 Ga0495584_0062703 Ga0495584_0062703_351_1007 218
800 3300046491 Ga0495584_0165797 Ga0495584_0165797_300_983 218
801 3300046492 Ga0495585_0059833 Ga0495585_0059833_981_1664 218
802 3300046492 Ga0495585_0256567 Ga0495585_0256567_132_845 218
803 3300046499 Ga0495594_0054448 Ga0495594_0054448_141_944 218
804 3300046511 Ga0495608_0273225 Ga0495608_0273225_112_768 218
805 3300046513 Ga0495616_0068675 Ga0495616_0068675_297_980 218
806 3300046514 Ga0495618_0011939 Ga0495618_0011939_1250_1942 218
807 3300046516 Ga0495628_0129667 Ga0495628_0129667_1118_1774 218
808 3300046517 Ga0495630_0007513 Ga0495630_0007513_6212_6904 218
809 3300046517 Ga0495630_0021008 Ga0495630_0021008_3290_3982 218
810 3300046517 Ga0495630_0077789 Ga0495630_0077789_1185_1904 218
811 3300046517 Ga0495630_0239667 Ga0495630_0239667_247_903 218
812 3300046523 Ga0495644_0015917 Ga0495644_0015917_1532_2245 218
813 3300046523 Ga0495644_0027880 Ga0495644_0027880_914_1597 218
814 3300046526 Ga0495666_0014190 Ga0495666_0014190_1105_1788 218
815 3300046528 Ga0495642_0032023 Ga0495642_0032023_1389_2072 218
816 3300046529 Ga0495652_0156952 Ga0495652_0156952_1060_1716 218
817 3300046531 Ga0495665_0005724 Ga0495665_0005724_366_1058 218
818 3300046531 Ga0495665_0046947 Ga0495665_0046947_363_1055 218
819 3300046533 Ga0495640_0002127 Ga0495640_0002127_4444_5136 218
820 3300046533 Ga0495640_0046905 Ga0495640_0046905_2054_2746 218
821 3300046533 Ga0495640_0098835 Ga0495640_0098835_1069_1725 218
822 3300046533 Ga0495640_0182000 Ga0495640_0182000_205_861 218
823 3300046533 Ga0495640_0212913 Ga0495640_0212913_198_857 218
824 3300046533 Ga0495640_0226650 Ga0495640_0226650_397_1080 218
825 3300046543 Ga0495645_0103121 Ga0495645_0103121_67_759 218
826 3300046559 Ga0495667_0113968 Ga0495667_0113968_233_889 218
827 3300046642 Ga0495634_0008365 Ga0495634_0008365_6113_6805 218
828 3300046642 Ga0495634_0008703 Ga0495634_0008703_5864_6556 218
829 3300046642 Ga0495634_0024228 Ga0495634_0024228_2427_3083 218
830 3300046663 Ga0495635_0003183 Ga0495635_0003183_4502_5194 218
831 3300046663 Ga0495635_0025747 Ga0495635_0025747_1541_2233 218
832 3300046664 Ga0495659_0050730 Ga0495659_0050730_564_1247 218
833 3300046674 Ga0495588_0024145 Ga0495588_0024145_2164_2847 218
834 3300046675 Ga0495657_0439279 Ga0495657_0439279_86_742 218
835 3300046680 Ga0495646_0075016 Ga0495646_0075016_994_1686 218
836 3300046680 Ga0495646_0169997 Ga0495646_0169997_403_1086 218
837 3300046681 Ga0495647_0014652 Ga0495647_0014652_1725_2408 218
838 3300046681 Ga0495647_0202208 Ga0495647_0202208_63_746 218
839 3300046683 Ga0495658_0078064 Ga0495658_0078064_70_852 218
840 3300046683 Ga0495658_0278028 Ga0495658_0278028_50_853 218
841 3300046684 Ga0495669_0033233 Ga0495669_0033233_142_825 218
842 3300046689 Ga0495613_0044148 Ga0495613_0044148_424_1116 218
843 3300046689 Ga0495613_0102775 Ga0495613_0102775_682_1374 218
844 3300046689 Ga0495613_0167425 Ga0495613_0167425_32_715 218
845 3300046690 Ga0495624_0006737 Ga0495624_0006737_2150_2842 218
846 3300046690 Ga0495624_0064046 Ga0495624_0064046_941_1633 218
847 3300046690 Ga0495624_0130531 Ga0495624_0130531_38_721 218
848 3300046690 Ga0495624_0158217 Ga0495624_0158217_20_703 218
849 3300046690 Ga0495624_0272749 Ga0495624_0272749_339_995 218
850 3300046694 Ga0495649_0239852 Ga0495649_0239852_11_694 218
851 3300047315 Ga0495581_0006878 Ga0495581_0006878_886_1578 218
852 3300047315 Ga0495581_0142109 Ga0495581_0142109_706_1389 218
853 3300047315 Ga0495581_0184091 Ga0495581_0184091_417_1073 218
854 3300047317 Ga0495604_0203740 Ga0495604_0203740_551_1243 218
855 3300047317 Ga0495604_0361736 Ga0495604_0361736_178_891 218
856 3300047319 Ga0495674_0006095 Ga0495674_0006095_7418_8110 218
857 3300047319 Ga0495674_0221364 Ga0495674_0221364_22_681 218
858 3300047319 Ga0495674_0402114 Ga0495674_0402114_44_700 218
859 3300047321 Ga0495676_0005365 Ga0495676_0005365_10991_11674 218
860 3300047321 Ga0495676_0077206 Ga0495676_0077206_1172_1864 218
861 3300047321 Ga0495676_0084861 Ga0495676_0084861_489_1145 218
862 3300047321 Ga0495676_0275083 Ga0495676_0275083_25_708 218
863 3300047322 Ga0495680_0109802 Ga0495680_0109802_1219_1875 218
864 3300047322 Ga0495680_0425235 Ga0495680_0425235_120_902 218
865 3300047471 Ga0495684_0017403 Ga0495684_0017403_3264_3956 218
866 3300047471 Ga0495684_0024906 Ga0495684_0024906_2362_3054 218
867 3300047471 Ga0495684_0035789 Ga0495684_0035789_2080_2772 218
868 3300047471 Ga0495684_0115615 Ga0495684_0115615_713_1372 218
869 3300047673 Ga0495593_0039687 Ga0495593_0039687_1619_2311 218
870 3300047673 Ga0495593_0047844 Ga0495593_0047844_1382_2101 218
871 3300048089 Ga0495614_0051892 Ga0495614_0051892_832_1524 218
872 3300048090 Ga0495615_0075150 Ga0495615_0075150_222_905 218
873 3300048091 Ga0495626_0122607 Ga0495626_0122607_62_775 218
874 3300048903 Ga0496100_0000192 Ga0496100_0000192_740_1396 218
875 3300048903 Ga0496100_0028248 Ga0496100_0028248_2454_3167 218
876 3300048903 Ga0496100_0087085 Ga0496100_0087085_654_1313 218
877 3300048903 Ga0496100_0146987 Ga0496100_0146987_285_941 218
878 3300048904 Ga0496101_0000274 Ga0496101_0000274_5019_5675 218
879 3300048904 Ga0496101_0038835 Ga0496101_0038835_2542_3255 218
880 3300048904 Ga0496101_0051031 Ga0496101_0051031_1896_2552 218
881 3300048905 Ga0496102_0022670 Ga0496102_0022670_785_1441 218
882 3300048905 Ga0496102_0079661 Ga0496102_0079661_1884_2597 218
883 3300048905 Ga0496102_0215432 Ga0496102_0215432_441_1097 218
884 3300048906 Ga0496103_0000937 Ga0496103_0000937_19469_20125 218
885 3300048906 Ga0496103_0016137 Ga0496103_0016137_3109_3768 218
886 3300048906 Ga0496103_0033832 Ga0496103_0033832_1866_2579 218
887 3300048906 Ga0496103_0048388 Ga0496103_0048388_1615_2271 218
888 3300048907 Ga0496104_0048302 Ga0496104_0048302_2070_2729 218
889 3300048907 Ga0496104_0076993 Ga0496104_0076993_265_921 218
890 3300048907 Ga0496104_0107904 Ga0496104_0107904_1037_1693 218
891 3300048908 Ga0496105_0005688 Ga0496105_0005688_6672_7331 218
892 3300048908 Ga0496105_0061668 Ga0496105_0061668_2330_3043 218
893 3300048908 Ga0496105_0239181 Ga0496105_0239181_304_960 218
894 3300048908 Ga0496105_0332855 Ga0496105_0332855_406_1062 218
895 3300048909 Ga0496106_0000165 Ga0496106_0000165_40985_41641 218
896 3300048909 Ga0496106_0019452 Ga0496106_0019452_2312_3025 218
897 3300048909 Ga0496106_0051204 Ga0496106_0051204_2206_2865 218
898 3300048909 Ga0496106_0554453 Ga0496106_0554453_225_881 218
899 3300048910 Ga0496107_0000591 Ga0496107_0000591_14560_15216 218
900 3300048910 Ga0496107_0008336 Ga0496107_0008336_673_1386 218
901 3300048910 Ga0496107_0120684 Ga0496107_0120684_1041_1700 218
902 3300048910 Ga0496107_0236410 Ga0496107_0236410_222_878 218
903 3300048910 Ga0496107_0400798 Ga0496107_0400798_18_677 218
904 3300048911 Ga0496108_0000491 Ga0496108_0000491_22684_23340 218
905 3300048911 Ga0496108_0002693 Ga0496108_0002693_7457_8113 218
906 3300048911 Ga0496108_0010074 Ga0496108_0010074_5058_5717 218
907 3300048912 Ga0496109_0000588 Ga0496109_0000588_16814_17470 218
908 3300048912 Ga0496109_0006833 Ga0496109_0006833_2620_3276 218
909 3300048912 Ga0496109_0203492 Ga0496109_0203492_229_888 218
910 3300048912 Ga0496109_0282101 Ga0496109_0282101_673_1386 218
911 3300048913 Ga0496110_0012829 Ga0496110_0012829_4867_5523 218
912 3300048913 Ga0496110_0031862 Ga0496110_0031862_54_713 218
913 3300048913 Ga0496110_0232297 Ga0496110_0232297_420_1133 218
914 3300048914 Ga0496111_0006996 Ga0496111_0006996_6477_7136 218
915 3300048914 Ga0496111_0009533 Ga0496111_0009533_2093_2806 218
916 3300048915 Ga0496112_0031885 Ga0496112_0031885_2518_3231 218
917 3300048915 Ga0496112_0062470 Ga0496112_0062470_156_815 218
918 3300048915 Ga0496112_0116495 Ga0496112_0116495_1755_2414 218
919 3300048915 Ga0496112_0133543 Ga0496112_0133543_1186_1842 218
920 3300048915 Ga0496112_0156354 Ga0496112_0156354_1576_2232 218
921 3300048915 Ga0496112_0241465 Ga0496112_0241465_52_708 218
922 3300048916 Ga0496113_0000939 Ga0496113_0000939_974_1633 218
923 3300048916 Ga0496113_0003195 Ga0496113_0003195_5280_5936 218
924 3300048916 Ga0496113_0039374 Ga0496113_0039374_254_967 218
925 3300048916 Ga0496113_0142170 Ga0496113_0142170_20_676 218
926 3300048917 Ga0496114_0001943 Ga0496114_0001943_3792_4448 218
927 3300048917 Ga0496114_0027710 Ga0496114_0027710_348_1004 218
928 3300048917 Ga0496114_0112142 Ga0496114_0112142_654_1367 218
929 3300048917 Ga0496114_0140673 Ga0496114_0140673_156_875 218
930 3300048918 Ga0496115_0003886 Ga0496115_0003886_3026_3682 218
931 3300048918 Ga0496115_0033362 Ga0496115_0033362_682_1338 218
932 3300048918 Ga0496115_0194128 Ga0496115_0194128_545_1258 218
933 3300050492 nmdc:mga0yw44_25304_c1 nmdc:mga0yw44_25304_c1_251_961 218
934 3300050492 nmdc:mga0yw44_52683_c1 nmdc:mga0yw44_52683_c1_1372_2085 218
935 3300050493 nmdc:mga0k408_39155_c1 nmdc:mga0k408_39155_c1_1545_2201 218
936 3300050494 nmdc:mga06z11_166532_c1 nmdc:mga06z11_166532_c1_228_941 218
937 3300050494 nmdc:mga06z11_244789_c1 nmdc:mga06z11_244789_c1_95_808 218
938 3300050494 nmdc:mga06z11_271443_c1 nmdc:mga06z11_271443_c1_163_819 218
939 3300050494 nmdc:mga06z11_4182_c1 nmdc:mga06z11_4182_c1_732_1388 218
940 3300050494 nmdc:mga06z11_8831_c2 nmdc:mga06z11_8831_c2_1103_1762 218
941 3300050496 nmdc:mga07m45_234028_c1 nmdc:mga07m45_234028_c1_98_808 218
942 3300050511 nmdc:mga08y16_937_c1 nmdc:mga08y16_937_c1_21547_22203 218
943 3300050512 nmdc:mga0n895_44_c1 nmdc:mga0n895_44_c1_59125_59781 218
944 3300050512 nmdc:mga0n895_577698_c1 nmdc:mga0n895_577698_c1_137_793 218
945 3300050513 nmdc:mga0rr50_25154_c1 nmdc:mga0rr50_25154_c1_1638_2294 218
946 3300050513 nmdc:mga0rr50_356857_c1 nmdc:mga0rr50_356857_c1_409_1065 218
947 3300050515 nmdc:mga0a205_5361_c1 nmdc:mga0a205_5361_c1_409_1065 218
948 3300053077 Ga0495601_0000334 Ga0495601_0000334_12162_12818 218
949 3300053077 Ga0495601_0005421 Ga0495601_0005421_3398_4090 218
950 3300053077 Ga0495601_0245023 Ga0495601_0245023_297_1010 218
951 3300053077 Ga0495601_0500224 Ga0495601_0500224_36_692 218
952 3300053078 Ga0495612_0000551 Ga0495612_0000551_2208_2900 218
953 3300053085 Ga0495619_0012959 Ga0495619_0012959_2214_2906 218
954 3300053085 Ga0495619_0137189 Ga0495619_0137189_303_962 218
955 3300053131 Ga0500652_000029 Ga0500652_000029_19254_19919 218
956 3300054114 Ga0501084_0184753 Ga0501084_0184753_1047_1703 218

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.763 40 174
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.7574 42 173
6ohi-assembly1.cif.gz_B crystal structure of the debrominase bmp8 (apo) 0.7482 1 175
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.7471 42 173
6ohj-assembly1.cif.gz_B crystal structure of the debrominase bmp8 c82a in complex with 2,3,4-tribromopyrrole 0.7279 2 198
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7633 41 172 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.757 36 180 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7453 58 174 1.20.1290.10
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.745 19 174 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7243 41 172 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A1F2U235-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8336 1 173 GO:0051920
AF-A0A381QX94-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8204 1 178
AF-A0A2S6QIU7-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8091 3 172
AF-A0A1W2BVT2-F1-model_v4 Alkylhydroperoxidase family enzyme, contains CxxC motif 0.7976 6 169 GO:0004601
AF-A0A848WAY4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.7936 3 174

Feature Viewer

pLDDT pTM Quality
73.91 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map