F486753

General Info

Members Datasets Scaffolds Average Seq Length
956 575 1912 253

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0066313|Ga0495686_0066313_646_1548
Length 300
Sequence LRPLKEISSGGKGSDIGISIRRCRVLLGNVMPSELRSPRLAVLIDADNASAKIADGLFEEIAKIGEASVRRIYGDFSNARSRGWADILSKHAIIPQQQFAYTTGKNASDITLVIDAMDLLHSGRFDGFCLVSSDSDFTRLAARIREQGVDVFGFGEHKTPESFRQACRRFVYTENLLAGTANTQDAGSRSTPLQPHDAATPIIKKVITQMESEDGWVTLGEVGRQLANLASDFDPRTFGFRKLSDLVRKTNSFEIDESKGRSMRIRVKPAAAPPPRTRNPRRPAARPSRSGPAGGPAPKA

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
204 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
205 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
337 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
338 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
341 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
347 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
348 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
353 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
354 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
359 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
360 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
363 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
366 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
367 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
368 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
371 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
372 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
373 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
374 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
375 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
376 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
377 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
378 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
379 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
380 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
381 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
382 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
383 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
384 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
385 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
386 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
387 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
388 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
389 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
390 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
391 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
392 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
393 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
394 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
395 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
396 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
397 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
398 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
399 2643221582 Rhizobium sp. Root651 Isolate Unclassified
400 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
401 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
402 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
403 2738541293 Rhizobium sp. GV031 Isolate Unclassified
404 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
405 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
406 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
407 2791355266 Rhizobium sp. L43 Isolate Nodule
408 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
409 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
410 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
411 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
412 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
413 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
414 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
415 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
416 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
417 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
418 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
419 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
420 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
421 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
422 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
423 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
424 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
425 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
426 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
427 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
428 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
429 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
430 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
431 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
432 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
433 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
434 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
435 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
436 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
437 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
438 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
439 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
440 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
441 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
442 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
443 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
444 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
445 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
446 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
447 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
448 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
449 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
450 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
451 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
452 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
453 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
454 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
455 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
456 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
457 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
458 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
459 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
460 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
461 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
462 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
463 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
464 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
465 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
466 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
467 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
468 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
469 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
470 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
471 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
472 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
473 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
474 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
475 2922368715
476 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
477 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
478 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
479 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
480 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
481 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
482 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
483 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
484 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
485 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
486 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
487 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
488 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
489 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
490 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
491 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
492 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
493 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
494 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
495 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
496 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
497 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
498 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
499 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
500 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
501 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
502 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
503 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
504 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
505 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
506 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
507 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
508 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
509 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
510 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
511 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
512 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
513 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
514 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
515 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
516 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
517 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
518 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
519 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
520 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
521 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
522 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
523 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
524 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
525 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
526 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
527 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
528 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
529 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
530 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
531 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
532 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
533 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
534 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
535 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
536 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
537 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
538 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
539 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
540 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
541 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
542 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
543 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
544 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
545 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
546 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
549 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
550 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
551 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
552 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
553 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
558 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
559 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
560 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
561 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
562 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
563 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
564 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
565 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
566 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
567 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
568 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
569 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
570 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
571 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
572 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
573 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
574 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
575 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.32
Metatranscriptomes 0.1
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.85
Nodule 16.42
Rhizoplane 4.92
Rhizosphere 50.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0066313 3300047472 Bacteria 2231
2 JGI24736J21556_1010478 3300001904 Bacteria 1513
3 JGI24740J21852_10009539 3300001979 Bacteria 3793
4 JGI24740J21852_10018129 3300001979 Bacteria 2505
5 JGI24740J21852_10043019 3300001979 Bacteria 1349
6 JGI24740J21852_10053524 3300001979 Bacteria 1144
7 JGI24739J22299_10045881 3300001989 Bacteria 1432
8 JGI24739J22299_10070700 3300001989 Bacteria 1086
9 JGI24737J22298_10041879 3300001990 Bacteria 1404
10 JGI24735J21928_10050971 3300002067 Bacteria 1195
11 JGI24738J21930_10021365 3300002075 Bacteria 1342
12 JGI25165J46597_1000006 3300003214 Bacteria 529784
13 JGI25153J46596_10002640 3300003215 Bacteria 10246
14 JGI25153J46596_10006320 3300003215 Bacteria 6030
15 JGI25153J46596_10008296 3300003215 Bacteria 4986
16 rootL2_10177720 3300003322 Bacteria 1472
17 JGI25160J50197_1000826 3300003354 Bacteria 16549
18 JGI25160J50197_1012801 3300003354 Bacteria 2890
19 JGI25404J52841_10011078 3300003659 Bacteria 1941
20 JGI25404J52841_10039595 3300003659 Bacteria 998
21 Ga0055528_1000544 3300003790 Bacteria 28745
22 Ga0065165_1000953 3300005262 Bacteria 36442
23 Ga0065165_1002778 3300005262 Bacteria 13850
24 Ga0065165_1016141 3300005262 Bacteria 2810
25 Ga0070658_10328052 3300005327 Bacteria 1307
26 Ga0070658_10492434 3300005327 Bacteria 1058
27 Ga0070676_10083914 3300005328 Bacteria 1939
28 Ga0070676_10085855 3300005328 Bacteria 1919
29 Ga0070683_100007383 3300005329 Bacteria 9286
30 Ga0070683_100031653 3300005329 Bacteria 4813
31 Ga0068869_100188815 3300005334 Bacteria 1619
32 Ga0068869_100480231 3300005334 Bacteria 1035
33 Ga0068869_100586891 3300005334 Bacteria 940
34 Ga0070666_10086242 3300005335 Bacteria 2151
35 Ga0070680_100531114 3300005336 Bacteria 1007
36 Ga0070682_100058791 3300005337 Bacteria 2425
37 Ga0070682_100313768 3300005337 Bacteria 1155
38 Ga0070660_100111058 3300005339 Bacteria 2181
39 Ga0070668_100138585 3300005347 Bacteria 1959
40 Ga0070669_100058680 3300005353 Bacteria 2824
41 Ga0070688_100269133 3300005365 Bacteria 1220
42 Ga0070659_100088026 3300005366 Bacteria 2487
43 Ga0070667_100056373 3300005367 Bacteria 3319
44 Ga0070709_10036716 3300005434 Bacteria 2987
45 Ga0070709_10307754 3300005434 Bacteria 1159
46 Ga0070714_100002584 3300005435 Bacteria 13346
47 Ga0070714_100585084 3300005435 Bacteria 1071
48 Ga0070713_100086394 3300005436 Bacteria 2689
49 Ga0070710_10000501 3300005437 Bacteria 18393
50 Ga0070710_10183781 3300005437 Bacteria 1311
51 Ga0070710_10476192 3300005437 Bacteria 851
52 Ga0070701_10033118 3300005438 Bacteria 2580
53 Ga0070711_100044952 3300005439 Bacteria 3000
54 Ga0070663_100021296 3300005455 Bacteria 4309
55 Ga0070663_100027618 3300005455 Bacteria 3855
56 Ga0070663_100079555 3300005455 Bacteria 2405
57 Ga0070663_100312237 3300005455 Bacteria 1262
58 Ga0070678_100086429 3300005456 Bacteria 2392
59 Ga0070678_100198686 3300005456 Bacteria 1654
60 Ga0070662_100023894 3300005457 Bacteria 4205
61 Ga0070662_100089686 3300005457 Bacteria 2307
62 Ga0070681_10033499 3300005458 Bacteria 5157
63 Ga0070681_10182527 3300005458 Bacteria 2019
64 Ga0070698_100736491 3300005471 Bacteria 929
65 Ga0070699_100384408 3300005518 Bacteria 1268
66 Ga0070679_100092244 3300005530 Bacteria 3016
67 Ga0070679_100334912 3300005530 Bacteria 1462
68 Ga0070684_100002474 3300005535 Bacteria 13604
69 Ga0068853_100001742 3300005539 Bacteria 15948
70 Ga0068853_100013884 3300005539 Bacteria 6585
71 Ga0068853_100099647 3300005539 Bacteria 2567
72 Ga0068853_100147807 3300005539 Bacteria 2113
73 Ga0068853_100267441 3300005539 Bacteria 1573
74 Ga0070672_100328535 3300005543 Bacteria 1301
75 Ga0070665_100046083 3300005548 Bacteria 4379
76 Ga0070665_100069708 3300005548 Bacteria 3524
77 Ga0070665_100427743 3300005548 Bacteria 1333
78 Ga0068855_100075640 3300005563 Bacteria 3909
79 Ga0068855_100150914 3300005563 Bacteria 2642
80 Ga0068857_100036325 3300005577 Bacteria 4365
81 Ga0068857_100418811 3300005577 Bacteria 1248
82 Ga0068857_100457678 3300005577 Bacteria 1194
83 Ga0068854_100039271 3300005578 Bacteria 3334
84 Ga0068854_100056832 3300005578 Bacteria 2821
85 Ga0068854_100321297 3300005578 Bacteria 1258
86 Ga0068856_100012955 3300005614 Bacteria 8074
87 Ga0068856_100322481 3300005614 Bacteria 1562
88 Ga0068856_100327042 3300005614 Bacteria 1551
89 Ga0068856_100477409 3300005614 Bacteria 1268
90 Ga0068856_100818653 3300005614 Bacteria 951
91 Ga0068852_100073636 3300005616 Bacteria 3005
92 Ga0068852_100328306 3300005616 Bacteria 1488
93 Ga0068852_100602969 3300005616 Bacteria 1102
94 Ga0068859_100176840 3300005617 Bacteria 2216
95 Ga0068859_100248636 3300005617 Bacteria 1868
96 Ga0068859_100534830 3300005617 Bacteria 1267
97 Ga0068864_100452028 3300005618 Bacteria 1229
98 Ga0068861_100009251 3300005719 Bacteria 6797
99 Ga0068861_100050478 3300005719 Bacteria 3154
100 Ga0068861_100266140 3300005719 Bacteria 1470
101 Ga0068861_100445797 3300005719 Bacteria 1159
102 Ga0068851_10046400 3300005834 Bacteria 2197
103 Ga0068851_10183348 3300005834 Bacteria 1160
104 Ga0068863_100202527 3300005841 Bacteria 1910
105 Ga0068858_100061887 3300005842 Bacteria 3460
106 Ga0068858_100624858 3300005842 Bacteria 1046
107 Ga0068860_100000217 3300005843 Bacteria 90245
108 Ga0068860_100034329 3300005843 Bacteria 4864
109 Ga0068862_100013908 3300005844 Bacteria 6671
110 Ga0068862_100044093 3300005844 Bacteria 3804
111 Ga0068862_100112279 3300005844 Bacteria 2393
112 Ga0068862_100194527 3300005844 Bacteria 1826
113 Ga0081455_10136729 3300005937 Bacteria 1909
114 Ga0081540_1006420 3300005983 Bacteria 8561
115 Ga0081540_1009150 3300005983 Bacteria 6836
116 Ga0081540_1009188 3300005983 Bacteria 6819
117 Ga0081540_1058566 3300005983 Bacteria 1855
118 Ga0081540_1061289 3300005983 Bacteria 1794
119 Ga0081540_1107676 3300005983 Bacteria 1186
120 Ga0070717_10223502 3300006028 Bacteria 1656
121 Ga0070717_10567823 3300006028 Bacteria 1028
122 Ga0075365_10093101 3300006038 Bacteria 2055
123 Ga0075365_10094729 3300006038 Bacteria 2038
124 Ga0075365_10133614 3300006038 Bacteria 1718
125 Ga0075365_10143954 3300006038 Bacteria 1655
126 Ga0075368_10018440 3300006042 Bacteria 2622
127 Ga0075368_10098687 3300006042 Bacteria 1198
128 Ga0075363_100061669 3300006048 Bacteria 2021
129 Ga0075363_100077582 3300006048 Bacteria 1813
130 Ga0075364_10064214 3300006051 Bacteria 2410
131 Ga0075364_10165551 3300006051 Bacteria 1494
132 Ga0070716_100001649 3300006173 Bacteria 10072
133 Ga0070712_100270628 3300006175 Bacteria 1364
134 Ga0075362_10007812 3300006177 Bacteria 4067
135 Ga0075362_10169015 3300006177 Bacteria 1056
136 Ga0075367_10021221 3300006178 Bacteria 3627
137 Ga0075369_10011058 3300006186 Bacteria 3541
138 Ga0075366_10069715 3300006195 Bacteria 2093
139 Ga0075366_10089603 3300006195 Bacteria 1843
140 Ga0075366_10132388 3300006195 Bacteria 1505
141 Ga0075366_10153173 3300006195 Bacteria 1396
142 Ga0097621_100056820 3300006237 Bacteria 3198
143 Ga0075370_10003227 3300006353 Bacteria 7718
144 Ga0075370_10012524 3300006353 Bacteria 4485
145 Ga0068871_100281926 3300006358 Bacteria 1454
146 Ga0068871_100286171 3300006358 Bacteria 1443
147 Ga0068871_100398121 3300006358 Bacteria 1226
148 Ga0075428_100041687 3300006844 Bacteria 5046
149 Ga0075428_100196785 3300006844 Bacteria 2180
150 Ga0075428_100645452 3300006844 Bacteria 1129
151 Ga0075431_100642590 3300006847 Bacteria 1042
152 Ga0075434_100115025 3300006871 Bacteria 2703
153 Ga0075434_100172071 3300006871 Bacteria 2186
154 Ga0068865_100159767 3300006881 Bacteria 1718
155 Ga0068865_100316578 3300006881 Bacteria 1254
156 Ga0097620_100176845 3300006931 Bacteria 2216
157 Ga0097620_100248637 3300006931 Bacteria 1868
158 Ga0097620_100534810 3300006931 Bacteria 1267
159 Ga0099794_10023859 3300007265 Bacteria 2802
160 Ga0105240_10000336 3300009093 Bacteria 87900
161 Ga0105240_10003411 3300009093 Bacteria 24689
162 Ga0105240_10465850 3300009093 Bacteria 1411
163 Ga0111539_10167067 3300009094 Bacteria 2572
164 Ga0105245_10160454 3300009098 Bacteria 2133
165 Ga0105247_10008005 3300009101 Bacteria 6458
166 Ga0105247_10132294 3300009101 Bacteria 1627
167 Ga0105243_10085956 3300009148 Bacteria 2579
168 Ga0105241_10013101 3300009174 Bacteria 6082
169 Ga0105241_10082829 3300009174 Bacteria 2515
170 Ga0105241_10143174 3300009174 Bacteria 1949
171 Ga0105241_10406186 3300009174 Bacteria 1196
172 Ga0105248_10009311 3300009177 Bacteria 10814
173 Ga0105248_10014838 3300009177 Bacteria 8582
174 Ga0105248_10039164 3300009177 Bacteria 5308
175 Ga0105248_10153724 3300009177 Bacteria 2596
176 Ga0105237_10000690 3300009545 Bacteria 46704
177 Ga0105237_10056017 3300009545 Bacteria 3947
178 Ga0105237_10059464 3300009545 Bacteria 3823
179 Ga0105237_10066120 3300009545 Bacteria 3610
180 Ga0105237_10088873 3300009545 Bacteria 3079
181 Ga0105237_10183098 3300009545 Bacteria 2095
182 Ga0105237_10250188 3300009545 Bacteria 1774
183 Ga0105237_10310279 3300009545 Bacteria 1581
184 Ga0105237_10430544 3300009545 Bacteria 1325
185 Ga0105238_10005788 3300009551 Bacteria 12235
186 Ga0105238_10007078 3300009551 Bacteria 11224
187 Ga0105238_10202980 3300009551 Bacteria 1958
188 Ga0105238_10275551 3300009551 Bacteria 1663
189 Ga0105238_10339591 3300009551 Bacteria 1490
190 Ga0105238_10551698 3300009551 Bacteria 1157
191 Ga0105249_10019015 3300009553 Bacteria 6126
192 Ga0105249_10393375 3300009553 Bacteria 1415
193 Ga0105249_10711666 3300009553 Bacteria 1065
194 Ga0099796_10084012 3300010159 Bacteria 1172
195 Ga0105239_10006751 3300010375 Bacteria 13254
196 Ga0105239_10008236 3300010375 Bacteria 11890
197 Ga0105239_10070772 3300010375 Bacteria 3832
198 Ga0105239_10375310 3300010375 Bacteria 1607
199 Ga0105239_10381665 3300010375 Bacteria 1593
200 Ga0105239_10383971 3300010375 Bacteria 1588
201 Ga0105239_10461945 3300010375 Bacteria 1441
202 Ga0105239_10712954 3300010375 Bacteria 1147
203 Ga0105239_10957680 3300010375 Bacteria 983
204 Ga0105246_10121974 3300011119 Bacteria 1933
205 Ga0105246_10426055 3300011119 Bacteria 1109
206 Ga0157370_10006306 3300013104 Bacteria 13106
207 Ga0157369_10118453 3300013105 Bacteria 2810
208 Ga0157369_10155960 3300013105 Bacteria 2411
209 Ga0157374_10371927 3300013296 Bacteria 1423
210 Ga0157378_10126465 3300013297 Bacteria 2361
211 Ga0157378_10207621 3300013297 Bacteria 1856
212 Ga0163162_10038979 3300013306 Bacteria 4744
213 Ga0163162_10194801 3300013306 Bacteria 2155
214 Ga0163162_10370534 3300013306 Bacteria 1565
215 Ga0157372_10138050 3300013307 Bacteria 2808
216 Ga0157372_10737478 3300013307 Bacteria 1146
217 Ga0157375_10249707 3300013308 Bacteria 1935
218 Ga0157375_10409895 3300013308 Bacteria 1521
219 Ga0157375_10595262 3300013308 Bacteria 1265
220 Ga0163163_10108583 3300014325 Bacteria 2802
221 Ga0163163_10546596 3300014325 Bacteria 1221
222 Ga0157380_10030487 3300014326 Bacteria 4131
223 Ga0157380_10089716 3300014326 Bacteria 2534
224 Ga0182008_10020976 3300014497 Bacteria 3360
225 Ga0182008_10041989 3300014497 Bacteria 2279
226 Ga0157379_10341744 3300014968 Bacteria 1369
227 Ga0157376_10402613 3300014969 Bacteria 1324
228 Ga0182007_10037005 3300015262 Bacteria 1640
229 Ga0182007_10054633 3300015262 Bacteria 1313
230 Ga0182005_1005352 3300015265 Bacteria 4021
231 Ga0163161_10189762 3300017792 Bacteria 1579
232 Ga0214543_1003759 3300021327 Bacteria 29285
233 Ga0213876_10060936 3300021384 Bacteria 1991
234 Ga0209563_102799 3300025230 Bacteria 3815
235 Ga0209437_107178 3300025233 Bacteria 1825
236 Ga0209677_103335 3300025253 Bacteria 5282
237 Ga0209148_1015515 3300025254 Bacteria 1329
238 Ga0209129_1001101 3300025258 Bacteria 15742
239 Ga0209233_1000010 3300025261 Bacteria 1194329
240 Ga0209233_1000097 3300025261 Bacteria 295452
241 Ga0209233_1006432 3300025261 Bacteria 3787
242 Ga0209455_1003379 3300025272 Bacteria 5674
243 Ga0209673_1000126 3300025273 Bacteria 167949
244 Ga0209673_1001062 3300025273 Bacteria 31387
245 Ga0209673_1002727 3300025273 Bacteria 11650
246 Ga0209025_1032697 3300025294 Bacteria 2424
247 Ga0209564_1000368 3300025295 Bacteria 83910
248 Ga0209564_1014503 3300025295 Bacteria 3273
249 Ga0209564_1014785 3300025295 Bacteria 3219
250 Ga0209758_1000345 3300025297 Bacteria 84958
251 Ga0209758_1000527 3300025297 Bacteria 61122
252 Ga0209758_1005729 3300025297 Bacteria 9361
253 Ga0209758_1008345 3300025297 Bacteria 6740
254 Ga0209758_1019444 3300025297 Bacteria 3273
255 Ga0209256_1001075 3300025299 Bacteria 31597
256 Ga0209256_1001095 3300025299 Bacteria 31168
257 Ga0207426_1000400 3300025302 Bacteria 73493
258 Ga0207426_1000402 3300025302 Bacteria 72738
259 Ga0207426_1000736 3300025302 Bacteria 37388
260 Ga0207426_1007160 3300025302 Bacteria 4709
261 Ga0209051_1002366 3300025303 Bacteria 13638
262 Ga0207656_10004091 3300025321 Bacteria 5061
263 Ga0207682_10124792 3300025893 Bacteria 1145
264 Ga0207692_10002994 3300025898 Bacteria 6550
265 Ga0207710_10015744 3300025900 Bacteria 3198
266 Ga0207710_10049206 3300025900 Bacteria 1888
267 Ga0207688_10052512 3300025901 Bacteria 2284
268 Ga0207680_10076672 3300025903 Bacteria 2088
269 Ga0207680_10178416 3300025903 Bacteria 1435
270 Ga0207647_10015521 3300025904 Bacteria 5218
271 Ga0207647_10041918 3300025904 Bacteria 2874
272 Ga0207699_10025361 3300025906 Bacteria 3253
273 Ga0207645_10074877 3300025907 Bacteria 2167
274 Ga0207705_10033323 3300025909 Bacteria 3679
275 Ga0207705_10287041 3300025909 Bacteria 1260
276 Ga0207654_10000717 3300025911 Bacteria 18498
277 Ga0207654_10032296 3300025911 Bacteria 2891
278 Ga0207654_10183398 3300025911 Bacteria 1367
279 Ga0207707_10001371 3300025912 Bacteria 22592
280 Ga0207707_10024804 3300025912 Bacteria 5246
281 Ga0207707_10407619 3300025912 Bacteria 1166
282 Ga0207695_10000458 3300025913 Bacteria 88734
283 Ga0207695_10002499 3300025913 Bacteria 27042
284 Ga0207695_10153319 3300025913 Bacteria 2241
285 Ga0207671_10011705 3300025914 Bacteria 7111
286 Ga0207671_10018973 3300025914 Bacteria 5269
287 Ga0207671_10036677 3300025914 Bacteria 3637
288 Ga0207671_10155129 3300025914 Bacteria 1771
289 Ga0207693_10292539 3300025915 Bacteria 1276
290 Ga0207663_10120570 3300025916 Bacteria 1795
291 Ga0207660_10103941 3300025917 Bacteria 2126
292 Ga0207657_10152968 3300025919 Bacteria 1878
293 Ga0207649_10388049 3300025920 Bacteria 1042
294 Ga0207652_10028115 3300025921 Bacteria 4690
295 Ga0207652_10039261 3300025921 Bacteria 4017
296 Ga0207681_10047323 3300025923 Bacteria 2897
297 Ga0207681_10156904 3300025923 Bacteria 1711
298 Ga0207694_10000258 3300025924 Bacteria 50514
299 Ga0207694_10018430 3300025924 Bacteria 5275
300 Ga0207694_10358970 3300025924 Bacteria 1207
301 Ga0207659_10448625 3300025926 Bacteria 1086
302 Ga0207700_10145389 3300025928 Bacteria 1953
303 Ga0207664_10038825 3300025929 Bacteria 3694
304 Ga0207644_10063340 3300025931 Bacteria 2685
305 Ga0207706_10042418 3300025933 Bacteria 4032
306 Ga0207686_10203467 3300025934 Bacteria 1419
307 Ga0207686_10263435 3300025934 Bacteria 1265
308 Ga0207709_10223642 3300025935 Bacteria 1359
309 Ga0207709_10281832 3300025935 Bacteria 1228
310 Ga0207665_10002675 3300025939 Bacteria 11969
311 Ga0207665_10245607 3300025939 Bacteria 1321
312 Ga0207691_10034093 3300025940 Bacteria 4738
313 Ga0207711_10009071 3300025941 Bacteria 8310
314 Ga0207711_10055022 3300025941 Bacteria 3416
315 Ga0207711_10238252 3300025941 Bacteria 1668
316 Ga0207711_10717426 3300025941 Bacteria 932
317 Ga0207689_10016221 3300025942 Bacteria 6309
318 Ga0207689_10504276 3300025942 Bacteria 1014
319 Ga0207689_10647975 3300025942 Bacteria 890
320 Ga0207661_10000331 3300025944 Bacteria 30097
321 Ga0207661_10032719 3300025944 Bacteria 4032
322 Ga0207679_10500171 3300025945 Bacteria 1084
323 Ga0207667_10009886 3300025949 Bacteria 11193
324 Ga0207667_10250852 3300025949 Bacteria 1810
325 Ga0207712_10006823 3300025961 Bacteria 7205
326 Ga0207712_10078385 3300025961 Bacteria 2397
327 Ga0207712_10521476 3300025961 Bacteria 1018
328 Ga0207668_10166914 3300025972 Bacteria 1722
329 Ga0207668_10210924 3300025972 Bacteria 1553
330 Ga0207640_10013426 3300025981 Bacteria 4694
331 Ga0207640_10046755 3300025981 Bacteria 2787
332 Ga0207640_10239367 3300025981 Bacteria 1401
333 Ga0207658_10184508 3300025986 Bacteria 1729
334 Ga0207703_10134015 3300026035 Bacteria 2142
335 Ga0207639_10072505 3300026041 Bacteria 2696
336 Ga0207639_10169897 3300026041 Bacteria 1845
337 Ga0207639_10200816 3300026041 Bacteria 1710
338 Ga0207639_10401952 3300026041 Bacteria 1234
339 Ga0207678_10007094 3300026067 Bacteria 9938
340 Ga0207678_10073914 3300026067 Bacteria 2921
341 Ga0207678_10285905 3300026067 Bacteria 1416
342 Ga0207708_10341706 3300026075 Bacteria 1226
343 Ga0207702_10000006 3300026078 Bacteria 346370
344 Ga0207702_10376403 3300026078 Bacteria 1364
345 Ga0207702_10479389 3300026078 Bacteria 1210
346 Ga0207641_10056865 3300026088 Bacteria 3326
347 Ga0207641_10421130 3300026088 Bacteria 1286
348 Ga0207648_10258308 3300026089 Bacteria 1554
349 Ga0207676_10443065 3300026095 Bacteria 1223
350 Ga0207676_10536164 3300026095 Bacteria 1116
351 Ga0207674_10056094 3300026116 Bacteria 4002
352 Ga0207674_10065044 3300026116 Bacteria 3677
353 Ga0207674_10077710 3300026116 Bacteria 3325
354 Ga0207674_10084921 3300026116 Bacteria 3163
355 Ga0207674_10174349 3300026116 Bacteria 2103
356 Ga0207674_10501809 3300026116 Bacteria 1172
357 Ga0207674_10789912 3300026116 Bacteria 916
358 Ga0207675_100124665 3300026118 Bacteria 2439
359 Ga0207675_100415244 3300026118 Bacteria 1328
360 Ga0207675_100522830 3300026118 Bacteria 1183
361 Ga0207683_10047777 3300026121 Bacteria 3748
362 Ga0207683_10103844 3300026121 Bacteria 2539
363 Ga0207683_10164930 3300026121 Bacteria 2004
364 Ga0207683_10251174 3300026121 Bacteria 1614
365 Ga0207698_10055008 3300026142 Bacteria 3064
366 Ga0207698_10088361 3300026142 Bacteria 2527
367 Ga0207698_10512724 3300026142 Bacteria 1169
368 Ga0209588_1068054 3300027671 Bacteria 1150
369 Ga0209813_10069552 3300027866 Bacteria 1142
370 Ga0268266_10028226 3300028379 Bacteria 4771
371 Ga0268266_10105070 3300028379 Bacteria 2494
372 Ga0268266_10208603 3300028379 Bacteria 1791
373 Ga0268266_10226873 3300028379 Bacteria 1719
374 Ga0268266_10323895 3300028379 Bacteria 1443
375 Ga0268266_10367665 3300028379 Bacteria 1354
376 Ga0268265_10009598 3300028380 Bacteria 6535
377 Ga0268265_10128860 3300028380 Bacteria 2099
378 Ga0268264_10000271 3300028381 Bacteria 90154
379 Ga0307509_10025601 3300031507 Bacteria 6586
380 Ga0307509_10029127 3300031507 Bacteria 6132
381 Ga0307408_100050149 3300031548 Bacteria 3001
382 Ga0307408_100370555 3300031548 Bacteria 1221
383 Ga0307408_100725981 3300031548 Bacteria 895
384 Ga0307508_10039588 3300031616 Bacteria 4233
385 Ga0307406_10301812 3300031901 Bacteria 1231
386 Ga0307416_100471782 3300032002 Bacteria 1313
387 Ga0307416_100625351 3300032002 Bacteria 1159
388 Ga0307411_10082470 3300032005 Bacteria 2218
389 Ga0307415_100064954 3300032126 Bacteria 2541
390 Ga0316593_10008780 3300032168 Bacteria 2833
391 Ga0307507_10013433 3300033179 Bacteria 9942
392 Ga0307510_10012167 3300033180 Bacteria 10203
393 Ga0307510_10021632 3300033180 Bacteria 7494
394 Ga0307510_10130945 3300033180 Bacteria 2182
395 Ga0307510_10299175 3300033180 Bacteria 1072
396 Ga0373955_0070441 3300035172 Bacteria 1954
397 Ga0316574_0215994 3300035398 Bacteria 1230
398 Ga0373935_0160393 3300035692 Bacteria 1532
399 Ga0373927_0005221 3300035695 Bacteria 8984
400 Ga0373927_0190934 3300035695 Bacteria 1344
401 Ga0373947_0104443 3300035725 Bacteria 1784
402 Ga0316582_0017683 3300036647 Bacteria 4131
403 Ga0373925_0196585 3300037068 Bacteria 1602
404 Ga0395898_0183641 3300037466 Bacteria 1998
405 Ga0395905_0002238 3300037471 Bacteria 21782
406 Ga0395901_0554737 3300038443 Bacteria 1164
407 Ga0436365_0301686 3300039437 Bacteria 9817
408 Ga0436365_0920281 3300039437 Bacteria 1605
409 Ga0436365_1546724 3300039437 Bacteria 1588
410 Ga0436365_1866973 3300039437 Bacteria 2842
411 Ga0436363_1116250 3300039450 Bacteria 1162
412 Ga0451833_0666882 3300041491 Bacteria 1165
413 Ga0451835_0701798 3300041492 Bacteria 1397
414 Ga0451835_0846484 3300041492 Bacteria 1528
415 Ga0451837_0832108 3300041494 Bacteria 5281
416 Ga0451837_1509718 3300041494 Bacteria 1397
417 Ga0451839_0615725 3300041496 Bacteria 1735
418 Ga0451839_1099990 3300041496 Bacteria 1397
419 Ga0451841_0047544 3300041498 Bacteria 1326
420 Ga0451841_0234887 3300041498 Bacteria 5141
421 Ga0451845_0451105 3300041501 Bacteria 1397
422 Ga0451847_0137423 3300041503 Bacteria 1397
423 Ga0451849_0615251 3300041505 Bacteria 4275
424 Ga0451849_0766215 3300041505 Bacteria 1397
425 Ga0451851_0095856 3300041507 Bacteria 1161
426 Ga0451843_0126997 3300041509 Bacteria 3404
427 Ga0451843_0277846 3300041509 Bacteria 1397
428 Ga0451855_0106049 3300041511 Bacteria 1638
429 Ga0451855_0179822 3300041511 Bacteria 1270
430 Ga0451853_3361738 3300041512 Bacteria 4036
431 Ga0451853_3365732 3300041512 Bacteria 1117
432 Ga0439435_0003562 3300042436 Bacteria 3254
433 Ga0495592_0314512 3300046454 Bacteria 1014
434 Ga0495603_0017441 3300046455 Bacteria 4344
435 Ga0495603_0177318 3300046455 Bacteria 1233
436 Ga0495603_0193862 3300046455 Bacteria 1174
437 Ga0495590_0075855 3300046457 Bacteria 1183
438 Ga0495629_0279900 3300046459 Bacteria 1145
439 Ga0495638_0000093 3300046460 Bacteria 142356
440 Ga0495638_0012296 3300046460 Bacteria 5871
441 Ga0495638_0094810 3300046460 Bacteria 1793
442 Ga0495651_0004745 3300046462 Bacteria 10404
443 Ga0495651_0035403 3300046462 Bacteria 3887
444 Ga0495650_0078871 3300046471 Bacteria 1274
445 Ga0495582_0298543 3300046473 Bacteria 926
446 Ga0495605_0058583 3300046474 Bacteria 1851
447 Ga0495605_0073658 3300046474 Bacteria 1608
448 Ga0495639_0033281 3300046475 Bacteria 2302
449 Ga0495639_0130439 3300046475 Bacteria 1203
450 Ga0495664_0021353 3300046477 Bacteria 3740
451 Ga0495664_0366400 3300046477 Bacteria 867
452 Ga0495584_0085316 3300046491 Bacteria 1591
453 Ga0495585_0116112 3300046492 Bacteria 1419
454 Ga0495594_0052519 3300046499 Bacteria 2244
455 Ga0495594_0171331 3300046499 Bacteria 1235
456 Ga0495607_0111819 3300046501 Bacteria 1447
457 Ga0495606_0013391 3300046507 Bacteria 6481
458 Ga0495606_0059370 3300046507 Bacteria 2454
459 Ga0495606_0121737 3300046507 Bacteria 1561
460 Ga0495606_0142679 3300046507 Bacteria 1413
461 Ga0495606_0154064 3300046507 Bacteria 1346
462 Ga0495608_0009046 3300046511 Bacteria 6968
463 Ga0495608_0059301 3300046511 Bacteria 2522
464 Ga0495610_0003544 3300046512 Bacteria 12092
465 Ga0495610_0030536 3300046512 Bacteria 2823
466 Ga0495616_0051909 3300046513 Bacteria 2043
467 Ga0495616_0055497 3300046513 Bacteria 1961
468 Ga0495620_0011824 3300046515 Bacteria 4538
469 Ga0495620_0049015 3300046515 Bacteria 1810
470 Ga0495620_0077440 3300046515 Bacteria 1350
471 Ga0495628_0047046 3300046516 Bacteria 3425
472 Ga0495631_0025660 3300046518 Bacteria 2711
473 Ga0495631_0049221 3300046518 Bacteria 1846
474 Ga0495632_0012123 3300046519 Bacteria 4986
475 Ga0495632_0069407 3300046519 Bacteria 1697
476 Ga0495643_0009325 3300046522 Bacteria 6109
477 Ga0495643_0051206 3300046522 Bacteria 2221
478 Ga0495643_0079847 3300046522 Bacteria 1704
479 Ga0495648_0049617 3300046524 Bacteria 2571
480 Ga0495648_0154229 3300046524 Bacteria 1195
481 Ga0495648_0200028 3300046524 Bacteria 1001
482 Ga0495666_0062894 3300046526 Bacteria 1772
483 Ga0495652_0025991 3300046529 Bacteria 5173
484 Ga0495652_0070348 3300046529 Bacteria 2925
485 Ga0495652_0200162 3300046529 Bacteria 1516
486 Ga0495587_0024739 3300046536 Bacteria 3677
487 Ga0495587_0174020 3300046536 Bacteria 1222
488 Ga0495609_0059358 3300046538 Bacteria 1691
489 Ga0495609_0102151 3300046538 Bacteria 1242
490 Ga0495597_0004648 3300046542 Bacteria 7477
491 Ga0495597_0014749 3300046542 Bacteria 3716
492 Ga0495597_0055352 3300046542 Bacteria 1740
493 Ga0495645_0089611 3300046543 Bacteria 2199
494 Ga0495622_0003148 3300046557 Bacteria 7810
495 Ga0495622_0007018 3300046557 Bacteria 5228
496 Ga0495622_0013881 3300046557 Bacteria 3737
497 Ga0495622_0031590 3300046557 Bacteria 2474
498 Ga0495622_0051770 3300046557 Bacteria 1904
499 Ga0495622_0099376 3300046557 Bacteria 1334
500 Ga0495633_0072008 3300046558 Bacteria 1612
501 Ga0495667_0038688 3300046559 Bacteria 3175
502 Ga0495668_0026449 3300046616 Bacteria 3292
503 Ga0495668_0072194 3300046616 Bacteria 1896
504 Ga0495668_0252893 3300046616 Bacteria 964
505 Ga0495634_0047258 3300046642 Bacteria 2901
506 Ga0495611_0018160 3300046648 Bacteria 3014
507 Ga0495625_0008959 3300046660 Bacteria 8451
508 Ga0495625_0112164 3300046660 Bacteria 1863
509 Ga0495625_0178005 3300046660 Bacteria 1416
510 Ga0495625_0279754 3300046660 Bacteria 1074
511 Ga0495635_0086462 3300046663 Bacteria 2145
512 Ga0495659_0080172 3300046664 Bacteria 1238
513 Ga0495661_0118917 3300046665 Bacteria 1462
514 Ga0495588_0004395 3300046674 Bacteria 6227
515 Ga0495588_0077068 3300046674 Bacteria 1738
516 Ga0495657_0025122 3300046675 Bacteria 4234
517 Ga0495657_0053262 3300046675 Bacteria 2708
518 Ga0495599_0007960 3300046678 Bacteria 6428
519 Ga0495599_0177361 3300046678 Bacteria 1314
520 Ga0495623_0016163 3300046679 Bacteria 4820
521 Ga0495646_0017819 3300046680 Bacteria 4501
522 Ga0495647_0035152 3300046681 Bacteria 1880
523 Ga0495669_0205330 3300046684 Bacteria 942
524 Ga0495613_0007936 3300046689 Bacteria 7900
525 Ga0495613_0042760 3300046689 Bacteria 3352
526 Ga0495624_0038078 3300046690 Bacteria 3091
527 Ga0495624_0190075 3300046690 Bacteria 1249
528 Ga0495624_0270335 3300046690 Bacteria 1027
529 Ga0495670_0018287 3300046691 Bacteria 3451
530 Ga0495670_0050605 3300046691 Bacteria 2080
531 Ga0495670_0060507 3300046691 Bacteria 1903
532 Ga0495649_0128470 3300046694 Bacteria 1338
533 Ga0495600_0001949 3300046809 Bacteria 11590
534 Ga0495600_0013037 3300046809 Bacteria 5215
535 Ga0495660_0006722 3300046810 Bacteria 6790
536 Ga0495660_0126052 3300046810 Bacteria 1290
537 Ga0495660_0153503 3300046810 Bacteria 1135
538 Ga0495581_0066884 3300047315 Bacteria 2078
539 Ga0495604_0026776 3300047317 Bacteria 4589
540 Ga0495604_0038952 3300047317 Bacteria 3737
541 Ga0495636_0025766 3300047318 Bacteria 2389
542 Ga0495674_0068767 3300047319 Bacteria 3064
543 Ga0495672_0092763 3300047320 Bacteria 1655
544 Ga0495676_0094977 3300047321 Bacteria 2220
545 Ga0495676_0307600 3300047321 Bacteria 1067
546 Ga0495680_0056250 3300047322 Bacteria 3046
547 Ga0495687_009909 3300047443 Bacteria 5273
548 Ga0495687_024317 3300047443 Bacteria 2880
549 Ga0495675_0018173 3300047444 Bacteria 4460
550 Ga0495684_0045599 3300047471 Bacteria 3355
551 Ga0495602_0021306 3300048088 Bacteria 6385
552 Ga0495602_0055287 3300048088 Bacteria 3497
553 Ga0496100_0047645 3300048903 Bacteria 2763
554 Ga0496100_0193011 3300048903 Bacteria 1480
555 Ga0496101_0052058 3300048904 Bacteria 2951
556 Ga0496102_0000614 3300048905 Bacteria 36967
557 Ga0496102_0018881 3300048905 Bacteria 6066
558 Ga0496102_0045731 3300048905 Bacteria 3974
559 Ga0496102_0304408 3300048905 Bacteria 1502
560 Ga0496102_0411624 3300048905 Bacteria 1270
561 Ga0496102_0458890 3300048905 Bacteria 1195
562 Ga0496102_0468777 3300048905 Bacteria 1180
563 Ga0496103_0013040 3300048906 Bacteria 4928
564 Ga0496103_0032673 3300048906 Bacteria 3176
565 Ga0496103_0198439 3300048906 Bacteria 1290
566 Ga0496104_0028633 3300048907 Bacteria 5163
567 Ga0496104_0041567 3300048907 Bacteria 4311
568 Ga0496104_0069427 3300048907 Bacteria 3349
569 Ga0496104_0088931 3300048907 Bacteria 2951
570 Ga0496105_0014940 3300048908 Bacteria 6181
571 Ga0496105_0033632 3300048908 Bacteria 4212
572 Ga0496105_0081982 3300048908 Bacteria 2664
573 Ga0496105_0143377 3300048908 Bacteria 1965
574 Ga0496105_0657615 3300048908 Bacteria 808
575 Ga0496106_0097872 3300048909 Bacteria 2272
576 Ga0496106_0307330 3300048909 Bacteria 1272
577 Ga0496107_0104865 3300048910 Bacteria 2075
578 Ga0496108_0054477 3300048911 Bacteria 3356
579 Ga0496108_0597165 3300048911 Bacteria 962
580 Ga0496109_0418734 3300048912 Bacteria 1265
581 Ga0496109_0501941 3300048912 Bacteria 1145
582 Ga0496109_0531469 3300048912 Bacteria 1110
583 Ga0496110_0106873 3300048913 Bacteria 2511
584 Ga0496110_0121491 3300048913 Bacteria 2354
585 Ga0496110_0234521 3300048913 Bacteria 1669
586 Ga0496110_0556462 3300048913 Bacteria 1042
587 Ga0496110_0592077 3300048913 Bacteria 1006
588 Ga0496111_0066281 3300048914 Bacteria 2622
589 Ga0496112_0084499 3300048915 Bacteria 3139
590 Ga0496112_0585805 3300048915 Bacteria 1048
591 Ga0496112_0775612 3300048915 Bacteria 884
592 Ga0496113_0064474 3300048916 Bacteria 2770
593 Ga0496113_0150197 3300048916 Bacteria 1837
594 Ga0496113_0242777 3300048916 Bacteria 1437
595 Ga0496115_0148694 3300048918 Bacteria 1934
596 Ga0496115_0420779 3300048918 Bacteria 1082
597 Ga0496115_0513494 3300048918 Bacteria 962
598 Ga0496116_0024695 3300048919 Bacteria 4436
599 Ga0496116_0048297 3300048919 Bacteria 2857
600 Ga0496116_0072039 3300048919 Bacteria 2186
601 Ga0496116_0108942 3300048919 Bacteria 1634
602 Ga0496116_0255484 3300048919 Bacteria 869
603 Ga0496117_0042409 3300048920 Bacteria 3320
604 Ga0496117_0091177 3300048920 Bacteria 1961
605 Ga0496117_0091313 3300048920 Bacteria 1959
606 Ga0496118_0000353 3300048921 Bacteria 77839
607 Ga0496118_0009194 3300048921 Bacteria 10034
608 Ga0496118_0106169 3300048921 Bacteria 1880
609 Ga0496118_0126991 3300048921 Bacteria 1647
610 Ga0496118_0135790 3300048921 Bacteria 1570
611 Ga0496118_0207637 3300048921 Bacteria 1153
612 Ga0496118_0269996 3300048921 Bacteria 954
613 Ga0496119_0005991 3300048922 Bacteria 11421
614 Ga0496119_0012748 3300048922 Bacteria 6789
615 Ga0496119_0132709 3300048922 Bacteria 1355
616 Ga0496120_0001950 3300048923 Bacteria 22601
617 Ga0496120_0003410 3300048923 Bacteria 14534
618 Ga0496120_0024687 3300048923 Bacteria 3743
619 Ga0496120_0070716 3300048923 Bacteria 1918
620 Ga0496121_0000536 3300048924 Bacteria 72166
621 Ga0496121_0001187 3300048924 Bacteria 45612
622 Ga0496121_0031628 3300048924 Bacteria 4830
623 Ga0496121_0038931 3300048924 Bacteria 4200
624 Ga0496121_0041610 3300048924 Bacteria 4013
625 Ga0496121_0132225 3300048924 Bacteria 1865
626 Ga0496121_0233284 3300048924 Bacteria 1287
627 Ga0496121_0303059 3300048924 Bacteria 1083
628 Ga0496122_0044235 3300048925 Bacteria 3478
629 Ga0496122_0047262 3300048925 Bacteria 3324
630 Ga0496124_0017619 3300048927 Bacteria 6725
631 Ga0496124_0271568 3300048927 Bacteria 1241
632 Ga0496125_0013222 3300048928 Bacteria 8128
633 Ga0496125_0033769 3300048928 Bacteria 4521
634 Ga0496125_0049986 3300048928 Bacteria 3467
635 Ga0496125_0128650 3300048928 Bacteria 1788
636 Ga0496125_0141482 3300048928 Bacteria 1672
637 Ga0496126_0002330 3300048929 Bacteria 26023
638 Ga0496126_0003343 3300048929 Bacteria 20380
639 Ga0496126_0042429 3300048929 Bacteria 4201
640 Ga0496126_0067381 3300048929 Bacteria 3198
641 Ga0496126_0113540 3300048929 Bacteria 2358
642 Ga0496126_0165644 3300048929 Bacteria 1886
643 Ga0496126_0191209 3300048929 Bacteria 1733
644 Ga0496126_0215921 3300048929 Bacteria 1613
645 Ga0496126_0218785 3300048929 Bacteria 1601
646 Ga0496126_0368243 3300048929 Bacteria 1172
647 Ga0496126_0409142 3300048929 Bacteria 1099
648 Ga0495678_075828 3300049459 Bacteria 1220
649 Ga0495682_0027421 3300049460 Bacteria 2112
650 Ga0501033_0028443 3300049570 Bacteria 4199
651 Ga0501034_0044368 3300049571 Bacteria 4498
652 Ga0501034_0044504 3300049571 Bacteria 4489
653 Ga0501034_0124768 3300049571 Bacteria 2560
654 Ga0501038_0024848 3300049574 Bacteria 5341
655 Ga0501039_0141055 3300049575 Bacteria 1893
656 Ga0501043_0075835 3300049579 Bacteria 2641
657 Ga0501047_0029247 3300049581 Bacteria 5314
658 Ga0501067_0132905 3300049583 Bacteria 1385
659 Ga0501073_0442238 3300049589 Bacteria 899
660 Ga0501044_0016392 3300049823 Bacteria 7956
661 nmdc:mga00v17_117832_c1 3300050491 Bacteria 1689
662 nmdc:mga0yw44_184330_c1 3300050492 Bacteria 1375
663 nmdc:mga0yw44_240269_c1 3300050492 Bacteria 1204
664 nmdc:mga0yw44_331417_c1 3300050492 Bacteria 1023
665 nmdc:mga0k408_105533_c1 3300050493 Bacteria 1663
666 nmdc:mga0k408_191336_c1 3300050493 Bacteria 1221
667 nmdc:mga0k408_286695_c1 3300050493 Bacteria 983
668 nmdc:mga06z11_32100_c1 3300050494 Bacteria 2558
669 nmdc:mga06z11_36737_c1 3300050494 Bacteria 2420
670 nmdc:mga04h51_58281_c1 3300050495 Bacteria 1316
671 nmdc:mga04h51_82851_c1 3300050495 Bacteria 1142
672 nmdc:mga07m45_20408_c1 3300050496 Bacteria 3598
673 nmdc:mga07m45_205883_c1 3300050496 Bacteria 1144
674 nmdc:mga07m45_39541_c1 3300050496 Bacteria 2636
675 nmdc:mga08y16_242270_c1 3300050511 Bacteria 1864
676 nmdc:mga0n895_171740_c1 3300050512 Bacteria 2200
677 nmdc:mga0sz30_17972_c1 3300050516 Bacteria 2826
678 Ga0500635_0000082 3300053080 Bacteria 62117
679 Ga0500635_0013594 3300053080 Bacteria 2368
680 Ga0500635_0027315 3300053080 Bacteria 1813
681 Ga0495655_0039111 3300053083 Bacteria 1200
682 Ga0495619_0043214 3300053085 Bacteria 2954
683 Ga0500578_0217792 3300053086 Bacteria 1162
684 Ga0500643_000046 3300053087 Bacteria 150388
685 Ga0500643_004317 3300053087 Bacteria 6483
686 Ga0500644_0135345 3300053088 Bacteria 974
687 Ga0500646_0079314 3300053090 Bacteria 999
688 Ga0500583_0011107 3300053092 Bacteria 3379
689 Ga0500566_0000381 3300053094 Bacteria 24461
690 Ga0500566_0070023 3300053094 Bacteria 1970
691 Ga0500566_0141175 3300053094 Bacteria 1278
692 Ga0500641_0021968 3300053096 Bacteria 2439
693 Ga0500555_003852 3300053103 Bacteria 4268
694 Ga0500556_0107655 3300053104 Bacteria 1078
695 Ga0500557_000054 3300053105 Bacteria 50111
696 Ga0500562_012538 3300053108 Bacteria 2157
697 Ga0500562_019187 3300053108 Bacteria 1768
698 Ga0500569_003280 3300053109 Bacteria 3289
699 Ga0500572_000074 3300053111 Bacteria 31840
700 Ga0500594_0021858 3300053118 Bacteria 1608
701 Ga0500595_002781 3300053119 Bacteria 8432
702 Ga0500595_008745 3300053119 Bacteria 4120
703 Ga0500595_025862 3300053119 Bacteria 2028
704 Ga0500607_013154 3300053121 Bacteria 4839
705 Ga0500607_062768 3300053121 Bacteria 1940
706 Ga0500608_010385 3300053122 Bacteria 3995
707 Ga0500608_099352 3300053122 Bacteria 1350
708 Ga0500618_008138 3300053125 Bacteria 2946
709 Ga0500642_0000136 3300053130 Bacteria 32674
710 Ga0500642_0040912 3300053130 Bacteria 2001
711 Ga0500655_021535 3300053133 Bacteria 1209
712 Ga0500658_0007101 3300053134 Bacteria 4141
713 Ga0500658_0011035 3300053134 Bacteria 3331
714 Ga0500658_0026826 3300053134 Bacteria 2222
715 Ga0500658_0032267 3300053134 Bacteria 2053
716 Ga0500559_0000780 3300053136 Bacteria 20835
717 Ga0500559_0013121 3300053136 Bacteria 3513
718 Ga0500559_0175459 3300053136 Bacteria 1008
719 Ga0500568_0000460 3300053139 Bacteria 30312
720 Ga0500589_113253 3300053147 Bacteria 1160
721 Ga0500590_046515 3300053148 Bacteria 2217
722 Ga0500603_014746 3300053150 Bacteria 1829
723 Ga0500616_0001157 3300053153 Bacteria 26958
724 Ga0500616_0101707 3300053153 Bacteria 1403
725 Ga0500620_004187 3300053155 Bacteria 3189
726 Ga0500622_0000064 3300053156 Bacteria 127531
727 Ga0500622_0012955 3300053156 Bacteria 4504
728 Ga0500624_000027 3300053157 Bacteria 108821
729 Ga0500627_0033964 3300053158 Bacteria 2159
730 Ga0500627_0076808 3300053158 Bacteria 1485
731 Ga0500633_0021962 3300053160 Bacteria 1948
732 Ga0500636_0001429 3300053177 Bacteria 13007
733 Ga0500636_0005358 3300053177 Bacteria 7315
734 Ga0500636_0019166 3300053177 Bacteria 4048
735 Ga0500636_0088371 3300053177 Bacteria 1777
736 Ga0500636_0217722 3300053177 Bacteria 997
737 Ga0500636_0273186 3300053177 Bacteria 848
738 Ga0500637_0000433 3300053178 Bacteria 15981
739 Ga0500637_0027901 3300053178 Bacteria 3119
740 Ga0500637_0069923 3300053178 Bacteria 2019
741 Ga0500637_0125663 3300053178 Bacteria 1487
742 Ga0500625_011807 3300053729 Bacteria 3979
743 Ga0500625_031227 3300053729 Bacteria 2528
744 Ga0500645_023914 3300053730 Bacteria 1871
745 Ga0500609_003116 3300053731 Bacteria 2351
746 Ga0500601_000722 3300053737 Bacteria 4354
747 Ga0500661_002049 3300055283 Bacteria 3807
748 Ga0590071_016772 3300059421 Bacteria 1719
749 Ga0590077_011018 3300059426 Bacteria 1865
750 2507507892 2507262055 Bacteria 8048963
751 2508542003 2508501009 Bacteria 7784016
752 2508692453 2508501042 Bacteria 8719808
753 2511395272 2511231028 Bacteria 8046582
754 2513612214 2513237090 Bacteria 7096802
755 2513639331 2513237094 Bacteria 8789602
756 2513647293 2513237095 Bacteria 8976980
757 2513700113 2513237102 Bacteria 7703324
758 2513870312 2513237138 Bacteria 7368160
759 2513878282 2513237139 Bacteria 8737671
760 2514009663 2513237161 Bacteria 8871253
761 2514032668 2513237164 Bacteria 7563725
762 2515626791 2515154112 Bacteria 8294334
763 2515635666 2515154113 Bacteria 7807172
764 2515741714 2515154134 Bacteria 7220242
765 2517103903 2517093001 Bacteria 9002274
766 2524463013 2524023209 Bacteria 6679728
767 2528853057 2528768022 Bacteria 10457665
768 2585203182 2582581294 Bacteria 6626667
769 2585277759 2582581308 Bacteria 7413247
770 2585403029 2582581867 Bacteria 7184437
771 2585530430 2585427526 Bacteria 7258840
772 2585533374 2585427527 Bacteria 7273426
773 2585557881 2585427530 Bacteria 7383882
774 2585825229 2585427590 Bacteria 6824633
775 2599936900 2599185301 Bacteria 6161860
776 2600196370 2599185352 Bacteria 7228948
777 2616310564 2615840626 Bacteria 7921970
778 2616311796 2615840626 Bacteria 7921970
779 2617346570 2617270735 Bacteria 9163226
780 2643918065 2643221582 Bacteria 5804683
781 2644130286 2643221623 Bacteria 5239945
782 2644153910 2643221627 Bacteria 6761570
783 2728749367 2728368998 Bacteria 8720350
784 2738799570 2738541293 Bacteria 7065685
785 2753459734 2751185821 Bacteria 6189929
786 2778176739 2775507266 Bacteria 7392367
787 2792751805 2791355123 Bacteria 8049106
788 2793359282 2791355266 Bacteria 7116587
789 2805918470 2802429603 Bacteria 8777136
790 2818236331 2816332527 Bacteria 8933356
791 2819643133 2818991453 Bacteria 7181617
792 2824622888 2824617872 Bacteria 8814715
793 2824631961 2824626560 Bacteria 8813858
794 2824638540 2824635225 Bacteria 8785348
795 2824649621 2824644064 Bacteria 8743947
796 2824658249 2824653114 Bacteria 8493680
797 2824665343 2824661429 Bacteria 9877870
798 2824678064 2824671348 Bacteria 8369588
799 2824694458 2824687955 Bacteria 8360029
800 2824699681 2824696289 Bacteria 8335049
801 2824707569 2824704595 Bacteria 9667483
802 2824716194 2824714736 Bacteria 8717648
803 2824726838 2824723954 Bacteria 8758240
804 2824755710 2824753945 Bacteria 9787441
805 2824766373 2824763712 Bacteria 9792355
806 2824777316 2824773399 Bacteria 8360218
807 2838034488 2838029111 Bacteria 6603031
808 2838122893 2838122688 Bacteria 8803140
809 2838668374 2838661181 Bacteria 7385261
810 2838691049 2838686498 Bacteria 7807632
811 2841950844 2841949485 Bacteria 8680857
812 2841973704 2841966195 Bacteria 8673214
813 2841988960 2841983080 Bacteria 8395090
814 2842040425 2842038055 Bacteria 8002051
815 2842046630 2842045827 Bacteria 8006841
816 2842117287 2842110456 Bacteria 7656360
817 2842275524 2842271015 Bacteria 7807131
818 2842302145 2842298080 Bacteria 6123127
819 2842363148 2842357229 Bacteria 6485165
820 2842481235 2842475841 Bacteria 6603183
821 2842489104 2842482326 Bacteria 7212537
822 2842508180 2842502639 Bacteria 6604161
823 2842513938 2842509118 Bacteria 6850950
824 2844462240 2844454524 Bacteria 7952546
825 2847947506 2847939898 Bacteria 8606328
826 2849078618 2849076700 Bacteria 7039503
827 2857513004 2857509624 Bacteria 7472071
828 2869166667 2869162929 Bacteria 6399702
829 2874598995 2874590934 Bacteria 8299676
830 2874614815 2874612657 Bacteria 8252029
831 2874622313 2874620515 Bacteria 8290088
832 2874650558 2874645413 Bacteria 8214782
833 2876779034 2876771140 Bacteria 8287509
834 2876810623 2876808645 Bacteria 8824342
835 2876822638 2876818435 Bacteria 8274608
836 2879082827 2879074833 Bacteria 8279565
837 2879102845 2879099564 Bacteria 10442239
838 2879114476 2879110137 Bacteria 8907982
839 2879133108 2879127579 Bacteria 8294491
840 2879149395 2879142872 Bacteria 8267021
841 2881364705 2881364244 Bacteria 7710352
842 2885310765 2885305155 Bacteria 7348390
843 2885341189 2885334103 Bacteria 7216818
844 2885369668 2885366525 Bacteria 8326213
845 2888385226 2888378607 Bacteria 9652610
846 2888393013 2888388044 Bacteria 7304136
847 2888425369 2888419890 Bacteria 7857137
848 2889021441 2889016732 Bacteria 6700763
849 2903730529 2903727486 Bacteria 8281579
850 2904667924 2904666416 Bacteria 8226587
851 2904694449 2904690495 Bacteria 9412302
852 2904712224 2904711408 Bacteria 9771557
853 2906632295 2906626472 Bacteria 8826946
854 2908741953 2908739725 Bacteria 8628932
855 2908759638 2908756301 Bacteria 8864324
856 2922372666
857 2924723469 2924718760 Bacteria 6331356
858 2929620479 2929615660 Bacteria 9193770
859 2929626372 2929624759 Bacteria 9339455
860 2932784755 2932784394 Bacteria 9704911
861 2932795370 2932794094 Bacteria 7915132
862 2932809735 2932809354 Bacteria 9135765
863 2932818520 2932818245 Bacteria 9955613
864 2932828538 2932828146 Bacteria 9745859
865 2933019354 2933016740 Bacteria 6355406
866 2933582397 2933577622 Bacteria 9116884
867 2933590031 2933586486 Bacteria 7667493
868 2935609617 2935608549 Bacteria 8203142
869 2935617496 2935616580 Bacteria 9032984
870 2935639022 2935638405 Bacteria 10015038
871 2935652236 2935648319 Bacteria 8801166
872 2935660818 2935656913 Bacteria 8965014
873 2935666126 2935665750 Bacteria 9571747
874 2935675775 2935675223 Bacteria 9928132
875 2935685216 2935684952 Bacteria 9590419
876 2935694906 2935694250 Bacteria 9291695
877 2935704029 2935703347 Bacteria 10242284
878 2935713769 2935713505 Bacteria 9608509
879 2935724388 2935722832 Bacteria 9608746
880 2935733254 2935732158 Bacteria 9706831
881 2935742633 2935741537 Bacteria 9707219
882 2935751181 2935750917 Bacteria 9590372
883 2935760295 2935760218 Bacteria 9817913
884 2935770008 2935769743 Bacteria 7878163
885 2935784783 2935777560 Bacteria 8077691
886 2935785750 2935785616 Bacteria 7962367
887 2935794322 2935793552 Bacteria 8012592
888 2935802112 2935801545 Bacteria 9301974
889 2935810934 2935810662 Bacteria 9401221
890 2935822779 2935819856 Bacteria 8261050
891 2935828517 2935827899 Bacteria 10038562
892 2935839893 2935837841 Bacteria 9454360
893 2935848361 2935847175 Bacteria 8228321
894 2935856121 2935855204 Bacteria 9035059
895 2935865935 2935864058 Bacteria 9784707
896 2935877740 2935873716 Bacteria 9632195
897 2935883737 2935883170 Bacteria 7964738
898 2935909836 2935908558 Bacteria 8568796
899 2935917560 2935916978 Bacteria 9113783
900 2935927316 2935926038 Bacteria 8601059
901 2935936839 2935934488 Bacteria 8602579
902 2935944858 2935942939 Bacteria 8599779
903 2935953295 2935951376 Bacteria 8602333
904 2935961204 2935959822 Bacteria 7869783
905 2935970135 2935967501 Bacteria 8603075
906 2935980436 2935975950 Bacteria 8347125
907 2935986703 2935984226 Bacteria 8302647
908 2935992685 2935992306 Bacteria 9802711
909 2936002557 2936002035 Bacteria 9362176
910 2936014874 2936011229 Bacteria 8801034
911 2936022145 2936019824 Bacteria 8804134
912 2936032833 2936028420 Bacteria 8965941
913 2936037646 2936037263 Bacteria 9446081
914 2936050615 2936046547 Bacteria 8903709
915 2936059609 2936055302 Bacteria 8785755
916 2937116079 2937113482 Bacteria 6505872
917 2940558017 2940556831 Bacteria 9590747
918 2941536832 2941531003 Bacteria 7653939
919 2941540767 2941538514 Bacteria 9402094
920 2957416628 2957415311 Bacteria 6991633
921 2957494162 2957491536 Bacteria 6695180
922 2964712856 2964712639 Bacteria 6695970
923 2970078787 2970076120 Bacteria 6697332
924 2977525453 2977523885 Bacteria 6960446
925 3005507305 3005506211 Bacteria 6943378
926 3005715605 3005710791 Bacteria 7622528
927 8004643018 8004640170 Bacteria 6723001
928 8006987436 8006984368 Bacteria 9651211
929 8016528904 8016522445 Bacteria 8156687
930 8016534098 8016530956 Bacteria 8155261
931 8016547327 8016539877 Bacteria 8155419
932 8016554816 8016548790 Bacteria 8155074
933 8016563179 8016557553 Bacteria 8154380
934 8016572440 8016566248 Bacteria 8158151
935 8016593882 8016583857 Bacteria 10421953
936 8016600935 8016595262 Bacteria 8149947
937 8016615377 8016613128 Bacteria 8794220
938 8016639414 8016630954 Bacteria 9217207
939 8017064632 8017057580 Bacteria 10023680
940 8019545802 8019538911 Bacteria 7872763
941 8019552919 8019547302 Bacteria 7996444
942 8019583998 8019576017 Bacteria 10049540
943 8019591805 8019586578 Bacteria 10212056
944 8019599532 8019597564 Bacteria 10041141
945 8019619569 8019619141 Bacteria 9218857
946 8019646352 8019638758 Bacteria 9062356
947 8019649102 8019648815 Bacteria 10014479
948 8019685228 8019678201 Bacteria 8863603
949 8019690838 8019687851 Bacteria 8712826
950 8055619317 8055617313 Bacteria 7548464
951 8055745341 8055742211 Bacteria 9226248
952 8056687680 8056681323 Bacteria 8472857
953 8056693473 8056689827 Bacteria 6712655
954 8056876649 8056875544 Bacteria 4355797
955 8056968806 8056967851 Bacteria 9038162
956 8057879853 8057874678 Bacteria 7494653
957 Ga0495686_0066313
958 JGI24736J21556_1010478
959 JGI24740J21852_10009539
960 JGI24740J21852_10018129
961 JGI24740J21852_10043019
962 JGI24740J21852_10053524
963 JGI24739J22299_10045881
964 JGI24739J22299_10070700
965 JGI24737J22298_10041879
966 JGI24735J21928_10050971
967 JGI24738J21930_10021365
968 JGI25165J46597_1000006
969 JGI25153J46596_10002640
970 JGI25153J46596_10006320
971 JGI25153J46596_10008296
972 rootL2_10177720
973 JGI25160J50197_1000826
974 JGI25160J50197_1012801
975 JGI25404J52841_10011078
976 JGI25404J52841_10039595
977 Ga0055528_1000544
978 Ga0065165_1000953
979 Ga0065165_1002778
980 Ga0065165_1016141
981 Ga0070658_10328052
982 Ga0070658_10492434
983 Ga0070676_10083914
984 Ga0070676_10085855
985 Ga0070683_100007383
986 Ga0070683_100031653
987 Ga0068869_100188815
988 Ga0068869_100480231
989 Ga0068869_100586891
990 Ga0070666_10086242
991 Ga0070680_100531114
992 Ga0070682_100058791
993 Ga0070682_100313768
994 Ga0070660_100111058
995 Ga0070668_100138585
996 Ga0070669_100058680
997 Ga0070688_100269133
998 Ga0070659_100088026
999 Ga0070667_100056373
1000 Ga0070709_10036716
1001 Ga0070709_10307754
1002 Ga0070714_100002584
1003 Ga0070714_100585084
1004 Ga0070713_100086394
1005 Ga0070710_10000501
1006 Ga0070710_10183781
1007 Ga0070710_10476192
1008 Ga0070701_10033118
1009 Ga0070711_100044952
1010 Ga0070663_100021296
1011 Ga0070663_100027618
1012 Ga0070663_100079555
1013 Ga0070663_100312237
1014 Ga0070678_100086429
1015 Ga0070678_100198686
1016 Ga0070662_100023894
1017 Ga0070662_100089686
1018 Ga0070681_10033499
1019 Ga0070681_10182527
1020 Ga0070698_100736491
1021 Ga0070699_100384408
1022 Ga0070679_100092244
1023 Ga0070679_100334912
1024 Ga0070684_100002474
1025 Ga0068853_100001742
1026 Ga0068853_100013884
1027 Ga0068853_100099647
1028 Ga0068853_100147807
1029 Ga0068853_100267441
1030 Ga0070672_100328535
1031 Ga0070665_100046083
1032 Ga0070665_100069708
1033 Ga0070665_100427743
1034 Ga0068855_100075640
1035 Ga0068855_100150914
1036 Ga0068857_100036325
1037 Ga0068857_100418811
1038 Ga0068857_100457678
1039 Ga0068854_100039271
1040 Ga0068854_100056832
1041 Ga0068854_100321297
1042 Ga0068856_100012955
1043 Ga0068856_100322481
1044 Ga0068856_100327042
1045 Ga0068856_100477409
1046 Ga0068856_100818653
1047 Ga0068852_100073636
1048 Ga0068852_100328306
1049 Ga0068852_100602969
1050 Ga0068859_100176840
1051 Ga0068859_100248636
1052 Ga0068859_100534830
1053 Ga0068864_100452028
1054 Ga0068861_100009251
1055 Ga0068861_100050478
1056 Ga0068861_100266140
1057 Ga0068861_100445797
1058 Ga0068851_10046400
1059 Ga0068851_10183348
1060 Ga0068863_100202527
1061 Ga0068858_100061887
1062 Ga0068858_100624858
1063 Ga0068860_100000217
1064 Ga0068860_100034329
1065 Ga0068862_100013908
1066 Ga0068862_100044093
1067 Ga0068862_100112279
1068 Ga0068862_100194527
1069 Ga0081455_10136729
1070 Ga0081540_1006420
1071 Ga0081540_1009150
1072 Ga0081540_1009188
1073 Ga0081540_1058566
1074 Ga0081540_1061289
1075 Ga0081540_1107676
1076 Ga0070717_10223502
1077 Ga0070717_10567823
1078 Ga0075365_10093101
1079 Ga0075365_10094729
1080 Ga0075365_10133614
1081 Ga0075365_10143954
1082 Ga0075368_10018440
1083 Ga0075368_10098687
1084 Ga0075363_100061669
1085 Ga0075363_100077582
1086 Ga0075364_10064214
1087 Ga0075364_10165551
1088 Ga0070716_100001649
1089 Ga0070712_100270628
1090 Ga0075362_10007812
1091 Ga0075362_10169015
1092 Ga0075367_10021221
1093 Ga0075369_10011058
1094 Ga0075366_10069715
1095 Ga0075366_10089603
1096 Ga0075366_10132388
1097 Ga0075366_10153173
1098 Ga0097621_100056820
1099 Ga0075370_10003227
1100 Ga0075370_10012524
1101 Ga0068871_100281926
1102 Ga0068871_100286171
1103 Ga0068871_100398121
1104 Ga0075428_100041687
1105 Ga0075428_100196785
1106 Ga0075428_100645452
1107 Ga0075431_100642590
1108 Ga0075434_100115025
1109 Ga0075434_100172071
1110 Ga0068865_100159767
1111 Ga0068865_100316578
1112 Ga0097620_100176845
1113 Ga0097620_100248637
1114 Ga0097620_100534810
1115 Ga0099794_10023859
1116 Ga0105240_10000336
1117 Ga0105240_10003411
1118 Ga0105240_10465850
1119 Ga0111539_10167067
1120 Ga0105245_10160454
1121 Ga0105247_10008005
1122 Ga0105247_10132294
1123 Ga0105243_10085956
1124 Ga0105241_10013101
1125 Ga0105241_10082829
1126 Ga0105241_10143174
1127 Ga0105241_10406186
1128 Ga0105248_10009311
1129 Ga0105248_10014838
1130 Ga0105248_10039164
1131 Ga0105248_10153724
1132 Ga0105237_10000690
1133 Ga0105237_10056017
1134 Ga0105237_10059464
1135 Ga0105237_10066120
1136 Ga0105237_10088873
1137 Ga0105237_10183098
1138 Ga0105237_10250188
1139 Ga0105237_10310279
1140 Ga0105237_10430544
1141 Ga0105238_10005788
1142 Ga0105238_10007078
1143 Ga0105238_10202980
1144 Ga0105238_10275551
1145 Ga0105238_10339591
1146 Ga0105238_10551698
1147 Ga0105249_10019015
1148 Ga0105249_10393375
1149 Ga0105249_10711666
1150 Ga0099796_10084012
1151 Ga0105239_10006751
1152 Ga0105239_10008236
1153 Ga0105239_10070772
1154 Ga0105239_10375310
1155 Ga0105239_10381665
1156 Ga0105239_10383971
1157 Ga0105239_10461945
1158 Ga0105239_10712954
1159 Ga0105239_10957680
1160 Ga0105246_10121974
1161 Ga0105246_10426055
1162 Ga0157370_10006306
1163 Ga0157369_10118453
1164 Ga0157369_10155960
1165 Ga0157374_10371927
1166 Ga0157378_10126465
1167 Ga0157378_10207621
1168 Ga0163162_10038979
1169 Ga0163162_10194801
1170 Ga0163162_10370534
1171 Ga0157372_10138050
1172 Ga0157372_10737478
1173 Ga0157375_10249707
1174 Ga0157375_10409895
1175 Ga0157375_10595262
1176 Ga0163163_10108583
1177 Ga0163163_10546596
1178 Ga0157380_10030487
1179 Ga0157380_10089716
1180 Ga0182008_10020976
1181 Ga0182008_10041989
1182 Ga0157379_10341744
1183 Ga0157376_10402613
1184 Ga0182007_10037005
1185 Ga0182007_10054633
1186 Ga0182005_1005352
1187 Ga0163161_10189762
1188 Ga0214543_1003759
1189 Ga0213876_10060936
1190 Ga0209563_102799
1191 Ga0209437_107178
1192 Ga0209677_103335
1193 Ga0209148_1015515
1194 Ga0209129_1001101
1195 Ga0209233_1000010
1196 Ga0209233_1000097
1197 Ga0209233_1006432
1198 Ga0209455_1003379
1199 Ga0209673_1000126
1200 Ga0209673_1001062
1201 Ga0209673_1002727
1202 Ga0209025_1032697
1203 Ga0209564_1000368
1204 Ga0209564_1014503
1205 Ga0209564_1014785
1206 Ga0209758_1000345
1207 Ga0209758_1000527
1208 Ga0209758_1005729
1209 Ga0209758_1008345
1210 Ga0209758_1019444
1211 Ga0209256_1001075
1212 Ga0209256_1001095
1213 Ga0207426_1000400
1214 Ga0207426_1000402
1215 Ga0207426_1000736
1216 Ga0207426_1007160
1217 Ga0209051_1002366
1218 Ga0207656_10004091
1219 Ga0207682_10124792
1220 Ga0207692_10002994
1221 Ga0207710_10015744
1222 Ga0207710_10049206
1223 Ga0207688_10052512
1224 Ga0207680_10076672
1225 Ga0207680_10178416
1226 Ga0207647_10015521
1227 Ga0207647_10041918
1228 Ga0207699_10025361
1229 Ga0207645_10074877
1230 Ga0207705_10033323
1231 Ga0207705_10287041
1232 Ga0207654_10000717
1233 Ga0207654_10032296
1234 Ga0207654_10183398
1235 Ga0207707_10001371
1236 Ga0207707_10024804
1237 Ga0207707_10407619
1238 Ga0207695_10000458
1239 Ga0207695_10002499
1240 Ga0207695_10153319
1241 Ga0207671_10011705
1242 Ga0207671_10018973
1243 Ga0207671_10036677
1244 Ga0207671_10155129
1245 Ga0207693_10292539
1246 Ga0207663_10120570
1247 Ga0207660_10103941
1248 Ga0207657_10152968
1249 Ga0207649_10388049
1250 Ga0207652_10028115
1251 Ga0207652_10039261
1252 Ga0207681_10047323
1253 Ga0207681_10156904
1254 Ga0207694_10000258
1255 Ga0207694_10018430
1256 Ga0207694_10358970
1257 Ga0207659_10448625
1258 Ga0207700_10145389
1259 Ga0207664_10038825
1260 Ga0207644_10063340
1261 Ga0207706_10042418
1262 Ga0207686_10203467
1263 Ga0207686_10263435
1264 Ga0207709_10223642
1265 Ga0207709_10281832
1266 Ga0207665_10002675
1267 Ga0207665_10245607
1268 Ga0207691_10034093
1269 Ga0207711_10009071
1270 Ga0207711_10055022
1271 Ga0207711_10238252
1272 Ga0207711_10717426
1273 Ga0207689_10016221
1274 Ga0207689_10504276
1275 Ga0207689_10647975
1276 Ga0207661_10000331
1277 Ga0207661_10032719
1278 Ga0207679_10500171
1279 Ga0207667_10009886
1280 Ga0207667_10250852
1281 Ga0207712_10006823
1282 Ga0207712_10078385
1283 Ga0207712_10521476
1284 Ga0207668_10166914
1285 Ga0207668_10210924
1286 Ga0207640_10013426
1287 Ga0207640_10046755
1288 Ga0207640_10239367
1289 Ga0207658_10184508
1290 Ga0207703_10134015
1291 Ga0207639_10072505
1292 Ga0207639_10169897
1293 Ga0207639_10200816
1294 Ga0207639_10401952
1295 Ga0207678_10007094
1296 Ga0207678_10073914
1297 Ga0207678_10285905
1298 Ga0207708_10341706
1299 Ga0207702_10000006
1300 Ga0207702_10376403
1301 Ga0207702_10479389
1302 Ga0207641_10056865
1303 Ga0207641_10421130
1304 Ga0207648_10258308
1305 Ga0207676_10443065
1306 Ga0207676_10536164
1307 Ga0207674_10056094
1308 Ga0207674_10065044
1309 Ga0207674_10077710
1310 Ga0207674_10084921
1311 Ga0207674_10174349
1312 Ga0207674_10501809
1313 Ga0207674_10789912
1314 Ga0207675_100124665
1315 Ga0207675_100415244
1316 Ga0207675_100522830
1317 Ga0207683_10047777
1318 Ga0207683_10103844
1319 Ga0207683_10164930
1320 Ga0207683_10251174
1321 Ga0207698_10055008
1322 Ga0207698_10088361
1323 Ga0207698_10512724
1324 Ga0209588_1068054
1325 Ga0209813_10069552
1326 Ga0268266_10028226
1327 Ga0268266_10105070
1328 Ga0268266_10208603
1329 Ga0268266_10226873
1330 Ga0268266_10323895
1331 Ga0268266_10367665
1332 Ga0268265_10009598
1333 Ga0268265_10128860
1334 Ga0268264_10000271
1335 Ga0307509_10025601
1336 Ga0307509_10029127
1337 Ga0307408_100050149
1338 Ga0307408_100370555
1339 Ga0307408_100725981
1340 Ga0307508_10039588
1341 Ga0307406_10301812
1342 Ga0307416_100471782
1343 Ga0307416_100625351
1344 Ga0307411_10082470
1345 Ga0307415_100064954
1346 Ga0316593_10008780
1347 Ga0307507_10013433
1348 Ga0307510_10012167
1349 Ga0307510_10021632
1350 Ga0307510_10130945
1351 Ga0307510_10299175
1352 Ga0373955_0070441
1353 Ga0316574_0215994
1354 Ga0373935_0160393
1355 Ga0373927_0005221
1356 Ga0373927_0190934
1357 Ga0373947_0104443
1358 Ga0316582_0017683
1359 Ga0373925_0196585
1360 Ga0395898_0183641
1361 Ga0395905_0002238
1362 Ga0395901_0554737
1363 Ga0436365_0301686
1364 Ga0436365_0920281
1365 Ga0436365_1546724
1366 Ga0436365_1866973
1367 Ga0436363_1116250
1368 Ga0451833_0666882
1369 Ga0451835_0701798
1370 Ga0451835_0846484
1371 Ga0451837_0832108
1372 Ga0451837_1509718
1373 Ga0451839_0615725
1374 Ga0451839_1099990
1375 Ga0451841_0047544
1376 Ga0451841_0234887
1377 Ga0451845_0451105
1378 Ga0451847_0137423
1379 Ga0451849_0615251
1380 Ga0451849_0766215
1381 Ga0451851_0095856
1382 Ga0451843_0126997
1383 Ga0451843_0277846
1384 Ga0451855_0106049
1385 Ga0451855_0179822
1386 Ga0451853_3361738
1387 Ga0451853_3365732
1388 Ga0439435_0003562
1389 Ga0495592_0314512
1390 Ga0495603_0017441
1391 Ga0495603_0177318
1392 Ga0495603_0193862
1393 Ga0495590_0075855
1394 Ga0495629_0279900
1395 Ga0495638_0000093
1396 Ga0495638_0012296
1397 Ga0495638_0094810
1398 Ga0495651_0004745
1399 Ga0495651_0035403
1400 Ga0495650_0078871
1401 Ga0495582_0298543
1402 Ga0495605_0058583
1403 Ga0495605_0073658
1404 Ga0495639_0033281
1405 Ga0495639_0130439
1406 Ga0495664_0021353
1407 Ga0495664_0366400
1408 Ga0495584_0085316
1409 Ga0495585_0116112
1410 Ga0495594_0052519
1411 Ga0495594_0171331
1412 Ga0495607_0111819
1413 Ga0495606_0013391
1414 Ga0495606_0059370
1415 Ga0495606_0121737
1416 Ga0495606_0142679
1417 Ga0495606_0154064
1418 Ga0495608_0009046
1419 Ga0495608_0059301
1420 Ga0495610_0003544
1421 Ga0495610_0030536
1422 Ga0495616_0051909
1423 Ga0495616_0055497
1424 Ga0495620_0011824
1425 Ga0495620_0049015
1426 Ga0495620_0077440
1427 Ga0495628_0047046
1428 Ga0495631_0025660
1429 Ga0495631_0049221
1430 Ga0495632_0012123
1431 Ga0495632_0069407
1432 Ga0495643_0009325
1433 Ga0495643_0051206
1434 Ga0495643_0079847
1435 Ga0495648_0049617
1436 Ga0495648_0154229
1437 Ga0495648_0200028
1438 Ga0495666_0062894
1439 Ga0495652_0025991
1440 Ga0495652_0070348
1441 Ga0495652_0200162
1442 Ga0495587_0024739
1443 Ga0495587_0174020
1444 Ga0495609_0059358
1445 Ga0495609_0102151
1446 Ga0495597_0004648
1447 Ga0495597_0014749
1448 Ga0495597_0055352
1449 Ga0495645_0089611
1450 Ga0495622_0003148
1451 Ga0495622_0007018
1452 Ga0495622_0013881
1453 Ga0495622_0031590
1454 Ga0495622_0051770
1455 Ga0495622_0099376
1456 Ga0495633_0072008
1457 Ga0495667_0038688
1458 Ga0495668_0026449
1459 Ga0495668_0072194
1460 Ga0495668_0252893
1461 Ga0495634_0047258
1462 Ga0495611_0018160
1463 Ga0495625_0008959
1464 Ga0495625_0112164
1465 Ga0495625_0178005
1466 Ga0495625_0279754
1467 Ga0495635_0086462
1468 Ga0495659_0080172
1469 Ga0495661_0118917
1470 Ga0495588_0004395
1471 Ga0495588_0077068
1472 Ga0495657_0025122
1473 Ga0495657_0053262
1474 Ga0495599_0007960
1475 Ga0495599_0177361
1476 Ga0495623_0016163
1477 Ga0495646_0017819
1478 Ga0495647_0035152
1479 Ga0495669_0205330
1480 Ga0495613_0007936
1481 Ga0495613_0042760
1482 Ga0495624_0038078
1483 Ga0495624_0190075
1484 Ga0495624_0270335
1485 Ga0495670_0018287
1486 Ga0495670_0050605
1487 Ga0495670_0060507
1488 Ga0495649_0128470
1489 Ga0495600_0001949
1490 Ga0495600_0013037
1491 Ga0495660_0006722
1492 Ga0495660_0126052
1493 Ga0495660_0153503
1494 Ga0495581_0066884
1495 Ga0495604_0026776
1496 Ga0495604_0038952
1497 Ga0495636_0025766
1498 Ga0495674_0068767
1499 Ga0495672_0092763
1500 Ga0495676_0094977
1501 Ga0495676_0307600
1502 Ga0495680_0056250
1503 Ga0495687_009909
1504 Ga0495687_024317
1505 Ga0495675_0018173
1506 Ga0495684_0045599
1507 Ga0495602_0021306
1508 Ga0495602_0055287
1509 Ga0496100_0047645
1510 Ga0496100_0193011
1511 Ga0496101_0052058
1512 Ga0496102_0000614
1513 Ga0496102_0018881
1514 Ga0496102_0045731
1515 Ga0496102_0304408
1516 Ga0496102_0411624
1517 Ga0496102_0458890
1518 Ga0496102_0468777
1519 Ga0496103_0013040
1520 Ga0496103_0032673
1521 Ga0496103_0198439
1522 Ga0496104_0028633
1523 Ga0496104_0041567
1524 Ga0496104_0069427
1525 Ga0496104_0088931
1526 Ga0496105_0014940
1527 Ga0496105_0033632
1528 Ga0496105_0081982
1529 Ga0496105_0143377
1530 Ga0496105_0657615
1531 Ga0496106_0097872
1532 Ga0496106_0307330
1533 Ga0496107_0104865
1534 Ga0496108_0054477
1535 Ga0496108_0597165
1536 Ga0496109_0418734
1537 Ga0496109_0501941
1538 Ga0496109_0531469
1539 Ga0496110_0106873
1540 Ga0496110_0121491
1541 Ga0496110_0234521
1542 Ga0496110_0556462
1543 Ga0496110_0592077
1544 Ga0496111_0066281
1545 Ga0496112_0084499
1546 Ga0496112_0585805
1547 Ga0496112_0775612
1548 Ga0496113_0064474
1549 Ga0496113_0150197
1550 Ga0496113_0242777
1551 Ga0496115_0148694
1552 Ga0496115_0420779
1553 Ga0496115_0513494
1554 Ga0496116_0024695
1555 Ga0496116_0048297
1556 Ga0496116_0072039
1557 Ga0496116_0108942
1558 Ga0496116_0255484
1559 Ga0496117_0042409
1560 Ga0496117_0091177
1561 Ga0496117_0091313
1562 Ga0496118_0000353
1563 Ga0496118_0009194
1564 Ga0496118_0106169
1565 Ga0496118_0126991
1566 Ga0496118_0135790
1567 Ga0496118_0207637
1568 Ga0496118_0269996
1569 Ga0496119_0005991
1570 Ga0496119_0012748
1571 Ga0496119_0132709
1572 Ga0496120_0001950
1573 Ga0496120_0003410
1574 Ga0496120_0024687
1575 Ga0496120_0070716
1576 Ga0496121_0000536
1577 Ga0496121_0001187
1578 Ga0496121_0031628
1579 Ga0496121_0038931
1580 Ga0496121_0041610
1581 Ga0496121_0132225
1582 Ga0496121_0233284
1583 Ga0496121_0303059
1584 Ga0496122_0044235
1585 Ga0496122_0047262
1586 Ga0496124_0017619
1587 Ga0496124_0271568
1588 Ga0496125_0013222
1589 Ga0496125_0033769
1590 Ga0496125_0049986
1591 Ga0496125_0128650
1592 Ga0496125_0141482
1593 Ga0496126_0002330
1594 Ga0496126_0003343
1595 Ga0496126_0042429
1596 Ga0496126_0067381
1597 Ga0496126_0113540
1598 Ga0496126_0165644
1599 Ga0496126_0191209
1600 Ga0496126_0215921
1601 Ga0496126_0218785
1602 Ga0496126_0368243
1603 Ga0496126_0409142
1604 Ga0495678_075828
1605 Ga0495682_0027421
1606 Ga0501033_0028443
1607 Ga0501034_0044368
1608 Ga0501034_0044504
1609 Ga0501034_0124768
1610 Ga0501038_0024848
1611 Ga0501039_0141055
1612 Ga0501043_0075835
1613 Ga0501047_0029247
1614 Ga0501067_0132905
1615 Ga0501073_0442238
1616 Ga0501044_0016392
1617 nmdc:mga00v17_117832_c1
1618 nmdc:mga0yw44_184330_c1
1619 nmdc:mga0yw44_240269_c1
1620 nmdc:mga0yw44_331417_c1
1621 nmdc:mga0k408_105533_c1
1622 nmdc:mga0k408_191336_c1
1623 nmdc:mga0k408_286695_c1
1624 nmdc:mga06z11_32100_c1
1625 nmdc:mga06z11_36737_c1
1626 nmdc:mga04h51_58281_c1
1627 nmdc:mga04h51_82851_c1
1628 nmdc:mga07m45_20408_c1
1629 nmdc:mga07m45_205883_c1
1630 nmdc:mga07m45_39541_c1
1631 nmdc:mga08y16_242270_c1
1632 nmdc:mga0n895_171740_c1
1633 nmdc:mga0sz30_17972_c1
1634 Ga0500635_0000082
1635 Ga0500635_0013594
1636 Ga0500635_0027315
1637 Ga0495655_0039111
1638 Ga0495619_0043214
1639 Ga0500578_0217792
1640 Ga0500643_000046
1641 Ga0500643_004317
1642 Ga0500644_0135345
1643 Ga0500646_0079314
1644 Ga0500583_0011107
1645 Ga0500566_0000381
1646 Ga0500566_0070023
1647 Ga0500566_0141175
1648 Ga0500641_0021968
1649 Ga0500555_003852
1650 Ga0500556_0107655
1651 Ga0500557_000054
1652 Ga0500562_012538
1653 Ga0500562_019187
1654 Ga0500569_003280
1655 Ga0500572_000074
1656 Ga0500594_0021858
1657 Ga0500595_002781
1658 Ga0500595_008745
1659 Ga0500595_025862
1660 Ga0500607_013154
1661 Ga0500607_062768
1662 Ga0500608_010385
1663 Ga0500608_099352
1664 Ga0500618_008138
1665 Ga0500642_0000136
1666 Ga0500642_0040912
1667 Ga0500655_021535
1668 Ga0500658_0007101
1669 Ga0500658_0011035
1670 Ga0500658_0026826
1671 Ga0500658_0032267
1672 Ga0500559_0000780
1673 Ga0500559_0013121
1674 Ga0500559_0175459
1675 Ga0500568_0000460
1676 Ga0500589_113253
1677 Ga0500590_046515
1678 Ga0500603_014746
1679 Ga0500616_0001157
1680 Ga0500616_0101707
1681 Ga0500620_004187
1682 Ga0500622_0000064
1683 Ga0500622_0012955
1684 Ga0500624_000027
1685 Ga0500627_0033964
1686 Ga0500627_0076808
1687 Ga0500633_0021962
1688 Ga0500636_0001429
1689 Ga0500636_0005358
1690 Ga0500636_0019166
1691 Ga0500636_0088371
1692 Ga0500636_0217722
1693 Ga0500636_0273186
1694 Ga0500637_0000433
1695 Ga0500637_0027901
1696 Ga0500637_0069923
1697 Ga0500637_0125663
1698 Ga0500625_011807
1699 Ga0500625_031227
1700 Ga0500645_023914
1701 Ga0500609_003116
1702 Ga0500601_000722
1703 Ga0500661_002049
1704 Ga0590071_016772
1705 Ga0590077_011018
1706 2507507892
1707 2508542003
1708 2508692453
1709 2511395272
1710 2513612214
1711 2513639331
1712 2513647293
1713 2513700113
1714 2513870312
1715 2513878282
1716 2514009663
1717 2514032668
1718 2515626791
1719 2515635666
1720 2515741714
1721 2517103903
1722 2524463013
1723 2528853057
1724 2585203182
1725 2585277759
1726 2585403029
1727 2585530430
1728 2585533374
1729 2585557881
1730 2585825229
1731 2599936900
1732 2600196370
1733 2616310564
1734 2616311796
1735 2617346570
1736 2643918065
1737 2644130286
1738 2644153910
1739 2728749367
1740 2738799570
1741 2753459734
1742 2778176739
1743 2792751805
1744 2793359282
1745 2805918470
1746 2818236331
1747 2819643133
1748 2824622888
1749 2824631961
1750 2824638540
1751 2824649621
1752 2824658249
1753 2824665343
1754 2824678064
1755 2824694458
1756 2824699681
1757 2824707569
1758 2824716194
1759 2824726838
1760 2824755710
1761 2824766373
1762 2824777316
1763 2838034488
1764 2838122893
1765 2838668374
1766 2838691049
1767 2841950844
1768 2841973704
1769 2841988960
1770 2842040425
1771 2842046630
1772 2842117287
1773 2842275524
1774 2842302145
1775 2842363148
1776 2842481235
1777 2842489104
1778 2842508180
1779 2842513938
1780 2844462240
1781 2847947506
1782 2849078618
1783 2857513004
1784 2869166667
1785 2874598995
1786 2874614815
1787 2874622313
1788 2874650558
1789 2876779034
1790 2876810623
1791 2876822638
1792 2879082827
1793 2879102845
1794 2879114476
1795 2879133108
1796 2879149395
1797 2881364705
1798 2885310765
1799 2885341189
1800 2885369668
1801 2888385226
1802 2888393013
1803 2888425369
1804 2889021441
1805 2903730529
1806 2904667924
1807 2904694449
1808 2904712224
1809 2906632295
1810 2908741953
1811 2908759638
1812 2922372666
1813 2924723469
1814 2929620479
1815 2929626372
1816 2932784755
1817 2932795370
1818 2932809735
1819 2932818520
1820 2932828538
1821 2933019354
1822 2933582397
1823 2933590031
1824 2935609617
1825 2935617496
1826 2935639022
1827 2935652236
1828 2935660818
1829 2935666126
1830 2935675775
1831 2935685216
1832 2935694906
1833 2935704029
1834 2935713769
1835 2935724388
1836 2935733254
1837 2935742633
1838 2935751181
1839 2935760295
1840 2935770008
1841 2935784783
1842 2935785750
1843 2935794322
1844 2935802112
1845 2935810934
1846 2935822779
1847 2935828517
1848 2935839893
1849 2935848361
1850 2935856121
1851 2935865935
1852 2935877740
1853 2935883737
1854 2935909836
1855 2935917560
1856 2935927316
1857 2935936839
1858 2935944858
1859 2935953295
1860 2935961204
1861 2935970135
1862 2935980436
1863 2935986703
1864 2935992685
1865 2936002557
1866 2936014874
1867 2936022145
1868 2936032833
1869 2936037646
1870 2936050615
1871 2936059609
1872 2937116079
1873 2940558017
1874 2941536832
1875 2941540767
1876 2957416628
1877 2957494162
1878 2964712856
1879 2970078787
1880 2977525453
1881 3005507305
1882 3005715605
1883 8004643018
1884 8006987436
1885 8016528904
1886 8016534098
1887 8016547327
1888 8016554816
1889 8016563179
1890 8016572440
1891 8016593882
1892 8016600935
1893 8016615377
1894 8016639414
1895 8017064632
1896 8019545802
1897 8019552919
1898 8019583998
1899 8019591805
1900 8019599532
1901 8019619569
1902 8019646352
1903 8019649102
1904 8019685228
1905 8019690838
1906 8055619317
1907 8055745341
1908 8056687680
1909 8056693473
1910 8056876649
1911 8056968806
1912 8057879853

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

39

176

0.96

PF12872

OST-HTH

OST-HTH/LOTUS domain

196

265

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dim-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide synthetase from anaerococcus prevotii 0.8694 96 142
5yaa-assembly4.cif.gz_D crystal structure of marf1 nyn domain from mus musculus 0.8091 8 148
6fdl-assembly2.cif.gz_B crystal structure of the nyn domain of human marf1 0.8017 8 149
6fdl-assembly1.cif.gz_A crystal structure of the nyn domain of human marf1 0.7992 8 149
5yaa-assembly4.cif.gz_D crystal structure of marf1 nyn domain from mus musculus 0.7648 8 148
ID Description Score Start End Superfamily
af_Q9FJ91_216_314_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9001 53 145 3.40.50.1010
2czgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8738 96 142 3.40.50.20
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8669 96 126 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8499 97 126 3.50.50.60
af_Q57905_62_208_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8442 8 143 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A434DGT3-F1-model_v4 NYN domain-containing protein 0.9504 1 141 GO:0004540
AF-A0A7X0KP36-F1-model_v4 NYN domain-containing protein 0.9492 1 140 GO:0004540
AF-A0A7C3H1K2-F1-model_v4 NYN domain-containing protein 0.9442 4 143 GO:0004540
AF-F0XZS7-F1-model_v4 NYN domain-containing protein 0.9432 10 142 GO:0004540
AF-A0A350KQV8-F1-model_v4 deleted 0.9431 3 146

Map