F486755

General Info

Members Datasets Scaffolds Average Seq Length
956 443 1912 277

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355253|2793280811
Length 295
Sequence MTAPAAPTPASDVGRGAPSGMVGRTTGDRIILGLTIALAIVMMAPLLWVVALSLKDNKELMVSMNAVFHAPYTVQNYINILATSSVFRWILNSLVVAGGLTVGTLVLSSLAGYGFARLNFPFRNVLFVIVLMGLAVPEQAVLIARHQLFSWLKLHNTYPGLILPGLSAPFGVFLMTQYFRAIPKELDEAALLDNASRFKIFWKVLLPLTLPAQATLGIFTFLGAWNDYLWPLISGTKKEMYTLTVGIASTQTNFAQSEGLGFLMSQAVFAGAPILILYLFFQKYIVTAVSGAAVR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
106 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
107 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
263 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
352 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
357 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
358 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
359 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
368 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
369 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
373 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
374 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
375 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
376 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
377 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
378 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
379 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
380 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
381 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
382 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
383 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
384 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
385 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
386 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
387 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
388 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
389 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
390 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
391 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
392 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
393 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
394 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
395 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
396 2643221568 Rhizobium sp. Root564 Isolate Unclassified
397 2643221584 Caulobacter sp. Root656 Isolate Unclassified
398 2643221599 Rhizobium sp. Root708 Isolate Unclassified
399 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
400 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
401 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
402 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
403 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
404 2738541293 Rhizobium sp. GV031 Isolate Unclassified
405 2738541297 Duganella sp. GV083 Isolate Unclassified
406 2738541357 Duganella sp. GV053 Isolate Unclassified
407 2738543003 Duganella sp. GV066 Isolate Unclassified
408 2738543026 Duganella sp. GV089 Isolate Unclassified
409 2738543029 Duganella sp. GV039 Isolate Unclassified
410 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
411 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
412 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
413 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
414 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
415 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
416 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
417 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
418 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
419 2818991435 Caulobacter henricii 536 Isolate Unclassified
420 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
421 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
422 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
423 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
424 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
425 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
426 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
427 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
428 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
429 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
430 2909042592 Labrys sp. LIt4 Isolate Nodule
431 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
432 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
433 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
434 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
435 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
436 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
437 2996887358 Rhizobium sp. R711 Isolate Nodule
438 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
439 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
440 8005258706 Rhizobium sp. R693 Isolate Nodule
441 8005321885 Rhizobium sp. R72 Isolate Nodule
442 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
443 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.15
Metatranscriptomes 0
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 10.25
Nodule 2.3
Rhizoplane 4.39
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001232 3300001979 Bacteria 11577
2 JGI24740J21852_10002276 3300001979 Bacteria 8731
3 JGI24739J22299_10011198 3300001989 Bacteria 3313
4 JGI24739J22299_10012889 3300001989 Bacteria 3062
5 JGI24735J21928_10004904 3300002067 Bacteria 4460
6 JGI24735J21928_10009146 3300002067 Bacteria 3188
7 JGI24735J21928_10009735 3300002067 Bacteria 3078
8 JGI24735J21928_10033867 3300002067 Bacteria 1508
9 JGI24744J21845_10000200 3300002077 Bacteria 9234
10 JGI25162J39368_1000322 3300002737 Bacteria 42100
11 JGI25152J39213_1000557 3300002773 Bacteria 20439
12 JGI25152J39213_1000784 3300002773 Bacteria 15967
13 JGI25152J39213_1007244 3300002773 Bacteria 2898
14 JGI25150J39212_1000119 3300002774 Bacteria 44099
15 JGI25159J45721_1005825 3300002987 Bacteria 3804
16 JGI25151J46595_10000007 3300003187 Bacteria 411751
17 JGI25151J46595_10000834 3300003187 Bacteria 24587
18 JGI25406J46586_10010542 3300003203 Bacteria 4096
19 JGI25165J46597_1000248 3300003214 Bacteria 73257
20 JGI25153J46596_10001312 3300003215 Bacteria 14885
21 JGI25153J46596_10023166 3300003215 Bacteria 2269
22 rootL2_10065467 3300003322 Bacteria 2313
23 rootH1_10100938 3300003323 Bacteria 10599
24 rootH1_10247060 3300003323 Bacteria 2449
25 rootH1_10287660 3300003323 Bacteria 1514
26 Ga0055526_1010747 3300003771 Bacteria 4220
27 Ga0055526_1011964 3300003771 Bacteria 3842
28 Ga0055537_1000646 3300003773 Bacteria 18512
29 Ga0055524_1009262 3300003775 Bacteria 4026
30 Ga0055524_1012966 3300003775 Bacteria 3170
31 Ga0055528_1001758 3300003790 Bacteria 12475
32 Ga0055528_1002895 3300003790 Bacteria 8922
33 Ga0055528_1012540 3300003790 Bacteria 3280
34 Ga0055530_10000082 3300003791 Bacteria 81812
35 Ga0055530_10001087 3300003791 Bacteria 21357
36 Ga0055531_10000012 3300003794 Bacteria 191187
37 Ga0065165_1001607 3300005262 Bacteria 23108
38 Ga0070658_10016871 3300005327 Bacteria 5845
39 Ga0070658_10021683 3300005327 Bacteria 5149
40 Ga0070658_10076002 3300005327 Bacteria 2755
41 Ga0070658_10107708 3300005327 Bacteria 2306
42 Ga0070658_10159433 3300005327 Bacteria 1892
43 Ga0070676_10076204 3300005328 Bacteria 2024
44 Ga0070683_100005325 3300005329 Bacteria 10726
45 Ga0070683_100075480 3300005329 Bacteria 3149
46 Ga0070690_100004330 3300005330 Bacteria 7872
47 Ga0070670_100052588 3300005331 Bacteria 3497
48 Ga0070670_100056212 3300005331 Bacteria 3377
49 Ga0070670_100126192 3300005331 Unclassified 2209
50 Ga0070677_10011562 3300005333 Bacteria 3048
51 Ga0070677_10062094 3300005333 Bacteria 1544
52 Ga0068869_100548347 3300005334 Bacteria 971
53 Ga0070666_10007359 3300005335 Bacteria 6784
54 Ga0070666_10014250 3300005335 Bacteria 5060
55 Ga0070666_10034931 3300005335 Bacteria 3332
56 Ga0070666_10149040 3300005335 Bacteria 1632
57 Ga0070680_100000896 3300005336 Bacteria 21045
58 Ga0070680_100027734 3300005336 Bacteria 4537
59 Ga0068868_100153899 3300005338 Bacteria 1895
60 Ga0070660_100012465 3300005339 Bacteria 6072
61 Ga0070660_100032761 3300005339 Bacteria 3913
62 Ga0070660_100161342 3300005339 Bacteria 1806
63 Ga0070660_100266824 3300005339 Bacteria 1399
64 Ga0070691_10000243 3300005341 Bacteria 18635
65 Ga0070661_100000114 3300005344 Bacteria 67216
66 Ga0070661_100007497 3300005344 Bacteria 7528
67 Ga0070661_100017301 3300005344 Bacteria 5112
68 Ga0070661_100046420 3300005344 Bacteria 3177
69 Ga0070661_100096305 3300005344 Bacteria 2196
70 Ga0070661_100274019 3300005344 Bacteria 1307
71 Ga0070661_100278344 3300005344 Bacteria 1297
72 Ga0070668_100072978 3300005347 Bacteria 2675
73 Ga0070668_100117672 3300005347 Bacteria 2121
74 Ga0070668_100207109 3300005347 Bacteria 1612
75 Ga0070669_100104748 3300005353 Bacteria 2139
76 Ga0070669_100322345 3300005353 Bacteria 1248
77 Ga0070675_100004750 3300005354 Bacteria 10371
78 Ga0070675_100101476 3300005354 Bacteria 2424
79 Ga0070671_100013084 3300005355 Bacteria 6686
80 Ga0070671_100021902 3300005355 Bacteria 5220
81 Ga0070671_100051862 3300005355 Bacteria 3411
82 Ga0070671_100165356 3300005355 Bacteria 1871
83 Ga0070674_100009553 3300005356 Bacteria 5809
84 Ga0070674_100116810 3300005356 Bacteria 1969
85 Ga0070674_100231453 3300005356 Bacteria 1442
86 Ga0070673_100011648 3300005364 Bacteria 6008
87 Ga0070673_100076810 3300005364 Bacteria 2698
88 Ga0070673_100303197 3300005364 Bacteria 1407
89 Ga0070659_100006154 3300005366 Bacteria 8662
90 Ga0070659_100027988 3300005366 Bacteria 4348
91 Ga0070659_100029874 3300005366 Bacteria 4214
92 Ga0070659_100036187 3300005366 Bacteria 3847
93 Ga0070667_100051710 3300005367 Bacteria 3464
94 Ga0070667_100060515 3300005367 Bacteria 3204
95 Ga0070667_100097175 3300005367 Bacteria 2540
96 Ga0070714_100051080 3300005435 Bacteria 3524
97 Ga0070714_100106170 3300005435 Bacteria 2481
98 Ga0070714_100204275 3300005435 Bacteria 1808
99 Ga0070663_100056616 3300005455 Bacteria 2810
100 Ga0070663_100141264 3300005455 Bacteria 1839
101 Ga0070663_100275765 3300005455 Bacteria 1338
102 Ga0070678_100011116 3300005456 Bacteria 5538
103 Ga0070678_100026944 3300005456 Bacteria 3894
104 Ga0070678_100142327 3300005456 Bacteria 1921
105 Ga0070662_100005842 3300005457 Bacteria 7898
106 Ga0070662_100016221 3300005457 Bacteria 4999
107 Ga0070662_100016262 3300005457 Bacteria 4993
108 Ga0070662_100076892 3300005457 Bacteria 2476
109 Ga0070662_100154096 3300005457 Bacteria 1792
110 Ga0070662_100191359 3300005457 Bacteria 1618
111 Ga0070662_100261332 3300005457 Bacteria 1395
112 Ga0070681_10001905 3300005458 Bacteria 18821
113 Ga0068867_100022953 3300005459 Bacteria 4464
114 Ga0068867_100044237 3300005459 Bacteria 3261
115 Ga0068867_100097356 3300005459 Bacteria 2242
116 Ga0070679_100000084 3300005530 Bacteria 70823
117 Ga0070679_100065796 3300005530 Bacteria 3613
118 Ga0070679_100197098 3300005530 Bacteria 1981
119 Ga0070679_100400011 3300005530 Bacteria 1319
120 Ga0070684_100099624 3300005535 Bacteria 2594
121 Ga0068853_100007461 3300005539 Bacteria 8754
122 Ga0068853_100303291 3300005539 Bacteria 1477
123 Ga0068853_100518696 3300005539 Bacteria 1126
124 Ga0070672_100001479 3300005543 Bacteria 14586
125 Ga0070672_100027362 3300005543 Bacteria 4252
126 Ga0070672_100056292 3300005543 Bacteria 3083
127 Ga0070665_100004829 3300005548 Bacteria 14002
128 Ga0070665_100025110 3300005548 Bacteria 6005
129 Ga0070665_100133769 3300005548 Bacteria 2481
130 Ga0070665_100203399 3300005548 Bacteria 1980
131 Ga0070665_100225279 3300005548 Bacteria 1875
132 Ga0070665_100236395 3300005548 Bacteria 1828
133 Ga0068855_100510988 3300005563 Unclassified 1305
134 Ga0070664_100005462 3300005564 Bacteria 10202
135 Ga0070664_100014140 3300005564 Bacteria 6511
136 Ga0070664_100030890 3300005564 Bacteria 4471
137 Ga0070664_100194836 3300005564 Bacteria 1806
138 Ga0070664_100372620 3300005564 Bacteria 1302
139 Ga0070664_100472244 3300005564 Bacteria 1153
140 Ga0070664_100543573 3300005564 Bacteria 1074
141 Ga0068857_100012566 3300005577 Bacteria 7375
142 Ga0068857_100061853 3300005577 Bacteria 3327
143 Ga0068857_100270538 3300005577 Bacteria 1561
144 Ga0068854_100003724 3300005578 Bacteria 9537
145 Ga0068856_100024453 3300005614 Bacteria 5881
146 Ga0068856_100077106 3300005614 Bacteria 3302
147 Ga0068856_100268147 3300005614 Bacteria 1723
148 Ga0068856_100653785 3300005614 Bacteria 1072
149 Ga0068852_100005727 3300005616 Bacteria 8912
150 Ga0068852_100007056 3300005616 Bacteria 8182
151 Ga0068852_100122427 3300005616 Unclassified 2384
152 Ga0068852_100308098 3300005616 Bacteria 1535
153 Ga0068852_100397856 3300005616 Bacteria 1354
154 Ga0068859_100040456 3300005617 Bacteria 4679
155 Ga0068864_100000487 3300005618 Bacteria 34323
156 Ga0068864_100043457 3300005618 Bacteria 3848
157 Ga0068864_100078492 3300005618 Bacteria 2889
158 Ga0068866_10007066 3300005718 Bacteria 4693
159 Ga0068851_10009633 3300005834 Bacteria 4497
160 Ga0068851_10022060 3300005834 Bacteria 3098
161 Ga0068851_10164207 3300005834 Bacteria 1222
162 Ga0068863_100060266 3300005841 Bacteria 3589
163 Ga0068858_100030052 3300005842 Bacteria 5045
164 Ga0068860_100134317 3300005843 Bacteria 2376
165 Ga0068862_100541626 3300005844 Bacteria 1110
166 Ga0081540_1028100 3300005983 Bacteria 3168
167 Ga0081539_10000038 3300005985 Bacteria 296079
168 Ga0075365_10015038 3300006038 Bacteria 4671
169 Ga0075365_10107863 3300006038 Bacteria 1912
170 Ga0075368_10014911 3300006042 Bacteria 2877
171 Ga0075367_10001368 3300006178 Bacteria 10395
172 Ga0075367_10021130 3300006178 Bacteria 3634
173 Ga0075367_10070893 3300006178 Bacteria 2096
174 Ga0075369_10003078 3300006186 Bacteria 6039
175 Ga0075369_10039051 3300006186 Bacteria 2026
176 Ga0075369_10039943 3300006186 Bacteria 2004
177 Ga0075370_10176661 3300006353 Bacteria 1256
178 Ga0068871_100239414 3300006358 Bacteria 1577
179 Ga0068865_100285155 3300006881 Bacteria 1316
180 Ga0097620_100040456 3300006931 Bacteria 4679
181 Ga0105251_10029906 3300009011 Bacteria 2740
182 Ga0105251_10034833 3300009011 Bacteria 2488
183 Ga0105244_10147377 3300009036 Bacteria 1129
184 Ga0105240_10021229 3300009093 Bacteria 8644
185 Ga0105240_10124835 3300009093 Bacteria 3095
186 Ga0105240_10219562 3300009093 Bacteria 2216
187 Ga0111539_10119724 3300009094 Bacteria 3085
188 Ga0111539_10721864 3300009094 Bacteria 1160
189 Ga0105245_10031632 3300009098 Bacteria 4684
190 Ga0105245_10183385 3300009098 Bacteria 2001
191 Ga0105245_10202837 3300009098 Bacteria 1905
192 Ga0105245_10322338 3300009098 Bacteria 1522
193 Ga0105247_10125008 3300009101 Bacteria 1671
194 Ga0105243_10022964 3300009148 Bacteria 4744
195 Ga0105243_10183355 3300009148 Bacteria 1822
196 Ga0105241_10101119 3300009174 Bacteria 2292
197 Ga0105241_10106735 3300009174 Bacteria 2235
198 Ga0105242_10112065 3300009176 Bacteria 2327
199 Ga0105242_10382834 3300009176 Bacteria 1308
200 Ga0105242_10765998 3300009176 Bacteria 952
201 Ga0105248_10001528 3300009177 Bacteria 25762
202 Ga0105248_10019256 3300009177 Bacteria 7552
203 Ga0105248_10023155 3300009177 Bacteria 6898
204 Ga0105248_10027431 3300009177 Bacteria 6341
205 Ga0105248_10286789 3300009177 Bacteria 1854
206 Ga0105248_10291577 3300009177 Bacteria 1837
207 Ga0105248_10613417 3300009177 Unclassified 1227
208 Ga0105237_10053612 3300009545 Bacteria 4044
209 Ga0105237_10392298 3300009545 Bacteria 1393
210 Ga0105238_10006858 3300009551 Bacteria 11373
211 Ga0105238_10079714 3300009551 Bacteria 3264
212 Ga0105249_10152102 3300009553 Bacteria 2229
213 Ga0105249_10160730 3300009553 Bacteria 2171
214 Ga0105249_10460336 3300009553 Unclassified 1312
215 Ga0105239_10039797 3300010375 Bacteria 5151
216 Ga0105239_10075638 3300010375 Bacteria 3703
217 Ga0105239_10275202 3300010375 Bacteria 1894
218 Ga0105239_10379452 3300010375 Bacteria 1598
219 Ga0157373_10024150 3300013100 Bacteria 4406
220 Ga0157373_10034558 3300013100 Bacteria 3630
221 Ga0157373_10194325 3300013100 Bacteria 1430
222 Ga0157371_10005134 3300013102 Bacteria 11163
223 Ga0157371_10024538 3300013102 Bacteria 4401
224 Ga0157371_10059690 3300013102 Bacteria 2704
225 Ga0157371_10124599 3300013102 Bacteria 1832
226 Ga0157371_10180469 3300013102 Bacteria 1510
227 Ga0157371_10307491 3300013102 Bacteria 1148
228 Ga0157371_10405516 3300013102 Bacteria 998
229 Ga0157370_10005211 3300013104 Bacteria 14650
230 Ga0157370_10102902 3300013104 Bacteria 2673
231 Ga0157369_10010073 3300013105 Bacteria 10792
232 Ga0157369_10058693 3300013105 Bacteria 4151
233 Ga0157369_10120004 3300013105 Bacteria 2790
234 Ga0157369_10126147 3300013105 Unclassified 2713
235 Ga0157369_10175271 3300013105 Bacteria 2258
236 Ga0157369_10187962 3300013105 Bacteria 2171
237 Ga0157369_10308625 3300013105 Bacteria 1645
238 Ga0157369_10324562 3300013105 Bacteria 1600
239 Ga0157374_10316770 3300013296 Bacteria 1545
240 Ga0157378_10058402 3300013297 Bacteria 3441
241 Ga0157378_10182842 3300013297 Bacteria 1973
242 Ga0157378_10483429 3300013297 Unclassified 1234
243 Ga0163162_10387233 3300013306 Unclassified 1531
244 Ga0157372_10026759 3300013307 Bacteria 6278
245 Ga0163163_10047514 3300014325 Bacteria 4220
246 Ga0163163_10212719 3300014325 Bacteria 1982
247 Ga0157380_10505272 3300014326 Bacteria 1175
248 Ga0157379_10422937 3300014968 Unclassified 1227
249 Ga0157376_10048842 3300014969 Bacteria 3503
250 Ga0163161_10026938 3300017792 Bacteria 4075
251 Ga0214544_1000017 3300021320 Bacteria 193638
252 Ga0214542_1000006 3300021321 Bacteria 345164
253 Ga0214543_1000014 3300021327 Bacteria 324986
254 Ga0213873_10000013 3300021358 Bacteria 206227
255 Ga0213876_10000072 3300021384 Bacteria 123469
256 Ga0213876_10006514 3300021384 Bacteria 6364
257 Ga0213876_10010220 3300021384 Bacteria 5041
258 Ga0209563_101879 3300025230 Bacteria 5091
259 Ga0209437_100040 3300025233 Bacteria 448096
260 Ga0207425_1000018 3300025245 Bacteria 411841
261 Ga0209759_1003548 3300025256 Bacteria 6177
262 Ga0209129_1000026 3300025258 Bacteria 411839
263 Ga0209129_1001054 3300025258 Bacteria 16280
264 Ga0209129_1005221 3300025258 Bacteria 4705
265 Ga0209233_1000051 3300025261 Bacteria 447617
266 Ga0209565_1000118 3300025263 Bacteria 113196
267 Ga0209673_1001150 3300025273 Bacteria 28906
268 Ga0209673_1015890 3300025273 Bacteria 2837
269 Ga0209673_1021733 3300025273 Bacteria 2235
270 Ga0209130_1001632 3300025284 Bacteria 13770
271 Ga0209675_1011805 3300025291 Bacteria 2869
272 Ga0209025_1000035 3300025294 Bacteria 411841
273 Ga0209025_1001871 3300025294 Bacteria 24663
274 Ga0209025_1009341 3300025294 Bacteria 6857
275 Ga0209564_1005948 3300025295 Bacteria 6757
276 Ga0209564_1007331 3300025295 Bacteria 5721
277 Ga0209758_1000040 3300025297 Bacteria 411841
278 Ga0209758_1000835 3300025297 Bacteria 42973
279 Ga0209758_1011719 3300025297 Bacteria 5034
280 Ga0209758_1018810 3300025297 Bacteria 3366
281 Ga0209758_1033961 3300025297 Bacteria 2038
282 Ga0209758_1035188 3300025297 Bacteria 1977
283 Ga0209050_1000039 3300025298 Bacteria 410069
284 Ga0209256_1011665 3300025299 Bacteria 3480
285 Ga0209256_1025930 3300025299 Bacteria 1699
286 Ga0207426_1000182 3300025302 Bacteria 155724
287 Ga0207426_1001984 3300025302 Bacteria 14503
288 Ga0207426_1002244 3300025302 Bacteria 12860
289 Ga0209257_1000051 3300025304 Bacteria 434166
290 Ga0209257_1000506 3300025304 Bacteria 68402
291 Ga0207697_10027588 3300025315 Bacteria 2322
292 Ga0207656_10006046 3300025321 Bacteria 4329
293 Ga0207656_10007905 3300025321 Bacteria 3896
294 Ga0207682_10006032 3300025893 Bacteria 4900
295 Ga0207682_10032212 3300025893 Bacteria 2107
296 Ga0207688_10002384 3300025901 Bacteria 10114
297 Ga0207680_10005418 3300025903 Bacteria 6097
298 Ga0207680_10044350 3300025903 Bacteria 2614
299 Ga0207647_10000769 3300025904 Bacteria 25007
300 Ga0207647_10001347 3300025904 Bacteria 18861
301 Ga0207647_10002711 3300025904 Bacteria 13377
302 Ga0207647_10021746 3300025904 Bacteria 4275
303 Ga0207647_10145577 3300025904 Unclassified 1387
304 Ga0207705_10009397 3300025909 Bacteria 7110
305 Ga0207705_10016966 3300025909 Bacteria 5215
306 Ga0207705_10086738 3300025909 Bacteria 2288
307 Ga0207705_10092501 3300025909 Bacteria 2216
308 Ga0207705_10103663 3300025909 Bacteria 2095
309 Ga0207705_10118753 3300025909 Bacteria 1960
310 Ga0207705_10121531 3300025909 Bacteria 1938
311 Ga0207705_10158675 3300025909 Bacteria 1698
312 Ga0207707_10005427 3300025912 Bacteria 11146
313 Ga0207695_10009389 3300025913 Bacteria 12098
314 Ga0207695_10088474 3300025913 Bacteria 3117
315 Ga0207695_10098981 3300025913 Bacteria 2914
316 Ga0207671_10267299 3300025914 Bacteria 1347
317 Ga0207660_10000951 3300025917 Bacteria 19171
318 Ga0207660_10011228 3300025917 Bacteria 5826
319 Ga0207660_10065921 3300025917 Bacteria 2618
320 Ga0207662_10060289 3300025918 Bacteria 2275
321 Ga0207657_10003509 3300025919 Bacteria 16744
322 Ga0207657_10007321 3300025919 Bacteria 11322
323 Ga0207657_10034689 3300025919 Bacteria 4534
324 Ga0207657_10048872 3300025919 Bacteria 3691
325 Ga0207657_10081899 3300025919 Bacteria 2710
326 Ga0207657_10083170 3300025919 Bacteria 2686
327 Ga0207657_10096625 3300025919 Bacteria 2457
328 Ga0207657_10281457 3300025919 Bacteria 1320
329 Ga0207649_10000011 3300025920 Bacteria 266219
330 Ga0207649_10005260 3300025920 Bacteria 6996
331 Ga0207649_10010641 3300025920 Bacteria 5058
332 Ga0207649_10018955 3300025920 Bacteria 3926
333 Ga0207649_10200544 3300025920 Bacteria 1409
334 Ga0207649_10235117 3300025920 Bacteria 1312
335 Ga0207652_10000001 3300025921 Bacteria 1006643
336 Ga0207652_10000002 3300025921 Bacteria 878035
337 Ga0207652_10141214 3300025921 Bacteria 2153
338 Ga0207652_10167226 3300025921 Bacteria 1972
339 Ga0207681_10162389 3300025923 Bacteria 1685
340 Ga0207681_10182879 3300025923 Bacteria 1598
341 Ga0207694_10012853 3300025924 Bacteria 6305
342 Ga0207694_10026522 3300025924 Bacteria 4408
343 Ga0207650_10068784 3300025925 Bacteria 2660
344 Ga0207650_10169574 3300025925 Bacteria 1734
345 Ga0207650_10374292 3300025925 Bacteria 1175
346 Ga0207659_10018045 3300025926 Bacteria 4619
347 Ga0207659_10019430 3300025926 Bacteria 4473
348 Ga0207687_10055397 3300025927 Bacteria 2779
349 Ga0207700_10122472 3300025928 Bacteria 2111
350 Ga0207664_10644988 3300025929 Bacteria 952
351 Ga0207644_10001523 3300025931 Bacteria 14942
352 Ga0207644_10013384 3300025931 Bacteria 5467
353 Ga0207644_10030632 3300025931 Bacteria 3743
354 Ga0207644_10095824 3300025931 Bacteria 2220
355 Ga0207644_10139090 3300025931 Bacteria 1868
356 Ga0207690_10001973 3300025932 Bacteria 12564
357 Ga0207690_10005548 3300025932 Bacteria 7449
358 Ga0207690_10014564 3300025932 Bacteria 4750
359 Ga0207690_10028343 3300025932 Bacteria 3549
360 Ga0207690_10038777 3300025932 Bacteria 3103
361 Ga0207690_10074543 3300025932 Bacteria 2351
362 Ga0207690_10104614 3300025932 Bacteria 2028
363 Ga0207690_10242763 3300025932 Bacteria 1388
364 Ga0207690_10243789 3300025932 Bacteria 1385
365 Ga0207706_10002853 3300025933 Bacteria 16775
366 Ga0207706_10005711 3300025933 Bacteria 11589
367 Ga0207706_10016430 3300025933 Bacteria 6681
368 Ga0207706_10024238 3300025933 Bacteria 5440
369 Ga0207706_10025153 3300025933 Bacteria 5337
370 Ga0207706_10078497 3300025933 Bacteria 2903
371 Ga0207706_10148231 3300025933 Bacteria 2064
372 Ga0207706_10464812 3300025933 Bacteria 1094
373 Ga0207686_10010042 3300025934 Bacteria 5150
374 Ga0207669_10016893 3300025937 Bacteria 3726
375 Ga0207669_10053759 3300025937 Bacteria 2428
376 Ga0207669_10158452 3300025937 Unclassified 1595
377 Ga0207669_10213230 3300025937 Bacteria 1411
378 Ga0207691_10004286 3300025940 Bacteria 13860
379 Ga0207691_10012677 3300025940 Bacteria 8074
380 Ga0207691_10013663 3300025940 Bacteria 7758
381 Ga0207691_10045971 3300025940 Bacteria 4013
382 Ga0207691_10158714 3300025940 Bacteria 1985
383 Ga0207711_10000345 3300025941 Bacteria 49338
384 Ga0207711_10004198 3300025941 Bacteria 12335
385 Ga0207711_10045263 3300025941 Bacteria 3761
386 Ga0207711_10051289 3300025941 Bacteria 3533
387 Ga0207711_10059324 3300025941 Bacteria 3294
388 Ga0207711_10161344 3300025941 Bacteria 2029
389 Ga0207711_10223058 3300025941 Bacteria 1725
390 Ga0207711_10242777 3300025941 Bacteria 1652
391 Ga0207689_10090834 3300025942 Bacteria 2509
392 Ga0207661_10014283 3300025944 Bacteria 5816
393 Ga0207661_10027319 3300025944 Bacteria 4358
394 Ga0207661_10352254 3300025944 Bacteria 1328
395 Ga0207661_10657162 3300025944 Bacteria 964
396 Ga0207679_10013785 3300025945 Bacteria 5301
397 Ga0207679_10032616 3300025945 Bacteria 3659
398 Ga0207679_10056492 3300025945 Bacteria 2898
399 Ga0207679_10085503 3300025945 Bacteria 2423
400 Ga0207667_10016893 3300025949 Bacteria 8233
401 Ga0207667_10257889 3300025949 Bacteria 1783
402 Ga0207651_10013678 3300025960 Bacteria 4653
403 Ga0207651_10014971 3300025960 Bacteria 4493
404 Ga0207651_10017450 3300025960 Bacteria 4243
405 Ga0207651_10289845 3300025960 Bacteria 1357
406 Ga0207712_10089157 3300025961 Bacteria 2267
407 Ga0207668_10180833 3300025972 Bacteria 1663
408 Ga0207640_10002725 3300025981 Bacteria 9449
409 Ga0207640_10046671 3300025981 Bacteria 2789
410 Ga0207640_10193830 3300025981 Bacteria 1534
411 Ga0207658_10109899 3300025986 Bacteria 2177
412 Ga0207658_10309064 3300025986 Bacteria 1365
413 Ga0207677_10036297 3300026023 Bacteria 3211
414 Ga0207703_10038455 3300026035 Bacteria 3818
415 Ga0207639_10009043 3300026041 Bacteria 6863
416 Ga0207639_10188416 3300026041 Bacteria 1760
417 Ga0207639_10281952 3300026041 Unclassified 1462
418 Ga0207678_10002237 3300026067 Bacteria 17496
419 Ga0207678_10020591 3300026067 Bacteria 5783
420 Ga0207678_10037661 3300026067 Bacteria 4206
421 Ga0207678_10083862 3300026067 Bacteria 2726
422 Ga0207702_10017005 3300026078 Bacteria 6019
423 Ga0207702_10063343 3300026078 Bacteria 3161
424 Ga0207702_10122322 3300026078 Bacteria 2331
425 Ga0207702_10170427 3300026078 Bacteria 1996
426 Ga0207702_10247017 3300026078 Bacteria 1674
427 Ga0207641_10102045 3300026088 Bacteria 2529
428 Ga0207641_10281469 3300026088 Bacteria 1564
429 Ga0207648_10005937 3300026089 Bacteria 12213
430 Ga0207648_10016189 3300026089 Bacteria 6824
431 Ga0207648_10121101 3300026089 Bacteria 2301
432 Ga0207676_10014056 3300026095 Bacteria 5750
433 Ga0207676_10017609 3300026095 Bacteria 5180
434 Ga0207674_10005682 3300026116 Bacteria 14788
435 Ga0207674_10009767 3300026116 Bacteria 10931
436 Ga0207674_10068073 3300026116 Bacteria 3583
437 Ga0207674_10264394 3300026116 Bacteria 1668
438 Ga0207675_100120056 3300026118 Bacteria 2487
439 Ga0207683_10024569 3300026121 Bacteria 5190
440 Ga0207683_10040908 3300026121 Bacteria 4047
441 Ga0207683_10094928 3300026121 Bacteria 2658
442 Ga0207698_10005661 3300026142 Bacteria 7738
443 Ga0207698_10066124 3300026142 Bacteria 2844
444 Ga0207698_10070482 3300026142 Bacteria 2770
445 Ga0207698_10078488 3300026142 Bacteria 2651
446 Ga0207698_10329012 3300026142 Bacteria 1434
447 Ga0209371_1030682 3300027312 Bacteria 1175
448 Ga0209974_10069589 3300027876 Bacteria 1199
449 Ga0268266_10060804 3300028379 Bacteria 3257
450 Ga0268265_10604031 3300028380 Bacteria 1049
451 Ga0268264_10105978 3300028381 Bacteria 2453
452 Ga0307515_10017859 3300028794 Bacteria 12890
453 Ga0307515_10018412 3300028794 Bacteria 12641
454 Ga0307515_10324848 3300028794 Bacteria 1202
455 Ga0268256_1034886 3300030500 Bacteria 1175
456 Ga0307511_10066775 3300030521 Bacteria 2677
457 Ga0307513_10185070 3300031456 Bacteria 1941
458 Ga0307408_100215159 3300031548 Bacteria 1564
459 Ga0307408_100231749 3300031548 Bacteria 1513
460 Ga0307508_10103537 3300031616 Bacteria 2443
461 Ga0307405_10014708 3300031731 Bacteria 4217
462 Ga0307405_10015120 3300031731 Bacteria 4170
463 Ga0307405_10034239 3300031731 Bacteria 3020
464 Ga0307413_10011924 3300031824 Bacteria 4300
465 Ga0307413_10033469 3300031824 Bacteria 2927
466 Ga0307413_10211771 3300031824 Bacteria 1408
467 Ga0307410_10000658 3300031852 Bacteria 14276
468 Ga0307410_10003486 3300031852 Bacteria 7899
469 Ga0307410_10059009 3300031852 Bacteria 2618
470 Ga0307410_10062340 3300031852 Bacteria 2554
471 Ga0307410_10104777 3300031852 Bacteria 2034
472 Ga0307410_10134767 3300031852 Bacteria 1819
473 Ga0307410_10141484 3300031852 Bacteria 1780
474 Ga0307410_10558877 3300031852 Bacteria 949
475 Ga0307406_10007490 3300031901 Bacteria 6055
476 Ga0307406_10036793 3300031901 Bacteria 3018
477 Ga0307407_10038425 3300031903 Bacteria 2653
478 Ga0307407_10088067 3300031903 Bacteria 1896
479 Ga0307407_10170308 3300031903 Bacteria 1433
480 Ga0307407_10270566 3300031903 Bacteria 1172
481 Ga0307412_10017634 3300031911 Bacteria 4276
482 Ga0307412_10040067 3300031911 Bacteria 3030
483 Ga0307412_10046028 3300031911 Bacteria 2856
484 Ga0307412_10226097 3300031911 Bacteria 1438
485 Ga0307409_100016764 3300031995 Bacteria 4860
486 Ga0307409_100115037 3300031995 Bacteria 2264
487 Ga0307409_100146291 3300031995 Bacteria 2044
488 Ga0307409_100299651 3300031995 Bacteria 1495
489 Ga0307409_100616950 3300031995 Bacteria 1074
490 Ga0307416_100052040 3300032002 Bacteria 3276
491 Ga0307416_100129195 3300032002 Bacteria 2270
492 Ga0307414_10020719 3300032004 Bacteria 4105
493 Ga0307414_10026608 3300032004 Bacteria 3726
494 Ga0307414_10039495 3300032004 Bacteria 3179
495 Ga0307414_10042888 3300032004 Bacteria 3077
496 Ga0307414_10078994 3300032004 Bacteria 2400
497 Ga0307414_10101051 3300032004 Bacteria 2170
498 Ga0307414_10461471 3300032004 Bacteria 1116
499 Ga0307411_10003235 3300032005 Bacteria 7505
500 Ga0307411_10006548 3300032005 Bacteria 5839
501 Ga0307411_10007485 3300032005 Bacteria 5569
502 Ga0307411_10020260 3300032005 Bacteria 3863
503 Ga0307411_10034980 3300032005 Bacteria 3132
504 Ga0307411_10060021 3300032005 Bacteria 2523
505 Ga0307411_10224071 3300032005 Bacteria 1461
506 Ga0307415_100003615 3300032126 Bacteria 7900
507 Ga0307415_100184902 3300032126 Bacteria 1639
508 Ga0307510_10000007 3300033180 Bacteria 558582
509 Ga0373936_0012860 3300035113 Bacteria 3190
510 Ga0373946_0070630 3300035171 Bacteria 1507
511 Ga0373946_0090533 3300035171 Bacteria 1355
512 Ga0395899_0000007 3300037312 Bacteria 629129
513 Ga0395899_0006239 3300037312 Bacteria 9235
514 Ga0395899_0067713 3300037312 Bacteria 2619
515 Ga0395899_0092635 3300037312 Bacteria 2188
516 Ga0395899_0122140 3300037312 Bacteria 1864
517 Ga0395900_0000026 3300037418 Bacteria 313470
518 Ga0395900_0000849 3300037418 Bacteria 40245
519 Ga0395900_0020627 3300037418 Bacteria 6733
520 Ga0395900_0029935 3300037418 Bacteria 5587
521 Ga0395900_0057163 3300037418 Bacteria 4016
522 Ga0395900_0068757 3300037418 Bacteria 3640
523 Ga0395900_0100913 3300037418 Bacteria 2964
524 Ga0395900_0105335 3300037418 Bacteria 2897
525 Ga0395900_0116182 3300037418 Bacteria 2745
526 Ga0395900_0123764 3300037418 Bacteria 2652
527 Ga0395900_0128884 3300037418 Bacteria 2593
528 Ga0395900_0130943 3300037418 Bacteria 2571
529 Ga0395900_0235325 3300037418 Bacteria 1840
530 Ga0395900_0281293 3300037418 Bacteria 1655
531 Ga0395900_0339800 3300037418 Bacteria 1477
532 Ga0395900_0503779 3300037418 Bacteria 1161
533 Ga0395898_0000085 3300037466 Bacteria 240992
534 Ga0395898_0035607 3300037466 Bacteria 4948
535 Ga0395898_0047421 3300037466 Bacteria 4216
536 Ga0395898_0072874 3300037466 Bacteria 3317
537 Ga0395898_0216568 3300037466 Bacteria 1826
538 Ga0395905_0000519 3300037471 Bacteria 52760
539 Ga0395905_0002257 3300037471 Bacteria 21639
540 Ga0395905_0005730 3300037471 Bacteria 12630
541 Ga0395905_0009882 3300037471 Bacteria 9299
542 Ga0395905_0013679 3300037471 Bacteria 7772
543 Ga0395905_0030896 3300037471 Bacteria 5044
544 Ga0395905_0047940 3300037471 Bacteria 4003
545 Ga0395905_0055365 3300037471 Bacteria 3712
546 Ga0395905_0102121 3300037471 Bacteria 2692
547 Ga0395905_0111374 3300037471 Bacteria 2570
548 Ga0395905_0152432 3300037471 Bacteria 2174
549 Ga0395905_0159507 3300037471 Bacteria 2120
550 Ga0395905_0161390 3300037471 Bacteria 2106
551 Ga0395905_0201968 3300037471 Bacteria 1863
552 Ga0395905_0225800 3300037471 Bacteria 1752
553 Ga0395905_0277318 3300037471 Bacteria 1562
554 Ga0395905_0308493 3300037471 Bacteria 1471
555 Ga0395905_0342111 3300037471 Bacteria 1387
556 Ga0395905_0365567 3300037471 Bacteria 1336
557 Ga0395905_0372548 3300037471 Bacteria 1321
558 Ga0436364_1438839 3300037853 Bacteria 7181
559 Ga0395901_0006625 3300038443 Bacteria 11701
560 Ga0395901_0023196 3300038443 Bacteria 6361
561 Ga0395901_0046562 3300038443 Bacteria 4505
562 Ga0395901_0060245 3300038443 Bacteria 3949
563 Ga0395901_0108404 3300038443 Bacteria 2915
564 Ga0395901_0178969 3300038443 Bacteria 2224
565 Ga0395901_0260621 3300038443 Bacteria 1804
566 Ga0395901_0285899 3300038443 Bacteria 1712
567 Ga0395901_0394036 3300038443 Bacteria 1423
568 Ga0395901_0522312 3300038443 Bacteria 1206
569 Ga0395901_0684975 3300038443 Bacteria 1024
570 Ga0436365_0044388 3300039437 Bacteria 123489
571 Ga0436365_0256427 3300039437 Bacteria 9558
572 Ga0436362_1051662 3300039453 Bacteria 138391
573 Ga0439436_0038446 3300041404 Bacteria 1376
574 Ga0439461_0000171 3300041410 Bacteria 8872
575 Ga0439465_0000356 3300041413 Bacteria 13110
576 Ga0451789_0805958 3300041443 Bacteria 1974
577 Ga0439431_0000437 3300041997 Bacteria 8834
578 Ga0439431_0008149 3300041997 Bacteria 2351
579 Ga0439431_0047518 3300041997 Bacteria 1107
580 Ga0439442_000878 3300042002 Bacteria 6192
581 Ga0439445_0000176 3300042004 Bacteria 11385
582 Ga0439432_000215 3300042006 Bacteria 20677
583 Ga0439452_012403 3300042010 Bacteria 2426
584 Ga0439455_0005448 3300042012 Bacteria 2587
585 Ga0450907_008880 3300042146 Bacteria 1667
586 Ga0439458_0000153 3300042157 Bacteria 15161
587 Ga0439434_0010753 3300042435 Bacteria 2700
588 Ga0439435_0106492 3300042436 Bacteria 866
589 Ga0466969_0001617 3300044656 Bacteria 12070
590 Ga0466969_0025519 3300044656 Bacteria 3037
591 Ga0466969_0183248 3300044656 Bacteria 958
592 Ga0466966_0000143 3300044684 Bacteria 45651
593 Ga0466966_0000492 3300044684 Bacteria 25352
594 Ga0466966_0033607 3300044684 Bacteria 3320
595 Ga0466966_0057894 3300044684 Bacteria 2450
596 Ga0466961_0000301 3300044693 Bacteria 32898
597 Ga0466961_0000868 3300044693 Bacteria 18843
598 Ga0466961_0047964 3300044693 Bacteria 2730
599 Ga0466961_0054737 3300044693 Bacteria 2544
600 Ga0466963_0007629 3300044694 Bacteria 6457
601 Ga0466963_0028365 3300044694 Bacteria 3593
602 Ga0466963_0039798 3300044694 Bacteria 3080
603 Ga0466963_0058547 3300044694 Bacteria 2569
604 Ga0466963_0090938 3300044694 Bacteria 2078
605 Ga0466963_0179827 3300044694 Bacteria 1476
606 Ga0453684_0224176 3300044712 Bacteria 2175
607 Ga0466971_0000632 3300044719 Bacteria 14039
608 Ga0466957_0013744 3300044842 Bacteria 4702
609 Ga0466957_0024784 3300044842 Bacteria 3553
610 Ga0466957_0033496 3300044842 Bacteria 3082
611 Ga0466957_0056737 3300044842 Bacteria 2395
612 Ga0466957_0087640 3300044842 Bacteria 1946
613 Ga0466957_0107267 3300044842 Bacteria 1768
614 Ga0466957_0177495 3300044842 Bacteria 1390
615 Ga0466960_0031638 3300044901 Bacteria 2443
616 Ga0466960_0115223 3300044901 Bacteria 1401
617 Ga0466959_0000511 3300045049 Bacteria 22572
618 Ga0466959_0035270 3300045049 Bacteria 3701
619 Ga0466959_0067777 3300045049 Bacteria 2586
620 Ga0466959_0194664 3300045049 Bacteria 1414
621 Ga0451576_0157512 3300045051 Bacteria 2369
622 Ga0466958_0000818 3300045836 Bacteria 13744
623 Ga0466958_0003818 3300045836 Bacteria 7868
624 Ga0466958_0014464 3300045836 Bacteria 4506
625 Ga0466958_0058042 3300045836 Unclassified 2353
626 Ga0466958_0106886 3300045836 Bacteria 1745
627 Ga0466958_0340064 3300045836 Bacteria 965
628 Ga0466967_0016590 3300045976 Bacteria 5816
629 Ga0466967_0046786 3300045976 Bacteria 3769
630 Ga0466967_0077393 3300045976 Bacteria 2994
631 Ga0466967_0078287 3300045976 Bacteria 2978
632 Ga0466967_0132819 3300045976 Bacteria 2312
633 Ga0466967_0179519 3300045976 Bacteria 1996
634 Ga0466967_0247942 3300045976 Bacteria 1700
635 Ga0466967_0369298 3300045976 Bacteria 1391
636 Ga0495617_000003 3300046452 Bacteria 541914
637 Ga0495592_0008744 3300046454 Bacteria 7603
638 Ga0495603_0136563 3300046455 Bacteria 1427
639 Ga0495590_0037793 3300046457 Bacteria 1683
640 Ga0495591_003143 3300046458 Bacteria 8724
641 Ga0495629_0035464 3300046459 Bacteria 3524
642 Ga0495638_0000552 3300046460 Bacteria 42693
643 Ga0495638_0001206 3300046460 Bacteria 24684
644 Ga0495638_0040724 3300046460 Bacteria 2943
645 Ga0495638_0058522 3300046460 Bacteria 2387
646 Ga0495638_0060759 3300046460 Bacteria 2336
647 Ga0495638_0075402 3300046460 Bacteria 2055
648 Ga0495651_0017339 3300046462 Bacteria 5577
649 Ga0495653_0020018 3300046463 Bacteria 5422
650 Ga0495653_0328559 3300046463 Bacteria 989
651 Ga0495650_0000069 3300046471 Bacteria 261124
652 Ga0495650_0000240 3300046471 Bacteria 109029
653 Ga0495650_0000417 3300046471 Bacteria 69289
654 Ga0495650_0061970 3300046471 Bacteria 1496
655 Ga0495582_0004825 3300046473 Bacteria 7567
656 Ga0495605_0000287 3300046474 Bacteria 55659
657 Ga0495662_0023700 3300046476 Bacteria 2964
658 Ga0495664_0009074 3300046477 Bacteria 5560
659 Ga0495584_0000026 3300046491 Bacteria 114028
660 Ga0495585_0001974 3300046492 Bacteria 15274
661 Ga0495585_0129036 3300046492 Bacteria 1332
662 Ga0495596_0001769 3300046500 Bacteria 12094
663 Ga0495607_0001107 3300046501 Bacteria 24522
664 Ga0495607_0009814 3300046501 Bacteria 6462
665 Ga0495583_0000141 3300046506 Bacteria 121899
666 Ga0495583_0016351 3300046506 Bacteria 3992
667 Ga0495606_0000147 3300046507 Bacteria 122261
668 Ga0495606_0001676 3300046507 Bacteria 28604
669 Ga0495606_0004031 3300046507 Bacteria 14979
670 Ga0495606_0011517 3300046507 Bacteria 7206
671 Ga0495606_0113420 3300046507 Bacteria 1632
672 Ga0495608_0004834 3300046511 Bacteria 9629
673 Ga0495610_0000003 3300046512 Bacteria 1203910
674 Ga0495610_0000378 3300046512 Bacteria 45991
675 Ga0495610_0001931 3300046512 Bacteria 17864
676 Ga0495610_0008022 3300046512 Bacteria 6912
677 Ga0495610_0083620 3300046512 Bacteria 1460
678 Ga0495618_0071975 3300046514 Bacteria 2199
679 Ga0495620_0005035 3300046515 Bacteria 7406
680 Ga0495628_0197997 3300046516 Bacteria 1514
681 Ga0495630_0010628 3300046517 Bacteria 6646
682 Ga0495631_0009499 3300046518 Bacteria 4857
683 Ga0495631_0163185 3300046518 Bacteria 956
684 Ga0495637_0002413 3300046520 Bacteria 10339
685 Ga0495643_0000051 3300046522 Bacteria 207804
686 Ga0495643_0003645 3300046522 Bacteria 11185
687 Ga0495643_0003725 3300046522 Bacteria 11043
688 Ga0495643_0034138 3300046522 Bacteria 2809
689 Ga0495644_0149282 3300046523 Bacteria 894
690 Ga0495648_0002396 3300046524 Bacteria 17400
691 Ga0495648_0008443 3300046524 Bacteria 8103
692 Ga0495648_0015666 3300046524 Bacteria 5491
693 Ga0495648_0079901 3300046524 Bacteria 1864
694 Ga0495666_0002451 3300046526 Bacteria 9211
695 Ga0495642_0004326 3300046528 Bacteria 5515
696 Ga0495652_0018649 3300046529 Bacteria 6184
697 Ga0495654_0000285 3300046530 Bacteria 46016
698 Ga0495654_0009943 3300046530 Bacteria 5198
699 Ga0495665_0005192 3300046531 Bacteria 7020
700 Ga0495640_0029546 3300046533 Bacteria 3934
701 Ga0495587_0002021 3300046536 Bacteria 13522
702 Ga0495609_0143046 3300046538 Bacteria 1020
703 Ga0495622_0000450 3300046557 Bacteria 26491
704 Ga0495633_0029699 3300046558 Bacteria 2658
705 Ga0495633_0124787 3300046558 Bacteria 1192
706 Ga0495656_0071538 3300046615 Bacteria 1542
707 Ga0495668_0004440 3300046616 Bacteria 9956
708 Ga0495668_0015655 3300046616 Bacteria 4424
709 Ga0495668_0210111 3300046616 Bacteria 1066
710 Ga0495625_0000857 3300046660 Bacteria 41346
711 Ga0495625_0003460 3300046660 Bacteria 15720
712 Ga0495625_0010507 3300046660 Bacteria 7650
713 Ga0495625_0014409 3300046660 Bacteria 6311
714 Ga0495625_0050255 3300046660 Bacteria 2992
715 Ga0495625_0141659 3300046660 Bacteria 1621
716 Ga0495659_0005556 3300046664 Bacteria 3967
717 Ga0495661_0004617 3300046665 Bacteria 9912
718 Ga0495661_0004853 3300046665 Bacteria 9632
719 Ga0495661_0011766 3300046665 Bacteria 5927
720 Ga0495661_0027910 3300046665 Bacteria 3619
721 Ga0495588_0000062 3300046674 Bacteria 253674
722 Ga0495588_0002924 3300046674 Bacteria 7371
723 Ga0495588_0122854 3300046674 Bacteria 1369
724 Ga0495657_0022634 3300046675 Bacteria 4499
725 Ga0495599_0038021 3300046678 Bacteria 3023
726 Ga0495646_0015977 3300046680 Bacteria 4764
727 Ga0495669_0059944 3300046684 Bacteria 1720
728 Ga0495613_0006859 3300046689 Bacteria 8501
729 Ga0495624_0058704 3300046690 Bacteria 2415
730 Ga0495671_0001894 3300046692 Bacteria 13432
731 Ga0495649_0002968 3300046694 Bacteria 11684
732 Ga0495649_0072327 3300046694 Bacteria 1848
733 Ga0495589_0000991 3300046794 Bacteria 17231
734 Ga0495589_0009545 3300046794 Bacteria 5042
735 Ga0495600_0005267 3300046809 Bacteria 7785
736 Ga0495660_0000101 3300046810 Bacteria 91466
737 Ga0495660_0004120 3300046810 Bacteria 8859
738 Ga0495660_0129408 3300046810 Bacteria 1268
739 Ga0495581_0018204 3300047315 Bacteria 4080
740 Ga0495672_0000030 3300047320 Bacteria 305021
741 Ga0495672_0000348 3300047320 Bacteria 59143
742 Ga0495672_0000663 3300047320 Bacteria 38282
743 Ga0495676_0021038 3300047321 Bacteria 5709
744 Ga0495683_0009372 3300047323 Bacteria 5216
745 Ga0495683_0013024 3300047323 Bacteria 4355
746 Ga0495683_0019971 3300047323 Bacteria 3457
747 Ga0495687_000036 3300047443 Bacteria 255427
748 Ga0495687_000938 3300047443 Bacteria 30149
749 Ga0495687_010251 3300047443 Bacteria 5151
750 Ga0495675_0000605 3300047444 Bacteria 23113
751 Ga0495677_0000422 3300047445 Bacteria 18190
752 Ga0495677_0014289 3300047445 Bacteria 2892
753 Ga0495679_001358 3300047446 Bacteria 14076
754 Ga0495679_009161 3300047446 Bacteria 3982
755 Ga0495679_011495 3300047446 Bacteria 3415
756 Ga0495673_0000016 3300047469 Bacteria 580643
757 Ga0495673_0001751 3300047469 Bacteria 16546
758 Ga0495673_0008711 3300047469 Bacteria 5669
759 Ga0495684_0106004 3300047471 Bacteria 2124
760 Ga0495686_0018455 3300047472 Bacteria 4681
761 Ga0495593_0001577 3300047673 Bacteria 13443
762 Ga0495614_0003703 3300048089 Bacteria 6862
763 Ga0495626_0000347 3300048091 Bacteria 48706
764 Ga0495626_0009286 3300048091 Bacteria 5320
765 Ga0496100_0109877 3300048903 Bacteria 1914
766 Ga0496101_0001508 3300048904 Bacteria 13943
767 Ga0496101_0003840 3300048904 Bacteria 9392
768 Ga0496101_0059856 3300048904 Bacteria 2762
769 Ga0496102_0001994 3300048905 Bacteria 17631
770 Ga0496102_0074546 3300048905 Bacteria 3119
771 Ga0496103_0043549 3300048906 Bacteria 2764
772 Ga0496103_0050994 3300048906 Bacteria 2561
773 Ga0496104_0158905 3300048907 Bacteria 2168
774 Ga0496104_0335616 3300048907 Bacteria 1424
775 Ga0496105_0033646 3300048908 Bacteria 4211
776 Ga0496105_0181017 3300048908 Unclassified 1726
777 Ga0496106_0001460 3300048909 Bacteria 17764
778 Ga0496106_0009518 3300048909 Bacteria 7177
779 Ga0496106_0022804 3300048909 Bacteria 4650
780 Ga0496106_0232170 3300048909 Bacteria 1473
781 Ga0496107_0012251 3300048910 Bacteria 5985
782 Ga0496107_0014479 3300048910 Bacteria 5522
783 Ga0496107_0022881 3300048910 Bacteria 4418
784 Ga0496107_0137584 3300048910 Bacteria 1805
785 Ga0496108_0015084 3300048911 Bacteria 6308
786 Ga0496108_0015113 3300048911 Bacteria 6300
787 Ga0496108_0177142 3300048911 Bacteria 1846
788 Ga0496109_0001761 3300048912 Bacteria 17994
789 Ga0496109_0009942 3300048912 Bacteria 8124
790 Ga0496110_0007368 3300048913 Bacteria 8782
791 Ga0496110_0009390 3300048913 Bacteria 7919
792 Ga0496110_0033799 3300048913 Bacteria 4426
793 Ga0496111_0003665 3300048914 Bacteria 9538
794 Ga0496111_0025636 3300048914 Bacteria 4160
795 Ga0496111_0035838 3300048914 Bacteria 3547
796 Ga0496112_0043890 3300048915 Bacteria 4378
797 Ga0496112_0075067 3300048915 Bacteria 3343
798 Ga0496113_0011054 3300048916 Bacteria 6002
799 Ga0496113_0012540 3300048916 Bacteria 5702
800 Ga0496113_0136283 3300048916 Bacteria 1929
801 Ga0496113_0183241 3300048916 Bacteria 1660
802 Ga0496114_0258027 3300048917 Bacteria 1534
803 Ga0496115_0001431 3300048918 Bacteria 17100
804 Ga0496116_0000097 3300048919 Bacteria 200658
805 Ga0496116_0067861 3300048919 Bacteria 2275
806 Ga0496116_0087427 3300048919 Bacteria 1907
807 Ga0496116_0088894 3300048919 Bacteria 1886
808 Ga0496117_0002771 3300048920 Bacteria 21469
809 Ga0496117_0037227 3300048920 Bacteria 3627
810 Ga0496118_0000553 3300048921 Bacteria 61663
811 Ga0496119_0045030 3300048922 Bacteria 2771
812 Ga0496120_0153548 3300048923 Bacteria 1155
813 Ga0496121_0092538 3300048924 Bacteria 2357
814 Ga0496121_0224326 3300048924 Bacteria 1321
815 Ga0496122_0090059 3300048925 Bacteria 2095
816 Ga0496122_0096670 3300048925 Bacteria 1990
817 Ga0496123_0054996 3300048926 Bacteria 2615
818 Ga0496123_0055342 3300048926 Bacteria 2604
819 Ga0496123_0096186 3300048926 Bacteria 1739
820 Ga0496123_0222039 3300048926 Bacteria 952
821 Ga0496124_0000610 3300048927 Bacteria 60097
822 Ga0496124_0017766 3300048927 Bacteria 6689
823 Ga0496124_0047966 3300048927 Bacteria 3651
824 Ga0496124_0238711 3300048927 Bacteria 1353
825 Ga0496125_0112157 3300048928 Bacteria 1971
826 Ga0496125_0130922 3300048928 Bacteria 1766
827 Ga0496126_0000119 3300048929 Bacteria 184211
828 Ga0496126_0006673 3300048929 Bacteria 12827
829 Ga0496126_0037392 3300048929 Bacteria 4531
830 Ga0496126_0087057 3300048929 Bacteria 2753
831 Ga0496126_0129141 3300048929 Bacteria 2185
832 Ga0496126_0234917 3300048929 Bacteria 1534
833 Ga0495678_000040 3300049459 Bacteria 190664
834 Ga0495678_062128 3300049459 Bacteria 1399
835 Ga0501033_0000351 3300049570 Bacteria 43920
836 Ga0501033_0002610 3300049570 Bacteria 15185
837 Ga0501033_0063214 3300049570 Bacteria 2725
838 Ga0501034_0506027 3300049571 Bacteria 1121
839 Ga0501047_0306747 3300049581 Bacteria 1429
840 Ga0501067_0115013 3300049583 Bacteria 1496
841 Ga0501068_0203191 3300049584 Bacteria 1257
842 Ga0501080_0077504 3300049742 Bacteria 3091
843 Ga0501035_0000263 3300049822 Bacteria 62255
844 Ga0501044_0004321 3300049823 Bacteria 15928
845 nmdc:mga03683_130406_c1 3300050489 Bacteria 1124
846 nmdc:mga03n38_82242_c1 3300050490 Bacteria 1516
847 nmdc:mga0yw44_1655_c1 3300050492 Bacteria 8986
848 nmdc:mga0k408_142822_c1 3300050493 Bacteria 1424
849 nmdc:mga0k408_17241_c1 3300050493 Bacteria 4020
850 nmdc:mga07m45_32184_c2 3300050496 Bacteria 1274
851 nmdc:mga07m45_97021_c1 3300050496 Bacteria 1692
852 nmdc:mga08y16_247919_c1 3300050511 Bacteria 1840
853 nmdc:mga0sz30_2903_c2 3300050516 Bacteria 1562
854 Ga0500635_0010287 3300053080 Bacteria 2621
855 Ga0500578_0167329 3300053086 Bacteria 1361
856 Ga0500583_0017161 3300053092 Bacteria 2908
857 Ga0500566_0003407 3300053094 Bacteria 9484
858 Ga0500641_0052903 3300053096 Bacteria 1675
859 Ga0500660_095581 3300053100 Bacteria 1313
860 Ga0500554_001873 3300053102 Bacteria 4071
861 Ga0500556_0004789 3300053104 Bacteria 3838
862 Ga0500608_000133 3300053122 Bacteria 30212
863 Ga0500608_034018 3300053122 Bacteria 2427
864 Ga0500618_000071 3300053125 Bacteria 85596
865 Ga0500658_0001144 3300053134 Bacteria 10827
866 Ga0500568_0027058 3300053139 Bacteria 2401
867 Ga0500586_000126 3300053145 Bacteria 13845
868 Ga0500586_000471 3300053145 Bacteria 8055
869 Ga0500616_0001263 3300053153 Bacteria 25267
870 Ga0500616_0012191 3300053153 Bacteria 5039
871 Ga0500620_000371 3300053155 Bacteria 8345
872 Ga0500622_0000746 3300053156 Bacteria 28397
873 Ga0500622_0005146 3300053156 Bacteria 7932
874 Ga0500622_0008310 3300053156 Bacteria 5817
875 Ga0500630_074893 3300053159 Bacteria 1595
876 Ga0500637_0000887 3300053178 Bacteria 12034
877 Ga0500611_031464 3300053727 Bacteria 1102
878 Ga0500645_002368 3300053730 Bacteria 8489
879 Ga0466962_0000509 3300061719 Bacteria 16925
880 Ga0466962_0004059 3300061719 Bacteria 7006
881 Ga0466962_0026394 3300061719 Bacteria 2789
882 2793280811 2791355253 Bacteria 5171699
883 2509117348 2508501123 Bacteria 6283661
884 2511185417 2510917028 Bacteria 6185411
885 2513595238 2513237088 Bacteria 6927906
886 2513607818 2513237090 Bacteria 7096802
887 2513866684 2513237138 Bacteria 7368160
888 2513999101 2513237159 Bacteria 6810126
889 2516023237 2515154189 Bacteria 9629850
890 2523470108 2523231067 Bacteria 5230452
891 2585155360 2582581280 Bacteria 5994497
892 2585198924 2582581293 Bacteria 5907401
893 2585202323 2582581294 Bacteria 6626667
894 2585204233 2582581294 Bacteria 6626667
895 2585228220 2582581299 Bacteria 6518058
896 2585258652 2582581304 Bacteria 5831370
897 2585265893 2582581306 Bacteria 6450535
898 2585390083 2582581865 Bacteria 6644329
899 2585396962 2582581866 Bacteria 6859583
900 2585401508 2582581867 Bacteria 7184437
901 2585821202 2585427590 Bacteria 6824633
902 2585842611 2585427594 Bacteria 6180594
903 2599335336 2599185156 Bacteria 5403036
904 2599936596 2599185301 Bacteria 6161860
905 2643748261 2643221545 Bacteria 5083237
906 2643779075 2643221552 Bacteria 5708754
907 2643858173 2643221568 Bacteria 5187270
908 2643927642 2643221584 Bacteria 5511711
909 2644003986 2643221599 Bacteria 6292121
910 2644004093 2643221599 Bacteria 6292121
911 2644128424 2643221622 Bacteria 4212502
912 2644191593 2643221634 Bacteria 6705461
913 2644508006 2643221691 Bacteria 5093099
914 2657683201 2657244999 Bacteria 5946535
915 2719638275 2718217991 Bacteria 7829542
916 2738799900 2738541293 Bacteria 7065685
917 2738829674 2738541297 Bacteria 6549566
918 2739153470 2738541357 Bacteria 6549408
919 2739195390 2738543003 Bacteria 6549560
920 2739321866 2738543026 Bacteria 6549408
921 2739340107 2738543029 Bacteria 6549249
922 2739350797 2738543031 Bacteria 5769731
923 2739791656 2739367756 Bacteria 4553612
924 2753565401 2751185846 Bacteria 7242164
925 2758638063 2758568016 Bacteria 5645291
926 2778176588 2775507266 Bacteria 7392367
927 2792584226 2791355082 Bacteria 5973319
928 2792622618 2791355091 Bacteria 6135441
929 2792628462 2791355092 Bacteria 6248105
930 2804751411 2802429268 Bacteria 6094027
931 2819539583 2818991435 Bacteria 5433759
932 2819648791 2818991454 Bacteria 5563326
933 2821448476 2821443989 Bacteria 7658172
934 2842486329 2842482326 Bacteria 7212537
935 2842524845 2842521101 Bacteria 6569494
936 2842927040 2842922631 Bacteria 5824079
937 2844534164 2844533157 Bacteria 7517899
938 2857365311 2857357740 Bacteria 9937880
939 2883093562 2883087390 Bacteria 9532701
940 2891051301 2891048133 Bacteria 4447501
941 2896185665 2896184354 Bacteria 3258548
942 2909048280 2909042592 Bacteria 6499737
943 2913297380 2913295892 Bacteria 6333755
944 2919169863 2919166419 Bacteria 4952238
945 2923556911 2923556063 Bacteria 6793593
946 2977867993 2977864932 Bacteria 7534097
947 2978972280 2978969890 Bacteria 5400756
948 2984590510 2984587000 Bacteria 5263363
949 2996887498 2996887358 Bacteria 5795980
950 3000140992 3000135777 Bacteria 6891109
951 3005457138 3005452660 Bacteria 5889319
952 3005458515 3005452660 Bacteria 5889319
953 8005258831 8005258706 Bacteria 6184835
954 8005322025 8005321885 Bacteria 5795980
955 8049293984 8049293176 Bacteria 6128433
956 8054465120 8054460903 Bacteria 4872905
957 JGI24740J21852_10001232
958 JGI24740J21852_10002276
959 JGI24739J22299_10011198
960 JGI24739J22299_10012889
961 JGI24735J21928_10004904
962 JGI24735J21928_10009146
963 JGI24735J21928_10009735
964 JGI24735J21928_10033867
965 JGI24744J21845_10000200
966 JGI25162J39368_1000322
967 JGI25152J39213_1000557
968 JGI25152J39213_1000784
969 JGI25152J39213_1007244
970 JGI25150J39212_1000119
971 JGI25159J45721_1005825
972 JGI25151J46595_10000007
973 JGI25151J46595_10000834
974 JGI25406J46586_10010542
975 JGI25165J46597_1000248
976 JGI25153J46596_10001312
977 JGI25153J46596_10023166
978 rootL2_10065467
979 rootH1_10100938
980 rootH1_10247060
981 rootH1_10287660
982 Ga0055526_1010747
983 Ga0055526_1011964
984 Ga0055537_1000646
985 Ga0055524_1009262
986 Ga0055524_1012966
987 Ga0055528_1001758
988 Ga0055528_1002895
989 Ga0055528_1012540
990 Ga0055530_10000082
991 Ga0055530_10001087
992 Ga0055531_10000012
993 Ga0065165_1001607
994 Ga0070658_10016871
995 Ga0070658_10021683
996 Ga0070658_10076002
997 Ga0070658_10107708
998 Ga0070658_10159433
999 Ga0070676_10076204
1000 Ga0070683_100005325
1001 Ga0070683_100075480
1002 Ga0070690_100004330
1003 Ga0070670_100052588
1004 Ga0070670_100056212
1005 Ga0070670_100126192
1006 Ga0070677_10011562
1007 Ga0070677_10062094
1008 Ga0068869_100548347
1009 Ga0070666_10007359
1010 Ga0070666_10014250
1011 Ga0070666_10034931
1012 Ga0070666_10149040
1013 Ga0070680_100000896
1014 Ga0070680_100027734
1015 Ga0068868_100153899
1016 Ga0070660_100012465
1017 Ga0070660_100032761
1018 Ga0070660_100161342
1019 Ga0070660_100266824
1020 Ga0070691_10000243
1021 Ga0070661_100000114
1022 Ga0070661_100007497
1023 Ga0070661_100017301
1024 Ga0070661_100046420
1025 Ga0070661_100096305
1026 Ga0070661_100274019
1027 Ga0070661_100278344
1028 Ga0070668_100072978
1029 Ga0070668_100117672
1030 Ga0070668_100207109
1031 Ga0070669_100104748
1032 Ga0070669_100322345
1033 Ga0070675_100004750
1034 Ga0070675_100101476
1035 Ga0070671_100013084
1036 Ga0070671_100021902
1037 Ga0070671_100051862
1038 Ga0070671_100165356
1039 Ga0070674_100009553
1040 Ga0070674_100116810
1041 Ga0070674_100231453
1042 Ga0070673_100011648
1043 Ga0070673_100076810
1044 Ga0070673_100303197
1045 Ga0070659_100006154
1046 Ga0070659_100027988
1047 Ga0070659_100029874
1048 Ga0070659_100036187
1049 Ga0070667_100051710
1050 Ga0070667_100060515
1051 Ga0070667_100097175
1052 Ga0070714_100051080
1053 Ga0070714_100106170
1054 Ga0070714_100204275
1055 Ga0070663_100056616
1056 Ga0070663_100141264
1057 Ga0070663_100275765
1058 Ga0070678_100011116
1059 Ga0070678_100026944
1060 Ga0070678_100142327
1061 Ga0070662_100005842
1062 Ga0070662_100016221
1063 Ga0070662_100016262
1064 Ga0070662_100076892
1065 Ga0070662_100154096
1066 Ga0070662_100191359
1067 Ga0070662_100261332
1068 Ga0070681_10001905
1069 Ga0068867_100022953
1070 Ga0068867_100044237
1071 Ga0068867_100097356
1072 Ga0070679_100000084
1073 Ga0070679_100065796
1074 Ga0070679_100197098
1075 Ga0070679_100400011
1076 Ga0070684_100099624
1077 Ga0068853_100007461
1078 Ga0068853_100303291
1079 Ga0068853_100518696
1080 Ga0070672_100001479
1081 Ga0070672_100027362
1082 Ga0070672_100056292
1083 Ga0070665_100004829
1084 Ga0070665_100025110
1085 Ga0070665_100133769
1086 Ga0070665_100203399
1087 Ga0070665_100225279
1088 Ga0070665_100236395
1089 Ga0068855_100510988
1090 Ga0070664_100005462
1091 Ga0070664_100014140
1092 Ga0070664_100030890
1093 Ga0070664_100194836
1094 Ga0070664_100372620
1095 Ga0070664_100472244
1096 Ga0070664_100543573
1097 Ga0068857_100012566
1098 Ga0068857_100061853
1099 Ga0068857_100270538
1100 Ga0068854_100003724
1101 Ga0068856_100024453
1102 Ga0068856_100077106
1103 Ga0068856_100268147
1104 Ga0068856_100653785
1105 Ga0068852_100005727
1106 Ga0068852_100007056
1107 Ga0068852_100122427
1108 Ga0068852_100308098
1109 Ga0068852_100397856
1110 Ga0068859_100040456
1111 Ga0068864_100000487
1112 Ga0068864_100043457
1113 Ga0068864_100078492
1114 Ga0068866_10007066
1115 Ga0068851_10009633
1116 Ga0068851_10022060
1117 Ga0068851_10164207
1118 Ga0068863_100060266
1119 Ga0068858_100030052
1120 Ga0068860_100134317
1121 Ga0068862_100541626
1122 Ga0081540_1028100
1123 Ga0081539_10000038
1124 Ga0075365_10015038
1125 Ga0075365_10107863
1126 Ga0075368_10014911
1127 Ga0075367_10001368
1128 Ga0075367_10021130
1129 Ga0075367_10070893
1130 Ga0075369_10003078
1131 Ga0075369_10039051
1132 Ga0075369_10039943
1133 Ga0075370_10176661
1134 Ga0068871_100239414
1135 Ga0068865_100285155
1136 Ga0097620_100040456
1137 Ga0105251_10029906
1138 Ga0105251_10034833
1139 Ga0105244_10147377
1140 Ga0105240_10021229
1141 Ga0105240_10124835
1142 Ga0105240_10219562
1143 Ga0111539_10119724
1144 Ga0111539_10721864
1145 Ga0105245_10031632
1146 Ga0105245_10183385
1147 Ga0105245_10202837
1148 Ga0105245_10322338
1149 Ga0105247_10125008
1150 Ga0105243_10022964
1151 Ga0105243_10183355
1152 Ga0105241_10101119
1153 Ga0105241_10106735
1154 Ga0105242_10112065
1155 Ga0105242_10382834
1156 Ga0105242_10765998
1157 Ga0105248_10001528
1158 Ga0105248_10019256
1159 Ga0105248_10023155
1160 Ga0105248_10027431
1161 Ga0105248_10286789
1162 Ga0105248_10291577
1163 Ga0105248_10613417
1164 Ga0105237_10053612
1165 Ga0105237_10392298
1166 Ga0105238_10006858
1167 Ga0105238_10079714
1168 Ga0105249_10152102
1169 Ga0105249_10160730
1170 Ga0105249_10460336
1171 Ga0105239_10039797
1172 Ga0105239_10075638
1173 Ga0105239_10275202
1174 Ga0105239_10379452
1175 Ga0157373_10024150
1176 Ga0157373_10034558
1177 Ga0157373_10194325
1178 Ga0157371_10005134
1179 Ga0157371_10024538
1180 Ga0157371_10059690
1181 Ga0157371_10124599
1182 Ga0157371_10180469
1183 Ga0157371_10307491
1184 Ga0157371_10405516
1185 Ga0157370_10005211
1186 Ga0157370_10102902
1187 Ga0157369_10010073
1188 Ga0157369_10058693
1189 Ga0157369_10120004
1190 Ga0157369_10126147
1191 Ga0157369_10175271
1192 Ga0157369_10187962
1193 Ga0157369_10308625
1194 Ga0157369_10324562
1195 Ga0157374_10316770
1196 Ga0157378_10058402
1197 Ga0157378_10182842
1198 Ga0157378_10483429
1199 Ga0163162_10387233
1200 Ga0157372_10026759
1201 Ga0163163_10047514
1202 Ga0163163_10212719
1203 Ga0157380_10505272
1204 Ga0157379_10422937
1205 Ga0157376_10048842
1206 Ga0163161_10026938
1207 Ga0214544_1000017
1208 Ga0214542_1000006
1209 Ga0214543_1000014
1210 Ga0213873_10000013
1211 Ga0213876_10000072
1212 Ga0213876_10006514
1213 Ga0213876_10010220
1214 Ga0209563_101879
1215 Ga0209437_100040
1216 Ga0207425_1000018
1217 Ga0209759_1003548
1218 Ga0209129_1000026
1219 Ga0209129_1001054
1220 Ga0209129_1005221
1221 Ga0209233_1000051
1222 Ga0209565_1000118
1223 Ga0209673_1001150
1224 Ga0209673_1015890
1225 Ga0209673_1021733
1226 Ga0209130_1001632
1227 Ga0209675_1011805
1228 Ga0209025_1000035
1229 Ga0209025_1001871
1230 Ga0209025_1009341
1231 Ga0209564_1005948
1232 Ga0209564_1007331
1233 Ga0209758_1000040
1234 Ga0209758_1000835
1235 Ga0209758_1011719
1236 Ga0209758_1018810
1237 Ga0209758_1033961
1238 Ga0209758_1035188
1239 Ga0209050_1000039
1240 Ga0209256_1011665
1241 Ga0209256_1025930
1242 Ga0207426_1000182
1243 Ga0207426_1001984
1244 Ga0207426_1002244
1245 Ga0209257_1000051
1246 Ga0209257_1000506
1247 Ga0207697_10027588
1248 Ga0207656_10006046
1249 Ga0207656_10007905
1250 Ga0207682_10006032
1251 Ga0207682_10032212
1252 Ga0207688_10002384
1253 Ga0207680_10005418
1254 Ga0207680_10044350
1255 Ga0207647_10000769
1256 Ga0207647_10001347
1257 Ga0207647_10002711
1258 Ga0207647_10021746
1259 Ga0207647_10145577
1260 Ga0207705_10009397
1261 Ga0207705_10016966
1262 Ga0207705_10086738
1263 Ga0207705_10092501
1264 Ga0207705_10103663
1265 Ga0207705_10118753
1266 Ga0207705_10121531
1267 Ga0207705_10158675
1268 Ga0207707_10005427
1269 Ga0207695_10009389
1270 Ga0207695_10088474
1271 Ga0207695_10098981
1272 Ga0207671_10267299
1273 Ga0207660_10000951
1274 Ga0207660_10011228
1275 Ga0207660_10065921
1276 Ga0207662_10060289
1277 Ga0207657_10003509
1278 Ga0207657_10007321
1279 Ga0207657_10034689
1280 Ga0207657_10048872
1281 Ga0207657_10081899
1282 Ga0207657_10083170
1283 Ga0207657_10096625
1284 Ga0207657_10281457
1285 Ga0207649_10000011
1286 Ga0207649_10005260
1287 Ga0207649_10010641
1288 Ga0207649_10018955
1289 Ga0207649_10200544
1290 Ga0207649_10235117
1291 Ga0207652_10000001
1292 Ga0207652_10000002
1293 Ga0207652_10141214
1294 Ga0207652_10167226
1295 Ga0207681_10162389
1296 Ga0207681_10182879
1297 Ga0207694_10012853
1298 Ga0207694_10026522
1299 Ga0207650_10068784
1300 Ga0207650_10169574
1301 Ga0207650_10374292
1302 Ga0207659_10018045
1303 Ga0207659_10019430
1304 Ga0207687_10055397
1305 Ga0207700_10122472
1306 Ga0207664_10644988
1307 Ga0207644_10001523
1308 Ga0207644_10013384
1309 Ga0207644_10030632
1310 Ga0207644_10095824
1311 Ga0207644_10139090
1312 Ga0207690_10001973
1313 Ga0207690_10005548
1314 Ga0207690_10014564
1315 Ga0207690_10028343
1316 Ga0207690_10038777
1317 Ga0207690_10074543
1318 Ga0207690_10104614
1319 Ga0207690_10242763
1320 Ga0207690_10243789
1321 Ga0207706_10002853
1322 Ga0207706_10005711
1323 Ga0207706_10016430
1324 Ga0207706_10024238
1325 Ga0207706_10025153
1326 Ga0207706_10078497
1327 Ga0207706_10148231
1328 Ga0207706_10464812
1329 Ga0207686_10010042
1330 Ga0207669_10016893
1331 Ga0207669_10053759
1332 Ga0207669_10158452
1333 Ga0207669_10213230
1334 Ga0207691_10004286
1335 Ga0207691_10012677
1336 Ga0207691_10013663
1337 Ga0207691_10045971
1338 Ga0207691_10158714
1339 Ga0207711_10000345
1340 Ga0207711_10004198
1341 Ga0207711_10045263
1342 Ga0207711_10051289
1343 Ga0207711_10059324
1344 Ga0207711_10161344
1345 Ga0207711_10223058
1346 Ga0207711_10242777
1347 Ga0207689_10090834
1348 Ga0207661_10014283
1349 Ga0207661_10027319
1350 Ga0207661_10352254
1351 Ga0207661_10657162
1352 Ga0207679_10013785
1353 Ga0207679_10032616
1354 Ga0207679_10056492
1355 Ga0207679_10085503
1356 Ga0207667_10016893
1357 Ga0207667_10257889
1358 Ga0207651_10013678
1359 Ga0207651_10014971
1360 Ga0207651_10017450
1361 Ga0207651_10289845
1362 Ga0207712_10089157
1363 Ga0207668_10180833
1364 Ga0207640_10002725
1365 Ga0207640_10046671
1366 Ga0207640_10193830
1367 Ga0207658_10109899
1368 Ga0207658_10309064
1369 Ga0207677_10036297
1370 Ga0207703_10038455
1371 Ga0207639_10009043
1372 Ga0207639_10188416
1373 Ga0207639_10281952
1374 Ga0207678_10002237
1375 Ga0207678_10020591
1376 Ga0207678_10037661
1377 Ga0207678_10083862
1378 Ga0207702_10017005
1379 Ga0207702_10063343
1380 Ga0207702_10122322
1381 Ga0207702_10170427
1382 Ga0207702_10247017
1383 Ga0207641_10102045
1384 Ga0207641_10281469
1385 Ga0207648_10005937
1386 Ga0207648_10016189
1387 Ga0207648_10121101
1388 Ga0207676_10014056
1389 Ga0207676_10017609
1390 Ga0207674_10005682
1391 Ga0207674_10009767
1392 Ga0207674_10068073
1393 Ga0207674_10264394
1394 Ga0207675_100120056
1395 Ga0207683_10024569
1396 Ga0207683_10040908
1397 Ga0207683_10094928
1398 Ga0207698_10005661
1399 Ga0207698_10066124
1400 Ga0207698_10070482
1401 Ga0207698_10078488
1402 Ga0207698_10329012
1403 Ga0209371_1030682
1404 Ga0209974_10069589
1405 Ga0268266_10060804
1406 Ga0268265_10604031
1407 Ga0268264_10105978
1408 Ga0307515_10017859
1409 Ga0307515_10018412
1410 Ga0307515_10324848
1411 Ga0268256_1034886
1412 Ga0307511_10066775
1413 Ga0307513_10185070
1414 Ga0307408_100215159
1415 Ga0307408_100231749
1416 Ga0307508_10103537
1417 Ga0307405_10014708
1418 Ga0307405_10015120
1419 Ga0307405_10034239
1420 Ga0307413_10011924
1421 Ga0307413_10033469
1422 Ga0307413_10211771
1423 Ga0307410_10000658
1424 Ga0307410_10003486
1425 Ga0307410_10059009
1426 Ga0307410_10062340
1427 Ga0307410_10104777
1428 Ga0307410_10134767
1429 Ga0307410_10141484
1430 Ga0307410_10558877
1431 Ga0307406_10007490
1432 Ga0307406_10036793
1433 Ga0307407_10038425
1434 Ga0307407_10088067
1435 Ga0307407_10170308
1436 Ga0307407_10270566
1437 Ga0307412_10017634
1438 Ga0307412_10040067
1439 Ga0307412_10046028
1440 Ga0307412_10226097
1441 Ga0307409_100016764
1442 Ga0307409_100115037
1443 Ga0307409_100146291
1444 Ga0307409_100299651
1445 Ga0307409_100616950
1446 Ga0307416_100052040
1447 Ga0307416_100129195
1448 Ga0307414_10020719
1449 Ga0307414_10026608
1450 Ga0307414_10039495
1451 Ga0307414_10042888
1452 Ga0307414_10078994
1453 Ga0307414_10101051
1454 Ga0307414_10461471
1455 Ga0307411_10003235
1456 Ga0307411_10006548
1457 Ga0307411_10007485
1458 Ga0307411_10020260
1459 Ga0307411_10034980
1460 Ga0307411_10060021
1461 Ga0307411_10224071
1462 Ga0307415_100003615
1463 Ga0307415_100184902
1464 Ga0307510_10000007
1465 Ga0373936_0012860
1466 Ga0373946_0070630
1467 Ga0373946_0090533
1468 Ga0395899_0000007
1469 Ga0395899_0006239
1470 Ga0395899_0067713
1471 Ga0395899_0092635
1472 Ga0395899_0122140
1473 Ga0395900_0000026
1474 Ga0395900_0000849
1475 Ga0395900_0020627
1476 Ga0395900_0029935
1477 Ga0395900_0057163
1478 Ga0395900_0068757
1479 Ga0395900_0100913
1480 Ga0395900_0105335
1481 Ga0395900_0116182
1482 Ga0395900_0123764
1483 Ga0395900_0128884
1484 Ga0395900_0130943
1485 Ga0395900_0235325
1486 Ga0395900_0281293
1487 Ga0395900_0339800
1488 Ga0395900_0503779
1489 Ga0395898_0000085
1490 Ga0395898_0035607
1491 Ga0395898_0047421
1492 Ga0395898_0072874
1493 Ga0395898_0216568
1494 Ga0395905_0000519
1495 Ga0395905_0002257
1496 Ga0395905_0005730
1497 Ga0395905_0009882
1498 Ga0395905_0013679
1499 Ga0395905_0030896
1500 Ga0395905_0047940
1501 Ga0395905_0055365
1502 Ga0395905_0102121
1503 Ga0395905_0111374
1504 Ga0395905_0152432
1505 Ga0395905_0159507
1506 Ga0395905_0161390
1507 Ga0395905_0201968
1508 Ga0395905_0225800
1509 Ga0395905_0277318
1510 Ga0395905_0308493
1511 Ga0395905_0342111
1512 Ga0395905_0365567
1513 Ga0395905_0372548
1514 Ga0436364_1438839
1515 Ga0395901_0006625
1516 Ga0395901_0023196
1517 Ga0395901_0046562
1518 Ga0395901_0060245
1519 Ga0395901_0108404
1520 Ga0395901_0178969
1521 Ga0395901_0260621
1522 Ga0395901_0285899
1523 Ga0395901_0394036
1524 Ga0395901_0522312
1525 Ga0395901_0684975
1526 Ga0436365_0044388
1527 Ga0436365_0256427
1528 Ga0436362_1051662
1529 Ga0439436_0038446
1530 Ga0439461_0000171
1531 Ga0439465_0000356
1532 Ga0451789_0805958
1533 Ga0439431_0000437
1534 Ga0439431_0008149
1535 Ga0439431_0047518
1536 Ga0439442_000878
1537 Ga0439445_0000176
1538 Ga0439432_000215
1539 Ga0439452_012403
1540 Ga0439455_0005448
1541 Ga0450907_008880
1542 Ga0439458_0000153
1543 Ga0439434_0010753
1544 Ga0439435_0106492
1545 Ga0466969_0001617
1546 Ga0466969_0025519
1547 Ga0466969_0183248
1548 Ga0466966_0000143
1549 Ga0466966_0000492
1550 Ga0466966_0033607
1551 Ga0466966_0057894
1552 Ga0466961_0000301
1553 Ga0466961_0000868
1554 Ga0466961_0047964
1555 Ga0466961_0054737
1556 Ga0466963_0007629
1557 Ga0466963_0028365
1558 Ga0466963_0039798
1559 Ga0466963_0058547
1560 Ga0466963_0090938
1561 Ga0466963_0179827
1562 Ga0453684_0224176
1563 Ga0466971_0000632
1564 Ga0466957_0013744
1565 Ga0466957_0024784
1566 Ga0466957_0033496
1567 Ga0466957_0056737
1568 Ga0466957_0087640
1569 Ga0466957_0107267
1570 Ga0466957_0177495
1571 Ga0466960_0031638
1572 Ga0466960_0115223
1573 Ga0466959_0000511
1574 Ga0466959_0035270
1575 Ga0466959_0067777
1576 Ga0466959_0194664
1577 Ga0451576_0157512
1578 Ga0466958_0000818
1579 Ga0466958_0003818
1580 Ga0466958_0014464
1581 Ga0466958_0058042
1582 Ga0466958_0106886
1583 Ga0466958_0340064
1584 Ga0466967_0016590
1585 Ga0466967_0046786
1586 Ga0466967_0077393
1587 Ga0466967_0078287
1588 Ga0466967_0132819
1589 Ga0466967_0179519
1590 Ga0466967_0247942
1591 Ga0466967_0369298
1592 Ga0495617_000003
1593 Ga0495592_0008744
1594 Ga0495603_0136563
1595 Ga0495590_0037793
1596 Ga0495591_003143
1597 Ga0495629_0035464
1598 Ga0495638_0000552
1599 Ga0495638_0001206
1600 Ga0495638_0040724
1601 Ga0495638_0058522
1602 Ga0495638_0060759
1603 Ga0495638_0075402
1604 Ga0495651_0017339
1605 Ga0495653_0020018
1606 Ga0495653_0328559
1607 Ga0495650_0000069
1608 Ga0495650_0000240
1609 Ga0495650_0000417
1610 Ga0495650_0061970
1611 Ga0495582_0004825
1612 Ga0495605_0000287
1613 Ga0495662_0023700
1614 Ga0495664_0009074
1615 Ga0495584_0000026
1616 Ga0495585_0001974
1617 Ga0495585_0129036
1618 Ga0495596_0001769
1619 Ga0495607_0001107
1620 Ga0495607_0009814
1621 Ga0495583_0000141
1622 Ga0495583_0016351
1623 Ga0495606_0000147
1624 Ga0495606_0001676
1625 Ga0495606_0004031
1626 Ga0495606_0011517
1627 Ga0495606_0113420
1628 Ga0495608_0004834
1629 Ga0495610_0000003
1630 Ga0495610_0000378
1631 Ga0495610_0001931
1632 Ga0495610_0008022
1633 Ga0495610_0083620
1634 Ga0495618_0071975
1635 Ga0495620_0005035
1636 Ga0495628_0197997
1637 Ga0495630_0010628
1638 Ga0495631_0009499
1639 Ga0495631_0163185
1640 Ga0495637_0002413
1641 Ga0495643_0000051
1642 Ga0495643_0003645
1643 Ga0495643_0003725
1644 Ga0495643_0034138
1645 Ga0495644_0149282
1646 Ga0495648_0002396
1647 Ga0495648_0008443
1648 Ga0495648_0015666
1649 Ga0495648_0079901
1650 Ga0495666_0002451
1651 Ga0495642_0004326
1652 Ga0495652_0018649
1653 Ga0495654_0000285
1654 Ga0495654_0009943
1655 Ga0495665_0005192
1656 Ga0495640_0029546
1657 Ga0495587_0002021
1658 Ga0495609_0143046
1659 Ga0495622_0000450
1660 Ga0495633_0029699
1661 Ga0495633_0124787
1662 Ga0495656_0071538
1663 Ga0495668_0004440
1664 Ga0495668_0015655
1665 Ga0495668_0210111
1666 Ga0495625_0000857
1667 Ga0495625_0003460
1668 Ga0495625_0010507
1669 Ga0495625_0014409
1670 Ga0495625_0050255
1671 Ga0495625_0141659
1672 Ga0495659_0005556
1673 Ga0495661_0004617
1674 Ga0495661_0004853
1675 Ga0495661_0011766
1676 Ga0495661_0027910
1677 Ga0495588_0000062
1678 Ga0495588_0002924
1679 Ga0495588_0122854
1680 Ga0495657_0022634
1681 Ga0495599_0038021
1682 Ga0495646_0015977
1683 Ga0495669_0059944
1684 Ga0495613_0006859
1685 Ga0495624_0058704
1686 Ga0495671_0001894
1687 Ga0495649_0002968
1688 Ga0495649_0072327
1689 Ga0495589_0000991
1690 Ga0495589_0009545
1691 Ga0495600_0005267
1692 Ga0495660_0000101
1693 Ga0495660_0004120
1694 Ga0495660_0129408
1695 Ga0495581_0018204
1696 Ga0495672_0000030
1697 Ga0495672_0000348
1698 Ga0495672_0000663
1699 Ga0495676_0021038
1700 Ga0495683_0009372
1701 Ga0495683_0013024
1702 Ga0495683_0019971
1703 Ga0495687_000036
1704 Ga0495687_000938
1705 Ga0495687_010251
1706 Ga0495675_0000605
1707 Ga0495677_0000422
1708 Ga0495677_0014289
1709 Ga0495679_001358
1710 Ga0495679_009161
1711 Ga0495679_011495
1712 Ga0495673_0000016
1713 Ga0495673_0001751
1714 Ga0495673_0008711
1715 Ga0495684_0106004
1716 Ga0495686_0018455
1717 Ga0495593_0001577
1718 Ga0495614_0003703
1719 Ga0495626_0000347
1720 Ga0495626_0009286
1721 Ga0496100_0109877
1722 Ga0496101_0001508
1723 Ga0496101_0003840
1724 Ga0496101_0059856
1725 Ga0496102_0001994
1726 Ga0496102_0074546
1727 Ga0496103_0043549
1728 Ga0496103_0050994
1729 Ga0496104_0158905
1730 Ga0496104_0335616
1731 Ga0496105_0033646
1732 Ga0496105_0181017
1733 Ga0496106_0001460
1734 Ga0496106_0009518
1735 Ga0496106_0022804
1736 Ga0496106_0232170
1737 Ga0496107_0012251
1738 Ga0496107_0014479
1739 Ga0496107_0022881
1740 Ga0496107_0137584
1741 Ga0496108_0015084
1742 Ga0496108_0015113
1743 Ga0496108_0177142
1744 Ga0496109_0001761
1745 Ga0496109_0009942
1746 Ga0496110_0007368
1747 Ga0496110_0009390
1748 Ga0496110_0033799
1749 Ga0496111_0003665
1750 Ga0496111_0025636
1751 Ga0496111_0035838
1752 Ga0496112_0043890
1753 Ga0496112_0075067
1754 Ga0496113_0011054
1755 Ga0496113_0012540
1756 Ga0496113_0136283
1757 Ga0496113_0183241
1758 Ga0496114_0258027
1759 Ga0496115_0001431
1760 Ga0496116_0000097
1761 Ga0496116_0067861
1762 Ga0496116_0087427
1763 Ga0496116_0088894
1764 Ga0496117_0002771
1765 Ga0496117_0037227
1766 Ga0496118_0000553
1767 Ga0496119_0045030
1768 Ga0496120_0153548
1769 Ga0496121_0092538
1770 Ga0496121_0224326
1771 Ga0496122_0090059
1772 Ga0496122_0096670
1773 Ga0496123_0054996
1774 Ga0496123_0055342
1775 Ga0496123_0096186
1776 Ga0496123_0222039
1777 Ga0496124_0000610
1778 Ga0496124_0017766
1779 Ga0496124_0047966
1780 Ga0496124_0238711
1781 Ga0496125_0112157
1782 Ga0496125_0130922
1783 Ga0496126_0000119
1784 Ga0496126_0006673
1785 Ga0496126_0037392
1786 Ga0496126_0087057
1787 Ga0496126_0129141
1788 Ga0496126_0234917
1789 Ga0495678_000040
1790 Ga0495678_062128
1791 Ga0501033_0000351
1792 Ga0501033_0002610
1793 Ga0501033_0063214
1794 Ga0501034_0506027
1795 Ga0501047_0306747
1796 Ga0501067_0115013
1797 Ga0501068_0203191
1798 Ga0501080_0077504
1799 Ga0501035_0000263
1800 Ga0501044_0004321
1801 nmdc:mga03683_130406_c1
1802 nmdc:mga03n38_82242_c1
1803 nmdc:mga0yw44_1655_c1
1804 nmdc:mga0k408_142822_c1
1805 nmdc:mga0k408_17241_c1
1806 nmdc:mga07m45_32184_c2
1807 nmdc:mga07m45_97021_c1
1808 nmdc:mga08y16_247919_c1
1809 nmdc:mga0sz30_2903_c2
1810 Ga0500635_0010287
1811 Ga0500578_0167329
1812 Ga0500583_0017161
1813 Ga0500566_0003407
1814 Ga0500641_0052903
1815 Ga0500660_095581
1816 Ga0500554_001873
1817 Ga0500556_0004789
1818 Ga0500608_000133
1819 Ga0500608_034018
1820 Ga0500618_000071
1821 Ga0500658_0001144
1822 Ga0500568_0027058
1823 Ga0500586_000126
1824 Ga0500586_000471
1825 Ga0500616_0001263
1826 Ga0500616_0012191
1827 Ga0500620_000371
1828 Ga0500622_0000746
1829 Ga0500622_0005146
1830 Ga0500622_0008310
1831 Ga0500630_074893
1832 Ga0500637_0000887
1833 Ga0500611_031464
1834 Ga0500645_002368
1835 Ga0466962_0000509
1836 Ga0466962_0004059
1837 Ga0466962_0026394
1838 2793280811
1839 2509117348
1840 2511185417
1841 2513595238
1842 2513607818
1843 2513866684
1844 2513999101
1845 2516023237
1846 2523470108
1847 2585155360
1848 2585198924
1849 2585202323
1850 2585204233
1851 2585228220
1852 2585258652
1853 2585265893
1854 2585390083
1855 2585396962
1856 2585401508
1857 2585821202
1858 2585842611
1859 2599335336
1860 2599936596
1861 2643748261
1862 2643779075
1863 2643858173
1864 2643927642
1865 2644003986
1866 2644004093
1867 2644128424
1868 2644191593
1869 2644508006
1870 2657683201
1871 2719638275
1872 2738799900
1873 2738829674
1874 2739153470
1875 2739195390
1876 2739321866
1877 2739340107
1878 2739350797
1879 2739791656
1880 2753565401
1881 2758638063
1882 2778176588
1883 2792584226
1884 2792622618
1885 2792628462
1886 2804751411
1887 2819539583
1888 2819648791
1889 2821448476
1890 2842486329
1891 2842524845
1892 2842927040
1893 2844534164
1894 2857365311
1895 2883093562
1896 2891051301
1897 2896185665
1898 2909048280
1899 2913297380
1900 2919169863
1901 2923556911
1902 2977867993
1903 2978972280
1904 2984590510
1905 2996887498
1906 3000140992
1907 3005457138
1908 3005458515
1909 8005258831
1910 8005322025
1911 8049293984
1912 8054465120

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

291

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8504 1 262
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8317 2 265
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8255 1 265
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.823 51 258
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8194 1 265
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9355 11 261 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9306 2 266 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9221 11 266 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9219 1 265 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9152 1 265 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0C5VSP3-F1-model_v4 ABC-type sugar transport system, permease component 0.9592 9 274 GO:0005886
GO:0055085
AF-A0A2M8GZ55-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9584 2 274 GO:0005886
GO:0055085
AF-A0A1M5G0H6-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9578 9 274 GO:0005886
GO:0055085
AF-A0A095WVZ1-F1-model_v4 Permease 0.9572 8 272 GO:0005886
GO:0055085
AF-A8F371-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9563 49 274 GO:0005886
GO:0055085

Map