F486759

General Info

Members Datasets Scaffolds Average Seq Length
957 362 1914 65

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100907877|Ga0070668_1009078772
Length 75
Sequence MRRGIHSGEMSMKKLNKSRDQLLTELRSAYEGGASIRSLVASTGRSYGSVHSMLRESGTTMRSRGGPNHRSRRAS

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
245 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
246 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
362 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.96
Nodule 0.1
Rhizoplane 10.45
Rhizosphere 64.68
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100907877 3300005347 Bacteria 788
2 CNXas_1006585 3300000545 Bacteria 819
3 CNXas_1008855 3300000545 Bacteria 710
4 JGI24747J21853_1002039 3300001978 Bacteria 1594
5 JGI24739J22299_10047155 3300001989 Bacteria 1407
6 JGI24737J22298_10024376 3300001990 Bacteria 1916
7 JGI24737J22298_10056757 3300001990 Bacteria 1183
8 JGI24750J21931_1001734 3300002070 Bacteria 2662
9 JGI24745J21846_1045985 3300002073 Bacteria 547
10 JGI24738J21930_10007182 3300002075 Bacteria 2581
11 JGI24738J21930_10039933 3300002075 Bacteria 953
12 JGI24744J21845_10001385 3300002077 Bacteria 4804
13 JGI24744J21845_10015867 3300002077 Bacteria 1502
14 JGI24744J21845_10021647 3300002077 Bacteria 1264
15 JGI24034J26672_10026934 3300002239 Bacteria 924
16 JGI24034J26672_10031550 3300002239 Bacteria 865
17 JGI24742J22300_10000717 3300002244 Bacteria 5027
18 JGI24742J22300_10006185 3300002244 Bacteria 1975
19 JGI24751J29686_10011577 3300002459 Bacteria 1818
20 rootH2_10104888 3300003320 Bacteria 3693
21 Ga0055528_1058316 3300003790 Bacteria 741
22 Ga0055540_1005419 3300003792 Bacteria 5364
23 Ga0055540_1010561 3300003792 Bacteria 3062
24 Ga0055540_1022945 3300003792 Bacteria 1583
25 Ga0070658_10511111 3300005327 Bacteria 1038
26 Ga0070676_10138685 3300005328 Bacteria 1546
27 Ga0070676_11400611 3300005328 Bacteria 536
28 Ga0070683_100160223 3300005329 Bacteria 2135
29 Ga0070683_100557077 3300005329 Bacteria 1096
30 Ga0070690_100011802 3300005330 Bacteria 5123
31 Ga0070690_100577413 3300005330 Bacteria 851
32 Ga0070690_101155232 3300005330 Bacteria 616
33 Ga0070670_100797397 3300005331 Bacteria 853
34 Ga0070677_10196921 3300005333 Bacteria 970
35 Ga0068869_100035051 3300005334 Bacteria 3555
36 Ga0070666_10015067 3300005335 Bacteria 4927
37 Ga0070666_10105893 3300005335 Bacteria 1942
38 Ga0070682_100313200 3300005337 Bacteria 1156
39 Ga0070682_100541044 3300005337 Bacteria 910
40 Ga0068868_100043386 3300005338 Bacteria 3513
41 Ga0068868_100119195 3300005338 Bacteria 2151
42 Ga0068868_100229701 3300005338 Bacteria 1556
43 Ga0068868_100384606 3300005338 Bacteria 1208
44 Ga0070660_100241413 3300005339 Bacteria 1472
45 Ga0070660_100788820 3300005339 Bacteria 799
46 Ga0070689_100012630 3300005340 Bacteria 6090
47 Ga0070689_100128859 3300005340 Bacteria 2027
48 Ga0070691_10012640 3300005341 Bacteria 3866
49 Ga0070687_100127670 3300005343 Bacteria 1464
50 Ga0070692_10142548 3300005345 Bacteria 1358
51 Ga0070692_10244629 3300005345 Bacteria 1071
52 Ga0070668_100001153 3300005347 Bacteria 18632
53 Ga0070668_100067301 3300005347 Bacteria 2782
54 Ga0070668_100137005 3300005347 Bacteria 1970
55 Ga0070668_100610676 3300005347 Bacteria 955
56 Ga0070668_102161898 3300005347 Bacteria 514
57 Ga0070669_100823497 3300005353 Bacteria 790
58 Ga0070669_101243288 3300005353 Bacteria 644
59 Ga0070675_100094838 3300005354 Bacteria 2504
60 Ga0070671_100090946 3300005355 Bacteria 2555
61 Ga0070671_100334649 3300005355 Bacteria 1291
62 Ga0070671_100621845 3300005355 Bacteria 934
63 Ga0070671_101613551 3300005355 Bacteria 575
64 Ga0070674_100105985 3300005356 Bacteria 2056
65 Ga0070674_100154601 3300005356 Bacteria 1734
66 Ga0070674_101264101 3300005356 Bacteria 657
67 Ga0070673_100311610 3300005364 Bacteria 1388
68 Ga0070673_100729388 3300005364 Bacteria 911
69 Ga0070688_100130511 3300005365 Bacteria 1695
70 Ga0070688_100262971 3300005365 Bacteria 1233
71 Ga0070688_100321842 3300005365 Bacteria 1124
72 Ga0070659_100319662 3300005366 Bacteria 1297
73 Ga0070659_100432021 3300005366 Bacteria 1115
74 Ga0070667_100001656 3300005367 Bacteria 19903
75 Ga0070667_100018832 3300005367 Bacteria 5726
76 Ga0070667_100094173 3300005367 Bacteria 2580
77 Ga0070667_100342810 3300005367 Bacteria 1352
78 Ga0070703_10044200 3300005406 Bacteria 1400
79 Ga0070703_10046940 3300005406 Bacteria 1367
80 Ga0070714_100019331 3300005435 Bacteria 5546
81 Ga0070714_100270119 3300005435 Bacteria 1577
82 Ga0070713_100140548 3300005436 Bacteria 2138
83 Ga0070710_10000684 3300005437 Bacteria 16093
84 Ga0070710_10184016 3300005437 Bacteria 1310
85 Ga0070710_10199442 3300005437 Bacteria 1263
86 Ga0070701_10001739 3300005438 Bacteria 8197
87 Ga0070701_11373889 3300005438 Bacteria 507
88 Ga0070711_100019602 3300005439 Bacteria 4341
89 Ga0070711_100178565 3300005439 Bacteria 1624
90 Ga0070711_100238733 3300005439 Bacteria 1420
91 Ga0070711_101778616 3300005439 Bacteria 541
92 Ga0070705_100009399 3300005440 Bacteria 4861
93 Ga0070705_100537786 3300005440 Bacteria 893
94 Ga0070700_100005646 3300005441 Bacteria 6636
95 Ga0070694_100003997 3300005444 Bacteria 8827
96 Ga0070708_100472589 3300005445 Bacteria 1183
97 Ga0070663_100017710 3300005455 Bacteria 4655
98 Ga0070663_100091891 3300005455 Bacteria 2250
99 Ga0070663_100173383 3300005455 Bacteria 1669
100 Ga0070663_100608395 3300005455 Bacteria 920
101 Ga0070663_101092455 3300005455 Bacteria 697
102 Ga0070678_100002898 3300005456 Bacteria 9502
103 Ga0070678_100301620 3300005456 Bacteria 1361
104 Ga0070678_101501884 3300005456 Bacteria 631
105 Ga0070662_100003167 3300005457 Bacteria 10228
106 Ga0070662_100320122 3300005457 Bacteria 1265
107 Ga0068867_100000819 3300005459 Bacteria 20982
108 Ga0068867_100193456 3300005459 Bacteria 1624
109 Ga0070685_10842424 3300005466 Bacteria 679
110 Ga0070707_101495994 3300005468 Bacteria 642
111 Ga0070679_100565197 3300005530 Bacteria 1081
112 Ga0070684_100169935 3300005535 Bacteria 1980
113 Ga0070697_101536817 3300005536 Bacteria 595
114 Ga0068853_100007752 3300005539 Bacteria 8608
115 Ga0068853_100144478 3300005539 Bacteria 2137
116 Ga0070672_100763514 3300005543 Bacteria 849
117 Ga0070686_100051532 3300005544 Bacteria 2621
118 Ga0070695_100022299 3300005545 Bacteria 3884
119 Ga0070695_100106176 3300005545 Bacteria 1899
120 Ga0070696_100039420 3300005546 Bacteria 3262
121 Ga0070696_100416840 3300005546 Bacteria 1053
122 Ga0070693_100113612 3300005547 Bacteria 1670
123 Ga0070665_100003448 3300005548 Bacteria 16866
124 Ga0070665_100013763 3300005548 Bacteria 8139
125 Ga0070665_100016676 3300005548 Bacteria 7361
126 Ga0070665_101284657 3300005548 Bacteria 742
127 Ga0070704_100037105 3300005549 Bacteria 3326
128 Ga0070704_100042439 3300005549 Bacteria 3146
129 Ga0070704_102030485 3300005549 Bacteria 534
130 Ga0068855_100814267 3300005563 Bacteria 992
131 Ga0068854_100000301 3300005578 Bacteria 32731
132 Ga0068854_100207300 3300005578 Bacteria 1544
133 Ga0068854_100400204 3300005578 Bacteria 1136
134 Ga0068854_100483994 3300005578 Bacteria 1039
135 Ga0068854_100575676 3300005578 Bacteria 958
136 Ga0068856_100495410 3300005614 Bacteria 1243
137 Ga0068856_102160246 3300005614 Bacteria 566
138 Ga0070702_100000480 3300005615 Bacteria 14317
139 Ga0070702_100018901 3300005615 Bacteria 3582
140 Ga0070702_100088528 3300005615 Bacteria 1872
141 Ga0070702_100948453 3300005615 Bacteria 677
142 Ga0068852_100492411 3300005616 Bacteria 1220
143 Ga0068852_100525147 3300005616 Bacteria 1181
144 Ga0068852_100559881 3300005616 Bacteria 1144
145 Ga0068859_100002385 3300005617 Bacteria 19127
146 Ga0068859_100226533 3300005617 Bacteria 1957
147 Ga0068859_100919227 3300005617 Bacteria 959
148 Ga0068859_101130889 3300005617 Bacteria 862
149 Ga0068866_10000373 3300005718 Bacteria 21109
150 Ga0068866_10059764 3300005718 Bacteria 1973
151 Ga0068861_100001911 3300005719 Bacteria 13411
152 Ga0068861_100105496 3300005719 Bacteria 2250
153 Ga0068861_100333174 3300005719 Bacteria 1325
154 Ga0068851_10091226 3300005834 Bacteria 1604
155 Ga0068863_100016574 3300005841 Bacteria 7070
156 Ga0068863_100099887 3300005841 Bacteria 2758
157 Ga0068863_100546247 3300005841 Bacteria 1144
158 Ga0068863_100701959 3300005841 Bacteria 1006
159 Ga0068858_100001749 3300005842 Bacteria 22140
160 Ga0068858_100084184 3300005842 Bacteria 2959
161 Ga0068858_100676416 3300005842 Bacteria 1004
162 Ga0068860_100050762 3300005843 Bacteria 3947
163 Ga0068860_100067015 3300005843 Bacteria 3411
164 Ga0068860_100081645 3300005843 Bacteria 3074
165 Ga0068860_101607691 3300005843 Bacteria 672
166 Ga0068862_100002533 3300005844 Bacteria 16169
167 Ga0068862_100173136 3300005844 Bacteria 1933
168 Ga0068862_100267717 3300005844 Bacteria 1562
169 Ga0081455_10036835 3300005937 Bacteria 4350
170 Ga0081455_10259675 3300005937 Bacteria 1266
171 Ga0081538_10091548 3300005981 Bacteria 1569
172 Ga0081538_10281643 3300005981 Bacteria 617
173 Ga0075365_10018316 3300006038 Bacteria 4305
174 Ga0075365_10043186 3300006038 Bacteria 2951
175 Ga0075365_10049178 3300006038 Bacteria 2778
176 Ga0075365_10059085 3300006038 Bacteria 2554
177 Ga0075365_10074027 3300006038 Bacteria 2297
178 Ga0075365_10165419 3300006038 Bacteria 1543
179 Ga0075365_10389020 3300006038 Bacteria 984
180 Ga0075365_10508061 3300006038 Bacteria 852
181 Ga0075365_10518008 3300006038 Bacteria 843
182 Ga0075365_10973704 3300006038 Bacteria 598
183 Ga0075368_10104836 3300006042 Bacteria 1163
184 Ga0075368_10132407 3300006042 Bacteria 1037
185 Ga0075368_10389637 3300006042 Bacteria 611
186 Ga0075368_10455524 3300006042 Bacteria 567
187 Ga0075368_10480904 3300006042 Bacteria 553
188 Ga0075363_100005318 3300006048 Bacteria 5713
189 Ga0075363_100006581 3300006048 Bacteria 5291
190 Ga0075363_100008963 3300006048 Bacteria 4686
191 Ga0075363_100034870 3300006048 Bacteria 2629
192 Ga0075363_100070261 3300006048 Bacteria 1901
193 Ga0075363_100079824 3300006048 Bacteria 1788
194 Ga0075363_100153328 3300006048 Bacteria 1301
195 Ga0075363_100185174 3300006048 Bacteria 1186
196 Ga0075363_100201692 3300006048 Bacteria 1137
197 Ga0075363_100640839 3300006048 Bacteria 639
198 Ga0075364_10000608 3300006051 Bacteria 18510
199 Ga0075364_10003346 3300006051 Bacteria 9094
200 Ga0075364_10013476 3300006051 Bacteria 5027
201 Ga0075364_10019857 3300006051 Bacteria 4223
202 Ga0075364_10078599 3300006051 Bacteria 2179
203 Ga0075364_10225066 3300006051 Bacteria 1274
204 Ga0075364_10262904 3300006051 Bacteria 1173
205 Ga0075364_10312857 3300006051 Bacteria 1069
206 Ga0075364_10358293 3300006051 Bacteria 994
207 Ga0075364_10365236 3300006051 Bacteria 984
208 Ga0075364_10391996 3300006051 Bacteria 947
209 Ga0075364_10531943 3300006051 Bacteria 803
210 Ga0075364_10535291 3300006051 Bacteria 801
211 Ga0075364_10629182 3300006051 Bacteria 733
212 Ga0075364_10839330 3300006051 Bacteria 626
213 Ga0075364_10879468 3300006051 Bacteria 610
214 Ga0075364_10970993 3300006051 Bacteria 578
215 Ga0075364_11080832 3300006051 Bacteria 545
216 Ga0070715_10000718 3300006163 Bacteria 8914
217 Ga0070715_10007515 3300006163 Bacteria 3756
218 Ga0070716_100004652 3300006173 Bacteria 6576
219 Ga0070716_100049687 3300006173 Bacteria 2377
220 Ga0070716_100268510 3300006173 Bacteria 1171
221 Ga0070716_100375251 3300006173 Bacteria 1015
222 Ga0070716_101550145 3300006173 Bacteria 543
223 Ga0070712_100037154 3300006175 Bacteria 3318
224 Ga0070712_100065980 3300006175 Bacteria 2571
225 Ga0070712_100246643 3300006175 Bacteria 1425
226 Ga0075362_10024970 3300006177 Bacteria 2539
227 Ga0075362_10025455 3300006177 Bacteria 2520
228 Ga0075362_10058936 3300006177 Bacteria 1733
229 Ga0075362_10187530 3300006177 Bacteria 1004
230 Ga0075362_10263292 3300006177 Bacteria 850
231 Ga0075362_10583032 3300006177 Bacteria 577
232 Ga0075362_10784898 3300006177 Bacteria 500
233 Ga0075367_10028194 3300006178 Bacteria 3201
234 Ga0075367_10055517 3300006178 Bacteria 2351
235 Ga0075367_10198018 3300006178 Bacteria 1255
236 Ga0075367_10288151 3300006178 Bacteria 1033
237 Ga0075367_10585137 3300006178 Bacteria 709
238 Ga0075367_10744617 3300006178 Bacteria 624
239 Ga0075369_10001584 3300006186 Bacteria 7819
240 Ga0075369_10002127 3300006186 Bacteria 7000
241 Ga0075369_10005917 3300006186 Bacteria 4599
242 Ga0075369_10009541 3300006186 Bacteria 3774
243 Ga0075369_10013585 3300006186 Bacteria 3236
244 Ga0075369_10021501 3300006186 Bacteria 2652
245 Ga0075369_10060062 3300006186 Bacteria 1657
246 Ga0075369_10081753 3300006186 Bacteria 1433
247 Ga0075369_10085271 3300006186 Bacteria 1405
248 Ga0075369_10103868 3300006186 Bacteria 1277
249 Ga0075369_10229680 3300006186 Bacteria 860
250 Ga0075369_10236322 3300006186 Bacteria 847
251 Ga0075369_10285076 3300006186 Bacteria 770
252 Ga0075369_10473069 3300006186 Bacteria 594
253 Ga0075369_10582358 3300006186 Bacteria 535
254 Ga0075369_10600374 3300006186 Bacteria 527
255 Ga0075366_10429027 3300006195 Bacteria 815
256 Ga0097621_100036417 3300006237 Bacteria 3937
257 Ga0075370_10001846 3300006353 Bacteria 9488
258 Ga0075370_10005781 3300006353 Bacteria 6182
259 Ga0075370_10052270 3300006353 Bacteria 2317
260 Ga0075370_10066126 3300006353 Bacteria 2062
261 Ga0075370_10076982 3300006353 Bacteria 1914
262 Ga0075370_10108659 3300006353 Bacteria 1609
263 Ga0075370_10206737 3300006353 Bacteria 1159
264 Ga0075370_10382983 3300006353 Bacteria 843
265 Ga0075370_10431497 3300006353 Bacteria 792
266 Ga0075370_10819971 3300006353 Bacteria 568
267 Ga0068871_100099622 3300006358 Bacteria 2433
268 Ga0068871_100216349 3300006358 Bacteria 1658
269 Ga0075428_100004424 3300006844 Bacteria 15515
270 Ga0075430_100067404 3300006846 Bacteria 3005
271 Ga0075430_100882422 3300006846 Bacteria 737
272 Ga0068865_100020421 3300006881 Bacteria 4294
273 Ga0068865_100161128 3300006881 Bacteria 1711
274 Ga0097620_100002385 3300006931 Bacteria 19127
275 Ga0097620_100226548 3300006931 Bacteria 1957
276 Ga0097620_100919029 3300006931 Bacteria 959
277 Ga0097620_101130877 3300006931 Bacteria 862
278 Ga0099794_10746859 3300007265 Bacteria 522
279 Ga0099795_10022970 3300007788 Bacteria 2064
280 Ga0105251_10515184 3300009011 Bacteria 560
281 Ga0105244_10161023 3300009036 Bacteria 1072
282 Ga0105250_10029040 3300009092 Bacteria 2225
283 Ga0105250_10082270 3300009092 Bacteria 1306
284 Ga0105250_10211875 3300009092 Bacteria 819
285 Ga0105240_12018480 3300009093 Bacteria 599
286 Ga0111539_10889668 3300009094 Bacteria 1036
287 Ga0111539_11156347 3300009094 Bacteria 899
288 Ga0111539_13274826 3300009094 Bacteria 522
289 Ga0105245_10002642 3300009098 Bacteria 16126
290 Ga0105245_10068844 3300009098 Bacteria 3208
291 Ga0105245_10275830 3300009098 Bacteria 1642
292 Ga0105245_10498765 3300009098 Bacteria 1233
293 Ga0105245_11689963 3300009098 Bacteria 685
294 Ga0105245_12016897 3300009098 Bacteria 630
295 Ga0105247_10001763 3300009101 Bacteria 15223
296 Ga0105247_10042071 3300009101 Bacteria 2797
297 Ga0105247_10213659 3300009101 Bacteria 1302
298 Ga0105247_10502788 3300009101 Bacteria 883
299 Ga0105243_10001936 3300009148 Bacteria 17632
300 Ga0105243_11137589 3300009148 Bacteria 791
301 Ga0105241_10023048 3300009174 Bacteria 4616
302 Ga0105241_10208059 3300009174 Bacteria 1638
303 Ga0105241_10922542 3300009174 Bacteria 812
304 Ga0105241_12590041 3300009174 Bacteria 509
305 Ga0105242_10001287 3300009176 Bacteria 19810
306 Ga0105242_10072434 3300009176 Bacteria 2862
307 Ga0105242_12725289 3300009176 Bacteria 544
308 Ga0105248_10003941 3300009177 Bacteria 16413
309 Ga0105248_10279683 3300009177 Bacteria 1879
310 Ga0105248_10826817 3300009177 Bacteria 1045
311 Ga0105248_12739117 3300009177 Bacteria 562
312 Ga0105237_10000298 3300009545 Bacteria 68533
313 Ga0105237_10010042 3300009545 Bacteria 10098
314 Ga0105237_10149505 3300009545 Bacteria 2331
315 Ga0105237_10195534 3300009545 Bacteria 2022
316 Ga0105237_10280095 3300009545 Bacteria 1670
317 Ga0105237_12151867 3300009545 Bacteria 567
318 Ga0105238_10155350 3300009551 Bacteria 2263
319 Ga0105238_10282773 3300009551 Bacteria 1640
320 Ga0105238_10339621 3300009551 Bacteria 1490
321 Ga0105238_11378936 3300009551 Bacteria 732
322 Ga0105249_10008335 3300009553 Bacteria 9026
323 Ga0105249_10158488 3300009553 Bacteria 2185
324 Ga0105249_10344392 3300009553 Bacteria 1508
325 Ga0105249_11460011 3300009553 Bacteria 756
326 Ga0105239_10014559 3300010375 Bacteria 8726
327 Ga0105239_10159940 3300010375 Bacteria 2516
328 Ga0105239_10451941 3300010375 Bacteria 1458
329 Ga0105239_10489143 3300010375 Bacteria 1398
330 Ga0105246_10067655 3300011119 Bacteria 2503
331 Ga0105246_12061578 3300011119 Bacteria 552
332 Ga0157370_11414265 3300013104 Bacteria 626
333 Ga0157369_10160325 3300013105 Bacteria 2374
334 Ga0157369_10205413 3300013105 Bacteria 2066
335 Ga0157369_10438264 3300013105 Bacteria 1354
336 Ga0157374_10354251 3300013296 Bacteria 1459
337 Ga0157378_10008016 3300013297 Bacteria 9220
338 Ga0157378_10208674 3300013297 Bacteria 1851
339 Ga0157378_11865938 3300013297 Bacteria 650
340 Ga0163162_10024373 3300013306 Bacteria 5970
341 Ga0163162_10113372 3300013306 Bacteria 2809
342 Ga0163162_10137885 3300013306 Bacteria 2551
343 Ga0163162_10430913 3300013306 Bacteria 1451
344 Ga0163162_12365613 3300013306 Bacteria 611
345 Ga0157372_10203882 3300013307 Bacteria 2291
346 Ga0157372_10272708 3300013307 Bacteria 1966
347 Ga0157372_10590783 3300013307 Bacteria 1294
348 Ga0157375_10002874 3300013308 Bacteria 14925
349 Ga0157375_10094780 3300013308 Bacteria 3055
350 Ga0157375_10557412 3300013308 Bacteria 1307
351 Ga0157375_11985710 3300013308 Bacteria 691
352 Ga0163163_10138681 3300014325 Bacteria 2474
353 Ga0163163_10144462 3300014325 Bacteria 2422
354 Ga0163163_10728358 3300014325 Bacteria 1055
355 Ga0163163_10921481 3300014325 Bacteria 937
356 Ga0163163_11429649 3300014325 Bacteria 753
357 Ga0157380_10071167 3300014326 Bacteria 2813
358 Ga0157380_10182970 3300014326 Bacteria 1843
359 Ga0157380_11720797 3300014326 Bacteria 685
360 Ga0182008_10073483 3300014497 Bacteria 1682
361 Ga0157377_10183621 3300014745 Bacteria 1317
362 Ga0157377_10224806 3300014745 Bacteria 1204
363 Ga0157379_10003493 3300014968 Bacteria 13318
364 Ga0157379_10110078 3300014968 Bacteria 2474
365 Ga0157376_10079859 3300014969 Bacteria 2805
366 Ga0157376_10166263 3300014969 Bacteria 2004
367 Ga0163161_10000541 3300017792 Bacteria 30663
368 Ga0163161_10090463 3300017792 Bacteria 2264
369 Ga0163161_11021255 3300017792 Bacteria 707
370 Ga0163161_11100255 3300017792 Bacteria 683
371 Ga0213876_10012529 3300021384 Bacteria 4511
372 Ga0213876_10319989 3300021384 Bacteria 825
373 Ga0213875_10009593 3300021388 Bacteria 4894
374 Ga0209673_1007316 3300025273 Bacteria 5119
375 Ga0209025_1085844 3300025294 Bacteria 1048
376 Ga0209051_1000021 3300025303 Bacteria 507633
377 Ga0209051_1000851 3300025303 Bacteria 31135
378 Ga0209051_1001100 3300025303 Bacteria 24862
379 Ga0209051_1032676 3300025303 Bacteria 1980
380 Ga0209051_1096707 3300025303 Bacteria 805
381 Ga0207696_1076121 3300025711 Bacteria 930
382 Ga0207696_1088842 3300025711 Bacteria 848
383 Ga0207653_10010466 3300025885 Bacteria 2893
384 Ga0207682_10049138 3300025893 Bacteria 1741
385 Ga0207692_10000155 3300025898 Bacteria 21763
386 Ga0207692_10118242 3300025898 Bacteria 1480
387 Ga0207642_10002811 3300025899 Bacteria 5431
388 Ga0207642_10154873 3300025899 Bacteria 1224
389 Ga0207710_10001993 3300025900 Bacteria 9738
390 Ga0207710_10039727 3300025900 Bacteria 2083
391 Ga0207710_10110901 3300025900 Bacteria 1302
392 Ga0207688_10000811 3300025901 Bacteria 15630
393 Ga0207688_10001753 3300025901 Bacteria 11515
394 Ga0207688_10165081 3300025901 Bacteria 1314
395 Ga0207688_10706254 3300025901 Bacteria 638
396 Ga0207680_10022015 3300025903 Bacteria 3461
397 Ga0207680_10330484 3300025903 Bacteria 1067
398 Ga0207680_10527697 3300025903 Bacteria 842
399 Ga0207647_10020704 3300025904 Bacteria 4406
400 Ga0207647_10269496 3300025904 Bacteria 973
401 Ga0207685_10004464 3300025905 Bacteria 3562
402 Ga0207685_10044207 3300025905 Bacteria 1683
403 Ga0207685_10841796 3300025905 Bacteria 507
404 Ga0207699_10011470 3300025906 Bacteria 4476
405 Ga0207699_10045823 3300025906 Bacteria 2554
406 Ga0207699_10136083 3300025906 Bacteria 1609
407 Ga0207645_10026494 3300025907 Bacteria 3746
408 Ga0207645_10321392 3300025907 Bacteria 1032
409 Ga0207643_10302159 3300025908 Bacteria 996
410 Ga0207705_10490719 3300025909 Bacteria 954
411 Ga0207654_10388555 3300025911 Bacteria 968
412 Ga0207654_10730096 3300025911 Bacteria 713
413 Ga0207654_10957483 3300025911 Bacteria 622
414 Ga0207707_10864134 3300025912 Bacteria 750
415 Ga0207671_10012421 3300025914 Bacteria 6847
416 Ga0207671_10028732 3300025914 Bacteria 4154
417 Ga0207671_10150786 3300025914 Bacteria 1796
418 Ga0207671_10269246 3300025914 Bacteria 1342
419 Ga0207693_10000569 3300025915 Bacteria 33235
420 Ga0207693_10004579 3300025915 Bacteria 11670
421 Ga0207693_10276532 3300025915 Bacteria 1316
422 Ga0207693_10323596 3300025915 Bacteria 1207
423 Ga0207663_10001069 3300025916 Bacteria 12560
424 Ga0207663_10120439 3300025916 Bacteria 1796
425 Ga0207662_10119720 3300025918 Bacteria 1650
426 Ga0207657_10389992 3300025919 Bacteria 1096
427 Ga0207652_10514053 3300025921 Bacteria 1078
428 Ga0207646_11468848 3300025922 Bacteria 591
429 Ga0207681_10016959 3300025923 Bacteria 4568
430 Ga0207681_10305972 3300025923 Bacteria 1259
431 Ga0207694_10249823 3300025924 Bacteria 1451
432 Ga0207694_10667604 3300025924 Bacteria 876
433 Ga0207650_10579309 3300025925 Bacteria 942
434 Ga0207659_10492169 3300025926 Bacteria 1037
435 Ga0207687_10149253 3300025927 Bacteria 1782
436 Ga0207687_10181826 3300025927 Bacteria 1630
437 Ga0207700_10086248 3300025928 Bacteria 2466
438 Ga0207700_10390139 3300025928 Bacteria 1219
439 Ga0207664_10351172 3300025929 Bacteria 1305
440 Ga0207664_10386419 3300025929 Bacteria 1243
441 Ga0207644_10097229 3300025931 Bacteria 2205
442 Ga0207644_10101003 3300025931 Bacteria 2167
443 Ga0207644_10119361 3300025931 Bacteria 2005
444 Ga0207644_10674514 3300025931 Bacteria 861
445 Ga0207690_10759942 3300025932 Bacteria 799
446 Ga0207706_10003525 3300025933 Bacteria 14945
447 Ga0207706_10435593 3300025933 Bacteria 1135
448 Ga0207686_10036190 3300025934 Bacteria 2970
449 Ga0207686_10150422 3300025934 Bacteria 1620
450 Ga0207709_10001301 3300025935 Bacteria 17781
451 Ga0207670_10062362 3300025936 Bacteria 2547
452 Ga0207670_10260747 3300025936 Bacteria 1343
453 Ga0207669_10021751 3300025937 Bacteria 3392
454 Ga0207669_10177963 3300025937 Bacteria 1521
455 Ga0207704_10007564 3300025938 Bacteria 5140
456 Ga0207704_10027591 3300025938 Bacteria 3136
457 Ga0207665_10001819 3300025939 Bacteria 14355
458 Ga0207665_10003777 3300025939 Bacteria 10117
459 Ga0207665_10518293 3300025939 Bacteria 923
460 Ga0207691_11041430 3300025940 Bacteria 682
461 Ga0207711_10075139 3300025941 Bacteria 2940
462 Ga0207711_10332379 3300025941 Bacteria 1405
463 Ga0207711_10591950 3300025941 Bacteria 1035
464 Ga0207689_10035026 3300025942 Bacteria 4171
465 Ga0207689_10053347 3300025942 Bacteria 3331
466 Ga0207661_10291688 3300025944 Bacteria 1460
467 Ga0207661_10750269 3300025944 Bacteria 898
468 Ga0207667_10631816 3300025949 Bacteria 1078
469 Ga0207651_10052550 3300025960 Bacteria 2779
470 Ga0207712_10006360 3300025961 Bacteria 7453
471 Ga0207712_10160899 3300025961 Bacteria 1745
472 Ga0207712_10228648 3300025961 Bacteria 1492
473 Ga0207668_10094941 3300025972 Bacteria 2200
474 Ga0207668_10124674 3300025972 Bacteria 1956
475 Ga0207668_10166811 3300025972 Bacteria 1722
476 Ga0207668_10579320 3300025972 Bacteria 975
477 Ga0207668_11763726 3300025972 Bacteria 559
478 Ga0207668_11875771 3300025972 Bacteria 540
479 Ga0207640_10058256 3300025981 Bacteria 2544
480 Ga0207640_10273819 3300025981 Bacteria 1322
481 Ga0207640_10493265 3300025981 Bacteria 1018
482 Ga0207658_10012743 3300025986 Bacteria 5742
483 Ga0207658_10026484 3300025986 Bacteria 4065
484 Ga0207658_10128291 3300025986 Bacteria 2033
485 Ga0207658_10162507 3300025986 Bacteria 1831
486 Ga0207677_10001267 3300026023 Bacteria 13599
487 Ga0207677_10337326 3300026023 Bacteria 1258
488 Ga0207677_10724724 3300026023 Bacteria 884
489 Ga0207677_10806937 3300026023 Bacteria 840
490 Ga0207703_10005162 3300026035 Bacteria 10558
491 Ga0207703_10606010 3300026035 Bacteria 1036
492 Ga0207703_10856725 3300026035 Bacteria 869
493 Ga0207639_10039251 3300026041 Bacteria 3527
494 Ga0207639_10221199 3300026041 Bacteria 1635
495 Ga0207678_10009728 3300026067 Bacteria 8455
496 Ga0207678_10014504 3300026067 Bacteria 6929
497 Ga0207678_10038103 3300026067 Bacteria 4179
498 Ga0207678_10498851 3300026067 Bacteria 1061
499 Ga0207708_10001638 3300026075 Bacteria 16671
500 Ga0207708_10354768 3300026075 Bacteria 1204
501 Ga0207702_10119359 3300026078 Bacteria 2358
502 Ga0207702_12315302 3300026078 Bacteria 525
503 Ga0207641_10001710 3300026088 Bacteria 21337
504 Ga0207641_10559478 3300026088 Bacteria 1116
505 Ga0207641_10679872 3300026088 Bacteria 1012
506 Ga0207648_10002899 3300026089 Bacteria 18153
507 Ga0207648_10071991 3300026089 Bacteria 3012
508 Ga0207674_10570179 3300026116 Bacteria 1093
509 Ga0207675_100018977 3300026118 Bacteria 6420
510 Ga0207675_100021572 3300026118 Bacteria 5998
511 Ga0207675_100289801 3300026118 Bacteria 1592
512 Ga0207683_10001716 3300026121 Bacteria 19591
513 Ga0207683_10010967 3300026121 Bacteria 7728
514 Ga0207683_10359077 3300026121 Bacteria 1338
515 Ga0207683_10681669 3300026121 Bacteria 953
516 Ga0207698_10480555 3300026142 Bacteria 1205
517 Ga0209813_10070309 3300027866 Bacteria 1136
518 Ga0209813_10143937 3300027866 Bacteria 848
519 Ga0209813_10199879 3300027866 Bacteria 739
520 Ga0209813_10212680 3300027866 Bacteria 720
521 Ga0209813_10486309 3300027866 Bacteria 510
522 Ga0207428_10207153 3300027907 Bacteria 1474
523 Ga0268266_10003448 3300028379 Bacteria 15767
524 Ga0268266_10028849 3300028379 Bacteria 4717
525 Ga0268266_10110763 3300028379 Bacteria 2432
526 Ga0268266_12328413 3300028379 Bacteria 507
527 Ga0268265_10000842 3300028380 Bacteria 28832
528 Ga0268265_10036169 3300028380 Bacteria 3615
529 Ga0268265_10212928 3300028380 Bacteria 1685
530 Ga0268264_10003437 3300028381 Bacteria 13659
531 Ga0268264_10035098 3300028381 Bacteria 4129
532 Ga0265327_10002020 3300031251 Bacteria 22893
533 Ga0307408_100602059 3300031548 Bacteria 977
534 Ga0316578_10532633 3300031728 Bacteria 691
535 Ga0307405_10153601 3300031731 Bacteria 1622
536 Ga0307405_11714449 3300031731 Bacteria 557
537 Ga0307413_10004998 3300031824 Bacteria 5851
538 Ga0307413_11471028 3300031824 Bacteria 601
539 Ga0307410_10264018 3300031852 Bacteria 1344
540 Ga0307410_10380114 3300031852 Bacteria 1136
541 Ga0307410_11164587 3300031852 Bacteria 670
542 Ga0307410_11908499 3300031852 Bacteria 529
543 Ga0307406_10026454 3300031901 Bacteria 3485
544 Ga0307407_10125110 3300031903 Bacteria 1636
545 Ga0307412_10383189 3300031911 Bacteria 1139
546 Ga0307412_10560680 3300031911 Bacteria 961
547 Ga0307412_10662202 3300031911 Bacteria 892
548 Ga0307409_100230223 3300031995 Bacteria 1679
549 Ga0307409_100359504 3300031995 Bacteria 1377
550 Ga0307409_100455910 3300031995 Bacteria 1235
551 Ga0307409_101112490 3300031995 Bacteria 811
552 Ga0307416_100004526 3300032002 Bacteria 8394
553 Ga0307416_100762953 3300032002 Bacteria 1061
554 Ga0307416_101636570 3300032002 Bacteria 749
555 Ga0307414_10325459 3300032004 Bacteria 1310
556 Ga0307415_100035593 3300032126 Bacteria 3253
557 Ga0307415_100227088 3300032126 Bacteria 1501
558 Ga0307415_100800191 3300032126 Bacteria 860
559 Ga0307415_101268711 3300032126 Bacteria 697
560 Ga0373958_0047160 3300034819 Bacteria 900
561 Ga0373958_0052154 3300034819 Bacteria 866
562 Ga0373940_0347757 3300035088 Bacteria 520
563 Ga0373949_0059797 3300035090 Bacteria 978
564 Ga0373952_0056380 3300035092 Bacteria 950
565 Ga0373932_0134448 3300035112 Bacteria 836
566 Ga0373939_0025784 3300035114 Bacteria 1651
567 Ga0373939_0055344 3300035114 Bacteria 1245
568 Ga0373941_0135362 3300035115 Bacteria 891
569 Ga0373960_0098413 3300035121 Bacteria 945
570 Ga0373962_0104784 3300035242 Bacteria 886
571 Ga0373931_0034339 3300035691 Bacteria 2632
572 Ga0373947_0123165 3300035725 Bacteria 1649
573 Ga0316582_0512179 3300036647 Bacteria 827
574 Ga0316584_0134344 3300036712 Bacteria 1847
575 Ga0395905_1830199 3300037471 Bacteria 513
576 Ga0436364_0914349 3300037853 Bacteria 10142
577 Ga0436365_0615832 3300039437 Bacteria 1645
578 Ga0436365_1175019 3300039437 Bacteria 2010
579 Ga0436365_1237616 3300039437 Bacteria 50809
580 Ga0436365_1650565 3300039437 Bacteria 11104
581 Ga0436360_1310369 3300039438 Bacteria 745
582 Ga0436361_0524309 3300039447 Bacteria 968
583 Ga0436363_0173342 3300039450 Bacteria 825
584 Ga0436363_0740702 3300039450 Bacteria 1294
585 Ga0439461_0000076 3300041410 Bacteria 12970
586 Ga0439461_0021949 3300041410 Bacteria 1275
587 Ga0439461_0025202 3300041410 Bacteria 1207
588 Ga0439466_0003739 3300041411 Bacteria 5877
589 Ga0439466_0003782 3300041411 Bacteria 5844
590 Ga0439465_0006761 3300041413 Bacteria 3642
591 Ga0439465_0007389 3300041413 Bacteria 3491
592 Ga0439465_0009070 3300041413 Bacteria 3135
593 Ga0439465_0072465 3300041413 Bacteria 1156
594 Ga0439465_0255334 3300041413 Bacteria 649
595 Ga0451789_0602891 3300041443 Bacteria 1045
596 Ga0451793_0627973 3300041452 Bacteria 629
597 Ga0451793_1365826 3300041452 Bacteria 588
598 Ga0451795_0095207 3300041456 Bacteria 955
599 Ga0451802_0295480 3300041460 Bacteria 611
600 Ga0451802_0365394 3300041460 Bacteria 976
601 Ga0451802_2076848 3300041460 Bacteria 533
602 Ga0451804_0145343 3300041463 Bacteria 510
603 Ga0451807_1765507 3300041486 Bacteria 718
604 Ga0451807_1858641 3300041486 Bacteria 651
605 Ga0451837_1109350 3300041494 Bacteria 716
606 Ga0451839_0352500 3300041496 Bacteria 907
607 Ga0451847_0147688 3300041503 Bacteria 682
608 Ga0451847_0751010 3300041503 Bacteria 519
609 Ga0451851_0447051 3300041507 Unclassified 500
610 Ga0451853_1516494 3300041512 Bacteria 539
611 Ga0451853_2678571 3300041512 Bacteria 505
612 Ga0439431_0029850 3300041997 Bacteria 1348
613 Ga0439431_0043819 3300041997 Bacteria 1146
614 Ga0439431_0073958 3300041997 Bacteria 911
615 Ga0439442_020654 3300042002 Bacteria 1365
616 Ga0439442_149330 3300042002 Bacteria 519
617 Ga0439445_0005355 3300042004 Bacteria 2924
618 Ga0439445_0022747 3300042004 Bacteria 1583
619 Ga0439445_0085557 3300042004 Bacteria 884
620 Ga0439448_0006605 3300042005 Bacteria 3338
621 Ga0439450_104204 3300042008 Bacteria 722
622 Ga0439434_0029210 3300042435 Bacteria 1671
623 Ga0439459_0057477 3300042438 Bacteria 870
624 Ga0466969_0058565 3300044656 Bacteria 1875
625 Ga0466969_0151109 3300044656 Bacteria 1070
626 Ga0466972_0025359 3300044658 Bacteria 2939
627 Ga0466972_0198721 3300044658 Bacteria 939
628 Ga0466972_0199085 3300044658 Bacteria 938
629 Ga0466972_0442779 3300044658 Bacteria 610
630 Ga0466972_0504873 3300044658 Bacteria 569
631 Ga0466965_0022598 3300044683 Bacteria 3032
632 Ga0466965_0030299 3300044683 Bacteria 2636
633 Ga0466965_0092432 3300044683 Bacteria 1540
634 Ga0466965_0287777 3300044683 Bacteria 889
635 Ga0466966_0012025 3300044684 Bacteria 5736
636 Ga0466966_0150877 3300044684 Bacteria 1417
637 Ga0466966_0195144 3300044684 Bacteria 1226
638 Ga0466961_0004452 3300044693 Bacteria 8776
639 Ga0466961_0022586 3300044693 Bacteria 4047
640 Ga0466961_0415757 3300044693 Bacteria 815
641 Ga0466964_0171321 3300044706 Bacteria 1022
642 Ga0466971_0143519 3300044719 Bacteria 1112
643 Ga0466971_0275297 3300044719 Bacteria 805
644 Ga0466968_0001609 3300044735 Bacteria 8154
645 Ga0466968_0007708 3300044735 Bacteria 4099
646 Ga0466968_0022966 3300044735 Bacteria 2538
647 Ga0466968_0467706 3300044735 Bacteria 625
648 Ga0466968_0601436 3300044735 Bacteria 555
649 Ga0466970_0003858 3300044765 Bacteria 7337
650 Ga0466970_0010400 3300044765 Bacteria 4724
651 Ga0466970_0019205 3300044765 Bacteria 3542
652 Ga0466970_0229721 3300044765 Bacteria 1037
653 Ga0466970_0453856 3300044765 Bacteria 735
654 Ga0466957_0001871 3300044842 Bacteria 11131
655 Ga0466957_0014581 3300044842 Bacteria 4578
656 Ga0466957_0218390 3300044842 Bacteria 1258
657 Ga0466957_1451150 3300044842 Bacteria 500
658 Ga0466960_0001148 3300044901 Bacteria 9509
659 Ga0466960_0169554 3300044901 Bacteria 1177
660 Ga0466960_0317394 3300044901 Bacteria 882
661 Ga0466960_0348136 3300044901 Bacteria 844
662 Ga0466960_0651298 3300044901 Bacteria 629
663 Ga0466959_0007863 3300045049 Bacteria 7503
664 Ga0466959_0012371 3300045049 Bacteria 6164
665 Ga0466959_0098004 3300045049 Bacteria 2100
666 Ga0466959_0137403 3300045049 Bacteria 1729
667 Ga0466958_0001503 3300045836 Bacteria 11150
668 Ga0466958_0003168 3300045836 Bacteria 8474
669 Ga0466958_0120469 3300045836 Bacteria 1642
670 Ga0466958_0336704 3300045836 Bacteria 971
671 Ga0466958_0852657 3300045836 Bacteria 594
672 Ga0466967_0007187 3300045976 Bacteria 7998
673 Ga0466967_0049351 3300045976 Bacteria 3680
674 Ga0466967_0366874 3300045976 Bacteria 1396
675 Ga0466967_0503576 3300045976 Bacteria 1189
676 Ga0466967_0509251 3300045976 Bacteria 1182
677 Ga0466967_0618105 3300045976 Bacteria 1070
678 Ga0466967_0865137 3300045976 Bacteria 898
679 Ga0466967_1802791 3300045976 Bacteria 609
680 Ga0466967_2428694 3300045976 Bacteria 519
681 Ga0495603_0008183 3300046455 Bacteria 6320
682 Ga0495590_0194549 3300046457 Bacteria 744
683 Ga0495629_0028866 3300046459 Bacteria 3938
684 Ga0495641_0145072 3300046461 Bacteria 1061
685 Ga0495583_0073706 3300046506 Bacteria 1496
686 Ga0495606_0217136 3300046507 Bacteria 1080
687 Ga0495648_0003743 3300046524 Bacteria 13251
688 Ga0495642_0197917 3300046528 Bacteria 876
689 Ga0495654_0307865 3300046530 Bacteria 645
690 Ga0495665_0211366 3300046531 Bacteria 1004
691 Ga0495640_0681553 3300046533 Bacteria 617
692 Ga0495667_0676913 3300046559 Bacteria 640
693 Ga0495668_0062042 3300046616 Bacteria 2060
694 Ga0495668_0698740 3300046616 Bacteria 561
695 Ga0495613_0363885 3300046689 Bacteria 991
696 Ga0495671_0016121 3300046692 Bacteria 3996
697 Ga0495649_0520725 3300046694 Bacteria 590
698 Ga0495649_0587085 3300046694 Bacteria 550
699 Ga0495600_0244422 3300046809 Bacteria 1143
700 Ga0495660_0460075 3300046810 Bacteria 549
701 Ga0495674_0220385 3300047319 Bacteria 1568
702 Ga0495672_0000925 3300047320 Bacteria 30689
703 Ga0495676_0456299 3300047321 Bacteria 842
704 Ga0495676_0793989 3300047321 Bacteria 610
705 Ga0495673_0000415 3300047469 Bacteria 49621
706 Ga0495686_0201541 3300047472 Bacteria 1142
707 Ga0495593_0002253 3300047673 Bacteria 11571
708 Ga0496100_0000011 3300048903 Bacteria 190969
709 Ga0496100_0001021 3300048903 Bacteria 13521
710 Ga0496100_0071738 3300048903 Bacteria 2313
711 Ga0496100_0089175 3300048903 Bacteria 2100
712 Ga0496100_0218085 3300048903 Bacteria 1399
713 Ga0496100_0928276 3300048903 Bacteria 684
714 Ga0496101_0000011 3300048904 Bacteria 272153
715 Ga0496101_0000517 3300048904 Bacteria 24069
716 Ga0496101_0003953 3300048904 Bacteria 9266
717 Ga0496101_0049483 3300048904 Bacteria 3024
718 Ga0496101_0118174 3300048904 Bacteria 2002
719 Ga0496101_0834464 3300048904 Bacteria 726
720 Ga0496101_0994295 3300048904 Bacteria 660
721 Ga0496102_0000012 3300048905 Bacteria 315470
722 Ga0496102_0001078 3300048905 Bacteria 25233
723 Ga0496102_0010258 3300048905 Bacteria 8055
724 Ga0496102_0178998 3300048905 Bacteria 1997
725 Ga0496102_0218261 3300048905 Bacteria 1797
726 Ga0496102_0270511 3300048905 Bacteria 1602
727 Ga0496102_0483675 3300048905 Bacteria 1159
728 Ga0496102_0579905 3300048905 Bacteria 1044
729 Ga0496103_0000005 3300048906 Bacteria 505416
730 Ga0496103_0000418 3300048906 Bacteria 37252
731 Ga0496103_0003102 3300048906 Bacteria 10213
732 Ga0496103_0020353 3300048906 Bacteria 3985
733 Ga0496103_0040796 3300048906 Bacteria 2852
734 Ga0496103_0095529 3300048906 Bacteria 1878
735 Ga0496103_0465508 3300048906 Bacteria 810
736 Ga0496104_0084151 3300048907 Bacteria 3035
737 Ga0496104_0524707 3300048907 Bacteria 1095
738 Ga0496104_0622139 3300048907 Bacteria 989
739 Ga0496104_0916582 3300048907 Bacteria 781
740 Ga0496104_1409186 3300048907 Bacteria 600
741 Ga0496105_0209505 3300048908 Bacteria 1589
742 Ga0496105_0633115 3300048908 Bacteria 827
743 Ga0496105_0828708 3300048908 Bacteria 702
744 Ga0496105_0922519 3300048908 Bacteria 657
745 Ga0496106_0000820 3300048909 Bacteria 22548
746 Ga0496106_0032809 3300048909 Bacteria 3872
747 Ga0496106_0045530 3300048909 Bacteria 3296
748 Ga0496106_0053728 3300048909 Bacteria 3043
749 Ga0496106_0069585 3300048909 Bacteria 2686
750 Ga0496107_0000372 3300048910 Bacteria 24290
751 Ga0496107_0001343 3300048910 Bacteria 15104
752 Ga0496107_0032564 3300048910 Bacteria 3726
753 Ga0496107_0341137 3300048910 Bacteria 1115
754 Ga0496107_0454276 3300048910 Bacteria 952
755 Ga0496107_0782557 3300048910 Bacteria 699
756 Ga0496108_0000197 3300048911 Bacteria 55651
757 Ga0496108_0009738 3300048911 Bacteria 7785
758 Ga0496108_0010647 3300048911 Bacteria 7460
759 Ga0496108_0061158 3300048911 Bacteria 3169
760 Ga0496108_0254746 3300048911 Bacteria 1527
761 Ga0496108_0384343 3300048911 Bacteria 1226
762 Ga0496108_1181941 3300048911 Bacteria 647
763 Ga0496109_0000179 3300048912 Bacteria 62857
764 Ga0496109_0010390 3300048912 Bacteria 7949
765 Ga0496109_0378916 3300048912 Bacteria 1336
766 Ga0496109_0403107 3300048912 Bacteria 1292
767 Ga0496110_0000848 3300048913 Bacteria 21521
768 Ga0496110_0022545 3300048913 Bacteria 5347
769 Ga0496110_0067961 3300048913 Bacteria 3154
770 Ga0496110_0212418 3300048913 Bacteria 1759
771 Ga0496110_0238241 3300048913 Bacteria 1655
772 Ga0496110_0593486 3300048913 Bacteria 1005
773 Ga0496110_0961389 3300048913 Bacteria 761
774 Ga0496110_1012471 3300048913 Bacteria 738
775 Ga0496111_0005223 3300048914 Bacteria 8279
776 Ga0496111_0068999 3300048914 Bacteria 2570
777 Ga0496111_0483707 3300048914 Bacteria 912
778 Ga0496112_0015977 3300048915 Bacteria 7017
779 Ga0496112_0037150 3300048915 Bacteria 4754
780 Ga0496112_0045431 3300048915 Bacteria 4306
781 Ga0496112_0213414 3300048915 Bacteria 1887
782 Ga0496112_0272868 3300048915 Bacteria 1639
783 Ga0496112_0680479 3300048915 Bacteria 957
784 Ga0496112_0684537 3300048915 Bacteria 954
785 Ga0496112_1553534 3300048915 Bacteria 575
786 Ga0496112_1664144 3300048915 Bacteria 551
787 Ga0496113_0003191 3300048916 Bacteria 9768
788 Ga0496113_0017808 3300048916 Bacteria 4939
789 Ga0496113_0368695 3300048916 Bacteria 1152
790 Ga0496113_0525720 3300048916 Bacteria 949
791 Ga0496113_0747835 3300048916 Bacteria 779
792 Ga0496113_1106739 3300048916 Bacteria 621
793 Ga0496113_1132345 3300048916 Bacteria 613
794 Ga0496114_0000726 3300048917 Bacteria 24552
795 Ga0496114_0003812 3300048917 Bacteria 11626
796 Ga0496114_1269254 3300048917 Bacteria 623
797 Ga0496115_0026519 3300048918 Bacteria 4523
798 Ga0496116_0000050 3300048919 Bacteria 311670
799 Ga0496116_0006709 3300048919 Bacteria 10371
800 Ga0496117_0000042 3300048920 Bacteria 315470
801 Ga0496117_0017235 3300048920 Bacteria 6042
802 Ga0496118_0000037 3300048921 Bacteria 315470
803 Ga0496118_0003047 3300048921 Bacteria 21585
804 Ga0496118_0016028 3300048921 Bacteria 6899
805 Ga0496119_0000755 3300048922 Bacteria 43406
806 Ga0496119_0007619 3300048922 Bacteria 9709
807 Ga0496119_0251359 3300048922 Bacteria 891
808 Ga0496119_0289710 3300048922 Bacteria 811
809 Ga0496120_0000449 3300048923 Bacteria 65290
810 Ga0496120_0005714 3300048923 Bacteria 9810
811 Ga0496120_0361758 3300048923 Bacteria 649
812 Ga0496121_0000014 3300048924 Bacteria 609379
813 Ga0496121_0000039 3300048924 Bacteria 351444
814 Ga0496122_0000084 3300048925 Bacteria 208740
815 Ga0496122_0111023 3300048925 Bacteria 1799
816 Ga0496123_0008199 3300048926 Bacteria 9634
817 Ga0496123_0009907 3300048926 Bacteria 8503
818 Ga0496124_0000019 3300048927 Bacteria 436995
819 Ga0496125_0000014 3300048928 Bacteria 610124
820 Ga0496126_0000017 3300048929 Bacteria 610676
821 Ga0496126_0009543 3300048929 Bacteria 10295
822 Ga0496126_0067628 3300048929 Bacteria 3192
823 Ga0496126_0277870 3300048929 Bacteria 1388
824 Ga0496126_0806645 3300048929 Bacteria 720
825 Ga0495682_0153877 3300049460 Bacteria 820
826 Ga0501032_0014075 3300049569 Bacteria 5673
827 Ga0501032_0423331 3300049569 Bacteria 854
828 Ga0501033_0011437 3300049570 Bacteria 6792
829 Ga0501033_0599950 3300049570 Bacteria 755
830 Ga0501034_0002932 3300049571 Bacteria 19775
831 Ga0501034_0036887 3300049571 Bacteria 4950
832 Ga0501034_0056675 3300049571 Bacteria 3942
833 Ga0501036_0018883 3300049572 Bacteria 5784
834 Ga0501037_0000111 3300049573 Bacteria 75787
835 Ga0501038_0006956 3300049574 Bacteria 10441
836 Ga0501039_0000326 3300049575 Bacteria 33921
837 Ga0501043_0000138 3300049579 Bacteria 67691
838 Ga0501043_0110471 3300049579 Bacteria 2159
839 Ga0501046_0741622 3300049580 Bacteria 690
840 Ga0501047_0011522 3300049581 Bacteria 8370
841 Ga0501047_0035047 3300049581 Bacteria 4847
842 Ga0501067_0469154 3300049583 Bacteria 703
843 Ga0501069_0181851 3300049585 Bacteria 1215
844 Ga0501070_0009460 3300049586 Bacteria 8238
845 Ga0501070_0109514 3300049586 Bacteria 2282
846 Ga0501070_0159192 3300049586 Bacteria 1862
847 Ga0501073_0004585 3300049589 Bacteria 10387
848 Ga0501225_0111544 3300049705 Bacteria 807
849 Ga0501080_0818800 3300049742 Bacteria 816
850 Ga0501279_091450 3300049775 Bacteria 537
851 Ga0501035_0000595 3300049822 Bacteria 39851
852 Ga0501035_0648327 3300049822 Bacteria 856
853 Ga0501035_1516412 3300049822 Bacteria 511
854 Ga0501044_0001470 3300049823 Bacteria 27679
855 Ga0501044_0005714 3300049823 Bacteria 13788
856 Ga0501044_0655936 3300049823 Bacteria 938
857 nmdc:mga03683_17710_c1 3300050489 Bacteria 2700
858 nmdc:mga03683_20201_c1 3300050489 Bacteria 2553
859 nmdc:mga03683_209379_c1 3300050489 Bacteria 897
860 nmdc:mga03683_223527_c1 3300050489 Bacteria 869
861 nmdc:mga03683_291073_c1 3300050489 Bacteria 764
862 nmdc:mga03683_361986_c1 3300050489 Bacteria 688
863 nmdc:mga03683_5838_c2 3300050489 Bacteria 2425
864 nmdc:mga03683_703125_c1 3300050489 Bacteria 500
865 nmdc:mga03n38_12485_c1 3300050490 Bacteria 3199
866 nmdc:mga03n38_18393_c1 3300050490 Bacteria 2758
867 nmdc:mga03n38_2336_c1 3300050490 Bacteria 5832
868 nmdc:mga03n38_345330_c1 3300050490 Bacteria 809
869 nmdc:mga03n38_3934_c1 3300050490 Bacteria 4844
870 nmdc:mga03n38_424024_c1 3300050490 Bacteria 736
871 nmdc:mga03n38_49933_c1 3300050490 Bacteria 1862
872 nmdc:mga03n38_569053_c1 3300050490 Bacteria 643
873 nmdc:mga03n38_574692_c1 3300050490 Bacteria 640
874 nmdc:mga03n38_642869_c1 3300050490 Bacteria 607
875 nmdc:mga03n38_78632_c1 3300050490 Bacteria 1544
876 nmdc:mga03n38_88873_c1 3300050490 Bacteria 1467
877 nmdc:mga03n38_943840_c1 3300050490 Bacteria 509
878 nmdc:mga00v17_10758_c1 3300050491 Bacteria 5012
879 nmdc:mga00v17_1996_c1 3300050491 Bacteria 10522
880 nmdc:mga00v17_24943_c1 3300050491 Bacteria 3471
881 nmdc:mga00v17_26502_c1 3300050491 Bacteria 3379
882 nmdc:mga00v17_289668_c1 3300050491 Bacteria 1063
883 nmdc:mga00v17_30985_c1 3300050491 Bacteria 3151
884 nmdc:mga00v17_31080_c1 3300050491 Bacteria 3147
885 nmdc:mga00v17_313201_c1 3300050491 Bacteria 1020
886 nmdc:mga00v17_349482_c1 3300050491 Bacteria 961
887 nmdc:mga00v17_426245_c1 3300050491 Bacteria 862
888 nmdc:mga00v17_5857_c1 3300050491 Bacteria 6492
889 nmdc:mga00v17_600313_c1 3300050491 Bacteria 710
890 nmdc:mga00v17_723892_c1 3300050491 Bacteria 637
891 nmdc:mga00v17_767861_c1 3300050491 Bacteria 615
892 nmdc:mga00v17_87367_c1 3300050491 Bacteria 1954
893 nmdc:mga00v17_9275_c1 3300050491 Bacteria 5320
894 nmdc:mga0yw44_1060965_c1 3300050492 Bacteria 548
895 nmdc:mga0yw44_112919_c1 3300050492 Bacteria 1743
896 nmdc:mga0yw44_12734_c1 3300050492 Bacteria 4396
897 nmdc:mga0yw44_136817_c1 3300050492 Bacteria 1590
898 nmdc:mga0yw44_226925_c1 3300050492 Bacteria 1239
899 nmdc:mga0yw44_361688_c1 3300050492 Bacteria 978
900 nmdc:mga0yw44_414858_c1 3300050492 Bacteria 911
901 nmdc:mga0yw44_43965_c1 3300050492 Bacteria 2670
902 nmdc:mga0yw44_451350_c1 3300050492 Bacteria 871
903 nmdc:mga0yw44_5806_c1 3300050492 Bacteria 5885
904 nmdc:mga0yw44_919351_c1 3300050492 Unclassified 593
905 nmdc:mga0yw44_952073_c1 3300050492 Bacteria 582
906 nmdc:mga0k408_168020_c1 3300050493 Bacteria 968
907 nmdc:mga0k408_283366_c1 3300050493 Bacteria 989
908 nmdc:mga06z11_190159_c1 3300050494 Bacteria 1188
909 nmdc:mga06z11_28103_c1 3300050494 Bacteria 2695
910 nmdc:mga06z11_49463_c1 3300050494 Bacteria 2145
911 nmdc:mga06z11_913712_c1 3300050494 Bacteria 535
912 nmdc:mga04h51_129080_c1 3300050495 Bacteria 949
913 nmdc:mga04h51_158492_c1 3300050495 Bacteria 869
914 nmdc:mga04h51_161984_c1 3300050495 Bacteria 861
915 nmdc:mga04h51_79754_c1 3300050495 Bacteria 1159
916 nmdc:mga07m45_30774_c1 3300050496 Bacteria 2974
917 nmdc:mga07m45_320016_c1 3300050496 Bacteria 902
918 nmdc:mga07m45_388629_c1 3300050496 Bacteria 810
919 nmdc:mga07m45_429943_c1 3300050496 Bacteria 766
920 nmdc:mga07m45_51788_c1 3300050496 Bacteria 2316
921 nmdc:mga07m45_5756_c1 3300050496 Bacteria 6203
922 nmdc:mga07m45_605303_c1 3300050496 Bacteria 633
923 nmdc:mga07m45_73023_c1 3300050496 Bacteria 1953
924 nmdc:mga07m45_73247_c1 3300050496 Bacteria 1950
925 nmdc:mga07m45_86068_c1 3300050496 Bacteria 1798
926 nmdc:mga0qj67_65928_c1 3300050509 Bacteria 2883
927 nmdc:mga0qj67_753230_c1 3300050509 Bacteria 773
928 nmdc:mga08y16_1389674_c1 3300050511 Bacteria 666
929 nmdc:mga08y16_1668194_c1 3300050511 Bacteria 593
930 nmdc:mga0sz30_125595_c2 3300050516 Bacteria 664
931 nmdc:mga0sz30_16796_c1 3300050516 Bacteria 2912
932 nmdc:mga0sz30_1708_c1 3300050516 Bacteria 7793
933 nmdc:mga0sz30_258379_c1 3300050516 Bacteria 775
934 nmdc:mga0sz30_258429_c1 3300050516 Bacteria 775
935 nmdc:mga0sz30_29997_c1 3300050516 Bacteria 2245
936 nmdc:mga0sz30_34470_c1 3300050516 Bacteria 2107
937 nmdc:mga0sz30_351828_c1 3300050516 Bacteria 658
938 nmdc:mga0sz30_36923_c1 3300050516 Bacteria 2043
939 nmdc:mga0sz30_503266_c1 3300050516 Bacteria 545
940 nmdc:mga0sz30_5127_c1 3300050516 Bacteria 4794
941 nmdc:mga0sz30_517003_c1 3300050516 Bacteria 537
942 nmdc:mga0sz30_5308_c1 3300050516 Bacteria 4722
943 nmdc:mga0sz30_560160_c1 3300050516 Bacteria 516
944 nmdc:mga0sz30_908_c1 3300050516 Bacteria 10639
945 Ga0495655_0015478 3300053083 Bacteria 1622
946 Ga0495619_0123533 3300053085 Bacteria 1775
947 Ga0500578_0537385 3300053086 Bacteria 652
948 Ga0500643_017409 3300053087 Bacteria 2407
949 Ga0500641_0310626 3300053096 Bacteria 644
950 Ga0500628_056471 3300053129 Bacteria 947
951 Ga0500642_0158555 3300053130 Bacteria 1061
952 Ga0500642_0373808 3300053130 Bacteria 628
953 Ga0500588_0280006 3300053146 Bacteria 630
954 Ga0500616_0007498 3300053153 Bacteria 6919
955 Ga0466962_0110549 3300061719 Bacteria 1323
956 2842137968 2842134933 Bacteria 5847019
957 2902815013 2902810491 Bacteria 6794147
958 Ga0070668_100907877
959 CNXas_1006585
960 CNXas_1008855
961 JGI24747J21853_1002039
962 JGI24739J22299_10047155
963 JGI24737J22298_10024376
964 JGI24737J22298_10056757
965 JGI24750J21931_1001734
966 JGI24745J21846_1045985
967 JGI24738J21930_10007182
968 JGI24738J21930_10039933
969 JGI24744J21845_10001385
970 JGI24744J21845_10015867
971 JGI24744J21845_10021647
972 JGI24034J26672_10026934
973 JGI24034J26672_10031550
974 JGI24742J22300_10000717
975 JGI24742J22300_10006185
976 JGI24751J29686_10011577
977 rootH2_10104888
978 Ga0055528_1058316
979 Ga0055540_1005419
980 Ga0055540_1010561
981 Ga0055540_1022945
982 Ga0070658_10511111
983 Ga0070676_10138685
984 Ga0070676_11400611
985 Ga0070683_100160223
986 Ga0070683_100557077
987 Ga0070690_100011802
988 Ga0070690_100577413
989 Ga0070690_101155232
990 Ga0070670_100797397
991 Ga0070677_10196921
992 Ga0068869_100035051
993 Ga0070666_10015067
994 Ga0070666_10105893
995 Ga0070682_100313200
996 Ga0070682_100541044
997 Ga0068868_100043386
998 Ga0068868_100119195
999 Ga0068868_100229701
1000 Ga0068868_100384606
1001 Ga0070660_100241413
1002 Ga0070660_100788820
1003 Ga0070689_100012630
1004 Ga0070689_100128859
1005 Ga0070691_10012640
1006 Ga0070687_100127670
1007 Ga0070692_10142548
1008 Ga0070692_10244629
1009 Ga0070668_100001153
1010 Ga0070668_100067301
1011 Ga0070668_100137005
1012 Ga0070668_100610676
1013 Ga0070668_102161898
1014 Ga0070669_100823497
1015 Ga0070669_101243288
1016 Ga0070675_100094838
1017 Ga0070671_100090946
1018 Ga0070671_100334649
1019 Ga0070671_100621845
1020 Ga0070671_101613551
1021 Ga0070674_100105985
1022 Ga0070674_100154601
1023 Ga0070674_101264101
1024 Ga0070673_100311610
1025 Ga0070673_100729388
1026 Ga0070688_100130511
1027 Ga0070688_100262971
1028 Ga0070688_100321842
1029 Ga0070659_100319662
1030 Ga0070659_100432021
1031 Ga0070667_100001656
1032 Ga0070667_100018832
1033 Ga0070667_100094173
1034 Ga0070667_100342810
1035 Ga0070703_10044200
1036 Ga0070703_10046940
1037 Ga0070714_100019331
1038 Ga0070714_100270119
1039 Ga0070713_100140548
1040 Ga0070710_10000684
1041 Ga0070710_10184016
1042 Ga0070710_10199442
1043 Ga0070701_10001739
1044 Ga0070701_11373889
1045 Ga0070711_100019602
1046 Ga0070711_100178565
1047 Ga0070711_100238733
1048 Ga0070711_101778616
1049 Ga0070705_100009399
1050 Ga0070705_100537786
1051 Ga0070700_100005646
1052 Ga0070694_100003997
1053 Ga0070708_100472589
1054 Ga0070663_100017710
1055 Ga0070663_100091891
1056 Ga0070663_100173383
1057 Ga0070663_100608395
1058 Ga0070663_101092455
1059 Ga0070678_100002898
1060 Ga0070678_100301620
1061 Ga0070678_101501884
1062 Ga0070662_100003167
1063 Ga0070662_100320122
1064 Ga0068867_100000819
1065 Ga0068867_100193456
1066 Ga0070685_10842424
1067 Ga0070707_101495994
1068 Ga0070679_100565197
1069 Ga0070684_100169935
1070 Ga0070697_101536817
1071 Ga0068853_100007752
1072 Ga0068853_100144478
1073 Ga0070672_100763514
1074 Ga0070686_100051532
1075 Ga0070695_100022299
1076 Ga0070695_100106176
1077 Ga0070696_100039420
1078 Ga0070696_100416840
1079 Ga0070693_100113612
1080 Ga0070665_100003448
1081 Ga0070665_100013763
1082 Ga0070665_100016676
1083 Ga0070665_101284657
1084 Ga0070704_100037105
1085 Ga0070704_100042439
1086 Ga0070704_102030485
1087 Ga0068855_100814267
1088 Ga0068854_100000301
1089 Ga0068854_100207300
1090 Ga0068854_100400204
1091 Ga0068854_100483994
1092 Ga0068854_100575676
1093 Ga0068856_100495410
1094 Ga0068856_102160246
1095 Ga0070702_100000480
1096 Ga0070702_100018901
1097 Ga0070702_100088528
1098 Ga0070702_100948453
1099 Ga0068852_100492411
1100 Ga0068852_100525147
1101 Ga0068852_100559881
1102 Ga0068859_100002385
1103 Ga0068859_100226533
1104 Ga0068859_100919227
1105 Ga0068859_101130889
1106 Ga0068866_10000373
1107 Ga0068866_10059764
1108 Ga0068861_100001911
1109 Ga0068861_100105496
1110 Ga0068861_100333174
1111 Ga0068851_10091226
1112 Ga0068863_100016574
1113 Ga0068863_100099887
1114 Ga0068863_100546247
1115 Ga0068863_100701959
1116 Ga0068858_100001749
1117 Ga0068858_100084184
1118 Ga0068858_100676416
1119 Ga0068860_100050762
1120 Ga0068860_100067015
1121 Ga0068860_100081645
1122 Ga0068860_101607691
1123 Ga0068862_100002533
1124 Ga0068862_100173136
1125 Ga0068862_100267717
1126 Ga0081455_10036835
1127 Ga0081455_10259675
1128 Ga0081538_10091548
1129 Ga0081538_10281643
1130 Ga0075365_10018316
1131 Ga0075365_10043186
1132 Ga0075365_10049178
1133 Ga0075365_10059085
1134 Ga0075365_10074027
1135 Ga0075365_10165419
1136 Ga0075365_10389020
1137 Ga0075365_10508061
1138 Ga0075365_10518008
1139 Ga0075365_10973704
1140 Ga0075368_10104836
1141 Ga0075368_10132407
1142 Ga0075368_10389637
1143 Ga0075368_10455524
1144 Ga0075368_10480904
1145 Ga0075363_100005318
1146 Ga0075363_100006581
1147 Ga0075363_100008963
1148 Ga0075363_100034870
1149 Ga0075363_100070261
1150 Ga0075363_100079824
1151 Ga0075363_100153328
1152 Ga0075363_100185174
1153 Ga0075363_100201692
1154 Ga0075363_100640839
1155 Ga0075364_10000608
1156 Ga0075364_10003346
1157 Ga0075364_10013476
1158 Ga0075364_10019857
1159 Ga0075364_10078599
1160 Ga0075364_10225066
1161 Ga0075364_10262904
1162 Ga0075364_10312857
1163 Ga0075364_10358293
1164 Ga0075364_10365236
1165 Ga0075364_10391996
1166 Ga0075364_10531943
1167 Ga0075364_10535291
1168 Ga0075364_10629182
1169 Ga0075364_10839330
1170 Ga0075364_10879468
1171 Ga0075364_10970993
1172 Ga0075364_11080832
1173 Ga0070715_10000718
1174 Ga0070715_10007515
1175 Ga0070716_100004652
1176 Ga0070716_100049687
1177 Ga0070716_100268510
1178 Ga0070716_100375251
1179 Ga0070716_101550145
1180 Ga0070712_100037154
1181 Ga0070712_100065980
1182 Ga0070712_100246643
1183 Ga0075362_10024970
1184 Ga0075362_10025455
1185 Ga0075362_10058936
1186 Ga0075362_10187530
1187 Ga0075362_10263292
1188 Ga0075362_10583032
1189 Ga0075362_10784898
1190 Ga0075367_10028194
1191 Ga0075367_10055517
1192 Ga0075367_10198018
1193 Ga0075367_10288151
1194 Ga0075367_10585137
1195 Ga0075367_10744617
1196 Ga0075369_10001584
1197 Ga0075369_10002127
1198 Ga0075369_10005917
1199 Ga0075369_10009541
1200 Ga0075369_10013585
1201 Ga0075369_10021501
1202 Ga0075369_10060062
1203 Ga0075369_10081753
1204 Ga0075369_10085271
1205 Ga0075369_10103868
1206 Ga0075369_10229680
1207 Ga0075369_10236322
1208 Ga0075369_10285076
1209 Ga0075369_10473069
1210 Ga0075369_10582358
1211 Ga0075369_10600374
1212 Ga0075366_10429027
1213 Ga0097621_100036417
1214 Ga0075370_10001846
1215 Ga0075370_10005781
1216 Ga0075370_10052270
1217 Ga0075370_10066126
1218 Ga0075370_10076982
1219 Ga0075370_10108659
1220 Ga0075370_10206737
1221 Ga0075370_10382983
1222 Ga0075370_10431497
1223 Ga0075370_10819971
1224 Ga0068871_100099622
1225 Ga0068871_100216349
1226 Ga0075428_100004424
1227 Ga0075430_100067404
1228 Ga0075430_100882422
1229 Ga0068865_100020421
1230 Ga0068865_100161128
1231 Ga0097620_100002385
1232 Ga0097620_100226548
1233 Ga0097620_100919029
1234 Ga0097620_101130877
1235 Ga0099794_10746859
1236 Ga0099795_10022970
1237 Ga0105251_10515184
1238 Ga0105244_10161023
1239 Ga0105250_10029040
1240 Ga0105250_10082270
1241 Ga0105250_10211875
1242 Ga0105240_12018480
1243 Ga0111539_10889668
1244 Ga0111539_11156347
1245 Ga0111539_13274826
1246 Ga0105245_10002642
1247 Ga0105245_10068844
1248 Ga0105245_10275830
1249 Ga0105245_10498765
1250 Ga0105245_11689963
1251 Ga0105245_12016897
1252 Ga0105247_10001763
1253 Ga0105247_10042071
1254 Ga0105247_10213659
1255 Ga0105247_10502788
1256 Ga0105243_10001936
1257 Ga0105243_11137589
1258 Ga0105241_10023048
1259 Ga0105241_10208059
1260 Ga0105241_10922542
1261 Ga0105241_12590041
1262 Ga0105242_10001287
1263 Ga0105242_10072434
1264 Ga0105242_12725289
1265 Ga0105248_10003941
1266 Ga0105248_10279683
1267 Ga0105248_10826817
1268 Ga0105248_12739117
1269 Ga0105237_10000298
1270 Ga0105237_10010042
1271 Ga0105237_10149505
1272 Ga0105237_10195534
1273 Ga0105237_10280095
1274 Ga0105237_12151867
1275 Ga0105238_10155350
1276 Ga0105238_10282773
1277 Ga0105238_10339621
1278 Ga0105238_11378936
1279 Ga0105249_10008335
1280 Ga0105249_10158488
1281 Ga0105249_10344392
1282 Ga0105249_11460011
1283 Ga0105239_10014559
1284 Ga0105239_10159940
1285 Ga0105239_10451941
1286 Ga0105239_10489143
1287 Ga0105246_10067655
1288 Ga0105246_12061578
1289 Ga0157370_11414265
1290 Ga0157369_10160325
1291 Ga0157369_10205413
1292 Ga0157369_10438264
1293 Ga0157374_10354251
1294 Ga0157378_10008016
1295 Ga0157378_10208674
1296 Ga0157378_11865938
1297 Ga0163162_10024373
1298 Ga0163162_10113372
1299 Ga0163162_10137885
1300 Ga0163162_10430913
1301 Ga0163162_12365613
1302 Ga0157372_10203882
1303 Ga0157372_10272708
1304 Ga0157372_10590783
1305 Ga0157375_10002874
1306 Ga0157375_10094780
1307 Ga0157375_10557412
1308 Ga0157375_11985710
1309 Ga0163163_10138681
1310 Ga0163163_10144462
1311 Ga0163163_10728358
1312 Ga0163163_10921481
1313 Ga0163163_11429649
1314 Ga0157380_10071167
1315 Ga0157380_10182970
1316 Ga0157380_11720797
1317 Ga0182008_10073483
1318 Ga0157377_10183621
1319 Ga0157377_10224806
1320 Ga0157379_10003493
1321 Ga0157379_10110078
1322 Ga0157376_10079859
1323 Ga0157376_10166263
1324 Ga0163161_10000541
1325 Ga0163161_10090463
1326 Ga0163161_11021255
1327 Ga0163161_11100255
1328 Ga0213876_10012529
1329 Ga0213876_10319989
1330 Ga0213875_10009593
1331 Ga0209673_1007316
1332 Ga0209025_1085844
1333 Ga0209051_1000021
1334 Ga0209051_1000851
1335 Ga0209051_1001100
1336 Ga0209051_1032676
1337 Ga0209051_1096707
1338 Ga0207696_1076121
1339 Ga0207696_1088842
1340 Ga0207653_10010466
1341 Ga0207682_10049138
1342 Ga0207692_10000155
1343 Ga0207692_10118242
1344 Ga0207642_10002811
1345 Ga0207642_10154873
1346 Ga0207710_10001993
1347 Ga0207710_10039727
1348 Ga0207710_10110901
1349 Ga0207688_10000811
1350 Ga0207688_10001753
1351 Ga0207688_10165081
1352 Ga0207688_10706254
1353 Ga0207680_10022015
1354 Ga0207680_10330484
1355 Ga0207680_10527697
1356 Ga0207647_10020704
1357 Ga0207647_10269496
1358 Ga0207685_10004464
1359 Ga0207685_10044207
1360 Ga0207685_10841796
1361 Ga0207699_10011470
1362 Ga0207699_10045823
1363 Ga0207699_10136083
1364 Ga0207645_10026494
1365 Ga0207645_10321392
1366 Ga0207643_10302159
1367 Ga0207705_10490719
1368 Ga0207654_10388555
1369 Ga0207654_10730096
1370 Ga0207654_10957483
1371 Ga0207707_10864134
1372 Ga0207671_10012421
1373 Ga0207671_10028732
1374 Ga0207671_10150786
1375 Ga0207671_10269246
1376 Ga0207693_10000569
1377 Ga0207693_10004579
1378 Ga0207693_10276532
1379 Ga0207693_10323596
1380 Ga0207663_10001069
1381 Ga0207663_10120439
1382 Ga0207662_10119720
1383 Ga0207657_10389992
1384 Ga0207652_10514053
1385 Ga0207646_11468848
1386 Ga0207681_10016959
1387 Ga0207681_10305972
1388 Ga0207694_10249823
1389 Ga0207694_10667604
1390 Ga0207650_10579309
1391 Ga0207659_10492169
1392 Ga0207687_10149253
1393 Ga0207687_10181826
1394 Ga0207700_10086248
1395 Ga0207700_10390139
1396 Ga0207664_10351172
1397 Ga0207664_10386419
1398 Ga0207644_10097229
1399 Ga0207644_10101003
1400 Ga0207644_10119361
1401 Ga0207644_10674514
1402 Ga0207690_10759942
1403 Ga0207706_10003525
1404 Ga0207706_10435593
1405 Ga0207686_10036190
1406 Ga0207686_10150422
1407 Ga0207709_10001301
1408 Ga0207670_10062362
1409 Ga0207670_10260747
1410 Ga0207669_10021751
1411 Ga0207669_10177963
1412 Ga0207704_10007564
1413 Ga0207704_10027591
1414 Ga0207665_10001819
1415 Ga0207665_10003777
1416 Ga0207665_10518293
1417 Ga0207691_11041430
1418 Ga0207711_10075139
1419 Ga0207711_10332379
1420 Ga0207711_10591950
1421 Ga0207689_10035026
1422 Ga0207689_10053347
1423 Ga0207661_10291688
1424 Ga0207661_10750269
1425 Ga0207667_10631816
1426 Ga0207651_10052550
1427 Ga0207712_10006360
1428 Ga0207712_10160899
1429 Ga0207712_10228648
1430 Ga0207668_10094941
1431 Ga0207668_10124674
1432 Ga0207668_10166811
1433 Ga0207668_10579320
1434 Ga0207668_11763726
1435 Ga0207668_11875771
1436 Ga0207640_10058256
1437 Ga0207640_10273819
1438 Ga0207640_10493265
1439 Ga0207658_10012743
1440 Ga0207658_10026484
1441 Ga0207658_10128291
1442 Ga0207658_10162507
1443 Ga0207677_10001267
1444 Ga0207677_10337326
1445 Ga0207677_10724724
1446 Ga0207677_10806937
1447 Ga0207703_10005162
1448 Ga0207703_10606010
1449 Ga0207703_10856725
1450 Ga0207639_10039251
1451 Ga0207639_10221199
1452 Ga0207678_10009728
1453 Ga0207678_10014504
1454 Ga0207678_10038103
1455 Ga0207678_10498851
1456 Ga0207708_10001638
1457 Ga0207708_10354768
1458 Ga0207702_10119359
1459 Ga0207702_12315302
1460 Ga0207641_10001710
1461 Ga0207641_10559478
1462 Ga0207641_10679872
1463 Ga0207648_10002899
1464 Ga0207648_10071991
1465 Ga0207674_10570179
1466 Ga0207675_100018977
1467 Ga0207675_100021572
1468 Ga0207675_100289801
1469 Ga0207683_10001716
1470 Ga0207683_10010967
1471 Ga0207683_10359077
1472 Ga0207683_10681669
1473 Ga0207698_10480555
1474 Ga0209813_10070309
1475 Ga0209813_10143937
1476 Ga0209813_10199879
1477 Ga0209813_10212680
1478 Ga0209813_10486309
1479 Ga0207428_10207153
1480 Ga0268266_10003448
1481 Ga0268266_10028849
1482 Ga0268266_10110763
1483 Ga0268266_12328413
1484 Ga0268265_10000842
1485 Ga0268265_10036169
1486 Ga0268265_10212928
1487 Ga0268264_10003437
1488 Ga0268264_10035098
1489 Ga0265327_10002020
1490 Ga0307408_100602059
1491 Ga0316578_10532633
1492 Ga0307405_10153601
1493 Ga0307405_11714449
1494 Ga0307413_10004998
1495 Ga0307413_11471028
1496 Ga0307410_10264018
1497 Ga0307410_10380114
1498 Ga0307410_11164587
1499 Ga0307410_11908499
1500 Ga0307406_10026454
1501 Ga0307407_10125110
1502 Ga0307412_10383189
1503 Ga0307412_10560680
1504 Ga0307412_10662202
1505 Ga0307409_100230223
1506 Ga0307409_100359504
1507 Ga0307409_100455910
1508 Ga0307409_101112490
1509 Ga0307416_100004526
1510 Ga0307416_100762953
1511 Ga0307416_101636570
1512 Ga0307414_10325459
1513 Ga0307415_100035593
1514 Ga0307415_100227088
1515 Ga0307415_100800191
1516 Ga0307415_101268711
1517 Ga0373958_0047160
1518 Ga0373958_0052154
1519 Ga0373940_0347757
1520 Ga0373949_0059797
1521 Ga0373952_0056380
1522 Ga0373932_0134448
1523 Ga0373939_0025784
1524 Ga0373939_0055344
1525 Ga0373941_0135362
1526 Ga0373960_0098413
1527 Ga0373962_0104784
1528 Ga0373931_0034339
1529 Ga0373947_0123165
1530 Ga0316582_0512179
1531 Ga0316584_0134344
1532 Ga0395905_1830199
1533 Ga0436364_0914349
1534 Ga0436365_0615832
1535 Ga0436365_1175019
1536 Ga0436365_1237616
1537 Ga0436365_1650565
1538 Ga0436360_1310369
1539 Ga0436361_0524309
1540 Ga0436363_0173342
1541 Ga0436363_0740702
1542 Ga0439461_0000076
1543 Ga0439461_0021949
1544 Ga0439461_0025202
1545 Ga0439466_0003739
1546 Ga0439466_0003782
1547 Ga0439465_0006761
1548 Ga0439465_0007389
1549 Ga0439465_0009070
1550 Ga0439465_0072465
1551 Ga0439465_0255334
1552 Ga0451789_0602891
1553 Ga0451793_0627973
1554 Ga0451793_1365826
1555 Ga0451795_0095207
1556 Ga0451802_0295480
1557 Ga0451802_0365394
1558 Ga0451802_2076848
1559 Ga0451804_0145343
1560 Ga0451807_1765507
1561 Ga0451807_1858641
1562 Ga0451837_1109350
1563 Ga0451839_0352500
1564 Ga0451847_0147688
1565 Ga0451847_0751010
1566 Ga0451851_0447051
1567 Ga0451853_1516494
1568 Ga0451853_2678571
1569 Ga0439431_0029850
1570 Ga0439431_0043819
1571 Ga0439431_0073958
1572 Ga0439442_020654
1573 Ga0439442_149330
1574 Ga0439445_0005355
1575 Ga0439445_0022747
1576 Ga0439445_0085557
1577 Ga0439448_0006605
1578 Ga0439450_104204
1579 Ga0439434_0029210
1580 Ga0439459_0057477
1581 Ga0466969_0058565
1582 Ga0466969_0151109
1583 Ga0466972_0025359
1584 Ga0466972_0198721
1585 Ga0466972_0199085
1586 Ga0466972_0442779
1587 Ga0466972_0504873
1588 Ga0466965_0022598
1589 Ga0466965_0030299
1590 Ga0466965_0092432
1591 Ga0466965_0287777
1592 Ga0466966_0012025
1593 Ga0466966_0150877
1594 Ga0466966_0195144
1595 Ga0466961_0004452
1596 Ga0466961_0022586
1597 Ga0466961_0415757
1598 Ga0466964_0171321
1599 Ga0466971_0143519
1600 Ga0466971_0275297
1601 Ga0466968_0001609
1602 Ga0466968_0007708
1603 Ga0466968_0022966
1604 Ga0466968_0467706
1605 Ga0466968_0601436
1606 Ga0466970_0003858
1607 Ga0466970_0010400
1608 Ga0466970_0019205
1609 Ga0466970_0229721
1610 Ga0466970_0453856
1611 Ga0466957_0001871
1612 Ga0466957_0014581
1613 Ga0466957_0218390
1614 Ga0466957_1451150
1615 Ga0466960_0001148
1616 Ga0466960_0169554
1617 Ga0466960_0317394
1618 Ga0466960_0348136
1619 Ga0466960_0651298
1620 Ga0466959_0007863
1621 Ga0466959_0012371
1622 Ga0466959_0098004
1623 Ga0466959_0137403
1624 Ga0466958_0001503
1625 Ga0466958_0003168
1626 Ga0466958_0120469
1627 Ga0466958_0336704
1628 Ga0466958_0852657
1629 Ga0466967_0007187
1630 Ga0466967_0049351
1631 Ga0466967_0366874
1632 Ga0466967_0503576
1633 Ga0466967_0509251
1634 Ga0466967_0618105
1635 Ga0466967_0865137
1636 Ga0466967_1802791
1637 Ga0466967_2428694
1638 Ga0495603_0008183
1639 Ga0495590_0194549
1640 Ga0495629_0028866
1641 Ga0495641_0145072
1642 Ga0495583_0073706
1643 Ga0495606_0217136
1644 Ga0495648_0003743
1645 Ga0495642_0197917
1646 Ga0495654_0307865
1647 Ga0495665_0211366
1648 Ga0495640_0681553
1649 Ga0495667_0676913
1650 Ga0495668_0062042
1651 Ga0495668_0698740
1652 Ga0495613_0363885
1653 Ga0495671_0016121
1654 Ga0495649_0520725
1655 Ga0495649_0587085
1656 Ga0495600_0244422
1657 Ga0495660_0460075
1658 Ga0495674_0220385
1659 Ga0495672_0000925
1660 Ga0495676_0456299
1661 Ga0495676_0793989
1662 Ga0495673_0000415
1663 Ga0495686_0201541
1664 Ga0495593_0002253
1665 Ga0496100_0000011
1666 Ga0496100_0001021
1667 Ga0496100_0071738
1668 Ga0496100_0089175
1669 Ga0496100_0218085
1670 Ga0496100_0928276
1671 Ga0496101_0000011
1672 Ga0496101_0000517
1673 Ga0496101_0003953
1674 Ga0496101_0049483
1675 Ga0496101_0118174
1676 Ga0496101_0834464
1677 Ga0496101_0994295
1678 Ga0496102_0000012
1679 Ga0496102_0001078
1680 Ga0496102_0010258
1681 Ga0496102_0178998
1682 Ga0496102_0218261
1683 Ga0496102_0270511
1684 Ga0496102_0483675
1685 Ga0496102_0579905
1686 Ga0496103_0000005
1687 Ga0496103_0000418
1688 Ga0496103_0003102
1689 Ga0496103_0020353
1690 Ga0496103_0040796
1691 Ga0496103_0095529
1692 Ga0496103_0465508
1693 Ga0496104_0084151
1694 Ga0496104_0524707
1695 Ga0496104_0622139
1696 Ga0496104_0916582
1697 Ga0496104_1409186
1698 Ga0496105_0209505
1699 Ga0496105_0633115
1700 Ga0496105_0828708
1701 Ga0496105_0922519
1702 Ga0496106_0000820
1703 Ga0496106_0032809
1704 Ga0496106_0045530
1705 Ga0496106_0053728
1706 Ga0496106_0069585
1707 Ga0496107_0000372
1708 Ga0496107_0001343
1709 Ga0496107_0032564
1710 Ga0496107_0341137
1711 Ga0496107_0454276
1712 Ga0496107_0782557
1713 Ga0496108_0000197
1714 Ga0496108_0009738
1715 Ga0496108_0010647
1716 Ga0496108_0061158
1717 Ga0496108_0254746
1718 Ga0496108_0384343
1719 Ga0496108_1181941
1720 Ga0496109_0000179
1721 Ga0496109_0010390
1722 Ga0496109_0378916
1723 Ga0496109_0403107
1724 Ga0496110_0000848
1725 Ga0496110_0022545
1726 Ga0496110_0067961
1727 Ga0496110_0212418
1728 Ga0496110_0238241
1729 Ga0496110_0593486
1730 Ga0496110_0961389
1731 Ga0496110_1012471
1732 Ga0496111_0005223
1733 Ga0496111_0068999
1734 Ga0496111_0483707
1735 Ga0496112_0015977
1736 Ga0496112_0037150
1737 Ga0496112_0045431
1738 Ga0496112_0213414
1739 Ga0496112_0272868
1740 Ga0496112_0680479
1741 Ga0496112_0684537
1742 Ga0496112_1553534
1743 Ga0496112_1664144
1744 Ga0496113_0003191
1745 Ga0496113_0017808
1746 Ga0496113_0368695
1747 Ga0496113_0525720
1748 Ga0496113_0747835
1749 Ga0496113_1106739
1750 Ga0496113_1132345
1751 Ga0496114_0000726
1752 Ga0496114_0003812
1753 Ga0496114_1269254
1754 Ga0496115_0026519
1755 Ga0496116_0000050
1756 Ga0496116_0006709
1757 Ga0496117_0000042
1758 Ga0496117_0017235
1759 Ga0496118_0000037
1760 Ga0496118_0003047
1761 Ga0496118_0016028
1762 Ga0496119_0000755
1763 Ga0496119_0007619
1764 Ga0496119_0251359
1765 Ga0496119_0289710
1766 Ga0496120_0000449
1767 Ga0496120_0005714
1768 Ga0496120_0361758
1769 Ga0496121_0000014
1770 Ga0496121_0000039
1771 Ga0496122_0000084
1772 Ga0496122_0111023
1773 Ga0496123_0008199
1774 Ga0496123_0009907
1775 Ga0496124_0000019
1776 Ga0496125_0000014
1777 Ga0496126_0000017
1778 Ga0496126_0009543
1779 Ga0496126_0067628
1780 Ga0496126_0277870
1781 Ga0496126_0806645
1782 Ga0495682_0153877
1783 Ga0501032_0014075
1784 Ga0501032_0423331
1785 Ga0501033_0011437
1786 Ga0501033_0599950
1787 Ga0501034_0002932
1788 Ga0501034_0036887
1789 Ga0501034_0056675
1790 Ga0501036_0018883
1791 Ga0501037_0000111
1792 Ga0501038_0006956
1793 Ga0501039_0000326
1794 Ga0501043_0000138
1795 Ga0501043_0110471
1796 Ga0501046_0741622
1797 Ga0501047_0011522
1798 Ga0501047_0035047
1799 Ga0501067_0469154
1800 Ga0501069_0181851
1801 Ga0501070_0009460
1802 Ga0501070_0109514
1803 Ga0501070_0159192
1804 Ga0501073_0004585
1805 Ga0501225_0111544
1806 Ga0501080_0818800
1807 Ga0501279_091450
1808 Ga0501035_0000595
1809 Ga0501035_0648327
1810 Ga0501035_1516412
1811 Ga0501044_0001470
1812 Ga0501044_0005714
1813 Ga0501044_0655936
1814 nmdc:mga03683_17710_c1
1815 nmdc:mga03683_20201_c1
1816 nmdc:mga03683_209379_c1
1817 nmdc:mga03683_223527_c1
1818 nmdc:mga03683_291073_c1
1819 nmdc:mga03683_361986_c1
1820 nmdc:mga03683_5838_c2
1821 nmdc:mga03683_703125_c1
1822 nmdc:mga03n38_12485_c1
1823 nmdc:mga03n38_18393_c1
1824 nmdc:mga03n38_2336_c1
1825 nmdc:mga03n38_345330_c1
1826 nmdc:mga03n38_3934_c1
1827 nmdc:mga03n38_424024_c1
1828 nmdc:mga03n38_49933_c1
1829 nmdc:mga03n38_569053_c1
1830 nmdc:mga03n38_574692_c1
1831 nmdc:mga03n38_642869_c1
1832 nmdc:mga03n38_78632_c1
1833 nmdc:mga03n38_88873_c1
1834 nmdc:mga03n38_943840_c1
1835 nmdc:mga00v17_10758_c1
1836 nmdc:mga00v17_1996_c1
1837 nmdc:mga00v17_24943_c1
1838 nmdc:mga00v17_26502_c1
1839 nmdc:mga00v17_289668_c1
1840 nmdc:mga00v17_30985_c1
1841 nmdc:mga00v17_31080_c1
1842 nmdc:mga00v17_313201_c1
1843 nmdc:mga00v17_349482_c1
1844 nmdc:mga00v17_426245_c1
1845 nmdc:mga00v17_5857_c1
1846 nmdc:mga00v17_600313_c1
1847 nmdc:mga00v17_723892_c1
1848 nmdc:mga00v17_767861_c1
1849 nmdc:mga00v17_87367_c1
1850 nmdc:mga00v17_9275_c1
1851 nmdc:mga0yw44_1060965_c1
1852 nmdc:mga0yw44_112919_c1
1853 nmdc:mga0yw44_12734_c1
1854 nmdc:mga0yw44_136817_c1
1855 nmdc:mga0yw44_226925_c1
1856 nmdc:mga0yw44_361688_c1
1857 nmdc:mga0yw44_414858_c1
1858 nmdc:mga0yw44_43965_c1
1859 nmdc:mga0yw44_451350_c1
1860 nmdc:mga0yw44_5806_c1
1861 nmdc:mga0yw44_919351_c1
1862 nmdc:mga0yw44_952073_c1
1863 nmdc:mga0k408_168020_c1
1864 nmdc:mga0k408_283366_c1
1865 nmdc:mga06z11_190159_c1
1866 nmdc:mga06z11_28103_c1
1867 nmdc:mga06z11_49463_c1
1868 nmdc:mga06z11_913712_c1
1869 nmdc:mga04h51_129080_c1
1870 nmdc:mga04h51_158492_c1
1871 nmdc:mga04h51_161984_c1
1872 nmdc:mga04h51_79754_c1
1873 nmdc:mga07m45_30774_c1
1874 nmdc:mga07m45_320016_c1
1875 nmdc:mga07m45_388629_c1
1876 nmdc:mga07m45_429943_c1
1877 nmdc:mga07m45_51788_c1
1878 nmdc:mga07m45_5756_c1
1879 nmdc:mga07m45_605303_c1
1880 nmdc:mga07m45_73023_c1
1881 nmdc:mga07m45_73247_c1
1882 nmdc:mga07m45_86068_c1
1883 nmdc:mga0qj67_65928_c1
1884 nmdc:mga0qj67_753230_c1
1885 nmdc:mga08y16_1389674_c1
1886 nmdc:mga08y16_1668194_c1
1887 nmdc:mga0sz30_125595_c2
1888 nmdc:mga0sz30_16796_c1
1889 nmdc:mga0sz30_1708_c1
1890 nmdc:mga0sz30_258379_c1
1891 nmdc:mga0sz30_258429_c1
1892 nmdc:mga0sz30_29997_c1
1893 nmdc:mga0sz30_34470_c1
1894 nmdc:mga0sz30_351828_c1
1895 nmdc:mga0sz30_36923_c1
1896 nmdc:mga0sz30_503266_c1
1897 nmdc:mga0sz30_5127_c1
1898 nmdc:mga0sz30_517003_c1
1899 nmdc:mga0sz30_5308_c1
1900 nmdc:mga0sz30_560160_c1
1901 nmdc:mga0sz30_908_c1
1902 Ga0495655_0015478
1903 Ga0495619_0123533
1904 Ga0500578_0537385
1905 Ga0500643_017409
1906 Ga0500641_0310626
1907 Ga0500628_056471
1908 Ga0500642_0158555
1909 Ga0500642_0373808
1910 Ga0500588_0280006
1911 Ga0500616_0007498
1912 Ga0466962_0110549
1913 2842137968
1914 2902815013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19575

HTH_58

Helix-turn-helix domain

14

69

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hno-assembly1.cif.gz_B archaeal transcription factor wild type 0.9468 10 45
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.941 12 47
8hnp-assembly1.cif.gz_B archaeal transcription factor mutant 0.932 10 46
7vim-assembly1.cif.gz_A the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9308 12 47
5o8z-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. 0.9264 10 45
ID Description Score Start End Superfamily
af_P0AED5_2_210_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9424 10 46 3.40.50.2300
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9335 10 47 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9198 10 47 1.10.10.10
2w48A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9132 9 45 1.10.10.60
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9025 10 45 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2U2N1B0-F1-model_v4 Mor transcription activator domain-containing protein 0.9806 8 47
AF-A0A6G3S033-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9799 8 47
AF-A0A7W7FMM4-F1-model_v4 deleted 0.9797 12 55
AF-A0A2S8LTG9-F1-model_v4 deleted 0.9788 16 56
AF-A0A1I4RT72-F1-model_v4 Helix-turn-helix domain-containing protein 0.9659 12 53

Map