F486779

General Info

Members Datasets Scaffolds Average Seq Length
957 686 1915 225

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0139263|Ga0495633_0139263_185_922
Length 245
Sequence MAAPGTTLIEGAKMSETMHVFDTAAELANALAADVAQRLDAATKEYGTASIAVSGGSTPKLFFQALSRHDLDWSNISVTLVDERFVPPESERSNHRLVGENLLQDKAKAAYFVPLFQPAASPEDAATLATVKTEAICDPFDVVVLGMGTDGHTASFFPGGDNLYEALDLDEPRGVLTMAAETAGEERLTFNFSSLHDAGFLVLHIEGAAKKATLEKAQSGEDEDEMPIRAVLNRAETLVDIYWAP

Samples

Sample ID Description Type Environment
1 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
54 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
70 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
119 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
221 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
222 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2509276019 Ensifer aridi TW10 Isolate Nodule
227 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
228 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
229 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
230 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
231 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
232 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
233 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
234 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
235 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
236 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
237 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
238 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
239 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
240 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
241 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
242 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
243 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
244 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
245 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
246 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
247 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
248 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
249 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
250 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
251 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
252 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
253 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
254 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
255 2516143018 Ensifer sp. BR816 Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
258 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
259 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
260 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
261 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
262 2519899620 Rhizobium sp. Pop5 Isolate Nodule
263 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
264 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
265 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
266 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
267 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
268 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
269 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
270 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
271 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
272 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
273 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
274 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
275 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
276 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
277 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
278 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
279 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
280 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
281 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
282 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
283 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
284 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
285 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
286 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
287 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
288 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
289 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
290 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
291 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
292 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
293 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
294 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
295 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
296 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
297 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
298 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
299 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
300 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
301 2643221557 Ensifer sp. Root558 Isolate Unclassified
302 2643221568 Rhizobium sp. Root564 Isolate Unclassified
303 2643221582 Rhizobium sp. Root651 Isolate Unclassified
304 2643221599 Rhizobium sp. Root708 Isolate Unclassified
305 2643221610 Ensifer sp. Root74 Isolate Unclassified
306 2643221668 Ensifer sp. Root423 Isolate Unclassified
307 2643221675 Ensifer sp. Root1298 Isolate Unclassified
308 2643221680 Ensifer sp. Root1312 Isolate Unclassified
309 2643221693 Rhizobium sp. Root491 Isolate Unclassified
310 2643221726 Ensifer sp. Root954 Isolate Unclassified
311 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
312 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
313 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
314 2718217882 Rhizobium sp. N741 Isolate Nodule
315 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
316 2718218009 Rhizobium sp. N561 Isolate Nodule
317 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
318 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
319 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
320 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
321 2718218363 Rhizobium sp. N113 Isolate Nodule
322 2718218365 Rhizobium sp. N731 Isolate Nodule
323 2718218366 Rhizobium sp. N621 Isolate Nodule
324 2721755514 Rhizobium sp. N6212 Isolate Nodule
325 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
326 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
327 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
328 2721755810 Rhizobium sp. N871 Isolate Nodule
329 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
330 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
331 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
332 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
333 2728369365 Rhizobium sp. N1341 Isolate Nodule
334 2728369397 Rhizobium sp. N1314 Isolate Nodule
335 2738541293 Rhizobium sp. GV031 Isolate Unclassified
336 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
337 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
338 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
339 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
340 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
341 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
342 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
343 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
344 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
345 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
346 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
347 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
348 2791355260 Rhizobium sp. L9 Isolate Nodule
349 2791355261 Rhizobium sp. J15 Isolate Nodule
350 2791355264 Rhizobium sp. S9 Isolate Nodule
351 2791355267 Rhizobium sp. L18 Isolate Nodule
352 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
353 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
354 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
355 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
356 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
357 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
358 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
359 2802429633 Rhizobium anhuiense J3 Isolate Nodule
360 2802429634 Rhizobium anhuiense S10 Isolate Nodule
361 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
362 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
363 2802429637 Rhizobium anhuiense C15 Isolate Nodule
364 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
365 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
366 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
367 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
368 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
369 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
370 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
371 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
372 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
373 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
374 2838048938 Rhizobium pisi 27/80 Isolate Nodule
375 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
376 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
377 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
378 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
379 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
380 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
381 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
382 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
383 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
384 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
385 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
386 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
387 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
388 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
389 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
390 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
391 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
392 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
393 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
394 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
395 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
396 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
397 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
398 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
399 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
400 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
401 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
402 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
403 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
404 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
405 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
406 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
407 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
408 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
409 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
410 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
411 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
412 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
413 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
414 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
415 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
416 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
417 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
418 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
419 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
420 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
421 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
422 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
423 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
424 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
425 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
426 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
427 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
428 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
429 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
430 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
431 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
432 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
433 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
434 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
435 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
436 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
437 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
438 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
439 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
440 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
441 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
442 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
443 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
444 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
445 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
446 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
447 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
448 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
449 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
450 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
451 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
452 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
453 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
454 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
455 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
456 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
457 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
458 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
459 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
460 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
461 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
462 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
463 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
464 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
465 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
466 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
467 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
468 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
469 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
470 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
471 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
472 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
473 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
474 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
475 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
476 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
477 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
478 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
479 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
480 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
481 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
482 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
483 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
484 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
485 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
486 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
487 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
488 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
489 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
490 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
491 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
492 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
493 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
494 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
495 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
496 2933599457 Rhizobium phaseoli M3 Isolate Nodule
497 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
498 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
499 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
500 2936381700 Rhizobium chutanense C16 Isolate Unclassified
501 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
502 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
503 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
504 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
505 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
506 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
507 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
508 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
509 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
510 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
511 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
512 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
513 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
514 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
515 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
516 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
517 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
518 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
519 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
520 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
521 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
522 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
523 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
524 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
525 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
526 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
527 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
528 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
529 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
530 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
531 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
532 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
533 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
534 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
535 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
536 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
537 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
538 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
539 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
540 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
541 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
542 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
543 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
544 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
545 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
546 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
547 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
548 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
549 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
550 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
551 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
552 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
553 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
554 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
555 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
556 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
557 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
558 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
559 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
560 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
561 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
562 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
563 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
564 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
565 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
566 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
567 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
568 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
569 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
570 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
571 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
572 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
573 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
574 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
575 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
576 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
577 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
578 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
579 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
580 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
581 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
582 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
583 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
584 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
585 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
586 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
587 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
588 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
589 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
590 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
591 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
592 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
593 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
594 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
595 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
596 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
597 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
598 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
599 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
600 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
601 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
602 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
603 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
604 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
605 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
606 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
607 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
608 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
609 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
610 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
611 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
612 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
613 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
614 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
615 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
616 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
617 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
618 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
619 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
620 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
621 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
622 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
623 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
624 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
625 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
626 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
627 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
628 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
629 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
630 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
631 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
632 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
633 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
634 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
635 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
636 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
637 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
638 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
639 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
640 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
641 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
642 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
643 2996893221 Rhizobium sp. R635 Isolate Nodule
644 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
645 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
646 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
647 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
648 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
649 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
650 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
651 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
652 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
653 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
654 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
655 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
656 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
657 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
658 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
659 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
660 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
661 8005382845 Rhizobium sp. R634 Isolate Nodule
662 8005395548 Rhizobium sp. R339 Isolate Nodule
663 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
664 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
665 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
666 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
667 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
668 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
669 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
670 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
671 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
672 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
673 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
674 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
675 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
676 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
677 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
678 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
679 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
680 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
681 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
682 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
683 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
684 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
685 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
686 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.72
Metatranscriptomes 0.1
Isolates 48.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 16.41
Nodule 38.04
Rhizoplane 1.46
Rhizosphere 26.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495633_0139263 3300046558 Bacteria 1122
2 JGI25155J39150_1000023 3300002704 Bacteria 136961
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25162J39368_1002348 3300002737 Bacteria 7511
5 JGI25154J39366_1000067 3300002738 Bacteria 100452
6 JGI25158J39367_1000254 3300002739 Bacteria 12201
7 JGI25157J39369_1000043 3300002741 Bacteria 122537
8 JGI25152J39213_1006415 3300002773 Bacteria 3218
9 JGI25152J39213_1007261 3300002773 Bacteria 2894
10 JGI25150J39212_1000012 3300002774 Bacteria 182468
11 JGI25159J45721_1000087 3300002987 Bacteria 43868
12 JGI25159J45721_1002669 3300002987 Bacteria 6642
13 JGI25151J46595_10000025 3300003187 Bacteria 213302
14 JGI25151J46595_10000346 3300003187 Bacteria 49745
15 JGI25151J46595_10008951 3300003187 Bacteria 4775
16 JGI25151J46595_10047816 3300003187 Bacteria 1484
17 JGI25165J46597_1000529 3300003214 Bacteria 35691
18 JGI25165J46597_1001287 3300003214 Bacteria 14566
19 JGI25165J46597_1013388 3300003214 Bacteria 1130
20 JGI25153J46596_10002371 3300003215 Bacteria 10908
21 JGI25153J46596_10003997 3300003215 Bacteria 8052
22 rootH1_10041182 3300003316 Bacteria 1303
23 rootH1_10041182 3300003323 Bacteria 1456
24 rootH1_10167985 3300003316 Bacteria 1273
25 rootH2_10017545 3300003320 Bacteria 1127
26 rootH2_10053655 3300003320 Bacteria 1553
27 rootH2_10186027 3300003320 Bacteria 1218
28 rootL2_10099180 3300003322 Bacteria 2159
29 rootH1_10046242 3300003323 Bacteria 1450
30 rootH1_10123595 3300003323 Bacteria 1117
31 JGI25160J50197_1000046 3300003354 Bacteria 141352
32 JGI25160J50197_1000500 3300003354 Bacteria 23279
33 JGI25160J50197_1003907 3300003354 Bacteria 6525
34 JGI25161J50226_1000031 3300003374 Bacteria 141352
35 JGI25161J50226_1000074 3300003374 Bacteria 85547
36 JGI25161J50226_1000382 3300003374 Bacteria 22288
37 Ga0032354_1032914 3300003693 Bacteria 3030
38 Ga0055526_1002431 3300003771 Bacteria 12618
39 Ga0055526_1015836 3300003771 Bacteria 2998
40 Ga0055524_1002633 3300003775 Bacteria 9137
41 Ga0055524_1003868 3300003775 Bacteria 7101
42 Ga0055524_1004431 3300003775 Bacteria 6477
43 Ga0055524_1008508 3300003775 Bacteria 4258
44 Ga0055528_1000303 3300003790 Bacteria 41794
45 Ga0055528_1001497 3300003790 Bacteria 14166
46 Ga0055540_1000471 3300003792 Bacteria 31092
47 Ga0055540_1001471 3300003792 Bacteria 14037
48 Ga0055531_10005094 3300003794 Bacteria 7768
49 Ga0058692_1009082 3300003856 Bacteria 2528
50 Ga0055543_1000008 3300004625 Bacteria 202062
51 Ga0055543_1000141 3300004625 Bacteria 60055
52 Ga0055543_1001182 3300004625 Bacteria 11019
53 Ga0065165_1000031 3300005262 Bacteria 216330
54 Ga0065165_1005966 3300005262 Bacteria 6585
55 Ga0065165_1011908 3300005262 Bacteria 3580
56 Ga0065165_1013652 3300005262 Bacteria 3213
57 Ga0065165_1068442 3300005262 Bacteria 950
58 Ga0065704_10001731 3300005289 Bacteria 9637
59 Ga0070668_100373549 3300005347 Bacteria 1212
60 Ga0070668_100416239 3300005347 Bacteria 1150
61 Ga0070669_100069998 3300005353 Bacteria 2592
62 Ga0070667_100169152 3300005367 Bacteria 1929
63 Ga0070678_100782328 3300005456 Bacteria 865
64 Ga0070665_100014231 3300005548 Bacteria 7991
65 Ga0070665_100220086 3300005548 Bacteria 1899
66 Ga0070665_100536846 3300005548 Bacteria 1181
67 Ga0068855_100254945 3300005563 Bacteria 1956
68 Ga0068854_100198901 3300005578 Bacteria 1574
69 Ga0068854_100284660 3300005578 Bacteria 1332
70 Ga0068856_100301256 3300005614 Bacteria 1621
71 Ga0068851_10051204 3300005834 Bacteria 2098
72 Ga0075365_10011895 3300006038 Bacteria 5139
73 Ga0075365_10106442 3300006038 Bacteria 1925
74 Ga0075368_10000571 3300006042 Bacteria 11054
75 Ga0075368_10019855 3300006042 Bacteria 2539
76 Ga0075363_100085615 3300006048 Bacteria 1729
77 Ga0075364_10151574 3300006051 Bacteria 1562
78 Ga0075364_10214680 3300006051 Bacteria 1305
79 Ga0075367_10085263 3300006178 Bacteria 1916
80 Ga0075367_10088173 3300006178 Bacteria 1885
81 Ga0075369_10027622 3300006186 Bacteria 2373
82 Ga0075369_10028567 3300006186 Bacteria 2338
83 Ga0075369_10074301 3300006186 Bacteria 1499
84 Ga0075366_10014660 3300006195 Bacteria 4479
85 Ga0075370_10086455 3300006353 Bacteria 1806
86 Ga0075370_10139831 3300006353 Bacteria 1415
87 Ga0075370_10214402 3300006353 Bacteria 1137
88 Ga0079104_1000876 3300006946 Bacteria 24701
89 Ga0079104_1004688 3300006946 Bacteria 5731
90 Ga0099826_10000216 3300006948 Bacteria 24979
91 Ga0105244_10081231 3300009036 Bacteria 1604
92 Ga0105240_10000278 3300009093 Bacteria 101540
93 Ga0105237_10003138 3300009545 Bacteria 19875
94 Ga0105238_10300955 3300009551 Bacteria 1587
95 Ga0123341_1000192 3300009765 Bacteria 31290
96 Ga0123342_1013143 3300009766 Bacteria 8393
97 Ga0105239_10001623 3300010375 Bacteria 29710
98 Ga0105246_10156879 3300011119 Bacteria 1729
99 Ga0157373_10049858 3300013100 Bacteria 2982
100 Ga0157371_10000058 3300013102 Bacteria 171756
101 Ga0157371_10015095 3300013102 Bacteria 5806
102 Ga0157370_10002372 3300013104 Bacteria 22708
103 Ga0157369_10866275 3300013105 Bacteria 927
104 Ga0171463_1001 3300013249 Bacteria 1406070
105 Ga0163162_11141173 3300013306 Bacteria 884
106 Ga0182007_10045652 3300015262 Bacteria 1452
107 Ga0182005_1022742 3300015265 Bacteria 1716
108 Ga0183363_1012 3300015690 Bacteria 90054
109 Ga0214544_1000012 3300021320 Bacteria 229808
110 Ga0214542_1000011 3300021321 Bacteria 238260
111 Ga0214542_1009335 3300021321 Bacteria 15333
112 Ga0214543_1000004 3300021327 Bacteria 527190
113 Ga0214543_1000256 3300021327 Bacteria 82084
114 Ga0228711_1000019 3300022739 Bacteria 111795
115 Ga0228710_1000022 3300022740 Bacteria 111795
116 Ga0209435_100011 3300025206 Bacteria 413027
117 Ga0209436_100051 3300025208 Bacteria 64359
118 Ga0209437_100036 3300025233 Bacteria 469153
119 Ga0209437_100086 3300025233 Bacteria 254578
120 Ga0207425_1000012 3300025245 Bacteria 528324
121 Ga0207425_1004154 3300025245 Bacteria 4415
122 Ga0207425_1007794 3300025245 Bacteria 2792
123 Ga0209646_1000024 3300025246 Bacteria 413027
124 Ga0209026_1000030 3300025250 Bacteria 329811
125 Ga0209677_101207 3300025253 Bacteria 11759
126 Ga0209148_1004207 3300025254 Bacteria 3610
127 Ga0209759_1000011 3300025256 Bacteria 413027
128 Ga0209129_1000081 3300025258 Bacteria 183694
129 Ga0209129_1000123 3300025258 Bacteria 133661
130 Ga0209129_1000545 3300025258 Bacteria 26086
131 Ga0209129_1003389 3300025258 Bacteria 6996
132 Ga0209233_1000110 3300025261 Bacteria 260825
133 Ga0209233_1000166 3300025261 Bacteria 152270
134 Ga0209233_1000356 3300025261 Bacteria 42791
135 Ga0209455_1020560 3300025272 Bacteria 1302
136 Ga0209673_1000015 3300025273 Bacteria 530618
137 Ga0209673_1000967 3300025273 Bacteria 35634
138 Ga0209673_1001074 3300025273 Bacteria 30901
139 Ga0209673_1002143 3300025273 Bacteria 14688
140 Ga0209673_1003246 3300025273 Bacteria 9824
141 Ga0209130_1000002 3300025284 Bacteria 722648
142 Ga0209130_1000088 3300025284 Bacteria 152927
143 Ga0209130_1008937 3300025284 Bacteria 2904
144 Ga0209675_1039946 3300025291 Bacteria 1035
145 Ga0209676_1003256 3300025292 Bacteria 10221
146 Ga0209676_1015253 3300025292 Bacteria 2836
147 Ga0209025_1000024 3300025294 Bacteria 528324
148 Ga0209025_1000441 3300025294 Bacteria 81951
149 Ga0209025_1000528 3300025294 Bacteria 72802
150 Ga0209025_1000970 3300025294 Bacteria 43006
151 Ga0209025_1016350 3300025294 Bacteria 4388
152 Ga0209025_1093537 3300025294 Bacteria 975
153 Ga0209564_1000382 3300025295 Bacteria 81070
154 Ga0209564_1001938 3300025295 Bacteria 18408
155 Ga0209564_1006978 3300025295 Bacteria 5926
156 Ga0209758_1000046 3300025297 Bacteria 364931
157 Ga0209758_1000349 3300025297 Bacteria 84164
158 Ga0209758_1001048 3300025297 Bacteria 36241
159 Ga0209050_1002637 3300025298 Bacteria 14727
160 Ga0209050_1005205 3300025298 Bacteria 8315
161 Ga0209256_1000180 3300025299 Bacteria 123687
162 Ga0209256_1000874 3300025299 Bacteria 37312
163 Ga0209256_1000991 3300025299 Bacteria 33849
164 Ga0209256_1003297 3300025299 Bacteria 11510
165 Ga0209256_1052758 3300025299 Bacteria 976
166 Ga0207426_1000012 3300025302 Bacteria 730942
167 Ga0207426_1000013 3300025302 Bacteria 721897
168 Ga0207426_1000063 3300025302 Bacteria 358920
169 Ga0207426_1000172 3300025302 Bacteria 163690
170 Ga0209051_1000084 3300025303 Bacteria 190324
171 Ga0209051_1001361 3300025303 Bacteria 21200
172 Ga0209051_1005782 3300025303 Bacteria 7121
173 Ga0209051_1011680 3300025303 Bacteria 4313
174 Ga0209051_1031902 3300025303 Bacteria 2019
175 Ga0209257_1004216 3300025304 Bacteria 11393
176 Ga0209257_1010896 3300025304 Bacteria 4495
177 Ga0209257_1027231 3300025304 Bacteria 1906
178 Ga0207656_10071163 3300025321 Bacteria 1546
179 Ga0207695_10000376 3300025913 Bacteria 101548
180 Ga0207671_10000275 3300025914 Bacteria 76888
181 Ga0207667_10233512 3300025949 Bacteria 1883
182 Ga0207668_10596720 3300025972 Bacteria 962
183 Ga0207658_10022653 3300025986 Bacteria 4376
184 Ga0207678_10193399 3300026067 Bacteria 1739
185 Ga0207702_10062428 3300026078 Bacteria 3182
186 Ga0209281_1000192 3300027111 Bacteria 140252
187 Ga0209281_1000227 3300027111 Bacteria 119329
188 Ga0209281_1001513 3300027111 Bacteria 13209
189 Ga0209371_1000009 3300027312 Bacteria 963030
190 Ga0209371_1000547 3300027312 Bacteria 35249
191 Ga0209371_1003471 3300027312 Bacteria 7634
192 Ga0209282_1000042 3300027666 Bacteria 119329
193 Ga0209282_1012946 3300027666 Bacteria 5308
194 Ga0209813_10018418 3300027866 Bacteria 1930
195 Ga0268266_10003170 3300028379 Bacteria 16690
196 Ga0268266_10215388 3300028379 Bacteria 1763
197 Ga0268256_1000010 3300030500 Bacteria 963034
198 Ga0268256_1003179 3300030500 Bacteria 7634
199 Ga0268256_1021622 3300030500 Bacteria 1706
200 Ga0316181_1112456 3300030744 Bacteria 4196
201 Ga0307513_10118868 3300031456 Bacteria 2616
202 Ga0316575_10021494 3300031665 Bacteria 2484
203 Ga0307405_10001288 3300031731 Bacteria 10466
204 Ga0307412_10009244 3300031911 Bacteria 5650
205 Ga0315914_1000009 3300031967 Bacteria 182444
206 Ga0307409_100134946 3300031995 Bacteria 2116
207 Ga0307416_100292761 3300032002 Bacteria 1613
208 Ga0307414_10011355 3300032004 Bacteria 5219
209 Ga0315913_1000015 3300033430 Bacteria 119325
210 Ga0315915_1000013 3300033464 Bacteria 182438
211 Ga0373927_0000887 3300035695 Bacteria 22766
212 Ga0373925_0003273 3300037068 Bacteria 12613
213 Ga0439465_0016858 3300041413 Bacteria 2280
214 Ga0439465_0021834 3300041413 Bacteria 2009
215 Ga0439465_0033354 3300041413 Bacteria 1646
216 Ga0451787_595301 3300041441 Bacteria 1364
217 Ga0451791_1542001 3300041451 Bacteria 1734
218 Ga0451798_0298663 3300041458 Bacteria 1890
219 Ga0451841_0033924 3300041498 Bacteria 1100
220 Ga0451851_0667480 3300041507 Bacteria 3946
221 Ga0439459_0031337 3300042438 Bacteria 1084
222 Ga0466960_0014783 3300044901 Bacteria 3352
223 Ga0495590_0084389 3300046457 Bacteria 1120
224 Ga0495638_0192024 3300046460 Bacteria 1158
225 Ga0495662_0018301 3300046476 Bacteria 3391
226 Ga0495585_0053852 3300046492 Bacteria 2226
227 Ga0495606_0001322 3300046507 Bacteria 33851
228 Ga0495606_0053292 3300046507 Bacteria 2625
229 Ga0495606_0106257 3300046507 Bacteria 1700
230 Ga0495610_0123856 3300046512 Bacteria 1129
231 Ga0495616_0163119 3300046513 Bacteria 1001
232 Ga0495620_0101656 3300046515 Bacteria 1145
233 Ga0495643_0036445 3300046522 Bacteria 2701
234 Ga0495643_0117763 3300046522 Bacteria 1344
235 Ga0495648_0095626 3300046524 Bacteria 1652
236 Ga0495654_0001458 3300046530 Bacteria 16197
237 Ga0495597_0100895 3300046542 Bacteria 1217
238 Ga0495668_0044767 3300046616 Bacteria 2459
239 Ga0495611_0190828 3300046648 Bacteria 956
240 Ga0495625_0110963 3300046660 Bacteria 1874
241 Ga0495625_0268577 3300046660 Bacteria 1101
242 Ga0495588_0041275 3300046674 Bacteria 2355
243 Ga0495658_0119475 3300046683 Bacteria 1593
244 Ga0495624_0283059 3300046690 Bacteria 1001
245 Ga0495671_0078267 3300046692 Bacteria 1621
246 Ga0495671_0099083 3300046692 Bacteria 1425
247 Ga0495649_0000165 3300046694 Bacteria 57643
248 Ga0495649_0211207 3300046694 Bacteria 1005
249 Ga0495660_0037091 3300046810 Bacteria 2716
250 Ga0495683_0152950 3300047323 Bacteria 1072
251 Ga0495687_059685 3300047443 Bacteria 1576
252 Ga0495681_0006515 3300047470 Bacteria 7656
253 Ga0495686_0082371 3300047472 Bacteria 1963
254 Ga0495686_0226314 3300047472 Bacteria 1061
255 Ga0495686_0252425 3300047472 Bacteria 991
256 Ga0496101_0530664 3300048904 Bacteria 930
257 Ga0496103_0301184 3300048906 Bacteria 1031
258 Ga0496106_0017594 3300048909 Bacteria 5287
259 Ga0496106_0251774 3300048909 Bacteria 1412
260 Ga0496113_0305184 3300048916 Bacteria 1275
261 Ga0496114_0011920 3300048917 Bacteria 6956
262 Ga0496116_0000080 3300048919 Bacteria 224530
263 Ga0496116_0009980 3300048919 Bacteria 8021
264 Ga0496116_0031077 3300048919 Bacteria 3829
265 Ga0496116_0043024 3300048919 Bacteria 3080
266 Ga0496116_0066648 3300048919 Bacteria 2303
267 Ga0496116_0078950 3300048919 Bacteria 2050
268 Ga0496116_0143485 3300048919 Bacteria 1339
269 Ga0496116_0144264 3300048919 Bacteria 1333
270 Ga0496116_0205731 3300048919 Bacteria 1025
271 Ga0496117_0000002 3300048920 Bacteria 2483758
272 Ga0496117_0002570 3300048920 Bacteria 22598
273 Ga0496117_0003540 3300048920 Bacteria 18034
274 Ga0496117_0016471 3300048920 Bacteria 6239
275 Ga0496117_0031612 3300048920 Bacteria 4037
276 Ga0496117_0116758 3300048920 Bacteria 1649
277 Ga0496117_0117248 3300048920 Bacteria 1644
278 Ga0496117_0149367 3300048920 Bacteria 1385
279 Ga0496117_0161780 3300048920 Bacteria 1310
280 Ga0496117_0179606 3300048920 Bacteria 1218
281 Ga0496117_0187332 3300048920 Bacteria 1183
282 Ga0496118_0000233 3300048921 Bacteria 97731
283 Ga0496118_0004324 3300048921 Bacteria 16941
284 Ga0496118_0056155 3300048921 Bacteria 2963
285 Ga0496118_0060112 3300048921 Bacteria 2824
286 Ga0496118_0114365 3300048921 Bacteria 1779
287 Ga0496118_0138849 3300048921 Bacteria 1545
288 Ga0496118_0147281 3300048921 Bacteria 1480
289 Ga0496118_0189347 3300048921 Bacteria 1232
290 Ga0496119_0025703 3300048922 Bacteria 4104
291 Ga0496119_0147606 3300048922 Bacteria 1263
292 Ga0496119_0168368 3300048922 Bacteria 1159
293 Ga0496120_0000021 3300048923 Bacteria 250966
294 Ga0496120_0006881 3300048923 Bacteria 8589
295 Ga0496120_0038167 3300048923 Bacteria 2844
296 Ga0496121_0000001 3300048924 Bacteria 1830318
297 Ga0496121_0006792 3300048924 Bacteria 14018
298 Ga0496121_0115192 3300048924 Bacteria 2041
299 Ga0496121_0136052 3300048924 Bacteria 1830
300 Ga0496121_0176353 3300048924 Bacteria 1547
301 Ga0496121_0190184 3300048924 Bacteria 1472
302 Ga0496121_0386357 3300048924 Bacteria 921
303 Ga0496122_0000001 3300048925 Bacteria 1827766
304 Ga0496122_0001050 3300048925 Bacteria 48341
305 Ga0496122_0002476 3300048925 Bacteria 26097
306 Ga0496122_0011009 3300048925 Bacteria 9243
307 Ga0496122_0124535 3300048925 Bacteria 1653
308 Ga0496122_0178776 3300048925 Bacteria 1268
309 Ga0496122_0186589 3300048925 Bacteria 1229
310 Ga0496123_0000001 3300048926 Bacteria 1831497
311 Ga0496123_0000020 3300048926 Bacteria 388748
312 Ga0496123_0000158 3300048926 Bacteria 136078
313 Ga0496123_0052473 3300048926 Bacteria 2705
314 Ga0496123_0064102 3300048926 Bacteria 2343
315 Ga0496123_0075335 3300048926 Bacteria 2083
316 Ga0496123_0112189 3300048926 Bacteria 1555
317 Ga0496123_0133630 3300048926 Bacteria 1369
318 Ga0496123_0141095 3300048926 Bacteria 1317
319 Ga0496123_0141915 3300048926 Bacteria 1311
320 Ga0496124_0000063 3300048927 Bacteria 229705
321 Ga0496124_0004315 3300048927 Bacteria 16678
322 Ga0496124_0006030 3300048927 Bacteria 13355
323 Ga0496124_0010037 3300048927 Bacteria 9661
324 Ga0496124_0063645 3300048927 Bacteria 3080
325 Ga0496124_0076573 3300048927 Bacteria 2761
326 Ga0496124_0109017 3300048927 Bacteria 2232
327 Ga0496124_0140029 3300048927 Bacteria 1910
328 Ga0496124_0214194 3300048927 Bacteria 1455
329 Ga0496124_0268676 3300048927 Bacteria 1250
330 Ga0496125_0000001 3300048928 Bacteria 1766138
331 Ga0496125_0000695 3300048928 Bacteria 55563
332 Ga0496125_0056070 3300048928 Bacteria 3203
333 Ga0496125_0056714 3300048928 Bacteria 3178
334 Ga0496125_0117809 3300048928 Bacteria 1903
335 Ga0496125_0130811 3300048928 Bacteria 1767
336 Ga0496125_0199862 3300048928 Bacteria 1310
337 Ga0496125_0204495 3300048928 Bacteria 1289
338 Ga0496126_0000094 3300048929 Bacteria 208184
339 Ga0496126_0000195 3300048929 Bacteria 135582
340 Ga0496126_0190342 3300048929 Bacteria 1738
341 Ga0496126_0193203 3300048929 Bacteria 1723
342 Ga0496126_0645744 3300048929 Bacteria 828
343 Ga0496126_0645784 3300048929 Bacteria 828
344 Ga0495678_043266 3300049459 Bacteria 1790
345 Ga0501031_0000003 3300049568 Bacteria 206821
346 Ga0501031_0010940 3300049568 Bacteria 5910
347 Ga0501031_0012255 3300049568 Bacteria 5588
348 Ga0501031_0283955 3300049568 Bacteria 1073
349 Ga0501032_0000010 3300049569 Bacteria 206795
350 Ga0501032_0000234 3300049569 Bacteria 46284
351 Ga0501032_0021226 3300049569 Bacteria 4516
352 Ga0501032_0137564 3300049569 Bacteria 1609
353 Ga0501032_0172395 3300049569 Bacteria 1418
354 Ga0501032_0296874 3300049569 Bacteria 1045
355 Ga0501033_0000017 3300049570 Bacteria 206819
356 Ga0501033_0000076 3300049570 Bacteria 93921
357 Ga0501033_0000495 3300049570 Bacteria 37085
358 Ga0501033_0001157 3300049570 Bacteria 23861
359 Ga0501033_0012742 3300049570 Bacteria 6412
360 Ga0501033_0178235 3300049570 Bacteria 1524
361 Ga0501033_0328447 3300049570 Bacteria 1073
362 Ga0501034_0000053 3300049571 Bacteria 206821
363 Ga0501034_0000408 3300049571 Bacteria 72244
364 Ga0501034_0043595 3300049571 Bacteria 4539
365 Ga0501034_0164311 3300049571 Bacteria 2189
366 Ga0501034_0465523 3300049571 Bacteria 1180
367 Ga0501036_0000009 3300049572 Bacteria 206821
368 Ga0501036_0001942 3300049572 Bacteria 16039
369 Ga0501036_0073396 3300049572 Bacteria 2893
370 Ga0501036_0369304 3300049572 Bacteria 1197
371 Ga0501036_0449501 3300049572 Bacteria 1073
372 Ga0501037_0000008 3300049573 Bacteria 206812
373 Ga0501037_0000308 3300049573 Bacteria 41514
374 Ga0501037_0000533 3300049573 Bacteria 30360
375 Ga0501037_0047422 3300049573 Bacteria 3148
376 Ga0501037_0156831 3300049573 Bacteria 1624
377 Ga0501037_0252976 3300049573 Bacteria 1232
378 Ga0501037_0263556 3300049573 Bacteria 1204
379 Ga0501038_0000008 3300049574 Bacteria 206821
380 Ga0501038_0000241 3300049574 Bacteria 46177
381 Ga0501038_0110679 3300049574 Bacteria 2275
382 Ga0501038_0327317 3300049574 Bacteria 1197
383 Ga0501038_0465463 3300049574 Bacteria 971
384 Ga0501039_0000021 3300049575 Bacteria 162552
385 Ga0501039_0000196 3300049575 Bacteria 43498
386 Ga0501039_0010706 3300049575 Bacteria 6986
387 Ga0501039_0435611 3300049575 Bacteria 1029
388 Ga0501040_0001596 3300049576 Bacteria 14448
389 Ga0501040_0096527 3300049576 Bacteria 2058
390 Ga0501042_0106048 3300049578 Bacteria 2022
391 Ga0501043_0000005 3300049579 Bacteria 254466
392 Ga0501043_0000043 3300049579 Bacteria 115410
393 Ga0501043_0001135 3300049579 Bacteria 23377
394 Ga0501043_0039716 3300049579 Bacteria 3699
395 Ga0501043_0088873 3300049579 Bacteria 2428
396 Ga0501043_0266271 3300049579 Bacteria 1316
397 Ga0501046_0053761 3300049580 Bacteria 3170
398 Ga0501046_0119833 3300049580 Bacteria 2003
399 Ga0501046_0308926 3300049580 Bacteria 1153
400 Ga0501047_0000126 3300049581 Bacteria 93841
401 Ga0501047_0094812 3300049581 Bacteria 2863
402 Ga0501047_0169348 3300049581 Bacteria 2053
403 Ga0501047_0397490 3300049581 Bacteria 1211
404 Ga0501047_0419612 3300049581 Bacteria 1169
405 Ga0501047_0466447 3300049581 Bacteria 1091
406 Ga0501048_0004705 3300049582 Bacteria 10392
407 Ga0501067_0142045 3300049583 Bacteria 1337
408 Ga0501068_0122751 3300049584 Bacteria 1621
409 Ga0501068_0179028 3300049584 Bacteria 1340
410 Ga0501069_0000011 3300049585 Bacteria 153214
411 Ga0501069_0203562 3300049585 Bacteria 1147
412 Ga0501069_0280354 3300049585 Bacteria 975
413 Ga0501070_0000117 3300049586 Bacteria 70793
414 Ga0501070_0000257 3300049586 Bacteria 50142
415 Ga0501070_0010854 3300049586 Bacteria 7694
416 Ga0501070_0021633 3300049586 Bacteria 5394
417 Ga0501070_0024616 3300049586 Bacteria 5047
418 Ga0501070_0043444 3300049586 Bacteria 3739
419 Ga0501071_0072949 3300049587 Bacteria 2503
420 Ga0501073_0052547 3300049589 Bacteria 2853
421 Ga0501073_0084610 3300049589 Bacteria 2207
422 Ga0501073_0277058 3300049589 Bacteria 1157
423 Ga0501074_0038414 3300049590 Bacteria 3469
424 Ga0501074_0050119 3300049590 Bacteria 3014
425 Ga0501074_0188929 3300049590 Bacteria 1469
426 Ga0501080_0016949 3300049742 Bacteria 6727
427 Ga0501080_0039435 3300049742 Bacteria 4408
428 Ga0501080_0150872 3300049742 Bacteria 2148
429 Ga0501083_0000831 3300049744 Bacteria 20279
430 Ga0501083_0040937 3300049744 Bacteria 3144
431 Ga0501083_0283738 3300049744 Bacteria 1077
432 Ga0501035_0000023 3300049822 Bacteria 206821
433 Ga0501035_0000107 3300049822 Bacteria 103130
434 Ga0501035_0000449 3300049822 Bacteria 46083
435 Ga0501035_0001314 3300049822 Bacteria 25674
436 Ga0501035_0002296 3300049822 Bacteria 18885
437 Ga0501035_0022408 3300049822 Bacteria 5800
438 Ga0501035_0044299 3300049822 Bacteria 4007
439 Ga0501035_0051590 3300049822 Bacteria 3682
440 Ga0501035_0074842 3300049822 Bacteria 2995
441 Ga0501035_0120322 3300049822 Bacteria 2296
442 Ga0501035_0283448 3300049822 Bacteria 1400
443 Ga0501035_0369481 3300049822 Bacteria 1197
444 Ga0501035_0444308 3300049822 Bacteria 1073
445 Ga0501035_0714358 3300049822 Bacteria 807
446 Ga0501044_0000021 3300049823 Bacteria 206821
447 Ga0501044_0000154 3300049823 Bacteria 85407
448 Ga0501044_0003690 3300049823 Bacteria 17210
449 Ga0501044_0082812 3300049823 Bacteria 3245
450 Ga0501044_0098865 3300049823 Bacteria 2937
451 Ga0501044_0192944 3300049823 Bacteria 1998
452 Ga0501044_0227015 3300049823 Bacteria 1816
453 Ga0501044_0448222 3300049823 Bacteria 1197
454 Ga0501044_0532370 3300049823 Bacteria 1073
455 Ga0501045_0027060 3300049824 Bacteria 4129
456 nmdc:mga00v17_4902_c1 3300050491 Bacteria 7015
457 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
458 nmdc:mga0yw44_109848_c1 3300050492 Bacteria 1766
459 nmdc:mga0yw44_35604_c1 3300050492 Bacteria 2926
460 nmdc:mga0yw44_41265_c1 3300050492 Bacteria 2747
461 nmdc:mga0k408_150279_c1 3300050493 Bacteria 1387
462 nmdc:mga06z11_104763_c1 3300050494 Bacteria 1558
463 nmdc:mga06z11_166055_c1 3300050494 Bacteria 1264
464 nmdc:mga04h51_1892_c1 3300050495 Bacteria 4885
465 nmdc:mga07m45_113552_c1 3300050496 Bacteria 1561
466 nmdc:mga07m45_162572_c1 3300050496 Bacteria 1296
467 nmdc:mga0sz30_168461_c1 3300050516 Bacteria 971
468 nmdc:mga0sz30_82783_c1 3300050516 Bacteria 1390
469 Ga0500644_0045322 3300053088 Bacteria 1481
470 Ga0500644_0084213 3300053088 Bacteria 1176
471 Ga0500651_0015578 3300053093 Bacteria 4667
472 Ga0500560_026381 3300053107 Bacteria 1715
473 Ga0500560_103419 3300053107 Bacteria 954
474 Ga0500562_073957 3300053108 Bacteria 920
475 Ga0500572_002397 3300053111 Bacteria 4521
476 Ga0500594_0113537 3300053118 Bacteria 845
477 Ga0500618_024101 3300053125 Bacteria 1467
478 Ga0500642_0252219 3300053130 Bacteria 810
479 Ga0500658_0005820 3300053134 Bacteria 4591
480 Ga0500658_0097498 3300053134 Bacteria 1279
481 Ga0500659_0159517 3300053135 Bacteria 1117
482 Ga0500568_0027275 3300053139 Bacteria 2390
483 Ga0500568_0090338 3300053139 Bacteria 1155
484 Ga0500573_0002214 3300053140 Bacteria 9624
485 Ga0500573_0112053 3300053140 Bacteria 1525
486 Ga0500604_0059210 3300053151 Bacteria 1199
487 Ga0500616_0000817 3300053153 Bacteria 35314
488 Ga0500616_0091130 3300053153 Bacteria 1509
489 Ga0500622_0000391 3300053156 Bacteria 42302
490 Ga0500622_0086810 3300053156 Bacteria 1558
491 Ga0500624_001342 3300053157 Bacteria 4168
492 Ga0500627_0189577 3300053158 Bacteria 924
493 Ga0500633_0076466 3300053160 Bacteria 1204
494 Ga0500634_0074801 3300053161 Bacteria 1763
495 Ga0500636_0000010 3300053177 Bacteria 145932
496 Ga0500636_0006722 3300053177 Bacteria 6617
497 Ga0501082_0093908 3300060353 Bacteria 2592
498 2509375018 2509276019 Bacteria 6802256
499 2509388455 2509276021 Bacteria 7634384
500 2510131398 2510065019 Bacteria 6903379
501 2510897752 2510461076 Bacteria 8618824
502 2511136292 2510917022 Bacteria 6504556
503 2511170127 2510917026 Bacteria 7046020
504 2511196833 2510917030 Bacteria 7460662
505 2511389332 2511231027 Bacteria 5013807
506 2511500511 2511231052 Bacteria 6974333
507 2512531972 2512047086 Bacteria 6850303
508 2512972702 2512875026 Bacteria 6861065
509 2513570617 2513237084 Bacteria 7231967
510 2513580230 2513237085 Bacteria 7695351
511 2513584139 2513237086 Bacteria 7265287
512 2513602909 2513237089 Bacteria 6553624
513 2513620456 2513237091 Bacteria 6900273
514 2513634235 2513237093 Bacteria 7545552
515 2513713206 2513237103 Bacteria 7647401
516 2513880583 2513237140 Bacteria 7076289
517 2513903313 2513237143 Bacteria 6664116
518 2513987675 2513237156 Bacteria 6402557
519 2514005161 2513237160 Bacteria 6650282
520 2514020262 2513237162 Bacteria 7468464
521 2515110359 2515075009 Bacteria 7288508
522 2515607709 2515154107 Bacteria 6795637
523 2515634559 2515154113 Bacteria 7807172
524 2515643784 2515154114 Bacteria 7848616
525 2515657182 2515154116 Bacteria 7552979
526 2515743317 2515154134 Bacteria 7220242
527 2516204352 2516143018 Bacteria 6951533
528 2516891843 2516653046 Bacteria 6989037
529 2517039036 2516653077 Bacteria 7555578
530 2517079302 2516653085 Bacteria 7346596
531 2517093231 2517093000 Bacteria 7412387
532 2517409500 2517287029 Bacteria 6905599
533 2517568639 2517487022 Bacteria 7227575
534 2520377850 2519899620 Bacteria 6499161
535 2524449879 2524023207 Bacteria 6813453
536 2524457500 2524023209 Bacteria 6679728
537 2530647837 2529292951 Bacteria 6916614
538 2537872792 2537561587 Bacteria 5425293
539 2547372860 2547132103 Bacteria 5115736
540 2551679314 2551306084 Bacteria 8942552
541 2551686181 2551306085 Bacteria 7347181
542 2551691040 2551306086 Bacteria 6843938
543 2551698520 2551306087 Bacteria 7351905
544 2551712305 2551306089 Bacteria 7162724
545 2551722049 2551306090 Bacteria 7953713
546 2551729915 2551306091 Bacteria 7086830
547 2551745697 2551306093 Bacteria 7064773
548 2554246629 2554235003 Bacteria 5877155
549 2558866019 2558860100 Bacteria 8458965
550 2559293857 2558860242 Bacteria 5568029
551 2585227060 2582581298 Bacteria 7315509
552 2585275455 2582581307 Bacteria 6597605
553 2585282314 2582581308 Bacteria 7413247
554 2585325991 2582581315 Bacteria 7318924
555 2585330161 2582581316 Bacteria 7774528
556 2585529281 2585427526 Bacteria 7258840
557 2585536489 2585427527 Bacteria 7273426
558 2585539667 2585427528 Bacteria 6842387
559 2585550515 2585427529 Bacteria 7395659
560 2585556966 2585427530 Bacteria 7383882
561 2585560102 2585427531 Bacteria 6992870
562 2585837624 2585427593 Bacteria 7141551
563 2585844669 2585427594 Bacteria 6180594
564 2585905717 2585427609 Bacteria 6667127
565 2585994385 2585427633 Bacteria 6413184
566 2585998843 2585427634 Bacteria 6455027
567 2587979167 2585428125 Bacteria 6662905
568 2599605406 2599185210 Bacteria 5624189
569 2601609169 2600255279 Bacteria 5605316
570 2601745944 2600255308 Bacteria 5611129
571 2616306337 2615840626 Bacteria 7921970
572 2616553393 2615840698 Bacteria 7319877
573 2643806279 2643221557 Bacteria 7184309
574 2643856349 2643221568 Bacteria 5187270
575 2643921154 2643221582 Bacteria 5804683
576 2644007303 2643221599 Bacteria 6292121
577 2644070119 2643221610 Bacteria 7480339
578 2644381090 2643221668 Bacteria 7306521
579 2644414996 2643221675 Bacteria 7473456
580 2644448653 2643221680 Bacteria 7473610
581 2644519229 2643221693 Bacteria 5513853
582 2644689039 2643221726 Bacteria 7455827
583 2657681882 2657244999 Bacteria 5946535
584 2671112354 2667528174 Bacteria 6435400
585 2692317270 2690316117 Bacteria 6800650
586 2719179553 2718217882 Bacteria 6556348
587 2719663900 2718217997 Bacteria 6740740
588 2719730223 2718218009 Bacteria 6478651
589 2720490319 2718218199 Bacteria 6740745
590 2720618543 2718218233 Bacteria 6662049
591 2720629951 2718218235 Bacteria 6630699
592 2720773646 2718218269 Bacteria 6906114
593 2721145646 2718218363 Bacteria 6524337
594 2721157163 2718218365 Bacteria 6274507
595 2721162525 2718218366 Bacteria 6425255
596 2722838695 2721755514 Bacteria 6424414
597 2723558902 2721755684 Bacteria 6859907
598 2723565472 2721755685 Bacteria 6704835
599 2723578262 2721755686 Bacteria 7343952
600 2724042979 2721755810 Bacteria 6479005
601 2724088253 2721755819 Bacteria 6906405
602 2724102737 2721755822 Bacteria 6726041
603 2724108635 2721755823 Bacteria 6752556
604 2725948977 2724679232 Bacteria 7646494
605 2730162790 2728369365 Bacteria 6555560
606 2730296795 2728369397 Bacteria 6274511
607 2738801257 2738541293 Bacteria 7065685
608 2738948248 2738541317 Bacteria 5340176
609 2739037057 2738541333 Bacteria 7106503
610 2753461332 2751185821 Bacteria 6189929
611 2765464303 2765235802 Bacteria 5618596
612 2766066583 2765235942 Bacteria 7445910
613 2776912074 2775507049 Bacteria 6284736
614 2778174155 2775507266 Bacteria 7392367
615 2792582936 2791355082 Bacteria 5973319
616 2792623823 2791355091 Bacteria 6135441
617 2792629797 2791355092 Bacteria 6248105
618 2792638132 2791355094 Bacteria 7011481
619 2793316346 2791355259 Bacteria 7254731
620 2793323422 2791355260 Bacteria 6598818
621 2793326184 2791355261 Bacteria 6661293
622 2793348159 2791355264 Bacteria 6429314
623 2793364658 2791355267 Bacteria 7222458
624 2802720328 2802428858 Bacteria 6636079
625 2802726148 2802428859 Bacteria 6667919
626 2802731688 2802428860 Bacteria 6525526
627 2802739439 2802428861 Bacteria 6534206
628 2802742581 2802428862 Bacteria 6633353
629 2802749286 2802428863 Bacteria 6410669
630 2804750902 2802429268 Bacteria 6094027
631 2806047561 2802429633 Bacteria 7341974
632 2806054980 2802429634 Bacteria 7083200
633 2806062118 2802429635 Bacteria 7650140
634 2806067156 2802429636 Bacteria 7597525
635 2806076477 2802429637 Bacteria 7067217
636 2808986368 2808606387 Bacteria 5697198
637 2819556498 2818991439 Bacteria 6907412
638 2819608423 2818991448 Bacteria 6772224
639 2819643500 2818991453 Bacteria 7181617
640 2819686308 2818991461 Bacteria 7026071
641 2821123625 2821123053 Bacteria 7836056
642 2838020268 2838016132 Bacteria 6577831
643 2838025785 2838022645 Bacteria 6494267
644 2838029306 2838029111 Bacteria 6603031
645 2838044441 2838042994 Bacteria 6046894
646 2838051516 2838048938 Bacteria 6044578
647 2838071092 2838068647 Bacteria 6208656
648 2838677226 2838675328 Bacteria 4909118
649 2838691601 2838686498 Bacteria 7807632
650 2838716114 2838714209 Bacteria 5525906
651 2838720086 2838719591 Bacteria 5523910
652 2838726866 2838724970 Bacteria 4908691
653 2838733915 2838729681 Bacteria 7400765
654 2838747021 2838742623 Bacteria 7396178
655 2839994225 2839993093 Bacteria 5512535
656 2840769383 2840764183 Bacteria 6358399
657 2841847018 2841846520 Bacteria 5345850
658 2841856162 2841851746 Bacteria 7532261
659 2841860452 2841859092 Bacteria 5436171
660 2842112191 2842110456 Bacteria 7656360
661 2842126953 2842124991 Bacteria 5346824
662 2842132119 2842130223 Bacteria 4909145
663 2842152712 2842152218 Bacteria 4908957
664 2842161950 2842156927 Bacteria 6894975
665 2842169674 2842163707 Bacteria 6916235
666 2842172359 2842170452 Bacteria 5525737
667 2842176331 2842175837 Bacteria 4908771
668 2842185792 2842180545 Bacteria 6888678
669 2842189221 2842187318 Bacteria 5524014
670 2842202936 2842198810 Bacteria 6608673
671 2842213535 2842211629 Bacteria 5523832
672 2842218813 2842217011 Bacteria 7497767
673 2842224847 2842224351 Bacteria 5524473
674 2842235320 2842229732 Bacteria 7475766
675 2842248225 2842243621 Bacteria 7421798
676 2842262181 2842257432 Bacteria 7401195
677 2842268778 2842264693 Bacteria 6472963
678 2842276574 2842271015 Bacteria 7807131
679 2842300885 2842298080 Bacteria 6123127
680 2842306520 2842304105 Bacteria 7023636
681 2842357993 2842357229 Bacteria 6485165
682 2842424708 2842422224 Bacteria 6239196
683 2842433022 2842428310 Bacteria 6767288
684 2842439327 2842434925 Bacteria 6502746
685 2842445956 2842441272 Bacteria 6769273
686 2842467142 2842462802 Bacteria 6588055
687 2842473830 2842469257 Bacteria 6752936
688 2842476264 2842475841 Bacteria 6603183
689 2842482336 2842482326 Bacteria 7212537
690 2842502834 2842502639 Bacteria 6604161
691 2842509188 2842509118 Bacteria 6850950
692 2842517237 2842515876 Bacteria 5436280
693 2842873063 2842871566 Bacteria 4827117
694 2843695746 2843690924 Bacteria 5169057
695 2844456010 2844454524 Bacteria 7952546
696 2847417663 2847417321 Bacteria 6913799
697 2848992468 2848992105 Bacteria 6810864
698 2850079962 2850079185 Bacteria 6848280
699 2852388463 2852387548 Bacteria 8025568
700 2854919933 2854916844 Bacteria 5725939
701 2855831760 2855825444 Bacteria 6785811
702 2855839981 2855839649 Bacteria 7135830
703 2855874550 2855872281 Bacteria 6964271
704 2857523458 2857516855 Bacteria 7787325
705 2857531189 2857531043 Bacteria 6754041
706 2858803955 2858800743 Bacteria 6603254
707 2891049562 2891048133 Bacteria 4447501
708 2891374950 2891373044 Bacteria 5202277
709 2894655410 2894652903 Bacteria 4587256
710 2896391568 2896384573 Bacteria 7700774
711 2899792517 2899792073 Bacteria 4926588
712 2899805280 2899803654 Bacteria 5577784
713 2899847892 2899845264 Bacteria 5672268
714 2913298006 2913295892 Bacteria 6333755
715 2913313410 2913308742 Bacteria 5350706
716 2915980769 2915980308 Bacteria 6624279
717 2915992642 2915986958 Bacteria 6739310
718 2915999702 2915993759 Bacteria 7016183
719 2916002014 2916000859 Bacteria 6865702
720 2916015417 2916014648 Bacteria 6946486
721 2916022522 2916021584 Bacteria 6854472
722 2916033338 2916028427 Bacteria 6748433
723 2916038826 2916035215 Bacteria 6755766
724 2916042768 2916041962 Bacteria 6820487
725 2916050226 2916048683 Bacteria 6543552
726 2916057693 2916055098 Bacteria 6758838
727 2916063664 2916061851 Bacteria 6737736
728 2916071928 2916068649 Bacteria 6943657
729 2916081867 2916076590 Bacteria 6596108
730 2919101367 2919100787 Bacteria 7710546
731 2919116317 2919114240 Bacteria 5700270
732 2919122068 2919119836 Bacteria 5208557
733 2919166884 2919166419 Bacteria 4952238
734 2919172104 2919171160 Bacteria 6499771
735 2919408785 2919408235 Bacteria 6149349
736 2920823360 2920822456 Bacteria 6897201
737 2921207924 2921201388 Bacteria 6926299
738 2921209377 2921208531 Bacteria 6745326
739 2921238992 2921237296 Bacteria 6876710
740 2921245216 2921244191 Bacteria 6568419
741 2921257173 2921250672 Bacteria 6677771
742 2921260362 2921257292 Bacteria 6808382
743 2921266463 2921263974 Bacteria 6864552
744 2921287577 2921282425 Bacteria 6826397
745 2921291966 2921289301 Bacteria 7316391
746 2921301756 2921296804 Bacteria 7176999
747 2924146036 2924144063 Bacteria 6883928
748 2924154419 2924150972 Bacteria 7169444
749 2924163479 2924158325 Bacteria 7188855
750 2924167067 2924165586 Bacteria 7260590
751 2924174639 2924172951 Bacteria 6749356
752 2924180878 2924179722 Bacteria 6843264
753 2924191792 2924186466 Bacteria 6876637
754 2924194307 2924193448 Bacteria 6955718
755 2924202422 2924200457 Bacteria 6757188
756 2924209654 2924207177 Bacteria 6917007
757 2924214550 2924214083 Bacteria 7080103
758 2924224297 2924221636 Bacteria 7113495
759 2924232979 2924228884 Bacteria 6633132
760 2924781660 2924776078 Bacteria 7492003
761 2926757271 2926754445 Bacteria 5964435
762 2926761487 2926760298 Bacteria 5505990
763 2933007357 2933006813 Bacteria 4912075
764 2933015051 2933011516 Bacteria 5439334
765 2933573589 2933570622 Bacteria 7023390
766 2933587520 2933586486 Bacteria 7667493
767 2933594565 2933594066 Bacteria 5594265
768 2933601891 2933599457 Bacteria 5858799
769 2935907183 2935901341 Bacteria 7341747
770 2936368947 2936367885 Bacteria 7324495
771 2936378437 2936375103 Bacteria 6652732
772 2936383725 2936381700 Bacteria 7006523
773 2936999104 2936996657 Bacteria 6298727
774 2937005061 2937002841 Bacteria 6934057
775 2937011342 2937009748 Bacteria 6746052
776 2937018751 2937016420 Bacteria 6782579
777 2937023805 2937023124 Bacteria 6815156
778 2937034543 2937029754 Bacteria 6424026
779 2937041296 2937036028 Bacteria 6846469
780 2937049457 2937042894 Bacteria 6741576
781 2937054012 2937049772 Bacteria 6757901
782 2937060641 2937056579 Bacteria 7107896
783 2937070015 2937063883 Bacteria 7199456
784 2937071534 2937071275 Bacteria 6984483
785 2937078755 2937078374 Bacteria 6610289
786 2937086085 2937084907 Bacteria 6618516
787 2937093276 2937091812 Bacteria 6979387
788 2937103464 2937098957 Bacteria 7249374
789 2937110393 2937106411 Bacteria 6947143
790 2937114691 2937113482 Bacteria 6505872
791 2937122601 2937119839 Bacteria 6597547
792 2937128479 2937126314 Bacteria 6771275
793 2954014653 2954011201 Bacteria 4762601
794 2957382071 2957375807 Bacteria 6425588
795 2957383649 2957382221 Bacteria 6737050
796 2957394052 2957388812 Bacteria 6778072
797 2957399573 2957395598 Bacteria 6822399
798 2957403697 2957402308 Bacteria 6741770
799 2957411052 2957408893 Bacteria 6558585
800 2957421549 2957415311 Bacteria 6991633
801 2957429480 2957422303 Bacteria 7172205
802 2957435389 2957430029 Bacteria 7022557
803 2957442624 2957437181 Bacteria 6568994
804 2957447142 2957443900 Bacteria 6869977
805 2957457314 2957450854 Bacteria 6765715
806 2957464425 2957457609 Bacteria 6967680
807 2957466198 2957464669 Bacteria 6568877
808 2957477049 2957471148 Bacteria 6797643
809 2957480301 2957478035 Bacteria 6756658
810 2957489045 2957484790 Bacteria 6703082
811 2957494585 2957491536 Bacteria 6695180
812 2957503796 2957498199 Bacteria 7126688
813 2957508594 2957505466 Bacteria 7253085
814 2960585693 2960584000 Bacteria 6864594
815 2960594752 2960591022 Bacteria 6622873
816 2960599754 2960597568 Bacteria 6550735
817 2960605395 2960603979 Bacteria 6898737
818 2960616914 2960610863 Bacteria 6691244
819 2960621682 2960617483 Bacteria 6727748
820 2960629218 2960624210 Bacteria 6875384
821 2960637471 2960631154 Bacteria 6732508
822 2960638834 2960637947 Bacteria 7296468
823 2960647669 2960645483 Bacteria 7211087
824 2960658871 2960652885 Bacteria 7083688
825 2960660426 2960660292 Bacteria 7041660
826 2960668440 2960667422 Bacteria 6763020
827 2960676388 2960674078 Bacteria 6609048
828 2960686597 2960680706 Bacteria 6624464
829 2960690308 2960687367 Bacteria 6535474
830 2960698838 2960693952 Bacteria 6749742
831 2961177043 2961170736 Bacteria 7072258
832 2964608419 2964607997 Bacteria 7101408
833 2964619794 2964615318 Bacteria 6809089
834 2964622449 2964621998 Bacteria 6834995
835 2964634293 2964628898 Bacteria 7083044
836 2964636423 2964636051 Bacteria 7091832
837 2964646952 2964643177 Bacteria 6820887
838 2964650317 2964649959 Bacteria 6675118
839 2964659450 2964656573 Bacteria 7100150
840 2964664933 2964663802 Bacteria 7019362
841 2964675417 2964670856 Bacteria 6851364
842 2964680595 2964678106 Bacteria 6792020
843 2964691086 2964685014 Bacteria 6839111
844 2964693055 2964691889 Bacteria 6802758
845 2964704148 2964698721 Bacteria 6765331
846 2964707170 2964705432 Bacteria 7114648
847 2964718589 2964712639 Bacteria 6695970
848 2964724992 2964719344 Bacteria 7286602
849 2967667659 2967664464 Bacteria 6948836
850 2967678163 2967671571 Bacteria 7021409
851 2967684943 2967678726 Bacteria 7264382
852 2967691511 2967686174 Bacteria 6678622
853 2967695055 2967693043 Bacteria 6804451
854 2967701967 2967699805 Bacteria 6854538
855 2967712751 2967706974 Bacteria 7186053
856 2967714649 2967714385 Bacteria 7000047
857 2967722476 2967721400 Bacteria 7073753
858 2967730544 2967728569 Bacteria 6641507
859 2967736346 2967735183 Bacteria 6827012
860 2967747798 2967742019 Bacteria 6794534
861 2967751861 2967748971 Bacteria 6733771
862 2967761283 2967755722 Bacteria 6814706
863 2967762703 2967762386 Bacteria 6923502
864 2967771318 2967769361 Bacteria 6587838
865 2967777019 2967775926 Bacteria 6738189
866 2968002831 2967996073 Bacteria 6787468
867 2970023336 2970019648 Bacteria 7072033
868 2970030565 2970026789 Bacteria 6785236
869 2970034048 2970033650 Bacteria 7118744
870 2970045475 2970040964 Bacteria 6731123
871 2970052644 2970047711 Bacteria 7088379
872 2970061189 2970054988 Bacteria 6611507
873 2970063978 2970061556 Bacteria 7099761
874 2970073357 2970068827 Bacteria 7123112
875 2970080385 2970076120 Bacteria 6697332
876 2970087323 2970082768 Bacteria 6183754
877 2970095391 2970088815 Bacteria 6933825
878 2970101499 2970095765 Bacteria 6936963
879 2970103351 2970102677 Bacteria 6812532
880 2970116073 2970109326 Bacteria 6863976
881 2970118579 2970116247 Bacteria 6501857
882 2970126283 2970122695 Bacteria 6625855
883 2970131553 2970129317 Bacteria 6806560
884 2970143356 2970136068 Bacteria 7207982
885 2970148526 2970143518 Bacteria 6446480
886 2970153239 2970149975 Bacteria 6779706
887 2970159547 2970156795 Bacteria 7168044
888 2970167723 2970164137 Bacteria 6861252
889 2970177003 2970170962 Bacteria 6876229
890 2970181914 2970177841 Bacteria 6768001
891 2970188471 2970184632 Bacteria 7054431
892 2970196410 2970191845 Bacteria 7032787
893 2977518036 2977516862 Bacteria 6940108
894 2977529148 2977523885 Bacteria 6960446
895 2977535847 2977530762 Bacteria 6951399
896 2977539973 2977537788 Bacteria 6929320
897 2977549479 2977544691 Bacteria 6875412
898 2977552945 2977551784 Bacteria 7125765
899 2977559294 2977558990 Bacteria 6863948
900 2977567496 2977565890 Bacteria 6901543
901 2977579590 2977572785 Bacteria 6763888
902 2977580423 2977579622 Bacteria 6772100
903 2977822151 2977821940 Bacteria 6906439
904 2978973301 2978969890 Bacteria 5400756
905 2979093225 2979089926 Bacteria 5670289
906 2979099390 2979095461 Bacteria 5669583
907 2979105195 2979100975 Bacteria 5423623
908 2984512948 2984509177 Bacteria 5274802
909 2984520688 2984518228 Bacteria 5277463
910 2984539980 2984537506 Bacteria 5277481
911 2984591582 2984587000 Bacteria 5263363
912 2984602171 2984601300 Bacteria 5455244
913 2989351425 2989349275 Bacteria 6349068
914 2989772774 2989771324 Bacteria 5605128
915 2996893415 2996893221 Bacteria 5823108
916 3005411214 3005409236 Bacteria 7188837
917 3005422823 3005416602 Bacteria 7064308
918 3005446165 3005445848 Bacteria 6906074
919 3005452824 3005452660 Bacteria 5889319
920 639646630 639633055 Bacteria 7751309
921 643824526 643692032 Bacteria 6891900
922 648739357 648276728 Bacteria 6968865
923 650739048 650716007 Bacteria 5573770
924 8003572681 8003570095 Bacteria 5747666
925 8003992434 8003992118 Bacteria 7266902
926 8003999762 8003999396 Bacteria 7063185
927 8004644546 8004640170 Bacteria 6723001
928 8005289028 8005282627 Bacteria 6675747
929 8005301534 8005301065 Bacteria 6614431
930 8005309213 8005307578 Bacteria 7395396
931 8005321641 8005314921 Bacteria 7072929
932 8005377453 8005376324 Bacteria 6590079
933 8005387316 8005382845 Bacteria 6732062
934 8005400107 8005395548 Bacteria 6806915
935 8005432914 8005430974 Bacteria 6689030
936 8005460998 8005460587 Bacteria 7157962
937 8005484934 8005484373 Bacteria 6297373
938 8005498642 8005497431 Bacteria 6477605
939 8005560603 8005556819 Bacteria 6908598
940 8005563938 8005563573 Bacteria 7153261
941 8005576902 8005570704 Bacteria 6957481
942 8005619836 8005619151 Bacteria 7030230
943 8005650130 8005645114 Bacteria 6950293
944 8005660374 8005658619 Bacteria 4500593
945 8005670053 8005668836 Bacteria 6953162
946 8005690250 8005688590 Bacteria 6610080
947 8005699273 8005695170 Bacteria 6912330
948 8018153081 8018150411 Bacteria 5549903
949 8018169006 8018163183 Bacteria 7277977
950 8023684260 8023680758 Bacteria 7729763
951 8024480257 8024479707 Bacteria 6954785
952 8046769860 8046767195 Bacteria 7547379
953 8049293458 8049293176 Bacteria 6128433
954 8054461310 8054460903 Bacteria 4872905
955 8055433426 8055431914 Bacteria 4551896
956 8056375615 8056375014 Bacteria 7006639
957 8057577821 8057575449 Bacteria 7367519
958 8057876029 8057874678 Bacteria 7494653
959 Ga0495633_0139263
960 JGI25155J39150_1000023
961 JGI25156J39149_1000029
962 JGI25162J39368_1002348
963 JGI25154J39366_1000067
964 JGI25158J39367_1000254
965 JGI25157J39369_1000043
966 JGI25152J39213_1006415
967 JGI25152J39213_1007261
968 JGI25150J39212_1000012
969 JGI25159J45721_1000087
970 JGI25159J45721_1002669
971 JGI25151J46595_10000025
972 JGI25151J46595_10000346
973 JGI25151J46595_10008951
974 JGI25151J46595_10047816
975 JGI25165J46597_1000529
976 JGI25165J46597_1001287
977 JGI25165J46597_1013388
978 JGI25153J46596_10002371
979 JGI25153J46596_10003997
980 rootH1_10041182
981 rootH1_10167985
982 rootH2_10017545
983 rootH2_10053655
984 rootH2_10186027
985 rootL2_10099180
986 rootH1_10046242
987 rootH1_10123595
988 JGI25160J50197_1000046
989 JGI25160J50197_1000500
990 JGI25160J50197_1003907
991 JGI25161J50226_1000031
992 JGI25161J50226_1000074
993 JGI25161J50226_1000382
994 Ga0032354_1032914
995 Ga0055526_1002431
996 Ga0055526_1015836
997 Ga0055524_1002633
998 Ga0055524_1003868
999 Ga0055524_1004431
1000 Ga0055524_1008508
1001 Ga0055528_1000303
1002 Ga0055528_1001497
1003 Ga0055540_1000471
1004 Ga0055540_1001471
1005 Ga0055531_10005094
1006 Ga0058692_1009082
1007 Ga0055543_1000008
1008 Ga0055543_1000141
1009 Ga0055543_1001182
1010 Ga0065165_1000031
1011 Ga0065165_1005966
1012 Ga0065165_1011908
1013 Ga0065165_1013652
1014 Ga0065165_1068442
1015 Ga0065704_10001731
1016 Ga0070668_100373549
1017 Ga0070668_100416239
1018 Ga0070669_100069998
1019 Ga0070667_100169152
1020 Ga0070678_100782328
1021 Ga0070665_100014231
1022 Ga0070665_100220086
1023 Ga0070665_100536846
1024 Ga0068855_100254945
1025 Ga0068854_100198901
1026 Ga0068854_100284660
1027 Ga0068856_100301256
1028 Ga0068851_10051204
1029 Ga0075365_10011895
1030 Ga0075365_10106442
1031 Ga0075368_10000571
1032 Ga0075368_10019855
1033 Ga0075363_100085615
1034 Ga0075364_10151574
1035 Ga0075364_10214680
1036 Ga0075367_10085263
1037 Ga0075367_10088173
1038 Ga0075369_10027622
1039 Ga0075369_10028567
1040 Ga0075369_10074301
1041 Ga0075366_10014660
1042 Ga0075370_10086455
1043 Ga0075370_10139831
1044 Ga0075370_10214402
1045 Ga0079104_1000876
1046 Ga0079104_1004688
1047 Ga0099826_10000216
1048 Ga0105244_10081231
1049 Ga0105240_10000278
1050 Ga0105237_10003138
1051 Ga0105238_10300955
1052 Ga0123341_1000192
1053 Ga0123342_1013143
1054 Ga0105239_10001623
1055 Ga0105246_10156879
1056 Ga0157373_10049858
1057 Ga0157371_10000058
1058 Ga0157371_10015095
1059 Ga0157370_10002372
1060 Ga0157369_10866275
1061 Ga0171463_1001
1062 Ga0163162_11141173
1063 Ga0182007_10045652
1064 Ga0182005_1022742
1065 Ga0183363_1012
1066 Ga0214544_1000012
1067 Ga0214542_1000011
1068 Ga0214542_1009335
1069 Ga0214543_1000004
1070 Ga0214543_1000256
1071 Ga0228711_1000019
1072 Ga0228710_1000022
1073 Ga0209435_100011
1074 Ga0209436_100051
1075 Ga0209437_100036
1076 Ga0209437_100086
1077 Ga0207425_1000012
1078 Ga0207425_1004154
1079 Ga0207425_1007794
1080 Ga0209646_1000024
1081 Ga0209026_1000030
1082 Ga0209677_101207
1083 Ga0209148_1004207
1084 Ga0209759_1000011
1085 Ga0209129_1000081
1086 Ga0209129_1000123
1087 Ga0209129_1000545
1088 Ga0209129_1003389
1089 Ga0209233_1000110
1090 Ga0209233_1000166
1091 Ga0209233_1000356
1092 Ga0209455_1020560
1093 Ga0209673_1000015
1094 Ga0209673_1000967
1095 Ga0209673_1001074
1096 Ga0209673_1002143
1097 Ga0209673_1003246
1098 Ga0209130_1000002
1099 Ga0209130_1000088
1100 Ga0209130_1008937
1101 Ga0209675_1039946
1102 Ga0209676_1003256
1103 Ga0209676_1015253
1104 Ga0209025_1000024
1105 Ga0209025_1000441
1106 Ga0209025_1000528
1107 Ga0209025_1000970
1108 Ga0209025_1016350
1109 Ga0209025_1093537
1110 Ga0209564_1000382
1111 Ga0209564_1001938
1112 Ga0209564_1006978
1113 Ga0209758_1000046
1114 Ga0209758_1000349
1115 Ga0209758_1001048
1116 Ga0209050_1002637
1117 Ga0209050_1005205
1118 Ga0209256_1000180
1119 Ga0209256_1000874
1120 Ga0209256_1000991
1121 Ga0209256_1003297
1122 Ga0209256_1052758
1123 Ga0207426_1000012
1124 Ga0207426_1000013
1125 Ga0207426_1000063
1126 Ga0207426_1000172
1127 Ga0209051_1000084
1128 Ga0209051_1001361
1129 Ga0209051_1005782
1130 Ga0209051_1011680
1131 Ga0209051_1031902
1132 Ga0209257_1004216
1133 Ga0209257_1010896
1134 Ga0209257_1027231
1135 Ga0207656_10071163
1136 Ga0207695_10000376
1137 Ga0207671_10000275
1138 Ga0207667_10233512
1139 Ga0207668_10596720
1140 Ga0207658_10022653
1141 Ga0207678_10193399
1142 Ga0207702_10062428
1143 Ga0209281_1000192
1144 Ga0209281_1000227
1145 Ga0209281_1001513
1146 Ga0209371_1000009
1147 Ga0209371_1000547
1148 Ga0209371_1003471
1149 Ga0209282_1000042
1150 Ga0209282_1012946
1151 Ga0209813_10018418
1152 Ga0268266_10003170
1153 Ga0268266_10215388
1154 Ga0268256_1000010
1155 Ga0268256_1003179
1156 Ga0268256_1021622
1157 Ga0316181_1112456
1158 Ga0307513_10118868
1159 Ga0316575_10021494
1160 Ga0307405_10001288
1161 Ga0307412_10009244
1162 Ga0315914_1000009
1163 Ga0307409_100134946
1164 Ga0307416_100292761
1165 Ga0307414_10011355
1166 Ga0315913_1000015
1167 Ga0315915_1000013
1168 Ga0373927_0000887
1169 Ga0373925_0003273
1170 Ga0439465_0016858
1171 Ga0439465_0021834
1172 Ga0439465_0033354
1173 Ga0451787_595301
1174 Ga0451791_1542001
1175 Ga0451798_0298663
1176 Ga0451841_0033924
1177 Ga0451851_0667480
1178 Ga0439459_0031337
1179 Ga0466960_0014783
1180 Ga0495590_0084389
1181 Ga0495638_0192024
1182 Ga0495662_0018301
1183 Ga0495585_0053852
1184 Ga0495606_0001322
1185 Ga0495606_0053292
1186 Ga0495606_0106257
1187 Ga0495610_0123856
1188 Ga0495616_0163119
1189 Ga0495620_0101656
1190 Ga0495643_0036445
1191 Ga0495643_0117763
1192 Ga0495648_0095626
1193 Ga0495654_0001458
1194 Ga0495597_0100895
1195 Ga0495668_0044767
1196 Ga0495611_0190828
1197 Ga0495625_0110963
1198 Ga0495625_0268577
1199 Ga0495588_0041275
1200 Ga0495658_0119475
1201 Ga0495624_0283059
1202 Ga0495671_0078267
1203 Ga0495671_0099083
1204 Ga0495649_0000165
1205 Ga0495649_0211207
1206 Ga0495660_0037091
1207 Ga0495683_0152950
1208 Ga0495687_059685
1209 Ga0495681_0006515
1210 Ga0495686_0082371
1211 Ga0495686_0226314
1212 Ga0495686_0252425
1213 Ga0496101_0530664
1214 Ga0496103_0301184
1215 Ga0496106_0017594
1216 Ga0496106_0251774
1217 Ga0496113_0305184
1218 Ga0496114_0011920
1219 Ga0496116_0000080
1220 Ga0496116_0009980
1221 Ga0496116_0031077
1222 Ga0496116_0043024
1223 Ga0496116_0066648
1224 Ga0496116_0078950
1225 Ga0496116_0143485
1226 Ga0496116_0144264
1227 Ga0496116_0205731
1228 Ga0496117_0000002
1229 Ga0496117_0002570
1230 Ga0496117_0003540
1231 Ga0496117_0016471
1232 Ga0496117_0031612
1233 Ga0496117_0116758
1234 Ga0496117_0117248
1235 Ga0496117_0149367
1236 Ga0496117_0161780
1237 Ga0496117_0179606
1238 Ga0496117_0187332
1239 Ga0496118_0000233
1240 Ga0496118_0004324
1241 Ga0496118_0056155
1242 Ga0496118_0060112
1243 Ga0496118_0114365
1244 Ga0496118_0138849
1245 Ga0496118_0147281
1246 Ga0496118_0189347
1247 Ga0496119_0025703
1248 Ga0496119_0147606
1249 Ga0496119_0168368
1250 Ga0496120_0000021
1251 Ga0496120_0006881
1252 Ga0496120_0038167
1253 Ga0496121_0000001
1254 Ga0496121_0006792
1255 Ga0496121_0115192
1256 Ga0496121_0136052
1257 Ga0496121_0176353
1258 Ga0496121_0190184
1259 Ga0496121_0386357
1260 Ga0496122_0000001
1261 Ga0496122_0001050
1262 Ga0496122_0002476
1263 Ga0496122_0011009
1264 Ga0496122_0124535
1265 Ga0496122_0178776
1266 Ga0496122_0186589
1267 Ga0496123_0000001
1268 Ga0496123_0000020
1269 Ga0496123_0000158
1270 Ga0496123_0052473
1271 Ga0496123_0064102
1272 Ga0496123_0075335
1273 Ga0496123_0112189
1274 Ga0496123_0133630
1275 Ga0496123_0141095
1276 Ga0496123_0141915
1277 Ga0496124_0000063
1278 Ga0496124_0004315
1279 Ga0496124_0006030
1280 Ga0496124_0010037
1281 Ga0496124_0063645
1282 Ga0496124_0076573
1283 Ga0496124_0109017
1284 Ga0496124_0140029
1285 Ga0496124_0214194
1286 Ga0496124_0268676
1287 Ga0496125_0000001
1288 Ga0496125_0000695
1289 Ga0496125_0056070
1290 Ga0496125_0056714
1291 Ga0496125_0117809
1292 Ga0496125_0130811
1293 Ga0496125_0199862
1294 Ga0496125_0204495
1295 Ga0496126_0000094
1296 Ga0496126_0000195
1297 Ga0496126_0190342
1298 Ga0496126_0193203
1299 Ga0496126_0645744
1300 Ga0496126_0645784
1301 Ga0495678_043266
1302 Ga0501031_0000003
1303 Ga0501031_0010940
1304 Ga0501031_0012255
1305 Ga0501031_0283955
1306 Ga0501032_0000010
1307 Ga0501032_0000234
1308 Ga0501032_0021226
1309 Ga0501032_0137564
1310 Ga0501032_0172395
1311 Ga0501032_0296874
1312 Ga0501033_0000017
1313 Ga0501033_0000076
1314 Ga0501033_0000495
1315 Ga0501033_0001157
1316 Ga0501033_0012742
1317 Ga0501033_0178235
1318 Ga0501033_0328447
1319 Ga0501034_0000053
1320 Ga0501034_0000408
1321 Ga0501034_0043595
1322 Ga0501034_0164311
1323 Ga0501034_0465523
1324 Ga0501036_0000009
1325 Ga0501036_0001942
1326 Ga0501036_0073396
1327 Ga0501036_0369304
1328 Ga0501036_0449501
1329 Ga0501037_0000008
1330 Ga0501037_0000308
1331 Ga0501037_0000533
1332 Ga0501037_0047422
1333 Ga0501037_0156831
1334 Ga0501037_0252976
1335 Ga0501037_0263556
1336 Ga0501038_0000008
1337 Ga0501038_0000241
1338 Ga0501038_0110679
1339 Ga0501038_0327317
1340 Ga0501038_0465463
1341 Ga0501039_0000021
1342 Ga0501039_0000196
1343 Ga0501039_0010706
1344 Ga0501039_0435611
1345 Ga0501040_0001596
1346 Ga0501040_0096527
1347 Ga0501042_0106048
1348 Ga0501043_0000005
1349 Ga0501043_0000043
1350 Ga0501043_0001135
1351 Ga0501043_0039716
1352 Ga0501043_0088873
1353 Ga0501043_0266271
1354 Ga0501046_0053761
1355 Ga0501046_0119833
1356 Ga0501046_0308926
1357 Ga0501047_0000126
1358 Ga0501047_0094812
1359 Ga0501047_0169348
1360 Ga0501047_0397490
1361 Ga0501047_0419612
1362 Ga0501047_0466447
1363 Ga0501048_0004705
1364 Ga0501067_0142045
1365 Ga0501068_0122751
1366 Ga0501068_0179028
1367 Ga0501069_0000011
1368 Ga0501069_0203562
1369 Ga0501069_0280354
1370 Ga0501070_0000117
1371 Ga0501070_0000257
1372 Ga0501070_0010854
1373 Ga0501070_0021633
1374 Ga0501070_0024616
1375 Ga0501070_0043444
1376 Ga0501071_0072949
1377 Ga0501073_0052547
1378 Ga0501073_0084610
1379 Ga0501073_0277058
1380 Ga0501074_0038414
1381 Ga0501074_0050119
1382 Ga0501074_0188929
1383 Ga0501080_0016949
1384 Ga0501080_0039435
1385 Ga0501080_0150872
1386 Ga0501083_0000831
1387 Ga0501083_0040937
1388 Ga0501083_0283738
1389 Ga0501035_0000023
1390 Ga0501035_0000107
1391 Ga0501035_0000449
1392 Ga0501035_0001314
1393 Ga0501035_0002296
1394 Ga0501035_0022408
1395 Ga0501035_0044299
1396 Ga0501035_0051590
1397 Ga0501035_0074842
1398 Ga0501035_0120322
1399 Ga0501035_0283448
1400 Ga0501035_0369481
1401 Ga0501035_0444308
1402 Ga0501035_0714358
1403 Ga0501044_0000021
1404 Ga0501044_0000154
1405 Ga0501044_0003690
1406 Ga0501044_0082812
1407 Ga0501044_0098865
1408 Ga0501044_0192944
1409 Ga0501044_0227015
1410 Ga0501044_0448222
1411 Ga0501044_0532370
1412 Ga0501045_0027060
1413 nmdc:mga00v17_4902_c1
1414 nmdc:mga00v17_72_c1
1415 nmdc:mga0yw44_109848_c1
1416 nmdc:mga0yw44_35604_c1
1417 nmdc:mga0yw44_41265_c1
1418 nmdc:mga0k408_150279_c1
1419 nmdc:mga06z11_104763_c1
1420 nmdc:mga06z11_166055_c1
1421 nmdc:mga04h51_1892_c1
1422 nmdc:mga07m45_113552_c1
1423 nmdc:mga07m45_162572_c1
1424 nmdc:mga0sz30_168461_c1
1425 nmdc:mga0sz30_82783_c1
1426 Ga0500644_0045322
1427 Ga0500644_0084213
1428 Ga0500651_0015578
1429 Ga0500560_026381
1430 Ga0500560_103419
1431 Ga0500562_073957
1432 Ga0500572_002397
1433 Ga0500594_0113537
1434 Ga0500618_024101
1435 Ga0500642_0252219
1436 Ga0500658_0005820
1437 Ga0500658_0097498
1438 Ga0500659_0159517
1439 Ga0500568_0027275
1440 Ga0500568_0090338
1441 Ga0500573_0002214
1442 Ga0500573_0112053
1443 Ga0500604_0059210
1444 Ga0500616_0000817
1445 Ga0500616_0091130
1446 Ga0500622_0000391
1447 Ga0500622_0086810
1448 Ga0500624_001342
1449 Ga0500627_0189577
1450 Ga0500633_0076466
1451 Ga0500634_0074801
1452 Ga0500636_0000010
1453 Ga0500636_0006722
1454 Ga0501082_0093908
1455 2509375018
1456 2509388455
1457 2510131398
1458 2510897752
1459 2511136292
1460 2511170127
1461 2511196833
1462 2511389332
1463 2511500511
1464 2512531972
1465 2512972702
1466 2513570617
1467 2513580230
1468 2513584139
1469 2513602909
1470 2513620456
1471 2513634235
1472 2513713206
1473 2513880583
1474 2513903313
1475 2513987675
1476 2514005161
1477 2514020262
1478 2515110359
1479 2515607709
1480 2515634559
1481 2515643784
1482 2515657182
1483 2515743317
1484 2516204352
1485 2516891843
1486 2517039036
1487 2517079302
1488 2517093231
1489 2517409500
1490 2517568639
1491 2520377850
1492 2524449879
1493 2524457500
1494 2530647837
1495 2537872792
1496 2547372860
1497 2551679314
1498 2551686181
1499 2551691040
1500 2551698520
1501 2551712305
1502 2551722049
1503 2551729915
1504 2551745697
1505 2554246629
1506 2558866019
1507 2559293857
1508 2585227060
1509 2585275455
1510 2585282314
1511 2585325991
1512 2585330161
1513 2585529281
1514 2585536489
1515 2585539667
1516 2585550515
1517 2585556966
1518 2585560102
1519 2585837624
1520 2585844669
1521 2585905717
1522 2585994385
1523 2585998843
1524 2587979167
1525 2599605406
1526 2601609169
1527 2601745944
1528 2616306337
1529 2616553393
1530 2643806279
1531 2643856349
1532 2643921154
1533 2644007303
1534 2644070119
1535 2644381090
1536 2644414996
1537 2644448653
1538 2644519229
1539 2644689039
1540 2657681882
1541 2671112354
1542 2692317270
1543 2719179553
1544 2719663900
1545 2719730223
1546 2720490319
1547 2720618543
1548 2720629951
1549 2720773646
1550 2721145646
1551 2721157163
1552 2721162525
1553 2722838695
1554 2723558902
1555 2723565472
1556 2723578262
1557 2724042979
1558 2724088253
1559 2724102737
1560 2724108635
1561 2725948977
1562 2730162790
1563 2730296795
1564 2738801257
1565 2738948248
1566 2739037057
1567 2753461332
1568 2765464303
1569 2766066583
1570 2776912074
1571 2778174155
1572 2792582936
1573 2792623823
1574 2792629797
1575 2792638132
1576 2793316346
1577 2793323422
1578 2793326184
1579 2793348159
1580 2793364658
1581 2802720328
1582 2802726148
1583 2802731688
1584 2802739439
1585 2802742581
1586 2802749286
1587 2804750902
1588 2806047561
1589 2806054980
1590 2806062118
1591 2806067156
1592 2806076477
1593 2808986368
1594 2819556498
1595 2819608423
1596 2819643500
1597 2819686308
1598 2821123625
1599 2838020268
1600 2838025785
1601 2838029306
1602 2838044441
1603 2838051516
1604 2838071092
1605 2838677226
1606 2838691601
1607 2838716114
1608 2838720086
1609 2838726866
1610 2838733915
1611 2838747021
1612 2839994225
1613 2840769383
1614 2841847018
1615 2841856162
1616 2841860452
1617 2842112191
1618 2842126953
1619 2842132119
1620 2842152712
1621 2842161950
1622 2842169674
1623 2842172359
1624 2842176331
1625 2842185792
1626 2842189221
1627 2842202936
1628 2842213535
1629 2842218813
1630 2842224847
1631 2842235320
1632 2842248225
1633 2842262181
1634 2842268778
1635 2842276574
1636 2842300885
1637 2842306520
1638 2842357993
1639 2842424708
1640 2842433022
1641 2842439327
1642 2842445956
1643 2842467142
1644 2842473830
1645 2842476264
1646 2842482336
1647 2842502834
1648 2842509188
1649 2842517237
1650 2842873063
1651 2843695746
1652 2844456010
1653 2847417663
1654 2848992468
1655 2850079962
1656 2852388463
1657 2854919933
1658 2855831760
1659 2855839981
1660 2855874550
1661 2857523458
1662 2857531189
1663 2858803955
1664 2891049562
1665 2891374950
1666 2894655410
1667 2896391568
1668 2899792517
1669 2899805280
1670 2899847892
1671 2913298006
1672 2913313410
1673 2915980769
1674 2915992642
1675 2915999702
1676 2916002014
1677 2916015417
1678 2916022522
1679 2916033338
1680 2916038826
1681 2916042768
1682 2916050226
1683 2916057693
1684 2916063664
1685 2916071928
1686 2916081867
1687 2919101367
1688 2919116317
1689 2919122068
1690 2919166884
1691 2919172104
1692 2919408785
1693 2920823360
1694 2921207924
1695 2921209377
1696 2921238992
1697 2921245216
1698 2921257173
1699 2921260362
1700 2921266463
1701 2921287577
1702 2921291966
1703 2921301756
1704 2924146036
1705 2924154419
1706 2924163479
1707 2924167067
1708 2924174639
1709 2924180878
1710 2924191792
1711 2924194307
1712 2924202422
1713 2924209654
1714 2924214550
1715 2924224297
1716 2924232979
1717 2924781660
1718 2926757271
1719 2926761487
1720 2933007357
1721 2933015051
1722 2933573589
1723 2933587520
1724 2933594565
1725 2933601891
1726 2935907183
1727 2936368947
1728 2936378437
1729 2936383725
1730 2936999104
1731 2937005061
1732 2937011342
1733 2937018751
1734 2937023805
1735 2937034543
1736 2937041296
1737 2937049457
1738 2937054012
1739 2937060641
1740 2937070015
1741 2937071534
1742 2937078755
1743 2937086085
1744 2937093276
1745 2937103464
1746 2937110393
1747 2937114691
1748 2937122601
1749 2937128479
1750 2954014653
1751 2957382071
1752 2957383649
1753 2957394052
1754 2957399573
1755 2957403697
1756 2957411052
1757 2957421549
1758 2957429480
1759 2957435389
1760 2957442624
1761 2957447142
1762 2957457314
1763 2957464425
1764 2957466198
1765 2957477049
1766 2957480301
1767 2957489045
1768 2957494585
1769 2957503796
1770 2957508594
1771 2960585693
1772 2960594752
1773 2960599754
1774 2960605395
1775 2960616914
1776 2960621682
1777 2960629218
1778 2960637471
1779 2960638834
1780 2960647669
1781 2960658871
1782 2960660426
1783 2960668440
1784 2960676388
1785 2960686597
1786 2960690308
1787 2960698838
1788 2961177043
1789 2964608419
1790 2964619794
1791 2964622449
1792 2964634293
1793 2964636423
1794 2964646952
1795 2964650317
1796 2964659450
1797 2964664933
1798 2964675417
1799 2964680595
1800 2964691086
1801 2964693055
1802 2964704148
1803 2964707170
1804 2964718589
1805 2964724992
1806 2967667659
1807 2967678163
1808 2967684943
1809 2967691511
1810 2967695055
1811 2967701967
1812 2967712751
1813 2967714649
1814 2967722476
1815 2967730544
1816 2967736346
1817 2967747798
1818 2967751861
1819 2967761283
1820 2967762703
1821 2967771318
1822 2967777019
1823 2968002831
1824 2970023336
1825 2970030565
1826 2970034048
1827 2970045475
1828 2970052644
1829 2970061189
1830 2970063978
1831 2970073357
1832 2970080385
1833 2970087323
1834 2970095391
1835 2970101499
1836 2970103351
1837 2970116073
1838 2970118579
1839 2970126283
1840 2970131553
1841 2970143356
1842 2970148526
1843 2970153239
1844 2970159547
1845 2970167723
1846 2970177003
1847 2970181914
1848 2970188471
1849 2970196410
1850 2977518036
1851 2977529148
1852 2977535847
1853 2977539973
1854 2977549479
1855 2977552945
1856 2977559294
1857 2977567496
1858 2977579590
1859 2977580423
1860 2977822151
1861 2978973301
1862 2979093225
1863 2979099390
1864 2979105195
1865 2984512948
1866 2984520688
1867 2984539980
1868 2984591582
1869 2984602171
1870 2989351425
1871 2989772774
1872 2996893415
1873 3005411214
1874 3005422823
1875 3005446165
1876 3005452824
1877 639646630
1878 643824526
1879 648739357
1880 650739048
1881 8003572681
1882 8003992434
1883 8003999762
1884 8004644546
1885 8005289028
1886 8005301534
1887 8005309213
1888 8005321641
1889 8005377453
1890 8005387316
1891 8005400107
1892 8005432914
1893 8005460998
1894 8005484934
1895 8005498642
1896 8005560603
1897 8005563938
1898 8005576902
1899 8005619836
1900 8005650130
1901 8005660374
1902 8005670053
1903 8005690250
1904 8005699273
1905 8018153081
1906 8018169006
1907 8023684260
1908 8024480257
1909 8046769860
1910 8049293458
1911 8054461310
1912 8055433426
1913 8056375615
1914 8057577821
1915 8057876029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

22

243

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.944 2 213
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.9354 2 213
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.9251 12 213
3lhi-assembly1.cif.gz_A crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution 0.9075 2 213
3lhi-assembly1.cif.gz_A crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution 0.8992 2 213
ID Description Score Start End Superfamily
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9202 12 213 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9154 2 213 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9071 2 213 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.892 5 213 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8718 5 213 3.40.50.1360
ID Description Score Start End GO Terms
AF-M5JS82-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9865 45 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A7W7YWS2-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9844 1 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A7K3UD13-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9829 1 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A4Q3I3H1-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9802 1 167 GO:0005975
GO:0006098
GO:0017057
AF-A0A7W7YWS2-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9798 1 213 GO:0005975
GO:0006098
GO:0017057

Map