F486786

General Info

Members Datasets Scaffolds Average Seq Length
958 243 1916 286

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1000377|JGI24741J21665_100037713
Length 320
Sequence MALDLYQRLGLKRGASEAEIKKAYRSLAKQLHPDRNKDKPDAAKRFSEVTAAYDLLSDKDKRARYDRGEIDEDGNPKMPFGGGFGGYSQGGGPRPGAGGPQGFENFNFGGADAADLSDLFEGLFGAAQSRGRGSGPFGGFRQRAAPPQKGADVAYRLKVPFEDAVALSPQRITLADGKTIDLKLPKGVEDGTKIRLAGKGQDGPAGRGDAIVTIEIAPHRFFTRDGTNIRLALPVTLKEAVLGAKVKVPTPEGPVMLTIPKGASSGTVLRLKGRGFTGKDGKRGDQLVAVEVDLPAHDPALQQFAESWDGGGNPRSGLGV

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 4.91
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000377 3300001915 Bacteria 13371
2 JGI24736J21556_1007854 3300001904 Bacteria 1785
3 JGI24746J21847_1008388 3300001977 Bacteria 1559
4 JGI24740J21852_10002452 3300001979 Bacteria 8411
5 JGI24740J21852_10006316 3300001979 Bacteria 4920
6 JGI24739J22299_10000015 3300001989 Bacteria 51265
7 JGI24739J22299_10006558 3300001989 Bacteria 4385
8 JGI24737J22298_10000005 3300001990 Bacteria 65241
9 JGI24737J22298_10000256 3300001990 Bacteria 17649
10 JGI24737J22298_10005760 3300001990 Bacteria 4266
11 JGI24737J22298_10008247 3300001990 Bacteria 3495
12 JGI24737J22298_10010523 3300001990 Bacteria 3052
13 JGI24737J22298_10023523 3300001990 Bacteria 1953
14 JGI24737J22298_10027358 3300001990 Bacteria 1798
15 JGI24743J22301_10006038 3300001991 Bacteria 2047
16 JGI24735J21928_10003623 3300002067 Bacteria 5241
17 JGI24735J21928_10008463 3300002067 Bacteria 3324
18 JGI24735J21928_10025474 3300002067 Bacteria 1785
19 JGI24738J21930_10000252 3300002075 Bacteria 14559
20 JGI24744J21845_10001214 3300002077 Bacteria 5053
21 JGI24035J26624_1002241 3300002126 Bacteria 1808
22 Ga0065715_10000754 3300005293 Bacteria 8580
23 Ga0070658_10000571 3300005327 Bacteria 32039
24 Ga0070658_10006843 3300005327 Bacteria 9217
25 Ga0070658_10069548 3300005327 Bacteria 2880
26 Ga0070658_10112785 3300005327 Bacteria 2254
27 Ga0070658_10272738 3300005327 Bacteria 1439
28 Ga0070676_10010282 3300005328 Bacteria 5075
29 Ga0070676_10014166 3300005328 Bacteria 4379
30 Ga0070676_10018338 3300005328 Bacteria 3878
31 Ga0070676_10037450 3300005328 Bacteria 2797
32 Ga0070676_10052979 3300005328 Bacteria 2388
33 Ga0070676_10173440 3300005328 Bacteria 1397
34 Ga0070683_100002329 3300005329 Bacteria 15071
35 Ga0070683_100010396 3300005329 Bacteria 8004
36 Ga0070683_100229281 3300005329 Bacteria 1765
37 Ga0070690_100002397 3300005330 Bacteria 10064
38 Ga0070690_100042651 3300005330 Bacteria 2874
39 Ga0070690_100166379 3300005330 Bacteria 1515
40 Ga0070670_100003539 3300005331 Bacteria 12988
41 Ga0070670_100013599 3300005331 Bacteria 6975
42 Ga0070670_100014268 3300005331 Bacteria 6817
43 Ga0070670_100031653 3300005331 Bacteria 4556
44 Ga0070670_100080560 3300005331 Bacteria 2798
45 Ga0070670_100089747 3300005331 Bacteria 2642
46 Ga0070670_100111387 3300005331 Bacteria 2358
47 Ga0070677_10014461 3300005333 Bacteria 2778
48 Ga0070677_10025838 3300005333 Bacteria 2196
49 Ga0070677_10035426 3300005333 Bacteria 1935
50 Ga0070677_10038264 3300005333 Bacteria 1876
51 Ga0070677_10096717 3300005333 Bacteria 1294
52 Ga0068869_100000003 3300005334 Bacteria 136262
53 Ga0070666_10000453 3300005335 Bacteria 24969
54 Ga0070666_10003732 3300005335 Bacteria 9229
55 Ga0070666_10083562 3300005335 Bacteria 2184
56 Ga0070666_10084747 3300005335 Bacteria 2170
57 Ga0070666_10190078 3300005335 Bacteria 1442
58 Ga0070680_100004013 3300005336 Bacteria 11011
59 Ga0070680_100006559 3300005336 Bacteria 8852
60 Ga0070680_100042360 3300005336 Bacteria 3694
61 Ga0070680_100080399 3300005336 Bacteria 2688
62 Ga0070680_100113776 3300005336 Bacteria 2254
63 Ga0070680_100184107 3300005336 Bacteria 1759
64 Ga0070682_100249126 3300005337 Bacteria 1280
65 Ga0068868_100000887 3300005338 Bacteria 20308
66 Ga0068868_100027730 3300005338 Bacteria 4322
67 Ga0068868_100042785 3300005338 Bacteria 3537
68 Ga0068868_100054147 3300005338 Bacteria 3161
69 Ga0068868_100198752 3300005338 Bacteria 1670
70 Ga0070660_100004195 3300005339 Bacteria 9953
71 Ga0070660_100005577 3300005339 Bacteria 8723
72 Ga0070660_100016711 3300005339 Bacteria 5334
73 Ga0070660_100042224 3300005339 Bacteria 3480
74 Ga0070660_100048038 3300005339 Bacteria 3277
75 Ga0070660_100083631 3300005339 Bacteria 2507
76 Ga0070689_100127869 3300005340 Bacteria 2035
77 Ga0070687_100182663 3300005343 Bacteria 1257
78 Ga0070661_100023633 3300005344 Bacteria 4407
79 Ga0070661_100024565 3300005344 Bacteria 4322
80 Ga0070661_100037627 3300005344 Bacteria 3520
81 Ga0070661_100049722 3300005344 Bacteria 3069
82 Ga0070661_100054233 3300005344 Bacteria 2936
83 Ga0070661_100073699 3300005344 Bacteria 2513
84 Ga0070661_100138783 3300005344 Bacteria 1831
85 Ga0070692_10000543 3300005345 Bacteria 11731
86 Ga0070692_10014403 3300005345 Bacteria 3714
87 Ga0070692_10018337 3300005345 Bacteria 3363
88 Ga0070692_10024208 3300005345 Bacteria 2982
89 Ga0070692_10034850 3300005345 Bacteria 2545
90 Ga0070668_100001009 3300005347 Bacteria 19720
91 Ga0070668_100002740 3300005347 Bacteria 12969
92 Ga0070668_100071771 3300005347 Bacteria 2697
93 Ga0070669_100000128 3300005353 Bacteria 69625
94 Ga0070669_100001654 3300005353 Bacteria 16124
95 Ga0070669_100028665 3300005353 Bacteria 4009
96 Ga0070669_100086600 3300005353 Bacteria 2341
97 Ga0070669_100103488 3300005353 Bacteria 2151
98 Ga0070669_100241319 3300005353 Bacteria 1436
99 Ga0070669_100253872 3300005353 Bacteria 1401
100 Ga0070669_100268194 3300005353 Bacteria 1364
101 Ga0070675_100014659 3300005354 Bacteria 6182
102 Ga0070675_100088219 3300005354 Bacteria 2595
103 Ga0070675_100091566 3300005354 Bacteria 2548
104 Ga0070671_100001632 3300005355 Bacteria 16922
105 Ga0070671_100016818 3300005355 Bacteria 5914
106 Ga0070671_100027920 3300005355 Bacteria 4646
107 Ga0070671_100075526 3300005355 Bacteria 2815
108 Ga0070671_100132858 3300005355 Bacteria 2097
109 Ga0070671_100146046 3300005355 Bacteria 1996
110 Ga0070674_100009453 3300005356 Bacteria 5838
111 Ga0070674_100010332 3300005356 Bacteria 5639
112 Ga0070674_100032362 3300005356 Bacteria 3472
113 Ga0070674_100051455 3300005356 Bacteria 2839
114 Ga0070674_100099034 3300005356 Bacteria 2120
115 Ga0070674_100109581 3300005356 Bacteria 2025
116 Ga0070674_100172851 3300005356 Bacteria 1649
117 Ga0070673_100006641 3300005364 Bacteria 7542
118 Ga0070673_100026593 3300005364 Bacteria 4276
119 Ga0070673_100081023 3300005364 Bacteria 2631
120 Ga0070673_100128741 3300005364 Bacteria 2121
121 Ga0070673_100222612 3300005364 Bacteria 1634
122 Ga0070659_100000220 3300005366 Bacteria 44199
123 Ga0070659_100006492 3300005366 Bacteria 8441
124 Ga0070659_100007675 3300005366 Bacteria 7846
125 Ga0070659_100012714 3300005366 Bacteria 6246
126 Ga0070659_100023575 3300005366 Bacteria 4711
127 Ga0070659_100029288 3300005366 Bacteria 4254
128 Ga0070659_100068394 3300005366 Bacteria 2817
129 Ga0070659_100134345 3300005366 Bacteria 2011
130 Ga0070659_100175425 3300005366 Bacteria 1757
131 Ga0070659_100318690 3300005366 Bacteria 1299
132 Ga0070667_100001743 3300005367 Bacteria 19441
133 Ga0070667_100002260 3300005367 Bacteria 16958
134 Ga0070667_100005674 3300005367 Bacteria 10426
135 Ga0070667_100007567 3300005367 Bacteria 9012
136 Ga0070667_100009002 3300005367 Bacteria 8265
137 Ga0070667_100032809 3300005367 Bacteria 4333
138 Ga0070667_100132111 3300005367 Bacteria 2180
139 Ga0070709_10040699 3300005434 Bacteria 2859
140 Ga0070714_100008475 3300005435 Bacteria 8032
141 Ga0070714_100008540 3300005435 Bacteria 8008
142 Ga0070714_100051556 3300005435 Bacteria 3508
143 Ga0070713_100001432 3300005436 Bacteria 15307
144 Ga0070713_100059900 3300005436 Bacteria 3181
145 Ga0070710_10081687 3300005437 Bacteria 1888
146 Ga0070700_100190307 3300005441 Bacteria 1434
147 Ga0070694_100008131 3300005444 Bacteria 6408
148 Ga0070663_100013338 3300005455 Bacteria 5236
149 Ga0070663_100048750 3300005455 Bacteria 3005
150 Ga0070663_100062520 3300005455 Bacteria 2684
151 Ga0070663_100143572 3300005455 Bacteria 1825
152 Ga0070663_100176175 3300005455 Bacteria 1656
153 Ga0070678_100004698 3300005456 Bacteria 7775
154 Ga0070678_100006366 3300005456 Bacteria 6927
155 Ga0070678_100014083 3300005456 Bacteria 5033
156 Ga0070678_100014806 3300005456 Bacteria 4933
157 Ga0070662_100000253 3300005457 Bacteria 31619
158 Ga0070662_100001068 3300005457 Bacteria 16709
159 Ga0070662_100006675 3300005457 Bacteria 7453
160 Ga0070662_100006963 3300005457 Bacteria 7316
161 Ga0070662_100009870 3300005457 Bacteria 6255
162 Ga0070662_100024072 3300005457 Bacteria 4191
163 Ga0070662_100040886 3300005457 Bacteria 3304
164 Ga0070662_100047114 3300005457 Bacteria 3099
165 Ga0070662_100075482 3300005457 Bacteria 2496
166 Ga0070662_100109426 3300005457 Bacteria 2103
167 Ga0070662_100165969 3300005457 Bacteria 1730
168 Ga0070662_100255008 3300005457 Bacteria 1411
169 Ga0070681_10043365 3300005458 Bacteria 4507
170 Ga0068867_100002144 3300005459 Bacteria 13847
171 Ga0068867_100002840 3300005459 Bacteria 12180
172 Ga0068867_100004962 3300005459 Bacteria 9377
173 Ga0068867_100017981 3300005459 Bacteria 5022
174 Ga0068867_100144277 3300005459 Bacteria 1864
175 Ga0068867_100196041 3300005459 Bacteria 1614
176 Ga0070679_100128246 3300005530 Bacteria 2518
177 Ga0070679_100225909 3300005530 Bacteria 1832
178 Ga0068853_100001264 3300005539 Bacteria 18103
179 Ga0068853_100014196 3300005539 Bacteria 6520
180 Ga0068853_100094145 3300005539 Bacteria 2639
181 Ga0068853_100102167 3300005539 Bacteria 2537
182 Ga0068853_100110374 3300005539 Bacteria 2443
183 Ga0068853_100140925 3300005539 Bacteria 2164
184 Ga0068853_100167582 3300005539 Bacteria 1986
185 Ga0068853_100282696 3300005539 Bacteria 1530
186 Ga0070672_100001398 3300005543 Bacteria 14886
187 Ga0070672_100001554 3300005543 Bacteria 14228
188 Ga0070672_100003180 3300005543 Bacteria 10627
189 Ga0070672_100003736 3300005543 Bacteria 9909
190 Ga0070672_100012875 3300005543 Bacteria 5893
191 Ga0070672_100013920 3300005543 Bacteria 5691
192 Ga0070672_100055950 3300005543 Bacteria 3092
193 Ga0070672_100207139 3300005543 Bacteria 1641
194 Ga0070672_100226375 3300005543 Bacteria 1570
195 Ga0070672_100242545 3300005543 Bacteria 1516
196 Ga0070696_100004087 3300005546 Bacteria 9731
197 Ga0070665_100001610 3300005548 Bacteria 25968
198 Ga0070665_100055198 3300005548 Bacteria 3984
199 Ga0070665_100056058 3300005548 Bacteria 3952
200 Ga0070665_100505339 3300005548 Bacteria 1220
201 Ga0070704_100204596 3300005549 Bacteria 1596
202 Ga0068855_100005203 3300005563 Bacteria 15868
203 Ga0068855_100061171 3300005563 Bacteria 4400
204 Ga0068855_100153040 3300005563 Bacteria 2622
205 Ga0068855_100216955 3300005563 Bacteria 2147
206 Ga0068855_100225857 3300005563 Bacteria 2098
207 Ga0070664_100001820 3300005564 Bacteria 17096
208 Ga0070664_100003812 3300005564 Bacteria 12177
209 Ga0070664_100003943 3300005564 Bacteria 11967
210 Ga0070664_100027608 3300005564 Bacteria 4717
211 Ga0070664_100048645 3300005564 Bacteria 3583
212 Ga0070664_100055332 3300005564 Bacteria 3368
213 Ga0070664_100062069 3300005564 Bacteria 3185
214 Ga0070664_100071846 3300005564 Bacteria 2966
215 Ga0070664_100185409 3300005564 Bacteria 1851
216 Ga0070664_100339622 3300005564 Bacteria 1364
217 Ga0068857_100000026 3300005577 Bacteria 83525
218 Ga0068857_100003458 3300005577 Bacteria 13174
219 Ga0068857_100028776 3300005577 Bacteria 4902
220 Ga0068857_100081835 3300005577 Bacteria 2883
221 Ga0068857_100099290 3300005577 Bacteria 2611
222 Ga0068857_100099460 3300005577 Bacteria 2609
223 Ga0068857_100141491 3300005577 Bacteria 2175
224 Ga0068857_100351966 3300005577 Bacteria 1364
225 Ga0068854_100000204 3300005578 Bacteria 40135
226 Ga0068854_100015475 3300005578 Bacteria 5055
227 Ga0068854_100022590 3300005578 Bacteria 4289
228 Ga0068854_100052483 3300005578 Bacteria 2924
229 Ga0068854_100214785 3300005578 Bacteria 1519
230 Ga0068856_100047207 3300005614 Bacteria 4242
231 Ga0068856_100297292 3300005614 Bacteria 1632
232 Ga0068852_100001011 3300005616 Bacteria 18568
233 Ga0068852_100002419 3300005616 Bacteria 12854
234 Ga0068852_100019175 3300005616 Bacteria 5406
235 Ga0068852_100030578 3300005616 Bacteria 4435
236 Ga0068852_100032794 3300005616 Bacteria 4304
237 Ga0068852_100034580 3300005616 Bacteria 4206
238 Ga0068852_100055704 3300005616 Bacteria 3413
239 Ga0068852_100183362 3300005616 Bacteria 1970
240 Ga0068852_100223614 3300005616 Bacteria 1791
241 Ga0068852_100230853 3300005616 Bacteria 1764
242 Ga0068852_100237284 3300005616 Bacteria 1741
243 Ga0068852_100336300 3300005616 Bacteria 1470
244 Ga0068852_100395917 3300005616 Bacteria 1358
245 Ga0068852_100397660 3300005616 Bacteria 1355
246 Ga0068852_100670303 3300005616 Bacteria 1046
247 Ga0068859_100003116 3300005617 Bacteria 16840
248 Ga0068859_100008469 3300005617 Bacteria 10409
249 Ga0068859_100023729 3300005617 Bacteria 6156
250 Ga0068859_100039022 3300005617 Bacteria 4763
251 Ga0068859_100044141 3300005617 Bacteria 4480
252 Ga0068859_100056578 3300005617 Bacteria 3948
253 Ga0068859_100131492 3300005617 Bacteria 2574
254 Ga0068859_100276988 3300005617 Bacteria 1770
255 Ga0068859_100376694 3300005617 Bacteria 1515
256 Ga0068864_100000047 3300005618 Bacteria 150798
257 Ga0068864_100000136 3300005618 Bacteria 70797
258 Ga0068864_100001237 3300005618 Bacteria 21245
259 Ga0068864_100004926 3300005618 Bacteria 10941
260 Ga0068864_100006088 3300005618 Bacteria 9896
261 Ga0068864_100018456 3300005618 Bacteria 5829
262 Ga0068864_100110832 3300005618 Bacteria 2444
263 Ga0068864_100476133 3300005618 Bacteria 1198
264 Ga0068866_10008716 3300005718 Bacteria 4286
265 Ga0068866_10194674 3300005718 Bacteria 1207
266 Ga0068861_100009762 3300005719 Bacteria 6637
267 Ga0068851_10002358 3300005834 Bacteria 8310
268 Ga0068851_10003968 3300005834 Bacteria 6627
269 Ga0068851_10020303 3300005834 Bacteria 3216
270 Ga0068851_10041408 3300005834 Bacteria 2315
271 Ga0068851_10151227 3300005834 Bacteria 1269
272 Ga0068870_10185255 3300005840 Bacteria 1253
273 Ga0068863_100000289 3300005841 Bacteria 52032
274 Ga0068863_100000384 3300005841 Bacteria 44825
275 Ga0068863_100001357 3300005841 Bacteria 24344
276 Ga0068863_100007264 3300005841 Bacteria 10850
277 Ga0068863_100015410 3300005841 Bacteria 7349
278 Ga0068863_100021890 3300005841 Bacteria 6099
279 Ga0068863_100148527 3300005841 Bacteria 2242
280 Ga0068858_100000063 3300005842 Bacteria 111811
281 Ga0068858_100000425 3300005842 Bacteria 43961
282 Ga0068858_100001550 3300005842 Bacteria 23576
283 Ga0068858_100005371 3300005842 Bacteria 12560
284 Ga0068858_100014673 3300005842 Bacteria 7375
285 Ga0068858_100022806 3300005842 Bacteria 5838
286 Ga0068858_100047366 3300005842 Bacteria 3985
287 Ga0068858_100070302 3300005842 Bacteria 3244
288 Ga0068860_100000607 3300005843 Bacteria 42670
289 Ga0068860_100008482 3300005843 Bacteria 10241
290 Ga0068860_100048962 3300005843 Bacteria 4028
291 Ga0068860_100098429 3300005843 Bacteria 2789
292 Ga0068860_100113882 3300005843 Bacteria 2586
293 Ga0068860_100119602 3300005843 Bacteria 2522
294 Ga0068860_100624652 3300005843 Bacteria 1084
295 Ga0068862_100001336 3300005844 Bacteria 22904
296 Ga0068862_100008474 3300005844 Bacteria 8504
297 Ga0068862_100082876 3300005844 Bacteria 2784
298 Ga0068862_100193261 3300005844 Bacteria 1832
299 Ga0068862_100540474 3300005844 Bacteria 1111
300 Ga0081539_10008427 3300005985 Bacteria 8992
301 Ga0081539_10039766 3300005985 Bacteria 2770
302 Ga0070717_10006588 3300006028 Bacteria 8555
303 Ga0070717_10035789 3300006028 Bacteria 4023
304 Ga0070716_100141477 3300006173 Bacteria 1535
305 Ga0070712_100018999 3300006175 Bacteria 4473
306 Ga0070712_100128196 3300006175 Bacteria 1920
307 Ga0097621_100004205 3300006237 Bacteria 9992
308 Ga0097621_100005903 3300006237 Bacteria 8654
309 Ga0097621_100169684 3300006237 Bacteria 1880
310 Ga0068871_100015768 3300006358 Bacteria 5668
311 Ga0068871_100020122 3300006358 Bacteria 5107
312 Ga0068871_100172088 3300006358 Bacteria 1857
313 Ga0068871_100269191 3300006358 Bacteria 1488
314 Ga0075428_100480991 3300006844 Bacteria 1329
315 Ga0075433_10074204 3300006852 Bacteria 2993
316 Ga0068865_100003427 3300006881 Bacteria 9489
317 Ga0068865_100015663 3300006881 Bacteria 4838
318 Ga0068865_100113424 3300006881 Bacteria 2003
319 Ga0068865_100117605 3300006881 Bacteria 1971
320 Ga0097620_100003116 3300006931 Bacteria 16840
321 Ga0097620_100008469 3300006931 Bacteria 10409
322 Ga0097620_100023729 3300006931 Bacteria 6156
323 Ga0097620_100039021 3300006931 Bacteria 4763
324 Ga0097620_100056578 3300006931 Bacteria 3948
325 Ga0097620_100131489 3300006931 Bacteria 2574
326 Ga0097620_100276995 3300006931 Bacteria 1770
327 Ga0097620_100376705 3300006931 Bacteria 1515
328 Ga0105240_10134041 3300009093 Bacteria 2967
329 Ga0105240_10457864 3300009093 Bacteria 1426
330 Ga0105245_10000062 3300009098 Bacteria 115179
331 Ga0105245_10012522 3300009098 Bacteria 7382
332 Ga0105245_10125368 3300009098 Bacteria 2403
333 Ga0105243_10044509 3300009148 Bacteria 3483
334 Ga0105243_10082712 3300009148 Bacteria 2625
335 Ga0105241_10033723 3300009174 Bacteria 3844
336 Ga0105241_10071114 3300009174 Bacteria 2701
337 Ga0105241_10187774 3300009174 Bacteria 1718
338 Ga0105242_10003904 3300009176 Bacteria 11589
339 Ga0105242_10470769 3300009176 Bacteria 1189
340 Ga0105248_10001782 3300009177 Bacteria 23920
341 Ga0105248_10002384 3300009177 Bacteria 20876
342 Ga0105248_10063271 3300009177 Bacteria 4153
343 Ga0105248_10114890 3300009177 Bacteria 3036
344 Ga0105248_10117346 3300009177 Bacteria 3002
345 Ga0105248_10153927 3300009177 Bacteria 2594
346 Ga0105248_10167354 3300009177 Bacteria 2477
347 Ga0105248_10305353 3300009177 Bacteria 1792
348 Ga0105248_10443528 3300009177 Bacteria 1462
349 Ga0105248_10458590 3300009177 Bacteria 1437
350 Ga0105248_10462159 3300009177 Bacteria 1431
351 Ga0105238_10133340 3300009551 Bacteria 2462
352 Ga0105238_10153772 3300009551 Bacteria 2275
353 Ga0105238_10276759 3300009551 Bacteria 1659
354 Ga0105238_10441974 3300009551 Bacteria 1297
355 Ga0105249_10055925 3300009553 Bacteria 3612
356 Ga0105249_10056170 3300009553 Bacteria 3604
357 Ga0105246_10032787 3300011119 Bacteria 3448
358 Ga0105246_10040944 3300011119 Bacteria 3130
359 Ga0105246_10145362 3300011119 Bacteria 1788
360 Ga0157373_10012041 3300013100 Bacteria 6357
361 Ga0157373_10138570 3300013100 Bacteria 1711
362 Ga0157373_10263492 3300013100 Bacteria 1220
363 Ga0157371_10000144 3300013102 Bacteria 103512
364 Ga0157371_10002441 3300013102 Bacteria 17716
365 Ga0157371_10019224 3300013102 Bacteria 5040
366 Ga0157371_10066598 3300013102 Bacteria 2550
367 Ga0157371_10081821 3300013102 Bacteria 2286
368 Ga0157371_10290802 3300013102 Bacteria 1181
369 Ga0157370_10090133 3300013104 Bacteria 2879
370 Ga0157370_10110534 3300013104 Bacteria 2569
371 Ga0157370_10188572 3300013104 Bacteria 1914
372 Ga0157370_10223041 3300013104 Bacteria 1746
373 Ga0157370_10267785 3300013104 Bacteria 1579
374 Ga0157370_10336864 3300013104 Bacteria 1391
375 Ga0157369_10000741 3300013105 Bacteria 42087
376 Ga0157369_10007345 3300013105 Bacteria 12686
377 Ga0157369_10032579 3300013105 Bacteria 5730
378 Ga0157369_10039133 3300013105 Bacteria 5183
379 Ga0157369_10080219 3300013105 Bacteria 3495
380 Ga0157369_10186378 3300013105 Bacteria 2182
381 Ga0157369_10238555 3300013105 Bacteria 1899
382 Ga0157374_10015411 3300013296 Bacteria 6704
383 Ga0157374_10056914 3300013296 Bacteria 3651
384 Ga0157374_10147142 3300013296 Bacteria 2288
385 Ga0157374_10298096 3300013296 Bacteria 1594
386 Ga0157378_10001355 3300013297 Bacteria 22018
387 Ga0157378_10006454 3300013297 Bacteria 10257
388 Ga0157378_10111576 3300013297 Bacteria 2507
389 Ga0163162_10036564 3300013306 Bacteria 4895
390 Ga0163162_10042776 3300013306 Bacteria 4535
391 Ga0163162_10060012 3300013306 Bacteria 3836
392 Ga0163162_10134078 3300013306 Bacteria 2587
393 Ga0163162_10157534 3300013306 Bacteria 2391
394 Ga0163162_10170905 3300013306 Bacteria 2298
395 Ga0157372_10080846 3300013307 Bacteria 3678
396 Ga0157372_10585257 3300013307 Bacteria 1301
397 Ga0157372_10873945 3300013307 Bacteria 1043
398 Ga0157375_10018509 3300013308 Bacteria 6319
399 Ga0157375_10045857 3300013308 Bacteria 4257
400 Ga0157375_10049254 3300013308 Bacteria 4127
401 Ga0157375_10109212 3300013308 Bacteria 2862
402 Ga0157375_10157743 3300013308 Bacteria 2409
403 Ga0157375_10480946 3300013308 Bacteria 1407
404 Ga0163163_10000170 3300014325 Bacteria 68377
405 Ga0163163_10002608 3300014325 Bacteria 15271
406 Ga0163163_10082110 3300014325 Bacteria 3226
407 Ga0157380_10005625 3300014326 Bacteria 8760
408 Ga0157380_10009239 3300014326 Bacteria 7056
409 Ga0157377_10005231 3300014745 Bacteria 6075
410 Ga0157379_10001773 3300014968 Bacteria 17808
411 Ga0157379_10027477 3300014968 Bacteria 5066
412 Ga0157379_10105055 3300014968 Bacteria 2535
413 Ga0157379_10255519 3300014968 Bacteria 1591
414 Ga0157376_10029474 3300014969 Bacteria 4371
415 Ga0163161_10006404 3300017792 Bacteria 8153
416 Ga0163161_10015740 3300017792 Bacteria 5274
417 Ga0213875_10000512 3300021388 Bacteria 32271
418 Ga0207697_10000235 3300025315 Bacteria 30187
419 Ga0207697_10001587 3300025315 Bacteria 12278
420 Ga0207697_10003726 3300025315 Bacteria 7453
421 Ga0207656_10001434 3300025321 Bacteria 7903
422 Ga0207656_10008936 3300025321 Bacteria 3710
423 Ga0207656_10062738 3300025321 Bacteria 1634
424 Ga0207682_10005975 3300025893 Bacteria 4924
425 Ga0207682_10017751 3300025893 Bacteria 2778
426 Ga0207682_10022523 3300025893 Bacteria 2482
427 Ga0207682_10041986 3300025893 Bacteria 1868
428 Ga0207682_10090281 3300025893 Bacteria 1327
429 Ga0207682_10096173 3300025893 Bacteria 1290
430 Ga0207692_10065559 3300025898 Bacteria 1895
431 Ga0207642_10004951 3300025899 Bacteria 4317
432 Ga0207688_10000105 3300025901 Bacteria 33639
433 Ga0207688_10018963 3300025901 Bacteria 3743
434 Ga0207688_10047406 3300025901 Bacteria 2400
435 Ga0207688_10050888 3300025901 Bacteria 2320
436 Ga0207688_10093327 3300025901 Bacteria 1731
437 Ga0207688_10111732 3300025901 Bacteria 1587
438 Ga0207680_10001515 3300025903 Bacteria 10936
439 Ga0207680_10121214 3300025903 Bacteria 1710
440 Ga0207647_10000181 3300025904 Bacteria 50570
441 Ga0207647_10000317 3300025904 Bacteria 40172
442 Ga0207647_10001120 3300025904 Bacteria 20616
443 Ga0207647_10007233 3300025904 Bacteria 8037
444 Ga0207647_10018342 3300025904 Bacteria 4736
445 Ga0207647_10030193 3300025904 Bacteria 3500
446 Ga0207647_10037676 3300025904 Bacteria 3064
447 Ga0207647_10052209 3300025904 Bacteria 2524
448 Ga0207647_10077349 3300025904 Bacteria 2000
449 Ga0207645_10009226 3300025907 Bacteria 6833
450 Ga0207645_10018802 3300025907 Bacteria 4539
451 Ga0207645_10024754 3300025907 Bacteria 3888
452 Ga0207645_10057813 3300025907 Bacteria 2476
453 Ga0207643_10097936 3300025908 Bacteria 1717
454 Ga0207705_10002713 3300025909 Bacteria 13555
455 Ga0207705_10005163 3300025909 Bacteria 9789
456 Ga0207705_10014253 3300025909 Bacteria 5725
457 Ga0207705_10014945 3300025909 Bacteria 5581
458 Ga0207705_10016089 3300025909 Bacteria 5368
459 Ga0207705_10032278 3300025909 Bacteria 3741
460 Ga0207705_10044026 3300025909 Bacteria 3207
461 Ga0207705_10050840 3300025909 Bacteria 2984
462 Ga0207705_10089055 3300025909 Bacteria 2258
463 Ga0207705_10301896 3300025909 Bacteria 1228
464 Ga0207707_10067503 3300025912 Bacteria 3115
465 Ga0207707_10111355 3300025912 Bacteria 2393
466 Ga0207707_10264357 3300025912 Bacteria 1492
467 Ga0207695_10028165 3300025913 Bacteria 6238
468 Ga0207695_10488148 3300025913 Bacteria 1114
469 Ga0207693_10070955 3300025915 Bacteria 2726
470 Ga0207693_10090232 3300025915 Bacteria 2402
471 Ga0207660_10001621 3300025917 Bacteria 15097
472 Ga0207660_10004028 3300025917 Bacteria 9586
473 Ga0207660_10013357 3300025917 Bacteria 5382
474 Ga0207660_10017005 3300025917 Bacteria 4825
475 Ga0207662_10044689 3300025918 Bacteria 2616
476 Ga0207657_10000092 3300025919 Bacteria 85665
477 Ga0207657_10001566 3300025919 Bacteria 24548
478 Ga0207657_10002456 3300025919 Bacteria 20031
479 Ga0207657_10004380 3300025919 Bacteria 14945
480 Ga0207657_10007333 3300025919 Bacteria 11314
481 Ga0207657_10042542 3300025919 Bacteria 4007
482 Ga0207657_10054103 3300025919 Bacteria 3473
483 Ga0207657_10073566 3300025919 Bacteria 2888
484 Ga0207657_10075939 3300025919 Bacteria 2836
485 Ga0207657_10087703 3300025919 Bacteria 2603
486 Ga0207657_10111592 3300025919 Bacteria 2257
487 Ga0207657_10277672 3300025919 Bacteria 1331
488 Ga0207649_10018128 3300025920 Bacteria 3997
489 Ga0207649_10027267 3300025920 Bacteria 3350
490 Ga0207649_10064505 3300025920 Bacteria 2316
491 Ga0207681_10000964 3300025923 Bacteria 18767
492 Ga0207681_10001107 3300025923 Bacteria 17467
493 Ga0207681_10022221 3300025923 Bacteria 4043
494 Ga0207681_10025181 3300025923 Bacteria 3824
495 Ga0207681_10091126 3300025923 Bacteria 2177
496 Ga0207681_10124556 3300025923 Bacteria 1895
497 Ga0207681_10148886 3300025923 Bacteria 1752
498 Ga0207694_10055283 3300025924 Bacteria 3082
499 Ga0207694_10427410 3300025924 Bacteria 1104
500 Ga0207650_10000907 3300025925 Bacteria 22318
501 Ga0207650_10029894 3300025925 Bacteria 3920
502 Ga0207650_10033984 3300025925 Bacteria 3696
503 Ga0207650_10038609 3300025925 Bacteria 3488
504 Ga0207650_10053733 3300025925 Bacteria 2986
505 Ga0207650_10066538 3300025925 Bacteria 2702
506 Ga0207650_10067323 3300025925 Bacteria 2687
507 Ga0207650_10087080 3300025925 Bacteria 2379
508 Ga0207650_10112525 3300025925 Bacteria 2109
509 Ga0207659_10003827 3300025926 Bacteria 9069
510 Ga0207687_10000424 3300025927 Bacteria 28651
511 Ga0207687_10092496 3300025927 Bacteria 2209
512 Ga0207687_10096014 3300025927 Bacteria 2172
513 Ga0207700_10006027 3300025928 Bacteria 7294
514 Ga0207700_10068502 3300025928 Bacteria 2720
515 Ga0207664_10011580 3300025929 Bacteria 6279
516 Ga0207664_10052133 3300025929 Bacteria 3234
517 Ga0207664_10090886 3300025929 Bacteria 2502
518 Ga0207644_10003200 3300025931 Bacteria 10547
519 Ga0207644_10004671 3300025931 Bacteria 8903
520 Ga0207644_10018957 3300025931 Bacteria 4664
521 Ga0207644_10028629 3300025931 Bacteria 3859
522 Ga0207644_10074598 3300025931 Bacteria 2490
523 Ga0207644_10104605 3300025931 Bacteria 2131
524 Ga0207644_10142276 3300025931 Bacteria 1848
525 Ga0207690_10002755 3300025932 Bacteria 10616
526 Ga0207690_10004088 3300025932 Bacteria 8614
527 Ga0207690_10009182 3300025932 Bacteria 5870
528 Ga0207690_10028493 3300025932 Bacteria 3540
529 Ga0207690_10033650 3300025932 Bacteria 3297
530 Ga0207690_10050151 3300025932 Bacteria 2785
531 Ga0207690_10147945 3300025932 Bacteria 1738
532 Ga0207690_10205282 3300025932 Bacteria 1499
533 Ga0207706_10000020 3300025933 Bacteria 162063
534 Ga0207706_10000911 3300025933 Bacteria 30395
535 Ga0207706_10001038 3300025933 Bacteria 28181
536 Ga0207706_10006436 3300025933 Bacteria 10908
537 Ga0207706_10012745 3300025933 Bacteria 7652
538 Ga0207706_10013785 3300025933 Bacteria 7336
539 Ga0207706_10023716 3300025933 Bacteria 5506
540 Ga0207706_10034256 3300025933 Bacteria 4518
541 Ga0207706_10037896 3300025933 Bacteria 4278
542 Ga0207706_10037976 3300025933 Bacteria 4273
543 Ga0207706_10083062 3300025933 Bacteria 2815
544 Ga0207706_10167772 3300025933 Bacteria 1929
545 Ga0207706_10187854 3300025933 Bacteria 1814
546 Ga0207709_10099608 3300025935 Bacteria 1918
547 Ga0207709_10161552 3300025935 Bacteria 1563
548 Ga0207669_10002674 3300025937 Bacteria 7631
549 Ga0207669_10005614 3300025937 Bacteria 5648
550 Ga0207669_10005881 3300025937 Bacteria 5550
551 Ga0207669_10016029 3300025937 Bacteria 3796
552 Ga0207669_10038328 3300025937 Bacteria 2758
553 Ga0207669_10042536 3300025937 Bacteria 2653
554 Ga0207669_10100513 3300025937 Bacteria 1911
555 Ga0207704_10094347 3300025938 Bacteria 1975
556 Ga0207704_10144076 3300025938 Bacteria 1671
557 Ga0207704_10234868 3300025938 Bacteria 1366
558 Ga0207704_10259883 3300025938 Bacteria 1309
559 Ga0207665_10100755 3300025939 Bacteria 2016
560 Ga0207691_10002048 3300025940 Bacteria 19704
561 Ga0207691_10002064 3300025940 Bacteria 19617
562 Ga0207691_10003207 3300025940 Bacteria 15952
563 Ga0207691_10006392 3300025940 Bacteria 11381
564 Ga0207691_10014345 3300025940 Bacteria 7554
565 Ga0207691_10023985 3300025940 Bacteria 5739
566 Ga0207691_10037780 3300025940 Bacteria 4470
567 Ga0207691_10047650 3300025940 Bacteria 3932
568 Ga0207691_10061908 3300025940 Bacteria 3398
569 Ga0207691_10063301 3300025940 Bacteria 3355
570 Ga0207691_10209145 3300025940 Bacteria 1695
571 Ga0207711_10000039 3300025941 Bacteria 162974
572 Ga0207711_10000122 3300025941 Bacteria 81465
573 Ga0207711_10001224 3300025941 Bacteria 24315
574 Ga0207711_10005572 3300025941 Bacteria 10648
575 Ga0207711_10006547 3300025941 Bacteria 9809
576 Ga0207711_10102822 3300025941 Bacteria 2529
577 Ga0207711_10157053 3300025941 Bacteria 2056
578 Ga0207711_10180509 3300025941 Bacteria 1919
579 Ga0207689_10000002 3300025942 Bacteria 198437
580 Ga0207689_10035984 3300025942 Bacteria 4110
581 Ga0207689_10053813 3300025942 Bacteria 3316
582 Ga0207689_10102659 3300025942 Bacteria 2349
583 Ga0207661_10023670 3300025944 Bacteria 4643
584 Ga0207661_10084398 3300025944 Bacteria 2631
585 Ga0207679_10001686 3300025945 Bacteria 13747
586 Ga0207679_10005038 3300025945 Bacteria 8257
587 Ga0207679_10024820 3300025945 Bacteria 4114
588 Ga0207679_10039139 3300025945 Bacteria 3384
589 Ga0207679_10040047 3300025945 Bacteria 3351
590 Ga0207679_10054025 3300025945 Bacteria 2955
591 Ga0207679_10062137 3300025945 Bacteria 2782
592 Ga0207679_10095600 3300025945 Bacteria 2310
593 Ga0207679_10099562 3300025945 Bacteria 2270
594 Ga0207679_10395507 3300025945 Bacteria 1215
595 Ga0207667_10005276 3300025949 Bacteria 15765
596 Ga0207667_10007180 3300025949 Bacteria 13438
597 Ga0207667_10058643 3300025949 Bacteria 4036
598 Ga0207667_10088590 3300025949 Bacteria 3200
599 Ga0207667_10093254 3300025949 Bacteria 3109
600 Ga0207667_10179281 3300025949 Bacteria 2176
601 Ga0207667_10265108 3300025949 Bacteria 1757
602 Ga0207667_10308193 3300025949 Bacteria 1617
603 Ga0207651_10000408 3300025960 Bacteria 18210
604 Ga0207651_10000667 3300025960 Bacteria 14642
605 Ga0207651_10007994 3300025960 Bacteria 5676
606 Ga0207651_10082132 3300025960 Bacteria 2325
607 Ga0207651_10119704 3300025960 Bacteria 1994
608 Ga0207651_10171287 3300025960 Bacteria 1712
609 Ga0207712_10031750 3300025961 Bacteria 3560
610 Ga0207712_10034031 3300025961 Bacteria 3449
611 Ga0207668_10000252 3300025972 Bacteria 35699
612 Ga0207668_10004371 3300025972 Bacteria 8297
613 Ga0207668_10097581 3300025972 Bacteria 2175
614 Ga0207668_10153351 3300025972 Bacteria 1786
615 Ga0207668_10163091 3300025972 Bacteria 1739
616 Ga0207668_10194907 3300025972 Bacteria 1609
617 Ga0207640_10000385 3300025981 Bacteria 28207
618 Ga0207640_10029411 3300025981 Bacteria 3372
619 Ga0207640_10188584 3300025981 Bacteria 1552
620 Ga0207640_10288168 3300025981 Bacteria 1293
621 Ga0207640_10366830 3300025981 Bacteria 1162
622 Ga0207658_10002840 3300025986 Bacteria 12403
623 Ga0207658_10003919 3300025986 Bacteria 10463
624 Ga0207658_10009320 3300025986 Bacteria 6656
625 Ga0207658_10010678 3300025986 Bacteria 6242
626 Ga0207658_10011233 3300025986 Bacteria 6101
627 Ga0207658_10011860 3300025986 Bacteria 5940
628 Ga0207658_10014869 3300025986 Bacteria 5333
629 Ga0207658_10032016 3300025986 Bacteria 3739
630 Ga0207658_10041802 3300025986 Bacteria 3321
631 Ga0207658_10124940 3300025986 Bacteria 2057
632 Ga0207658_10282870 3300025986 Bacteria 1422
633 Ga0207677_10004769 3300026023 Bacteria 7314
634 Ga0207677_10021792 3300026023 Bacteria 3924
635 Ga0207677_10038671 3300026023 Bacteria 3130
636 Ga0207703_10003680 3300026035 Bacteria 12780
637 Ga0207703_10007242 3300026035 Bacteria 8822
638 Ga0207703_10009578 3300026035 Bacteria 7606
639 Ga0207703_10042442 3300026035 Bacteria 3649
640 Ga0207703_10302305 3300026035 Bacteria 1459
641 Ga0207639_10003529 3300026041 Bacteria 10503
642 Ga0207639_10072744 3300026041 Bacteria 2693
643 Ga0207639_10090292 3300026041 Bacteria 2450
644 Ga0207639_10122560 3300026041 Bacteria 2138
645 Ga0207639_10162394 3300026041 Bacteria 1884
646 Ga0207678_10002521 3300026067 Bacteria 16679
647 Ga0207678_10030046 3300026067 Bacteria 4744
648 Ga0207678_10068514 3300026067 Bacteria 3044
649 Ga0207678_10069581 3300026067 Bacteria 3018
650 Ga0207678_10101504 3300026067 Bacteria 2456
651 Ga0207678_10245872 3300026067 Bacteria 1532
652 Ga0207678_10247241 3300026067 Bacteria 1527
653 Ga0207708_10135778 3300026075 Bacteria 1926
654 Ga0207702_10017395 3300026078 Bacteria 5948
655 Ga0207702_10057591 3300026078 Bacteria 3303
656 Ga0207702_10078378 3300026078 Bacteria 2860
657 Ga0207702_10372604 3300026078 Bacteria 1371
658 Ga0207641_10000138 3300026088 Bacteria 106531
659 Ga0207641_10002431 3300026088 Bacteria 17210
660 Ga0207641_10014324 3300026088 Bacteria 6498
661 Ga0207641_10033921 3300026088 Bacteria 4243
662 Ga0207641_10125713 3300026088 Bacteria 2295
663 Ga0207641_10219248 3300026088 Bacteria 1763
664 Ga0207648_10003551 3300026089 Bacteria 16308
665 Ga0207648_10004113 3300026089 Bacteria 15059
666 Ga0207648_10009179 3300026089 Bacteria 9500
667 Ga0207648_10012537 3300026089 Bacteria 7932
668 Ga0207648_10025566 3300026089 Bacteria 5257
669 Ga0207648_10025952 3300026089 Bacteria 5211
670 Ga0207648_10093622 3300026089 Bacteria 2627
671 Ga0207648_10127843 3300026089 Bacteria 2235
672 Ga0207676_10000821 3300026095 Bacteria 24225
673 Ga0207676_10000833 3300026095 Bacteria 24045
674 Ga0207676_10001716 3300026095 Bacteria 16157
675 Ga0207676_10002720 3300026095 Bacteria 12581
676 Ga0207676_10011712 3300026095 Bacteria 6274
677 Ga0207676_10185301 3300026095 Bacteria 1826
678 Ga0207676_10393113 3300026095 Bacteria 1294
679 Ga0207676_10458706 3300026095 Bacteria 1203
680 Ga0207674_10000082 3300026116 Bacteria 101650
681 Ga0207674_10000185 3300026116 Bacteria 76519
682 Ga0207674_10000280 3300026116 Bacteria 64258
683 Ga0207674_10009846 3300026116 Bacteria 10881
684 Ga0207674_10015262 3300026116 Bacteria 8446
685 Ga0207674_10037277 3300026116 Bacteria 5059
686 Ga0207674_10073684 3300026116 Bacteria 3427
687 Ga0207674_10077848 3300026116 Bacteria 3321
688 Ga0207674_10112345 3300026116 Bacteria 2698
689 Ga0207675_100036684 3300026118 Bacteria 4572
690 Ga0207675_100095307 3300026118 Bacteria 2800
691 Ga0207683_10001462 3300026121 Bacteria 21298
692 Ga0207683_10003296 3300026121 Bacteria 14076
693 Ga0207683_10011041 3300026121 Bacteria 7697
694 Ga0207683_10024400 3300026121 Bacteria 5208
695 Ga0207683_10034949 3300026121 Bacteria 4371
696 Ga0207683_10038447 3300026121 Bacteria 4171
697 Ga0207698_10000412 3300026142 Bacteria 24694
698 Ga0207698_10002091 3300026142 Bacteria 11782
699 Ga0207698_10002621 3300026142 Bacteria 10691
700 Ga0207698_10010892 3300026142 Bacteria 5871
701 Ga0207698_10014687 3300026142 Bacteria 5215
702 Ga0207698_10030848 3300026142 Bacteria 3861
703 Ga0207698_10135880 3300026142 Bacteria 2110
704 Ga0207698_10311807 3300026142 Bacteria 1469
705 Ga0207698_10463079 3300026142 Bacteria 1226
706 Ga0207698_10595274 3300026142 Bacteria 1090
707 Ga0268266_10000332 3300028379 Bacteria 74181
708 Ga0268266_10024998 3300028379 Bacteria 5084
709 Ga0268266_10036693 3300028379 Bacteria 4174
710 Ga0268265_10001741 3300028380 Bacteria 17506
711 Ga0268265_10007468 3300028380 Bacteria 7382
712 Ga0268265_10017141 3300028380 Bacteria 4991
713 Ga0268265_10026149 3300028380 Bacteria 4149
714 Ga0268265_10140039 3300028380 Bacteria 2024
715 Ga0268264_10001588 3300028381 Bacteria 21046
716 Ga0268264_10001868 3300028381 Bacteria 19146
717 Ga0268264_10006600 3300028381 Bacteria 9757
718 Ga0268264_10025086 3300028381 Bacteria 4872
719 Ga0268264_10406992 3300028381 Bacteria 1309
720 Ga0268264_10438379 3300028381 Bacteria 1263
721 Ga0268264_10585619 3300028381 Bacteria 1098
722 Ga0307408_100102043 3300031548 Bacteria 2187
723 Ga0307405_10418709 3300031731 Bacteria 1053
724 Ga0307413_10054160 3300031824 Bacteria 2432
725 Ga0307413_10087231 3300031824 Bacteria 2020
726 Ga0307413_10102097 3300031824 Bacteria 1898
727 Ga0307410_10032232 3300031852 Bacteria 3369
728 Ga0307410_10074060 3300031852 Bacteria 2370
729 Ga0307410_10099191 3300031852 Bacteria 2084
730 Ga0307406_10024901 3300031901 Bacteria 3578
731 Ga0307406_10287537 3300031901 Bacteria 1257
732 Ga0307407_10010231 3300031903 Bacteria 4414
733 Ga0307407_10176084 3300031903 Bacteria 1413
734 Ga0307409_100048341 3300031995 Bacteria 3236
735 Ga0307409_100243626 3300031995 Bacteria 1638
736 Ga0307409_100246053 3300031995 Bacteria 1631
737 Ga0307416_100083318 3300032002 Bacteria 2712
738 Ga0307416_100324788 3300032002 Bacteria 1543
739 Ga0307414_10007701 3300032004 Bacteria 6065
740 Ga0307414_10118163 3300032004 Bacteria 2033
741 Ga0307411_10005231 3300032005 Bacteria 6353
742 Ga0307411_10100086 3300032005 Bacteria 2047
743 Ga0307411_10218453 3300032005 Bacteria 1477
744 Ga0307411_10406166 3300032005 Bacteria 1127
745 Ga0307415_100019595 3300032126 Bacteria 4111
746 Ga0307415_100056209 3300032126 Bacteria 2696
747 Ga0373923_0074064 3300035111 Bacteria 1467
748 Ga0373943_0185896 3300035170 Bacteria 1144
749 Ga0373935_0045196 3300035692 Bacteria 2778
750 Ga0373933_0119841 3300035724 Bacteria 1647
751 Ga0373947_0089989 3300035725 Bacteria 1912
752 Ga0373937_0080501 3300036401 Bacteria 3012
753 Ga0395899_0000132 3300037312 Bacteria 115455
754 Ga0395899_0000140 3300037312 Bacteria 109989
755 Ga0395899_0005371 3300037312 Bacteria 9949
756 Ga0395899_0018961 3300037312 Bacteria 5227
757 Ga0395899_0022720 3300037312 Bacteria 4751
758 Ga0395899_0023109 3300037312 Bacteria 4711
759 Ga0395899_0032339 3300037312 Bacteria 3929
760 Ga0395899_0035960 3300037312 Bacteria 3716
761 Ga0395899_0065720 3300037312 Bacteria 2665
762 Ga0395899_0072116 3300037312 Bacteria 2527
763 Ga0395899_0076630 3300037312 Bacteria 2440
764 Ga0395899_0089641 3300037312 Bacteria 2230
765 Ga0395899_0117713 3300037312 Bacteria 1905
766 Ga0395899_0117788 3300037312 Bacteria 1905
767 Ga0395899_0193277 3300037312 Bacteria 1423
768 Ga0395899_0243619 3300037312 Bacteria 1236
769 Ga0395900_0000075 3300037418 Bacteria 183525
770 Ga0395900_0000359 3300037418 Bacteria 66277
771 Ga0395900_0003546 3300037418 Bacteria 16790
772 Ga0395900_0004128 3300037418 Bacteria 15465
773 Ga0395900_0011157 3300037418 Bacteria 9186
774 Ga0395900_0018851 3300037418 Bacteria 7038
775 Ga0395900_0025739 3300037418 Bacteria 6022
776 Ga0395900_0028638 3300037418 Bacteria 5710
777 Ga0395900_0029643 3300037418 Bacteria 5614
778 Ga0395900_0039712 3300037418 Bacteria 4848
779 Ga0395900_0044021 3300037418 Bacteria 4601
780 Ga0395900_0098222 3300037418 Bacteria 3008
781 Ga0395900_0163232 3300037418 Bacteria 2271
782 Ga0395900_0167234 3300037418 Bacteria 2240
783 Ga0395900_0198452 3300037418 Bacteria 2031
784 Ga0395900_0296161 3300037418 Bacteria 1605
785 Ga0395900_0315724 3300037418 Bacteria 1544
786 Ga0395900_0331610 3300037418 Bacteria 1499
787 Ga0395900_0420940 3300037418 Bacteria 1296
788 Ga0395900_0427899 3300037418 Bacteria 1283
789 Ga0395898_0000055 3300037466 Bacteria 278557
790 Ga0395898_0005917 3300037466 Bacteria 13140
791 Ga0395898_0012181 3300037466 Bacteria 8896
792 Ga0395898_0012491 3300037466 Bacteria 8781
793 Ga0395898_0016618 3300037466 Bacteria 7521
794 Ga0395898_0033717 3300037466 Bacteria 5107
795 Ga0395898_0060845 3300037466 Bacteria 3669
796 Ga0395898_0067272 3300037466 Bacteria 3469
797 Ga0395898_0108440 3300037466 Bacteria 2662
798 Ga0395898_0179300 3300037466 Bacteria 2024
799 Ga0395898_0368669 3300037466 Bacteria 1369
800 Ga0395898_0469513 3300037466 Bacteria 1197
801 Ga0395905_0000089 3300037471 Bacteria 152196
802 Ga0395905_0001412 3300037471 Bacteria 29029
803 Ga0395905_0002470 3300037471 Bacteria 20479
804 Ga0395905_0003012 3300037471 Bacteria 18251
805 Ga0395905_0010246 3300037471 Bacteria 9132
806 Ga0395905_0013133 3300037471 Bacteria 7950
807 Ga0395905_0014913 3300037471 Bacteria 7413
808 Ga0395905_0015134 3300037471 Bacteria 7341
809 Ga0395905_0024442 3300037471 Bacteria 5702
810 Ga0395905_0037448 3300037471 Bacteria 4553
811 Ga0395905_0040608 3300037471 Bacteria 4365
812 Ga0395905_0043529 3300037471 Bacteria 4212
813 Ga0395905_0070584 3300037471 Bacteria 3274
814 Ga0395905_0075878 3300037471 Bacteria 3150
815 Ga0395905_0116480 3300037471 Bacteria 2511
816 Ga0395905_0129670 3300037471 Bacteria 2372
817 Ga0395905_0141993 3300037471 Bacteria 2259
818 Ga0395905_0166801 3300037471 Bacteria 2069
819 Ga0395905_0212507 3300037471 Bacteria 1812
820 Ga0395905_0231955 3300037471 Bacteria 1726
821 Ga0395905_0267900 3300037471 Bacteria 1594
822 Ga0395905_0392862 3300037471 Bacteria 1281
823 Ga0395905_0394402 3300037471 Bacteria 1279
824 Ga0395905_0490956 3300037471 Bacteria 1128
825 Ga0436364_0543975 3300037853 Bacteria 15107
826 Ga0395901_0000168 3300038443 Bacteria 85645
827 Ga0395901_0000275 3300038443 Bacteria 63659
828 Ga0395901_0000418 3300038443 Bacteria 50129
829 Ga0395901_0006456 3300038443 Bacteria 11883
830 Ga0395901_0011448 3300038443 Bacteria 8989
831 Ga0395901_0015818 3300038443 Bacteria 7687
832 Ga0395901_0019139 3300038443 Bacteria 7000
833 Ga0395901_0020983 3300038443 Bacteria 6692
834 Ga0395901_0023540 3300038443 Bacteria 6315
835 Ga0395901_0029018 3300038443 Bacteria 5691
836 Ga0395901_0065271 3300038443 Bacteria 3790
837 Ga0395901_0068996 3300038443 Bacteria 3682
838 Ga0395901_0113280 3300038443 Bacteria 2848
839 Ga0395901_0139964 3300038443 Bacteria 2543
840 Ga0395901_0192508 3300038443 Bacteria 2138
841 Ga0395901_0201941 3300038443 Bacteria 2083
842 Ga0395901_0261783 3300038443 Bacteria 1800
843 Ga0395901_0343825 3300038443 Bacteria 1541
844 Ga0395901_0350080 3300038443 Bacteria 1524
845 Ga0395901_0424800 3300038443 Bacteria 1362
846 Ga0439448_0001207 3300042005 Bacteria 6589
847 Ga0439432_013010 3300042006 Bacteria 2834
848 Ga0439449_0022423 3300042007 Bacteria 2364
849 Ga0439455_0003518 3300042012 Bacteria 3004
850 Ga0439458_0003888 3300042157 Bacteria 3455
851 Ga0439464_0000069 3300042439 Bacteria 14387
852 Ga0466969_0081644 3300044656 Bacteria 1542
853 Ga0466972_0048353 3300044658 Bacteria 2055
854 Ga0466965_0104326 3300044683 Bacteria 1452
855 Ga0466966_0091386 3300044684 Bacteria 1889
856 Ga0466966_0133841 3300044684 Bacteria 1517
857 Ga0466961_0012502 3300044693 Bacteria 5434
858 Ga0466961_0113644 3300044693 Bacteria 1702
859 Ga0466963_0009210 3300044694 Bacteria 5942
860 Ga0466963_0022376 3300044694 Bacteria 4003
861 Ga0466963_0026831 3300044694 Bacteria 3685
862 Ga0466963_0027873 3300044694 Bacteria 3621
863 Ga0466963_0107192 3300044694 Bacteria 1916
864 Ga0466968_0009518 3300044735 Bacteria 3738
865 Ga0466970_0009663 3300044765 Bacteria 4880
866 Ga0466970_0017799 3300044765 Bacteria 3674
867 Ga0466957_0009081 3300044842 Bacteria 5666
868 Ga0466957_0021353 3300044842 Bacteria 3814
869 Ga0466957_0088764 3300044842 Bacteria 1935
870 Ga0466957_0133915 3300044842 Bacteria 1591
871 Ga0466960_0003484 3300044901 Bacteria 6052
872 Ga0466959_0017633 3300045049 Bacteria 5235
873 Ga0466959_0137329 3300045049 Bacteria 1730
874 Ga0466959_0161621 3300045049 Bacteria 1574
875 Ga0466958_0000386 3300045836 Bacteria 17958
876 Ga0466958_0012196 3300045836 Bacteria 4860
877 Ga0466958_0027400 3300045836 Bacteria 3372
878 Ga0466958_0091893 3300045836 Bacteria 1879
879 Ga0466967_0011227 3300045976 Bacteria 6770
880 Ga0466967_0015448 3300045976 Bacteria 5985
881 Ga0466967_0022442 3300045976 Bacteria 5150
882 Ga0466967_0026363 3300045976 Bacteria 4813
883 Ga0466967_0065071 3300045976 Bacteria 3244
884 Ga0466967_0108328 3300045976 Bacteria 2549
885 Ga0466967_0115605 3300045976 Bacteria 2471
886 Ga0466967_0243611 3300045976 Bacteria 1716
887 Ga0466967_0568911 3300045976 Bacteria 1116
888 Ga0495621_0000019 3300046539 Bacteria 29890
889 Ga0495621_0000434 3300046539 Bacteria 10340
890 Ga0495623_0007895 3300046679 Bacteria 6922
891 Ga0495669_0010888 3300046684 Bacteria 3849
892 Ga0495669_0012693 3300046684 Bacteria 3588
893 Ga0495670_0000340 3300046691 Bacteria 22311
894 Ga0495677_0010791 3300047445 Bacteria 3347
895 Ga0495602_0098924 3300048088 Bacteria 2399
896 Ga0496100_0078240 3300048903 Bacteria 2226
897 Ga0496101_0002586 3300048904 Bacteria 11121
898 Ga0496102_0134958 3300048905 Bacteria 2312
899 Ga0496102_0193649 3300048905 Bacteria 1916
900 Ga0496103_0009172 3300048906 Bacteria 5858
901 Ga0496103_0077604 3300048906 Bacteria 2085
902 Ga0496104_0061673 3300048907 Bacteria 3555
903 Ga0496105_0063691 3300048908 Bacteria 3042
904 Ga0496105_0355083 3300048908 Bacteria 1170
905 Ga0496106_0006411 3300048909 Bacteria 8711
906 Ga0496106_0037282 3300048909 Bacteria 3637
907 Ga0496107_0001528 3300048910 Bacteria 14373
908 Ga0496107_0015607 3300048910 Bacteria 5325
909 Ga0496107_0025942 3300048910 Bacteria 4153
910 Ga0496107_0034281 3300048910 Bacteria 3635
911 Ga0496108_0007974 3300048911 Bacteria 8590
912 Ga0496108_0008182 3300048911 Bacteria 8486
913 Ga0496108_0013918 3300048911 Bacteria 6561
914 Ga0496108_0130856 3300048911 Bacteria 2157
915 Ga0496109_0002645 3300048912 Bacteria 15018
916 Ga0496109_0020290 3300048912 Bacteria 5868
917 Ga0496109_0043667 3300048912 Bacteria 4063
918 Ga0496109_0152969 3300048912 Bacteria 2160
919 Ga0496109_0234233 3300048912 Bacteria 1728
920 Ga0496109_0434484 3300048912 Bacteria 1240
921 Ga0496110_0000654 3300048913 Bacteria 23654
922 Ga0496110_0003420 3300048913 Bacteria 12142
923 Ga0496110_0004024 3300048913 Bacteria 11334
924 Ga0496110_0012265 3300048913 Bacteria 7043
925 Ga0496110_0106900 3300048913 Bacteria 2511
926 Ga0496111_0002476 3300048914 Bacteria 11137
927 Ga0496111_0016315 3300048914 Bacteria 5116
928 Ga0496111_0053698 3300048914 Bacteria 2911
929 Ga0496111_0132208 3300048914 Bacteria 1847
930 Ga0496112_0001660 3300048915 Bacteria 17301
931 Ga0496112_0003906 3300048915 Bacteria 12474
932 Ga0496112_0006543 3300048915 Bacteria 10249
933 Ga0496112_0042166 3300048915 Bacteria 4464
934 Ga0496112_0078167 3300048915 Bacteria 3272
935 Ga0496112_0084283 3300048915 Bacteria 3143
936 Ga0496113_0012038 3300048916 Bacteria 5801
937 Ga0496113_0027098 3300048916 Bacteria 4104
938 Ga0496113_0038742 3300048916 Bacteria 3505
939 Ga0496113_0051891 3300048916 Bacteria 3061
940 Ga0496113_0329721 3300048916 Bacteria 1224
941 Ga0496114_0000033 3300048917 Bacteria 166897
942 Ga0496115_0002071 3300048918 Bacteria 14360
943 Ga0501032_0054126 3300049569 Bacteria 2701
944 Ga0501033_0028929 3300049570 Bacteria 4163
945 Ga0501034_0150123 3300049571 Bacteria 2306
946 Ga0501036_0017650 3300049572 Bacteria 5971
947 Ga0501037_0017116 3300049573 Bacteria 5334
948 Ga0501038_0045901 3300049574 Bacteria 3790
949 Ga0501039_0004554 3300049575 Bacteria 10469
950 Ga0501047_0100431 3300049581 Bacteria 2772
951 Ga0501067_0016272 3300049583 Bacteria 4110
952 Ga0501070_0064240 3300049586 Bacteria 3040
953 Ga0501035_0009830 3300049822 Bacteria 8885
954 Ga0501044_0052676 3300049823 Bacteria 4191
955 nmdc:mga0n895_653585_c1 3300050512 Bacteria 1050
956 Ga0500658_0000022 3300053134 Bacteria 129341
957 Ga0466962_0044490 3300061719 Bacteria 2124
958 2896429389 2896429255 Bacteria 2557483
959 JGI24741J21665_1000377
960 JGI24736J21556_1007854
961 JGI24746J21847_1008388
962 JGI24740J21852_10002452
963 JGI24740J21852_10006316
964 JGI24739J22299_10000015
965 JGI24739J22299_10006558
966 JGI24737J22298_10000005
967 JGI24737J22298_10000256
968 JGI24737J22298_10005760
969 JGI24737J22298_10008247
970 JGI24737J22298_10010523
971 JGI24737J22298_10023523
972 JGI24737J22298_10027358
973 JGI24743J22301_10006038
974 JGI24735J21928_10003623
975 JGI24735J21928_10008463
976 JGI24735J21928_10025474
977 JGI24738J21930_10000252
978 JGI24744J21845_10001214
979 JGI24035J26624_1002241
980 Ga0065715_10000754
981 Ga0070658_10000571
982 Ga0070658_10006843
983 Ga0070658_10069548
984 Ga0070658_10112785
985 Ga0070658_10272738
986 Ga0070676_10010282
987 Ga0070676_10014166
988 Ga0070676_10018338
989 Ga0070676_10037450
990 Ga0070676_10052979
991 Ga0070676_10173440
992 Ga0070683_100002329
993 Ga0070683_100010396
994 Ga0070683_100229281
995 Ga0070690_100002397
996 Ga0070690_100042651
997 Ga0070690_100166379
998 Ga0070670_100003539
999 Ga0070670_100013599
1000 Ga0070670_100014268
1001 Ga0070670_100031653
1002 Ga0070670_100080560
1003 Ga0070670_100089747
1004 Ga0070670_100111387
1005 Ga0070677_10014461
1006 Ga0070677_10025838
1007 Ga0070677_10035426
1008 Ga0070677_10038264
1009 Ga0070677_10096717
1010 Ga0068869_100000003
1011 Ga0070666_10000453
1012 Ga0070666_10003732
1013 Ga0070666_10083562
1014 Ga0070666_10084747
1015 Ga0070666_10190078
1016 Ga0070680_100004013
1017 Ga0070680_100006559
1018 Ga0070680_100042360
1019 Ga0070680_100080399
1020 Ga0070680_100113776
1021 Ga0070680_100184107
1022 Ga0070682_100249126
1023 Ga0068868_100000887
1024 Ga0068868_100027730
1025 Ga0068868_100042785
1026 Ga0068868_100054147
1027 Ga0068868_100198752
1028 Ga0070660_100004195
1029 Ga0070660_100005577
1030 Ga0070660_100016711
1031 Ga0070660_100042224
1032 Ga0070660_100048038
1033 Ga0070660_100083631
1034 Ga0070689_100127869
1035 Ga0070687_100182663
1036 Ga0070661_100023633
1037 Ga0070661_100024565
1038 Ga0070661_100037627
1039 Ga0070661_100049722
1040 Ga0070661_100054233
1041 Ga0070661_100073699
1042 Ga0070661_100138783
1043 Ga0070692_10000543
1044 Ga0070692_10014403
1045 Ga0070692_10018337
1046 Ga0070692_10024208
1047 Ga0070692_10034850
1048 Ga0070668_100001009
1049 Ga0070668_100002740
1050 Ga0070668_100071771
1051 Ga0070669_100000128
1052 Ga0070669_100001654
1053 Ga0070669_100028665
1054 Ga0070669_100086600
1055 Ga0070669_100103488
1056 Ga0070669_100241319
1057 Ga0070669_100253872
1058 Ga0070669_100268194
1059 Ga0070675_100014659
1060 Ga0070675_100088219
1061 Ga0070675_100091566
1062 Ga0070671_100001632
1063 Ga0070671_100016818
1064 Ga0070671_100027920
1065 Ga0070671_100075526
1066 Ga0070671_100132858
1067 Ga0070671_100146046
1068 Ga0070674_100009453
1069 Ga0070674_100010332
1070 Ga0070674_100032362
1071 Ga0070674_100051455
1072 Ga0070674_100099034
1073 Ga0070674_100109581
1074 Ga0070674_100172851
1075 Ga0070673_100006641
1076 Ga0070673_100026593
1077 Ga0070673_100081023
1078 Ga0070673_100128741
1079 Ga0070673_100222612
1080 Ga0070659_100000220
1081 Ga0070659_100006492
1082 Ga0070659_100007675
1083 Ga0070659_100012714
1084 Ga0070659_100023575
1085 Ga0070659_100029288
1086 Ga0070659_100068394
1087 Ga0070659_100134345
1088 Ga0070659_100175425
1089 Ga0070659_100318690
1090 Ga0070667_100001743
1091 Ga0070667_100002260
1092 Ga0070667_100005674
1093 Ga0070667_100007567
1094 Ga0070667_100009002
1095 Ga0070667_100032809
1096 Ga0070667_100132111
1097 Ga0070709_10040699
1098 Ga0070714_100008475
1099 Ga0070714_100008540
1100 Ga0070714_100051556
1101 Ga0070713_100001432
1102 Ga0070713_100059900
1103 Ga0070710_10081687
1104 Ga0070700_100190307
1105 Ga0070694_100008131
1106 Ga0070663_100013338
1107 Ga0070663_100048750
1108 Ga0070663_100062520
1109 Ga0070663_100143572
1110 Ga0070663_100176175
1111 Ga0070678_100004698
1112 Ga0070678_100006366
1113 Ga0070678_100014083
1114 Ga0070678_100014806
1115 Ga0070662_100000253
1116 Ga0070662_100001068
1117 Ga0070662_100006675
1118 Ga0070662_100006963
1119 Ga0070662_100009870
1120 Ga0070662_100024072
1121 Ga0070662_100040886
1122 Ga0070662_100047114
1123 Ga0070662_100075482
1124 Ga0070662_100109426
1125 Ga0070662_100165969
1126 Ga0070662_100255008
1127 Ga0070681_10043365
1128 Ga0068867_100002144
1129 Ga0068867_100002840
1130 Ga0068867_100004962
1131 Ga0068867_100017981
1132 Ga0068867_100144277
1133 Ga0068867_100196041
1134 Ga0070679_100128246
1135 Ga0070679_100225909
1136 Ga0068853_100001264
1137 Ga0068853_100014196
1138 Ga0068853_100094145
1139 Ga0068853_100102167
1140 Ga0068853_100110374
1141 Ga0068853_100140925
1142 Ga0068853_100167582
1143 Ga0068853_100282696
1144 Ga0070672_100001398
1145 Ga0070672_100001554
1146 Ga0070672_100003180
1147 Ga0070672_100003736
1148 Ga0070672_100012875
1149 Ga0070672_100013920
1150 Ga0070672_100055950
1151 Ga0070672_100207139
1152 Ga0070672_100226375
1153 Ga0070672_100242545
1154 Ga0070696_100004087
1155 Ga0070665_100001610
1156 Ga0070665_100055198
1157 Ga0070665_100056058
1158 Ga0070665_100505339
1159 Ga0070704_100204596
1160 Ga0068855_100005203
1161 Ga0068855_100061171
1162 Ga0068855_100153040
1163 Ga0068855_100216955
1164 Ga0068855_100225857
1165 Ga0070664_100001820
1166 Ga0070664_100003812
1167 Ga0070664_100003943
1168 Ga0070664_100027608
1169 Ga0070664_100048645
1170 Ga0070664_100055332
1171 Ga0070664_100062069
1172 Ga0070664_100071846
1173 Ga0070664_100185409
1174 Ga0070664_100339622
1175 Ga0068857_100000026
1176 Ga0068857_100003458
1177 Ga0068857_100028776
1178 Ga0068857_100081835
1179 Ga0068857_100099290
1180 Ga0068857_100099460
1181 Ga0068857_100141491
1182 Ga0068857_100351966
1183 Ga0068854_100000204
1184 Ga0068854_100015475
1185 Ga0068854_100022590
1186 Ga0068854_100052483
1187 Ga0068854_100214785
1188 Ga0068856_100047207
1189 Ga0068856_100297292
1190 Ga0068852_100001011
1191 Ga0068852_100002419
1192 Ga0068852_100019175
1193 Ga0068852_100030578
1194 Ga0068852_100032794
1195 Ga0068852_100034580
1196 Ga0068852_100055704
1197 Ga0068852_100183362
1198 Ga0068852_100223614
1199 Ga0068852_100230853
1200 Ga0068852_100237284
1201 Ga0068852_100336300
1202 Ga0068852_100395917
1203 Ga0068852_100397660
1204 Ga0068852_100670303
1205 Ga0068859_100003116
1206 Ga0068859_100008469
1207 Ga0068859_100023729
1208 Ga0068859_100039022
1209 Ga0068859_100044141
1210 Ga0068859_100056578
1211 Ga0068859_100131492
1212 Ga0068859_100276988
1213 Ga0068859_100376694
1214 Ga0068864_100000047
1215 Ga0068864_100000136
1216 Ga0068864_100001237
1217 Ga0068864_100004926
1218 Ga0068864_100006088
1219 Ga0068864_100018456
1220 Ga0068864_100110832
1221 Ga0068864_100476133
1222 Ga0068866_10008716
1223 Ga0068866_10194674
1224 Ga0068861_100009762
1225 Ga0068851_10002358
1226 Ga0068851_10003968
1227 Ga0068851_10020303
1228 Ga0068851_10041408
1229 Ga0068851_10151227
1230 Ga0068870_10185255
1231 Ga0068863_100000289
1232 Ga0068863_100000384
1233 Ga0068863_100001357
1234 Ga0068863_100007264
1235 Ga0068863_100015410
1236 Ga0068863_100021890
1237 Ga0068863_100148527
1238 Ga0068858_100000063
1239 Ga0068858_100000425
1240 Ga0068858_100001550
1241 Ga0068858_100005371
1242 Ga0068858_100014673
1243 Ga0068858_100022806
1244 Ga0068858_100047366
1245 Ga0068858_100070302
1246 Ga0068860_100000607
1247 Ga0068860_100008482
1248 Ga0068860_100048962
1249 Ga0068860_100098429
1250 Ga0068860_100113882
1251 Ga0068860_100119602
1252 Ga0068860_100624652
1253 Ga0068862_100001336
1254 Ga0068862_100008474
1255 Ga0068862_100082876
1256 Ga0068862_100193261
1257 Ga0068862_100540474
1258 Ga0081539_10008427
1259 Ga0081539_10039766
1260 Ga0070717_10006588
1261 Ga0070717_10035789
1262 Ga0070716_100141477
1263 Ga0070712_100018999
1264 Ga0070712_100128196
1265 Ga0097621_100004205
1266 Ga0097621_100005903
1267 Ga0097621_100169684
1268 Ga0068871_100015768
1269 Ga0068871_100020122
1270 Ga0068871_100172088
1271 Ga0068871_100269191
1272 Ga0075428_100480991
1273 Ga0075433_10074204
1274 Ga0068865_100003427
1275 Ga0068865_100015663
1276 Ga0068865_100113424
1277 Ga0068865_100117605
1278 Ga0097620_100003116
1279 Ga0097620_100008469
1280 Ga0097620_100023729
1281 Ga0097620_100039021
1282 Ga0097620_100056578
1283 Ga0097620_100131489
1284 Ga0097620_100276995
1285 Ga0097620_100376705
1286 Ga0105240_10134041
1287 Ga0105240_10457864
1288 Ga0105245_10000062
1289 Ga0105245_10012522
1290 Ga0105245_10125368
1291 Ga0105243_10044509
1292 Ga0105243_10082712
1293 Ga0105241_10033723
1294 Ga0105241_10071114
1295 Ga0105241_10187774
1296 Ga0105242_10003904
1297 Ga0105242_10470769
1298 Ga0105248_10001782
1299 Ga0105248_10002384
1300 Ga0105248_10063271
1301 Ga0105248_10114890
1302 Ga0105248_10117346
1303 Ga0105248_10153927
1304 Ga0105248_10167354
1305 Ga0105248_10305353
1306 Ga0105248_10443528
1307 Ga0105248_10458590
1308 Ga0105248_10462159
1309 Ga0105238_10133340
1310 Ga0105238_10153772
1311 Ga0105238_10276759
1312 Ga0105238_10441974
1313 Ga0105249_10055925
1314 Ga0105249_10056170
1315 Ga0105246_10032787
1316 Ga0105246_10040944
1317 Ga0105246_10145362
1318 Ga0157373_10012041
1319 Ga0157373_10138570
1320 Ga0157373_10263492
1321 Ga0157371_10000144
1322 Ga0157371_10002441
1323 Ga0157371_10019224
1324 Ga0157371_10066598
1325 Ga0157371_10081821
1326 Ga0157371_10290802
1327 Ga0157370_10090133
1328 Ga0157370_10110534
1329 Ga0157370_10188572
1330 Ga0157370_10223041
1331 Ga0157370_10267785
1332 Ga0157370_10336864
1333 Ga0157369_10000741
1334 Ga0157369_10007345
1335 Ga0157369_10032579
1336 Ga0157369_10039133
1337 Ga0157369_10080219
1338 Ga0157369_10186378
1339 Ga0157369_10238555
1340 Ga0157374_10015411
1341 Ga0157374_10056914
1342 Ga0157374_10147142
1343 Ga0157374_10298096
1344 Ga0157378_10001355
1345 Ga0157378_10006454
1346 Ga0157378_10111576
1347 Ga0163162_10036564
1348 Ga0163162_10042776
1349 Ga0163162_10060012
1350 Ga0163162_10134078
1351 Ga0163162_10157534
1352 Ga0163162_10170905
1353 Ga0157372_10080846
1354 Ga0157372_10585257
1355 Ga0157372_10873945
1356 Ga0157375_10018509
1357 Ga0157375_10045857
1358 Ga0157375_10049254
1359 Ga0157375_10109212
1360 Ga0157375_10157743
1361 Ga0157375_10480946
1362 Ga0163163_10000170
1363 Ga0163163_10002608
1364 Ga0163163_10082110
1365 Ga0157380_10005625
1366 Ga0157380_10009239
1367 Ga0157377_10005231
1368 Ga0157379_10001773
1369 Ga0157379_10027477
1370 Ga0157379_10105055
1371 Ga0157379_10255519
1372 Ga0157376_10029474
1373 Ga0163161_10006404
1374 Ga0163161_10015740
1375 Ga0213875_10000512
1376 Ga0207697_10000235
1377 Ga0207697_10001587
1378 Ga0207697_10003726
1379 Ga0207656_10001434
1380 Ga0207656_10008936
1381 Ga0207656_10062738
1382 Ga0207682_10005975
1383 Ga0207682_10017751
1384 Ga0207682_10022523
1385 Ga0207682_10041986
1386 Ga0207682_10090281
1387 Ga0207682_10096173
1388 Ga0207692_10065559
1389 Ga0207642_10004951
1390 Ga0207688_10000105
1391 Ga0207688_10018963
1392 Ga0207688_10047406
1393 Ga0207688_10050888
1394 Ga0207688_10093327
1395 Ga0207688_10111732
1396 Ga0207680_10001515
1397 Ga0207680_10121214
1398 Ga0207647_10000181
1399 Ga0207647_10000317
1400 Ga0207647_10001120
1401 Ga0207647_10007233
1402 Ga0207647_10018342
1403 Ga0207647_10030193
1404 Ga0207647_10037676
1405 Ga0207647_10052209
1406 Ga0207647_10077349
1407 Ga0207645_10009226
1408 Ga0207645_10018802
1409 Ga0207645_10024754
1410 Ga0207645_10057813
1411 Ga0207643_10097936
1412 Ga0207705_10002713
1413 Ga0207705_10005163
1414 Ga0207705_10014253
1415 Ga0207705_10014945
1416 Ga0207705_10016089
1417 Ga0207705_10032278
1418 Ga0207705_10044026
1419 Ga0207705_10050840
1420 Ga0207705_10089055
1421 Ga0207705_10301896
1422 Ga0207707_10067503
1423 Ga0207707_10111355
1424 Ga0207707_10264357
1425 Ga0207695_10028165
1426 Ga0207695_10488148
1427 Ga0207693_10070955
1428 Ga0207693_10090232
1429 Ga0207660_10001621
1430 Ga0207660_10004028
1431 Ga0207660_10013357
1432 Ga0207660_10017005
1433 Ga0207662_10044689
1434 Ga0207657_10000092
1435 Ga0207657_10001566
1436 Ga0207657_10002456
1437 Ga0207657_10004380
1438 Ga0207657_10007333
1439 Ga0207657_10042542
1440 Ga0207657_10054103
1441 Ga0207657_10073566
1442 Ga0207657_10075939
1443 Ga0207657_10087703
1444 Ga0207657_10111592
1445 Ga0207657_10277672
1446 Ga0207649_10018128
1447 Ga0207649_10027267
1448 Ga0207649_10064505
1449 Ga0207681_10000964
1450 Ga0207681_10001107
1451 Ga0207681_10022221
1452 Ga0207681_10025181
1453 Ga0207681_10091126
1454 Ga0207681_10124556
1455 Ga0207681_10148886
1456 Ga0207694_10055283
1457 Ga0207694_10427410
1458 Ga0207650_10000907
1459 Ga0207650_10029894
1460 Ga0207650_10033984
1461 Ga0207650_10038609
1462 Ga0207650_10053733
1463 Ga0207650_10066538
1464 Ga0207650_10067323
1465 Ga0207650_10087080
1466 Ga0207650_10112525
1467 Ga0207659_10003827
1468 Ga0207687_10000424
1469 Ga0207687_10092496
1470 Ga0207687_10096014
1471 Ga0207700_10006027
1472 Ga0207700_10068502
1473 Ga0207664_10011580
1474 Ga0207664_10052133
1475 Ga0207664_10090886
1476 Ga0207644_10003200
1477 Ga0207644_10004671
1478 Ga0207644_10018957
1479 Ga0207644_10028629
1480 Ga0207644_10074598
1481 Ga0207644_10104605
1482 Ga0207644_10142276
1483 Ga0207690_10002755
1484 Ga0207690_10004088
1485 Ga0207690_10009182
1486 Ga0207690_10028493
1487 Ga0207690_10033650
1488 Ga0207690_10050151
1489 Ga0207690_10147945
1490 Ga0207690_10205282
1491 Ga0207706_10000020
1492 Ga0207706_10000911
1493 Ga0207706_10001038
1494 Ga0207706_10006436
1495 Ga0207706_10012745
1496 Ga0207706_10013785
1497 Ga0207706_10023716
1498 Ga0207706_10034256
1499 Ga0207706_10037896
1500 Ga0207706_10037976
1501 Ga0207706_10083062
1502 Ga0207706_10167772
1503 Ga0207706_10187854
1504 Ga0207709_10099608
1505 Ga0207709_10161552
1506 Ga0207669_10002674
1507 Ga0207669_10005614
1508 Ga0207669_10005881
1509 Ga0207669_10016029
1510 Ga0207669_10038328
1511 Ga0207669_10042536
1512 Ga0207669_10100513
1513 Ga0207704_10094347
1514 Ga0207704_10144076
1515 Ga0207704_10234868
1516 Ga0207704_10259883
1517 Ga0207665_10100755
1518 Ga0207691_10002048
1519 Ga0207691_10002064
1520 Ga0207691_10003207
1521 Ga0207691_10006392
1522 Ga0207691_10014345
1523 Ga0207691_10023985
1524 Ga0207691_10037780
1525 Ga0207691_10047650
1526 Ga0207691_10061908
1527 Ga0207691_10063301
1528 Ga0207691_10209145
1529 Ga0207711_10000039
1530 Ga0207711_10000122
1531 Ga0207711_10001224
1532 Ga0207711_10005572
1533 Ga0207711_10006547
1534 Ga0207711_10102822
1535 Ga0207711_10157053
1536 Ga0207711_10180509
1537 Ga0207689_10000002
1538 Ga0207689_10035984
1539 Ga0207689_10053813
1540 Ga0207689_10102659
1541 Ga0207661_10023670
1542 Ga0207661_10084398
1543 Ga0207679_10001686
1544 Ga0207679_10005038
1545 Ga0207679_10024820
1546 Ga0207679_10039139
1547 Ga0207679_10040047
1548 Ga0207679_10054025
1549 Ga0207679_10062137
1550 Ga0207679_10095600
1551 Ga0207679_10099562
1552 Ga0207679_10395507
1553 Ga0207667_10005276
1554 Ga0207667_10007180
1555 Ga0207667_10058643
1556 Ga0207667_10088590
1557 Ga0207667_10093254
1558 Ga0207667_10179281
1559 Ga0207667_10265108
1560 Ga0207667_10308193
1561 Ga0207651_10000408
1562 Ga0207651_10000667
1563 Ga0207651_10007994
1564 Ga0207651_10082132
1565 Ga0207651_10119704
1566 Ga0207651_10171287
1567 Ga0207712_10031750
1568 Ga0207712_10034031
1569 Ga0207668_10000252
1570 Ga0207668_10004371
1571 Ga0207668_10097581
1572 Ga0207668_10153351
1573 Ga0207668_10163091
1574 Ga0207668_10194907
1575 Ga0207640_10000385
1576 Ga0207640_10029411
1577 Ga0207640_10188584
1578 Ga0207640_10288168
1579 Ga0207640_10366830
1580 Ga0207658_10002840
1581 Ga0207658_10003919
1582 Ga0207658_10009320
1583 Ga0207658_10010678
1584 Ga0207658_10011233
1585 Ga0207658_10011860
1586 Ga0207658_10014869
1587 Ga0207658_10032016
1588 Ga0207658_10041802
1589 Ga0207658_10124940
1590 Ga0207658_10282870
1591 Ga0207677_10004769
1592 Ga0207677_10021792
1593 Ga0207677_10038671
1594 Ga0207703_10003680
1595 Ga0207703_10007242
1596 Ga0207703_10009578
1597 Ga0207703_10042442
1598 Ga0207703_10302305
1599 Ga0207639_10003529
1600 Ga0207639_10072744
1601 Ga0207639_10090292
1602 Ga0207639_10122560
1603 Ga0207639_10162394
1604 Ga0207678_10002521
1605 Ga0207678_10030046
1606 Ga0207678_10068514
1607 Ga0207678_10069581
1608 Ga0207678_10101504
1609 Ga0207678_10245872
1610 Ga0207678_10247241
1611 Ga0207708_10135778
1612 Ga0207702_10017395
1613 Ga0207702_10057591
1614 Ga0207702_10078378
1615 Ga0207702_10372604
1616 Ga0207641_10000138
1617 Ga0207641_10002431
1618 Ga0207641_10014324
1619 Ga0207641_10033921
1620 Ga0207641_10125713
1621 Ga0207641_10219248
1622 Ga0207648_10003551
1623 Ga0207648_10004113
1624 Ga0207648_10009179
1625 Ga0207648_10012537
1626 Ga0207648_10025566
1627 Ga0207648_10025952
1628 Ga0207648_10093622
1629 Ga0207648_10127843
1630 Ga0207676_10000821
1631 Ga0207676_10000833
1632 Ga0207676_10001716
1633 Ga0207676_10002720
1634 Ga0207676_10011712
1635 Ga0207676_10185301
1636 Ga0207676_10393113
1637 Ga0207676_10458706
1638 Ga0207674_10000082
1639 Ga0207674_10000185
1640 Ga0207674_10000280
1641 Ga0207674_10009846
1642 Ga0207674_10015262
1643 Ga0207674_10037277
1644 Ga0207674_10073684
1645 Ga0207674_10077848
1646 Ga0207674_10112345
1647 Ga0207675_100036684
1648 Ga0207675_100095307
1649 Ga0207683_10001462
1650 Ga0207683_10003296
1651 Ga0207683_10011041
1652 Ga0207683_10024400
1653 Ga0207683_10034949
1654 Ga0207683_10038447
1655 Ga0207698_10000412
1656 Ga0207698_10002091
1657 Ga0207698_10002621
1658 Ga0207698_10010892
1659 Ga0207698_10014687
1660 Ga0207698_10030848
1661 Ga0207698_10135880
1662 Ga0207698_10311807
1663 Ga0207698_10463079
1664 Ga0207698_10595274
1665 Ga0268266_10000332
1666 Ga0268266_10024998
1667 Ga0268266_10036693
1668 Ga0268265_10001741
1669 Ga0268265_10007468
1670 Ga0268265_10017141
1671 Ga0268265_10026149
1672 Ga0268265_10140039
1673 Ga0268264_10001588
1674 Ga0268264_10001868
1675 Ga0268264_10006600
1676 Ga0268264_10025086
1677 Ga0268264_10406992
1678 Ga0268264_10438379
1679 Ga0268264_10585619
1680 Ga0307408_100102043
1681 Ga0307405_10418709
1682 Ga0307413_10054160
1683 Ga0307413_10087231
1684 Ga0307413_10102097
1685 Ga0307410_10032232
1686 Ga0307410_10074060
1687 Ga0307410_10099191
1688 Ga0307406_10024901
1689 Ga0307406_10287537
1690 Ga0307407_10010231
1691 Ga0307407_10176084
1692 Ga0307409_100048341
1693 Ga0307409_100243626
1694 Ga0307409_100246053
1695 Ga0307416_100083318
1696 Ga0307416_100324788
1697 Ga0307414_10007701
1698 Ga0307414_10118163
1699 Ga0307411_10005231
1700 Ga0307411_10100086
1701 Ga0307411_10218453
1702 Ga0307411_10406166
1703 Ga0307415_100019595
1704 Ga0307415_100056209
1705 Ga0373923_0074064
1706 Ga0373943_0185896
1707 Ga0373935_0045196
1708 Ga0373933_0119841
1709 Ga0373947_0089989
1710 Ga0373937_0080501
1711 Ga0395899_0000132
1712 Ga0395899_0000140
1713 Ga0395899_0005371
1714 Ga0395899_0018961
1715 Ga0395899_0022720
1716 Ga0395899_0023109
1717 Ga0395899_0032339
1718 Ga0395899_0035960
1719 Ga0395899_0065720
1720 Ga0395899_0072116
1721 Ga0395899_0076630
1722 Ga0395899_0089641
1723 Ga0395899_0117713
1724 Ga0395899_0117788
1725 Ga0395899_0193277
1726 Ga0395899_0243619
1727 Ga0395900_0000075
1728 Ga0395900_0000359
1729 Ga0395900_0003546
1730 Ga0395900_0004128
1731 Ga0395900_0011157
1732 Ga0395900_0018851
1733 Ga0395900_0025739
1734 Ga0395900_0028638
1735 Ga0395900_0029643
1736 Ga0395900_0039712
1737 Ga0395900_0044021
1738 Ga0395900_0098222
1739 Ga0395900_0163232
1740 Ga0395900_0167234
1741 Ga0395900_0198452
1742 Ga0395900_0296161
1743 Ga0395900_0315724
1744 Ga0395900_0331610
1745 Ga0395900_0420940
1746 Ga0395900_0427899
1747 Ga0395898_0000055
1748 Ga0395898_0005917
1749 Ga0395898_0012181
1750 Ga0395898_0012491
1751 Ga0395898_0016618
1752 Ga0395898_0033717
1753 Ga0395898_0060845
1754 Ga0395898_0067272
1755 Ga0395898_0108440
1756 Ga0395898_0179300
1757 Ga0395898_0368669
1758 Ga0395898_0469513
1759 Ga0395905_0000089
1760 Ga0395905_0001412
1761 Ga0395905_0002470
1762 Ga0395905_0003012
1763 Ga0395905_0010246
1764 Ga0395905_0013133
1765 Ga0395905_0014913
1766 Ga0395905_0015134
1767 Ga0395905_0024442
1768 Ga0395905_0037448
1769 Ga0395905_0040608
1770 Ga0395905_0043529
1771 Ga0395905_0070584
1772 Ga0395905_0075878
1773 Ga0395905_0116480
1774 Ga0395905_0129670
1775 Ga0395905_0141993
1776 Ga0395905_0166801
1777 Ga0395905_0212507
1778 Ga0395905_0231955
1779 Ga0395905_0267900
1780 Ga0395905_0392862
1781 Ga0395905_0394402
1782 Ga0395905_0490956
1783 Ga0436364_0543975
1784 Ga0395901_0000168
1785 Ga0395901_0000275
1786 Ga0395901_0000418
1787 Ga0395901_0006456
1788 Ga0395901_0011448
1789 Ga0395901_0015818
1790 Ga0395901_0019139
1791 Ga0395901_0020983
1792 Ga0395901_0023540
1793 Ga0395901_0029018
1794 Ga0395901_0065271
1795 Ga0395901_0068996
1796 Ga0395901_0113280
1797 Ga0395901_0139964
1798 Ga0395901_0192508
1799 Ga0395901_0201941
1800 Ga0395901_0261783
1801 Ga0395901_0343825
1802 Ga0395901_0350080
1803 Ga0395901_0424800
1804 Ga0439448_0001207
1805 Ga0439432_013010
1806 Ga0439449_0022423
1807 Ga0439455_0003518
1808 Ga0439458_0003888
1809 Ga0439464_0000069
1810 Ga0466969_0081644
1811 Ga0466972_0048353
1812 Ga0466965_0104326
1813 Ga0466966_0091386
1814 Ga0466966_0133841
1815 Ga0466961_0012502
1816 Ga0466961_0113644
1817 Ga0466963_0009210
1818 Ga0466963_0022376
1819 Ga0466963_0026831
1820 Ga0466963_0027873
1821 Ga0466963_0107192
1822 Ga0466968_0009518
1823 Ga0466970_0009663
1824 Ga0466970_0017799
1825 Ga0466957_0009081
1826 Ga0466957_0021353
1827 Ga0466957_0088764
1828 Ga0466957_0133915
1829 Ga0466960_0003484
1830 Ga0466959_0017633
1831 Ga0466959_0137329
1832 Ga0466959_0161621
1833 Ga0466958_0000386
1834 Ga0466958_0012196
1835 Ga0466958_0027400
1836 Ga0466958_0091893
1837 Ga0466967_0011227
1838 Ga0466967_0015448
1839 Ga0466967_0022442
1840 Ga0466967_0026363
1841 Ga0466967_0065071
1842 Ga0466967_0108328
1843 Ga0466967_0115605
1844 Ga0466967_0243611
1845 Ga0466967_0568911
1846 Ga0495621_0000019
1847 Ga0495621_0000434
1848 Ga0495623_0007895
1849 Ga0495669_0010888
1850 Ga0495669_0012693
1851 Ga0495670_0000340
1852 Ga0495677_0010791
1853 Ga0495602_0098924
1854 Ga0496100_0078240
1855 Ga0496101_0002586
1856 Ga0496102_0134958
1857 Ga0496102_0193649
1858 Ga0496103_0009172
1859 Ga0496103_0077604
1860 Ga0496104_0061673
1861 Ga0496105_0063691
1862 Ga0496105_0355083
1863 Ga0496106_0006411
1864 Ga0496106_0037282
1865 Ga0496107_0001528
1866 Ga0496107_0015607
1867 Ga0496107_0025942
1868 Ga0496107_0034281
1869 Ga0496108_0007974
1870 Ga0496108_0008182
1871 Ga0496108_0013918
1872 Ga0496108_0130856
1873 Ga0496109_0002645
1874 Ga0496109_0020290
1875 Ga0496109_0043667
1876 Ga0496109_0152969
1877 Ga0496109_0234233
1878 Ga0496109_0434484
1879 Ga0496110_0000654
1880 Ga0496110_0003420
1881 Ga0496110_0004024
1882 Ga0496110_0012265
1883 Ga0496110_0106900
1884 Ga0496111_0002476
1885 Ga0496111_0016315
1886 Ga0496111_0053698
1887 Ga0496111_0132208
1888 Ga0496112_0001660
1889 Ga0496112_0003906
1890 Ga0496112_0006543
1891 Ga0496112_0042166
1892 Ga0496112_0078167
1893 Ga0496112_0084283
1894 Ga0496113_0012038
1895 Ga0496113_0027098
1896 Ga0496113_0038742
1897 Ga0496113_0051891
1898 Ga0496113_0329721
1899 Ga0496114_0000033
1900 Ga0496115_0002071
1901 Ga0501032_0054126
1902 Ga0501033_0028929
1903 Ga0501034_0150123
1904 Ga0501036_0017650
1905 Ga0501037_0017116
1906 Ga0501038_0045901
1907 Ga0501039_0004554
1908 Ga0501047_0100431
1909 Ga0501067_0016272
1910 Ga0501070_0064240
1911 Ga0501035_0009830
1912 Ga0501044_0052676
1913 nmdc:mga0n895_653585_c1
1914 Ga0500658_0000022
1915 Ga0466962_0044490
1916 2896429389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

4

66

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

153

295

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3apq-assembly2.cif.gz_B crystal structure of j-trx1 fragment of erdj5 0.9731 3 67
2dn9-assembly1.cif.gz_A solution structure of j-domain from the dnaj homolog, human tid1 protein 0.9523 1 68
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9519 4 67
8fe2-assembly2.cif.gz_B structure of j-pkac chimera complexed with aplithianine a 0.9491 4 68
5vso-assembly1.cif.gz_A nmr structure of ydj1 j-domain, a cytosolic hsp40 from saccharomyces cerevisiae 0.9466 4 67
ID Description Score Start End Superfamily
af_D3ZD82_4_109_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9938 4 67 1.10.287.110
af_P46997_4_92_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9891 5 68 1.10.287.110
af_Q4DS80_4_96_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9873 4 68 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9836 3 68 1.10.287.110
af_Q55D98_6_109_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9788 3 68 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A2E1Z000-F1-model_v4 deleted 0.9784 3 78
AF-A0A2K8Z9G0-F1-model_v4 J domain-containing protein 0.9768 3 68 GO:0016020
AF-A0A0D3BCM5-F1-model_v4 J domain-containing protein 0.969 1 67 GO:0003723
AF-A0A2E1Z000-F1-model_v4 deleted 0.9539 3 78
AF-A0A7S3GH81-F1-model_v4 J domain-containing protein 0.9492 1 67 GO:0005634
GO:0005737
GO:0044183
GO:0051082
GO:0051087
GO:0061077

Map