F486799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 958 | 438 | 932 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300035118|Ga0373954_0024673|Ga0373954_0024673_772_1365 |
| Length | 197 |
| Sequence | MSMRNRRGLRAWSFPPYIDGGRRCSGDAITRFRQEMMLDGLRQFIADVISPAAQEHRTFDDAGYRLAATALLVHVISLDGEPSEAERRKLHGLIESRFGLDPGTADQLIASATLIEGEAVDLYHFTSVIMRSVDEEGRLRIVEMMWELVYADGQVSEFEDNVVWRAADLLGVSSRDRIDLKHNVAARPPVPVVGTTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 2 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 3 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 4 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 5 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 6 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 7 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 8 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 9 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 10 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 11 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 12 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 13 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 14 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 15 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 16 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 17 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 18 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 19 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 20 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 21 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 22 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 23 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 24 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 25 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 26 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 118 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 119 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 283 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 412 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 413 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 426 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 427 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 429 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 432 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 433 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 434 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.44 |
| Nodule | 2.3 |
| Rhizoplane | 6.68 |
| Rhizosphere | 74.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10012434 | 3300003203 | Bacteria | 3693 |
| 2 | JGI25165J46597_1014365 | 3300003214 | Bacteria | 1078 |
| 3 | rootL2_10045963 | 3300003322 | Bacteria | 1730 |
| 4 | rootL2_10096256 | 3300003322 | Bacteria | 1282 |
| 5 | rootL2_10110173 | 3300003322 | Bacteria | 2825 |
| 6 | JGI25404J52841_10003473 | 3300003659 | Bacteria | 3120 |
| 7 | JGI25404J52841_10014495 | 3300003659 | Bacteria | 1712 |
| 8 | JGI25404J52841_10017249 | 3300003659 | Bacteria | 1566 |
| 9 | JGI25404J52841_10029009 | 3300003659 | Bacteria | 1187 |
| 10 | JGI25405J52794_10029568 | 3300003911 | Bacteria | 1134 |
| 11 | JGI25405J52794_10038265 | 3300003911 | Bacteria | 1010 |
| 12 | Ga0070658_10014893 | 3300005327 | Bacteria | 6229 |
| 13 | Ga0070658_10161129 | 3300005327 | Bacteria | 1882 |
| 14 | Ga0070658_10207026 | 3300005327 | Bacteria | 1656 |
| 15 | Ga0070676_10269668 | 3300005328 | Bacteria | 1143 |
| 16 | Ga0070683_100023757 | 3300005329 | Bacteria | 5486 |
| 17 | Ga0070683_100026678 | 3300005329 | Bacteria | 5205 |
| 18 | Ga0068869_100153340 | 3300005334 | Bacteria | 1788 |
| 19 | Ga0068869_100272752 | 3300005334 | Bacteria | 1358 |
| 20 | Ga0068869_101690795 | 3300005334 | Bacteria | 565 |
| 21 | Ga0070680_100081500 | 3300005336 | Bacteria | 2670 |
| 22 | Ga0068868_100034114 | 3300005338 | Bacteria | 3927 |
| 23 | Ga0070660_100002091 | 3300005339 | Bacteria | 13777 |
| 24 | Ga0070660_100207546 | 3300005339 | Bacteria | 1590 |
| 25 | Ga0070689_100446774 | 3300005340 | Bacteria | 1099 |
| 26 | Ga0070689_101212350 | 3300005340 | Bacteria | 678 |
| 27 | Ga0070687_100789260 | 3300005343 | Bacteria | 672 |
| 28 | Ga0070687_101264114 | 3300005343 | Bacteria | 547 |
| 29 | Ga0070661_100380440 | 3300005344 | Bacteria | 1113 |
| 30 | Ga0070668_100038776 | 3300005347 | Bacteria | 3643 |
| 31 | Ga0070668_100052404 | 3300005347 | Bacteria | 3145 |
| 32 | Ga0070668_100052629 | 3300005347 | Bacteria | 3138 |
| 33 | Ga0070668_100065717 | 3300005347 | Bacteria | 2813 |
| 34 | Ga0070668_100081584 | 3300005347 | Bacteria | 2536 |
| 35 | Ga0070668_100093078 | 3300005347 | Bacteria | 2378 |
| 36 | Ga0070669_100112510 | 3300005353 | Bacteria | 2067 |
| 37 | Ga0070675_100166479 | 3300005354 | Bacteria | 1899 |
| 38 | Ga0070675_100214135 | 3300005354 | Bacteria | 1676 |
| 39 | Ga0070675_100246901 | 3300005354 | Bacteria | 1561 |
| 40 | Ga0070675_100524883 | 3300005354 | Bacteria | 1069 |
| 41 | Ga0070671_100139781 | 3300005355 | Bacteria | 2043 |
| 42 | Ga0070671_100615204 | 3300005355 | Bacteria | 939 |
| 43 | Ga0070674_100427848 | 3300005356 | Bacteria | 1088 |
| 44 | Ga0070674_100461309 | 3300005356 | Bacteria | 1051 |
| 45 | Ga0070674_100548676 | 3300005356 | Bacteria | 969 |
| 46 | Ga0070674_100781989 | 3300005356 | Bacteria | 823 |
| 47 | Ga0070673_100197544 | 3300005364 | Bacteria | 1731 |
| 48 | Ga0070673_100284219 | 3300005364 | Bacteria | 1452 |
| 49 | Ga0070673_101336580 | 3300005364 | Bacteria | 674 |
| 50 | Ga0070688_100183024 | 3300005365 | Bacteria | 1455 |
| 51 | Ga0070688_100574830 | 3300005365 | Bacteria | 859 |
| 52 | Ga0070659_100100796 | 3300005366 | Bacteria | 2324 |
| 53 | Ga0070659_100379757 | 3300005366 | Bacteria | 1190 |
| 54 | Ga0070667_100057192 | 3300005367 | Bacteria | 3296 |
| 55 | Ga0070667_100599446 | 3300005367 | Bacteria | 1015 |
| 56 | Ga0070709_10003366 | 3300005434 | Bacteria | 8596 |
| 57 | Ga0070709_10992061 | 3300005434 | Bacteria | 668 |
| 58 | Ga0070714_100003204 | 3300005435 | Bacteria | 12177 |
| 59 | Ga0070714_100077968 | 3300005435 | Bacteria | 2879 |
| 60 | Ga0070714_100105094 | 3300005435 | Bacteria | 2492 |
| 61 | Ga0070713_100055042 | 3300005436 | Bacteria | 3304 |
| 62 | Ga0070713_100289224 | 3300005436 | Bacteria | 1505 |
| 63 | Ga0070710_10003286 | 3300005437 | Bacteria | 7665 |
| 64 | Ga0070710_10030798 | 3300005437 | Bacteria | 2889 |
| 65 | Ga0070710_10237258 | 3300005437 | Bacteria | 1167 |
| 66 | Ga0070701_10087544 | 3300005438 | Bacteria | 1699 |
| 67 | Ga0070711_100000745 | 3300005439 | Bacteria | 16987 |
| 68 | Ga0070711_100014756 | 3300005439 | Bacteria | 4931 |
| 69 | Ga0070711_100015345 | 3300005439 | Bacteria | 4848 |
| 70 | Ga0070711_100342468 | 3300005439 | Bacteria | 1200 |
| 71 | Ga0070700_100150599 | 3300005441 | Bacteria | 1591 |
| 72 | Ga0070700_100711335 | 3300005441 | Bacteria | 800 |
| 73 | Ga0070700_100822968 | 3300005441 | Bacteria | 750 |
| 74 | Ga0070708_100263882 | 3300005445 | Bacteria | 1619 |
| 75 | Ga0070663_100011469 | 3300005455 | Bacteria | 5566 |
| 76 | Ga0070663_100022407 | 3300005455 | Bacteria | 4223 |
| 77 | Ga0070663_100082416 | 3300005455 | Bacteria | 2366 |
| 78 | Ga0070663_100204768 | 3300005455 | Bacteria | 1542 |
| 79 | Ga0070663_100858687 | 3300005455 | Bacteria | 782 |
| 80 | Ga0070678_100011085 | 3300005456 | Bacteria | 5542 |
| 81 | Ga0070678_100048833 | 3300005456 | Bacteria | 3050 |
| 82 | Ga0070678_100064850 | 3300005456 | Bacteria | 2709 |
| 83 | Ga0070678_100152067 | 3300005456 | Bacteria | 1865 |
| 84 | Ga0070678_100159924 | 3300005456 | Bacteria | 1823 |
| 85 | Ga0070678_100185861 | 3300005456 | Bacteria | 1705 |
| 86 | Ga0070662_100097724 | 3300005457 | Bacteria | 2216 |
| 87 | Ga0070681_10041643 | 3300005458 | Bacteria | 4603 |
| 88 | Ga0070681_10233050 | 3300005458 | Bacteria | 1755 |
| 89 | Ga0068867_100049258 | 3300005459 | Bacteria | 3101 |
| 90 | Ga0068867_100393149 | 3300005459 | Bacteria | 1168 |
| 91 | Ga0068867_100407017 | 3300005459 | Bacteria | 1149 |
| 92 | Ga0068867_100603275 | 3300005459 | Bacteria | 958 |
| 93 | Ga0070685_10132615 | 3300005466 | Bacteria | 1560 |
| 94 | Ga0070685_10296082 | 3300005466 | Bacteria | 1089 |
| 95 | Ga0070706_100072375 | 3300005467 | Bacteria | 3190 |
| 96 | Ga0070706_100493931 | 3300005467 | Bacteria | 1139 |
| 97 | Ga0070706_100585893 | 3300005467 | Bacteria | 1037 |
| 98 | Ga0070706_101528771 | 3300005467 | Bacteria | 610 |
| 99 | Ga0070707_100560281 | 3300005468 | Bacteria | 1105 |
| 100 | Ga0070698_100084471 | 3300005471 | Bacteria | 3163 |
| 101 | Ga0070698_100904999 | 3300005471 | Bacteria | 828 |
| 102 | Ga0070698_101814548 | 3300005471 | Bacteria | 563 |
| 103 | Ga0070699_100506767 | 3300005518 | Bacteria | 1097 |
| 104 | Ga0070679_100028386 | 3300005530 | Bacteria | 5516 |
| 105 | Ga0070679_100038806 | 3300005530 | Bacteria | 4735 |
| 106 | Ga0070679_100080723 | 3300005530 | Bacteria | 3242 |
| 107 | Ga0070684_100004519 | 3300005535 | Bacteria | 10592 |
| 108 | Ga0070684_100016992 | 3300005535 | Bacteria | 5962 |
| 109 | Ga0070684_100159841 | 3300005535 | Bacteria | 2043 |
| 110 | Ga0070684_100752393 | 3300005535 | Bacteria | 910 |
| 111 | Ga0070697_100399205 | 3300005536 | Bacteria | 1193 |
| 112 | Ga0070697_100399786 | 3300005536 | Bacteria | 1192 |
| 113 | Ga0070697_100436918 | 3300005536 | Bacteria | 1139 |
| 114 | Ga0068853_100203859 | 3300005539 | Bacteria | 1800 |
| 115 | Ga0068853_100430451 | 3300005539 | Bacteria | 1239 |
| 116 | Ga0068853_101055805 | 3300005539 | Bacteria | 783 |
| 117 | Ga0070672_100047552 | 3300005543 | Bacteria | 3329 |
| 118 | Ga0070672_100119640 | 3300005543 | Bacteria | 2155 |
| 119 | Ga0070672_100382019 | 3300005543 | Bacteria | 1205 |
| 120 | Ga0070686_100069204 | 3300005544 | Bacteria | 2304 |
| 121 | Ga0070686_100181281 | 3300005544 | Bacteria | 1496 |
| 122 | Ga0070695_100889492 | 3300005545 | Bacteria | 719 |
| 123 | Ga0070696_100935292 | 3300005546 | Bacteria | 721 |
| 124 | Ga0070665_100038779 | 3300005548 | Bacteria | 4789 |
| 125 | Ga0070665_100084569 | 3300005548 | Bacteria | 3178 |
| 126 | Ga0070665_100143395 | 3300005548 | Bacteria | 2392 |
| 127 | Ga0070665_100159117 | 3300005548 | Bacteria | 2260 |
| 128 | Ga0070665_100227433 | 3300005548 | Bacteria | 1865 |
| 129 | Ga0070665_100487636 | 3300005548 | Bacteria | 1243 |
| 130 | Ga0070665_100790605 | 3300005548 | Bacteria | 962 |
| 131 | Ga0068855_100021984 | 3300005563 | Bacteria | 7648 |
| 132 | Ga0068855_100039709 | 3300005563 | Bacteria | 5586 |
| 133 | Ga0068855_100111720 | 3300005563 | Bacteria | 3137 |
| 134 | Ga0068855_100494392 | 3300005563 | Bacteria | 1330 |
| 135 | Ga0070664_100118017 | 3300005564 | Bacteria | 2321 |
| 136 | Ga0068857_100021483 | 3300005577 | Bacteria | 5680 |
| 137 | Ga0068857_100268057 | 3300005577 | Bacteria | 1569 |
| 138 | Ga0068857_100272157 | 3300005577 | Bacteria | 1557 |
| 139 | Ga0068857_100493160 | 3300005577 | Bacteria | 1149 |
| 140 | Ga0068854_100010964 | 3300005578 | Bacteria | 5882 |
| 141 | Ga0068854_100661758 | 3300005578 | Bacteria | 898 |
| 142 | Ga0068856_100000540 | 3300005614 | Bacteria | 41724 |
| 143 | Ga0068856_100014372 | 3300005614 | Bacteria | 7652 |
| 144 | Ga0068856_100288133 | 3300005614 | Bacteria | 1659 |
| 145 | Ga0068856_100447966 | 3300005614 | Bacteria | 1312 |
| 146 | Ga0068856_100473876 | 3300005614 | Bacteria | 1273 |
| 147 | Ga0070702_100617486 | 3300005615 | Bacteria | 815 |
| 148 | Ga0070702_101000616 | 3300005615 | Bacteria | 662 |
| 149 | Ga0068852_100004787 | 3300005616 | Bacteria | 9615 |
| 150 | Ga0068852_100123844 | 3300005616 | Bacteria | 2371 |
| 151 | Ga0068859_100200649 | 3300005617 | Bacteria | 2079 |
| 152 | Ga0068859_100201023 | 3300005617 | Bacteria | 2077 |
| 153 | Ga0068864_100378585 | 3300005618 | Bacteria | 1341 |
| 154 | Ga0068864_100396125 | 3300005618 | Bacteria | 1311 |
| 155 | Ga0068866_10021203 | 3300005718 | Bacteria | 2991 |
| 156 | Ga0068866_10353099 | 3300005718 | Bacteria | 935 |
| 157 | Ga0068861_100052249 | 3300005719 | Bacteria | 3105 |
| 158 | Ga0068861_100194902 | 3300005719 | Bacteria | 1696 |
| 159 | Ga0068870_10063270 | 3300005840 | Bacteria | 1995 |
| 160 | Ga0068858_100049531 | 3300005842 | Bacteria | 3890 |
| 161 | Ga0068858_100063701 | 3300005842 | Bacteria | 3411 |
| 162 | Ga0068858_100085133 | 3300005842 | Bacteria | 2941 |
| 163 | Ga0068858_100249542 | 3300005842 | Bacteria | 1685 |
| 164 | Ga0068860_100130560 | 3300005843 | Bacteria | 2410 |
| 165 | Ga0068860_100233797 | 3300005843 | Bacteria | 1786 |
| 166 | Ga0068860_100333779 | 3300005843 | Bacteria | 1490 |
| 167 | Ga0068860_100528878 | 3300005843 | Bacteria | 1179 |
| 168 | Ga0068862_100037181 | 3300005844 | Bacteria | 4126 |
| 169 | Ga0068862_100259184 | 3300005844 | Bacteria | 1587 |
| 170 | Ga0068862_100551300 | 3300005844 | Bacteria | 1101 |
| 171 | Ga0081455_10003799 | 3300005937 | Bacteria | 17228 |
| 172 | Ga0081455_10016122 | 3300005937 | Bacteria | 7224 |
| 173 | Ga0081455_10023378 | 3300005937 | Bacteria | 5752 |
| 174 | Ga0081455_10024424 | 3300005937 | Bacteria | 5598 |
| 175 | Ga0081538_10022806 | 3300005981 | Bacteria | 4521 |
| 176 | Ga0081540_1001162 | 3300005983 | Bacteria | 23140 |
| 177 | Ga0081540_1005031 | 3300005983 | Bacteria | 9920 |
| 178 | Ga0081540_1007496 | 3300005983 | Bacteria | 7769 |
| 179 | Ga0081540_1009260 | 3300005983 | Bacteria | 6793 |
| 180 | Ga0081540_1012233 | 3300005983 | Bacteria | 5673 |
| 181 | Ga0081540_1018775 | 3300005983 | Bacteria | 4227 |
| 182 | Ga0081540_1074124 | 3300005983 | Bacteria | 1561 |
| 183 | Ga0081540_1117597 | 3300005983 | Bacteria | 1110 |
| 184 | Ga0081540_1123230 | 3300005983 | Bacteria | 1071 |
| 185 | Ga0081539_10000966 | 3300005985 | Bacteria | 53690 |
| 186 | Ga0081539_10046027 | 3300005985 | Bacteria | 2503 |
| 187 | Ga0070717_10000269 | 3300006028 | Bacteria | 35470 |
| 188 | Ga0070717_10004197 | 3300006028 | Bacteria | 10389 |
| 189 | Ga0070717_10124111 | 3300006028 | Bacteria | 2215 |
| 190 | Ga0070717_10239814 | 3300006028 | Bacteria | 1598 |
| 191 | Ga0075365_10007222 | 3300006038 | Bacteria | 6205 |
| 192 | Ga0075365_10055244 | 3300006038 | Bacteria | 2635 |
| 193 | Ga0075365_10104789 | 3300006038 | Bacteria | 1939 |
| 194 | Ga0075365_10200035 | 3300006038 | Bacteria | 1399 |
| 195 | Ga0075365_10254392 | 3300006038 | Bacteria | 1235 |
| 196 | Ga0075365_10281124 | 3300006038 | Bacteria | 1171 |
| 197 | Ga0075368_10212815 | 3300006042 | Bacteria | 820 |
| 198 | Ga0075368_10279892 | 3300006042 | Bacteria | 717 |
| 199 | Ga0075363_100016896 | 3300006048 | Bacteria | 3610 |
| 200 | Ga0075363_100028560 | 3300006048 | Bacteria | 2871 |
| 201 | Ga0075363_100053851 | 3300006048 | Bacteria | 2151 |
| 202 | Ga0075363_100277746 | 3300006048 | Bacteria | 969 |
| 203 | Ga0075364_10031529 | 3300006051 | Bacteria | 3405 |
| 204 | Ga0075364_10305866 | 3300006051 | Bacteria | 1082 |
| 205 | Ga0075364_10455731 | 3300006051 | Bacteria | 874 |
| 206 | Ga0070715_10009248 | 3300006163 | Bacteria | 3467 |
| 207 | Ga0070715_10043682 | 3300006163 | Bacteria | 1891 |
| 208 | Ga0070715_10213412 | 3300006163 | Bacteria | 988 |
| 209 | Ga0070716_100024130 | 3300006173 | Bacteria | 3234 |
| 210 | Ga0070716_100054308 | 3300006173 | Bacteria | 2288 |
| 211 | Ga0070716_100330371 | 3300006173 | Bacteria | 1072 |
| 212 | Ga0070712_100006808 | 3300006175 | Bacteria | 7115 |
| 213 | Ga0070712_100105562 | 3300006175 | Bacteria | 2092 |
| 214 | Ga0070712_100161542 | 3300006175 | Bacteria | 1730 |
| 215 | Ga0070712_100280156 | 3300006175 | Bacteria | 1343 |
| 216 | Ga0075362_10017408 | 3300006177 | Bacteria | 2960 |
| 217 | Ga0075362_10091355 | 3300006177 | Bacteria | 1414 |
| 218 | Ga0075362_10124324 | 3300006177 | Bacteria | 1223 |
| 219 | Ga0075362_10187535 | 3300006177 | Bacteria | 1004 |
| 220 | Ga0075367_10204281 | 3300006178 | Bacteria | 1235 |
| 221 | Ga0075367_10421047 | 3300006178 | Bacteria | 845 |
| 222 | Ga0075369_10016235 | 3300006186 | Bacteria | 3001 |
| 223 | Ga0075369_10034714 | 3300006186 | Bacteria | 2141 |
| 224 | Ga0075369_10148024 | 3300006186 | Bacteria | 1073 |
| 225 | Ga0075369_10157110 | 3300006186 | Bacteria | 1041 |
| 226 | Ga0075366_10030691 | 3300006195 | Bacteria | 3161 |
| 227 | Ga0075366_10137217 | 3300006195 | Bacteria | 1477 |
| 228 | Ga0075366_10450007 | 3300006195 | Bacteria | 794 |
| 229 | Ga0097621_100068907 | 3300006237 | Bacteria | 2919 |
| 230 | Ga0097621_100094411 | 3300006237 | Bacteria | 2508 |
| 231 | Ga0075370_10021423 | 3300006353 | Bacteria | 3541 |
| 232 | Ga0075370_10131295 | 3300006353 | Bacteria | 1461 |
| 233 | Ga0075370_10377985 | 3300006353 | Bacteria | 848 |
| 234 | Ga0075370_10561316 | 3300006353 | Bacteria | 691 |
| 235 | Ga0068871_100564787 | 3300006358 | Bacteria | 1032 |
| 236 | Ga0068871_100945052 | 3300006358 | Bacteria | 801 |
| 237 | Ga0075428_100125897 | 3300006844 | Bacteria | 2788 |
| 238 | Ga0075434_100315212 | 3300006871 | Bacteria | 1585 |
| 239 | Ga0075429_100459510 | 3300006880 | Bacteria | 1116 |
| 240 | Ga0068865_100017842 | 3300006881 | Bacteria | 4570 |
| 241 | Ga0068865_100129004 | 3300006881 | Bacteria | 1892 |
| 242 | Ga0068865_100587428 | 3300006881 | Bacteria | 940 |
| 243 | Ga0068865_100601009 | 3300006881 | Bacteria | 930 |
| 244 | Ga0068865_100647124 | 3300006881 | Bacteria | 898 |
| 245 | Ga0068865_100807603 | 3300006881 | Bacteria | 810 |
| 246 | Ga0075436_100637026 | 3300006914 | Bacteria | 787 |
| 247 | Ga0097620_100200641 | 3300006931 | Bacteria | 2079 |
| 248 | Ga0097620_100201032 | 3300006931 | Bacteria | 2077 |
| 249 | Ga0099824_1006119 | 3300006942 | Bacteria | 16669 |
| 250 | Ga0099822_1014043 | 3300006943 | Bacteria | 9278 |
| 251 | Ga0099794_10230174 | 3300007265 | Bacteria | 953 |
| 252 | Ga0099795_10006732 | 3300007788 | Bacteria | 3155 |
| 253 | Ga0099795_10012369 | 3300007788 | Bacteria | 2586 |
| 254 | Ga0105240_10002943 | 3300009093 | Bacteria | 26851 |
| 255 | Ga0105240_10113703 | 3300009093 | Bacteria | 3271 |
| 256 | Ga0111539_10061321 | 3300009094 | Bacteria | 4456 |
| 257 | Ga0105245_10074999 | 3300009098 | Bacteria | 3078 |
| 258 | Ga0105245_10181113 | 3300009098 | Bacteria | 2013 |
| 259 | Ga0105245_10337206 | 3300009098 | Bacteria | 1490 |
| 260 | Ga0105247_10028777 | 3300009101 | Bacteria | 3362 |
| 261 | Ga0105247_10078744 | 3300009101 | Bacteria | 2074 |
| 262 | Ga0105247_10140941 | 3300009101 | Bacteria | 1580 |
| 263 | Ga0105243_10045318 | 3300009148 | Bacteria | 3455 |
| 264 | Ga0105243_10539593 | 3300009148 | Bacteria | 1112 |
| 265 | Ga0105243_10619255 | 3300009148 | Bacteria | 1045 |
| 266 | Ga0105241_10125496 | 3300009174 | Bacteria | 2072 |
| 267 | Ga0105242_10039799 | 3300009176 | Bacteria | 3785 |
| 268 | Ga0105242_10711023 | 3300009176 | Bacteria | 984 |
| 269 | Ga0105248_10023017 | 3300009177 | Bacteria | 6919 |
| 270 | Ga0105248_10314212 | 3300009177 | Bacteria | 1765 |
| 271 | Ga0105248_11020580 | 3300009177 | Bacteria | 935 |
| 272 | Ga0105237_10043269 | 3300009545 | Bacteria | 4537 |
| 273 | Ga0105237_10083496 | 3300009545 | Bacteria | 3185 |
| 274 | Ga0105237_10528926 | 3300009545 | Bacteria | 1186 |
| 275 | Ga0105237_10865440 | 3300009545 | Bacteria | 911 |
| 276 | Ga0105238_10006820 | 3300009551 | Bacteria | 11404 |
| 277 | Ga0105238_10087183 | 3300009551 | Bacteria | 3108 |
| 278 | Ga0105238_10213127 | 3300009551 | Bacteria | 1908 |
| 279 | Ga0105249_10262698 | 3300009553 | Bacteria | 1716 |
| 280 | Ga0105249_10340165 | 3300009553 | Bacteria | 1517 |
| 281 | Ga0105249_10416025 | 3300009553 | Bacteria | 1377 |
| 282 | Ga0105249_11715565 | 3300009553 | Bacteria | 701 |
| 283 | Ga0099796_10011515 | 3300010159 | Bacteria | 2469 |
| 284 | Ga0099796_10017101 | 3300010159 | Bacteria | 2153 |
| 285 | Ga0099796_10219691 | 3300010159 | Bacteria | 778 |
| 286 | Ga0105239_10013186 | 3300010375 | Bacteria | 9184 |
| 287 | Ga0105239_10039840 | 3300010375 | Bacteria | 5147 |
| 288 | Ga0105239_10060392 | 3300010375 | Bacteria | 4161 |
| 289 | Ga0105239_10073624 | 3300010375 | Bacteria | 3755 |
| 290 | Ga0105239_10146156 | 3300010375 | Bacteria | 2637 |
| 291 | Ga0105239_10544550 | 3300010375 | Bacteria | 1321 |
| 292 | Ga0105239_10592338 | 3300010375 | Bacteria | 1264 |
| 293 | Ga0105246_10004242 | 3300011119 | Bacteria | 8716 |
| 294 | Ga0105246_10061626 | 3300011119 | Bacteria | 2611 |
| 295 | Ga0105246_10109633 | 3300011119 | Bacteria | 2025 |
| 296 | Ga0105246_10425285 | 3300011119 | Bacteria | 1110 |
| 297 | Ga0157337_1019336 | 3300012483 | Bacteria | 616 |
| 298 | Ga0157370_10019039 | 3300013104 | Bacteria | 6901 |
| 299 | Ga0157370_10055288 | 3300013104 | Bacteria | 3782 |
| 300 | Ga0157369_10006724 | 3300013105 | Bacteria | 13270 |
| 301 | Ga0157369_10749753 | 3300013105 | Bacteria | 1004 |
| 302 | Ga0157369_11179679 | 3300013105 | Bacteria | 782 |
| 303 | Ga0157374_10110606 | 3300013296 | Bacteria | 2642 |
| 304 | Ga0157374_10708571 | 3300013296 | Bacteria | 1020 |
| 305 | Ga0157378_10119537 | 3300013297 | Bacteria | 2427 |
| 306 | Ga0157378_10177987 | 3300013297 | Bacteria | 1999 |
| 307 | Ga0157378_10257569 | 3300013297 | Bacteria | 1673 |
| 308 | Ga0157378_10344116 | 3300013297 | Bacteria | 1455 |
| 309 | Ga0157378_11639592 | 3300013297 | Bacteria | 689 |
| 310 | Ga0163162_10007574 | 3300013306 | Bacteria | 10573 |
| 311 | Ga0163162_10315174 | 3300013306 | Bacteria | 1697 |
| 312 | Ga0163162_10455550 | 3300013306 | Bacteria | 1411 |
| 313 | Ga0163162_10528306 | 3300013306 | Bacteria | 1309 |
| 314 | Ga0163162_11197798 | 3300013306 | Bacteria | 862 |
| 315 | Ga0157372_12623184 | 3300013307 | Bacteria | 578 |
| 316 | Ga0157375_10247981 | 3300013308 | Bacteria | 1941 |
| 317 | Ga0157375_10272575 | 3300013308 | Bacteria | 1854 |
| 318 | Ga0157375_10292148 | 3300013308 | Bacteria | 1793 |
| 319 | Ga0157375_11010552 | 3300013308 | Bacteria | 971 |
| 320 | Ga0163163_10068804 | 3300014325 | Bacteria | 3524 |
| 321 | Ga0163163_10088341 | 3300014325 | Bacteria | 3111 |
| 322 | Ga0163163_10237236 | 3300014325 | Bacteria | 1873 |
| 323 | Ga0163163_10322212 | 3300014325 | Bacteria | 1599 |
| 324 | Ga0163163_10882382 | 3300014325 | Bacteria | 958 |
| 325 | Ga0163163_11046677 | 3300014325 | Bacteria | 879 |
| 326 | Ga0157380_10027065 | 3300014326 | Bacteria | 4357 |
| 327 | Ga0157380_10149254 | 3300014326 | Bacteria | 2019 |
| 328 | Ga0157380_10332147 | 3300014326 | Bacteria | 1414 |
| 329 | Ga0157380_11081999 | 3300014326 | Bacteria | 840 |
| 330 | Ga0157380_11411552 | 3300014326 | Bacteria | 747 |
| 331 | Ga0157377_10131013 | 3300014745 | Bacteria | 1531 |
| 332 | Ga0157377_10735503 | 3300014745 | Bacteria | 720 |
| 333 | Ga0157377_10750139 | 3300014745 | Bacteria | 714 |
| 334 | Ga0157379_10192840 | 3300014968 | Bacteria | 1841 |
| 335 | Ga0157379_11068753 | 3300014968 | Bacteria | 772 |
| 336 | Ga0157376_10110109 | 3300014969 | Bacteria | 2422 |
| 337 | Ga0157376_10147227 | 3300014969 | Bacteria | 2119 |
| 338 | Ga0157376_10701271 | 3300014969 | Bacteria | 1017 |
| 339 | Ga0157376_11136703 | 3300014969 | Bacteria | 808 |
| 340 | Ga0182007_10167031 | 3300015262 | Bacteria | 755 |
| 341 | Ga0163161_10080606 | 3300017792 | Bacteria | 2396 |
| 342 | Ga0163161_10272828 | 3300017792 | Bacteria | 1324 |
| 343 | Ga0163161_10573798 | 3300017792 | Bacteria | 927 |
| 344 | Ga0213876_10032614 | 3300021384 | Bacteria | 2746 |
| 345 | Ga0213871_10150037 | 3300021441 | Bacteria | 709 |
| 346 | Ga0209233_1023807 | 3300025261 | Bacteria | 1543 |
| 347 | Ga0209233_1028045 | 3300025261 | Bacteria | 1356 |
| 348 | Ga0209455_1002223 | 3300025272 | Bacteria | 7649 |
| 349 | Ga0209758_1006028 | 3300025297 | Bacteria | 8946 |
| 350 | Ga0209758_1010347 | 3300025297 | Bacteria | 5598 |
| 351 | Ga0209758_1070185 | 3300025297 | Bacteria | 1106 |
| 352 | Ga0207426_1112741 | 3300025302 | Bacteria | 683 |
| 353 | Ga0207697_10013036 | 3300025315 | Bacteria | 3474 |
| 354 | Ga0207697_10023965 | 3300025315 | Bacteria | 2499 |
| 355 | Ga0207656_10465633 | 3300025321 | Bacteria | 640 |
| 356 | Ga0207692_10005362 | 3300025898 | Bacteria | 5134 |
| 357 | Ga0207692_10015075 | 3300025898 | Bacteria | 3392 |
| 358 | Ga0207692_10170389 | 3300025898 | Bacteria | 1261 |
| 359 | Ga0207642_10035126 | 3300025899 | Bacteria | 2138 |
| 360 | Ga0207642_10157253 | 3300025899 | Bacteria | 1216 |
| 361 | Ga0207642_10409132 | 3300025899 | Bacteria | 814 |
| 362 | Ga0207710_10028750 | 3300025900 | Bacteria | 2414 |
| 363 | Ga0207710_10070899 | 3300025900 | Bacteria | 1598 |
| 364 | Ga0207710_10108829 | 3300025900 | Bacteria | 1314 |
| 365 | Ga0207710_10112693 | 3300025900 | Bacteria | 1292 |
| 366 | Ga0207710_10136584 | 3300025900 | Bacteria | 1181 |
| 367 | Ga0207688_10010585 | 3300025901 | Bacteria | 5016 |
| 368 | Ga0207688_10026527 | 3300025901 | Bacteria | 3186 |
| 369 | Ga0207688_10046897 | 3300025901 | Bacteria | 2413 |
| 370 | Ga0207688_10061701 | 3300025901 | Bacteria | 2113 |
| 371 | Ga0207688_10263506 | 3300025901 | Bacteria | 1047 |
| 372 | Ga0207680_10393967 | 3300025903 | Bacteria | 978 |
| 373 | Ga0207647_10100687 | 3300025904 | Bacteria | 1715 |
| 374 | Ga0207685_10501513 | 3300025905 | Bacteria | 639 |
| 375 | Ga0207699_10000309 | 3300025906 | Bacteria | 26099 |
| 376 | Ga0207699_10090360 | 3300025906 | Bacteria | 1921 |
| 377 | Ga0207699_10436859 | 3300025906 | Bacteria | 937 |
| 378 | Ga0207645_10442535 | 3300025907 | Bacteria | 877 |
| 379 | Ga0207643_10186796 | 3300025908 | Bacteria | 1256 |
| 380 | Ga0207643_10631469 | 3300025908 | Bacteria | 690 |
| 381 | Ga0207705_10357472 | 3300025909 | Bacteria | 1126 |
| 382 | Ga0207684_10201526 | 3300025910 | Bacteria | 1717 |
| 383 | Ga0207684_10235799 | 3300025910 | Bacteria | 1578 |
| 384 | Ga0207684_10836656 | 3300025910 | Bacteria | 776 |
| 385 | Ga0207654_10096908 | 3300025911 | Bacteria | 1810 |
| 386 | Ga0207654_10129163 | 3300025911 | Bacteria | 1597 |
| 387 | Ga0207707_10004049 | 3300025912 | Bacteria | 12993 |
| 388 | Ga0207707_10084173 | 3300025912 | Bacteria | 2777 |
| 389 | Ga0207695_10158317 | 3300025913 | Bacteria | 2198 |
| 390 | Ga0207695_10308117 | 3300025913 | Bacteria | 1474 |
| 391 | Ga0207671_10060067 | 3300025914 | Bacteria | 2820 |
| 392 | Ga0207671_10163465 | 3300025914 | Bacteria | 1725 |
| 393 | Ga0207671_11221270 | 3300025914 | Bacteria | 587 |
| 394 | Ga0207693_10002279 | 3300025915 | Bacteria | 16682 |
| 395 | Ga0207693_10036569 | 3300025915 | Bacteria | 3871 |
| 396 | Ga0207693_10037840 | 3300025915 | Bacteria | 3802 |
| 397 | Ga0207693_10092682 | 3300025915 | Bacteria | 2367 |
| 398 | Ga0207693_10108972 | 3300025915 | Bacteria | 2172 |
| 399 | Ga0207663_10001983 | 3300025916 | Bacteria | 9708 |
| 400 | Ga0207663_10002139 | 3300025916 | Bacteria | 9428 |
| 401 | Ga0207663_10053409 | 3300025916 | Bacteria | 2524 |
| 402 | Ga0207660_10039770 | 3300025917 | Bacteria | 3289 |
| 403 | Ga0207660_10258781 | 3300025917 | Bacteria | 1376 |
| 404 | Ga0207657_10003634 | 3300025919 | Bacteria | 16422 |
| 405 | Ga0207657_10092864 | 3300025919 | Bacteria | 2514 |
| 406 | Ga0207657_10210687 | 3300025919 | Bacteria | 1560 |
| 407 | Ga0207657_10322449 | 3300025919 | Bacteria | 1221 |
| 408 | Ga0207649_10105847 | 3300025920 | Bacteria | 1870 |
| 409 | Ga0207649_10379231 | 3300025920 | Bacteria | 1053 |
| 410 | Ga0207652_10002638 | 3300025921 | Bacteria | 15043 |
| 411 | Ga0207652_10097756 | 3300025921 | Bacteria | 2588 |
| 412 | Ga0207681_10100674 | 3300025923 | Bacteria | 2083 |
| 413 | Ga0207694_10112473 | 3300025924 | Bacteria | 2167 |
| 414 | Ga0207694_11317947 | 3300025924 | Bacteria | 611 |
| 415 | Ga0207650_10328321 | 3300025925 | Bacteria | 1254 |
| 416 | Ga0207650_10473929 | 3300025925 | Bacteria | 1044 |
| 417 | Ga0207650_10477105 | 3300025925 | Bacteria | 1040 |
| 418 | Ga0207650_10777394 | 3300025925 | Bacteria | 811 |
| 419 | Ga0207659_10159889 | 3300025926 | Bacteria | 1767 |
| 420 | Ga0207659_10223616 | 3300025926 | Bacteria | 1515 |
| 421 | Ga0207659_10324128 | 3300025926 | Bacteria | 1272 |
| 422 | Ga0207659_10569531 | 3300025926 | Bacteria | 964 |
| 423 | Ga0207687_10023004 | 3300025927 | Bacteria | 4150 |
| 424 | Ga0207687_10024543 | 3300025927 | Bacteria | 4029 |
| 425 | Ga0207687_10871268 | 3300025927 | Bacteria | 770 |
| 426 | Ga0207700_10016746 | 3300025928 | Bacteria | 4880 |
| 427 | Ga0207700_10049134 | 3300025928 | Bacteria | 3136 |
| 428 | Ga0207664_10042185 | 3300025929 | Bacteria | 3560 |
| 429 | Ga0207664_10055752 | 3300025929 | Bacteria | 3137 |
| 430 | Ga0207664_10175665 | 3300025929 | Bacteria | 1836 |
| 431 | Ga0207664_10280396 | 3300025929 | Bacteria | 1462 |
| 432 | Ga0207644_10385830 | 3300025931 | Bacteria | 1143 |
| 433 | Ga0207644_10438468 | 3300025931 | Bacteria | 1072 |
| 434 | Ga0207644_11229092 | 3300025931 | Bacteria | 630 |
| 435 | Ga0207690_10891055 | 3300025932 | Bacteria | 738 |
| 436 | Ga0207706_10025700 | 3300025933 | Bacteria | 5275 |
| 437 | Ga0207706_10088312 | 3300025933 | Bacteria | 2725 |
| 438 | Ga0207706_10323700 | 3300025933 | Bacteria | 1342 |
| 439 | Ga0207686_10366762 | 3300025934 | Bacteria | 1088 |
| 440 | Ga0207709_10413595 | 3300025935 | Bacteria | 1034 |
| 441 | Ga0207709_10418209 | 3300025935 | Bacteria | 1029 |
| 442 | Ga0207709_10954767 | 3300025935 | Bacteria | 699 |
| 443 | Ga0207709_10957997 | 3300025935 | Bacteria | 698 |
| 444 | Ga0207669_10055249 | 3300025937 | Bacteria | 2403 |
| 445 | Ga0207669_10300119 | 3300025937 | Bacteria | 1220 |
| 446 | Ga0207704_10031422 | 3300025938 | Bacteria | 2991 |
| 447 | Ga0207704_10178562 | 3300025938 | Bacteria | 1532 |
| 448 | Ga0207704_10601907 | 3300025938 | Bacteria | 900 |
| 449 | Ga0207704_10646143 | 3300025938 | Bacteria | 871 |
| 450 | Ga0207665_10002452 | 3300025939 | Bacteria | 12524 |
| 451 | Ga0207665_10035091 | 3300025939 | Bacteria | 3327 |
| 452 | Ga0207665_10053824 | 3300025939 | Bacteria | 2713 |
| 453 | Ga0207665_10066823 | 3300025939 | Bacteria | 2447 |
| 454 | Ga0207665_10188122 | 3300025939 | Bacteria | 1499 |
| 455 | Ga0207665_10203579 | 3300025939 | Bacteria | 1443 |
| 456 | Ga0207691_10058603 | 3300025940 | Bacteria | 3502 |
| 457 | Ga0207691_10060550 | 3300025940 | Bacteria | 3439 |
| 458 | Ga0207691_10313472 | 3300025940 | Bacteria | 1346 |
| 459 | Ga0207711_10155096 | 3300025941 | Bacteria | 2069 |
| 460 | Ga0207711_10217312 | 3300025941 | Bacteria | 1747 |
| 461 | Ga0207711_10583776 | 3300025941 | Bacteria | 1043 |
| 462 | Ga0207689_10196723 | 3300025942 | Bacteria | 1664 |
| 463 | Ga0207661_10001804 | 3300025944 | Bacteria | 14632 |
| 464 | Ga0207661_10007278 | 3300025944 | Bacteria | 7874 |
| 465 | Ga0207679_10103763 | 3300025945 | Bacteria | 2229 |
| 466 | Ga0207679_10171579 | 3300025945 | Bacteria | 1786 |
| 467 | Ga0207667_10008204 | 3300025949 | Bacteria | 12430 |
| 468 | Ga0207667_10046583 | 3300025949 | Bacteria | 4591 |
| 469 | Ga0207667_10391628 | 3300025949 | Bacteria | 1415 |
| 470 | Ga0207667_10539508 | 3300025949 | Bacteria | 1180 |
| 471 | Ga0207651_10292405 | 3300025960 | Bacteria | 1351 |
| 472 | Ga0207651_10514015 | 3300025960 | Bacteria | 1037 |
| 473 | Ga0207712_10239357 | 3300025961 | Bacteria | 1461 |
| 474 | Ga0207668_10073979 | 3300025972 | Bacteria | 2444 |
| 475 | Ga0207668_10186108 | 3300025972 | Bacteria | 1642 |
| 476 | Ga0207668_10406272 | 3300025972 | Bacteria | 1152 |
| 477 | Ga0207668_10557764 | 3300025972 | Bacteria | 993 |
| 478 | Ga0207640_10011851 | 3300025981 | Bacteria | 4949 |
| 479 | Ga0207640_10714416 | 3300025981 | Bacteria | 860 |
| 480 | Ga0207640_11044766 | 3300025981 | Bacteria | 720 |
| 481 | Ga0207640_11616702 | 3300025981 | Bacteria | 584 |
| 482 | Ga0207658_11224375 | 3300025986 | Bacteria | 686 |
| 483 | Ga0207677_10028438 | 3300026023 | Bacteria | 3535 |
| 484 | Ga0207677_10117463 | 3300026023 | Bacteria | 1994 |
| 485 | Ga0207703_10034719 | 3300026035 | Bacteria | 4003 |
| 486 | Ga0207703_10186095 | 3300026035 | Bacteria | 1836 |
| 487 | Ga0207703_10409057 | 3300026035 | Bacteria | 1260 |
| 488 | Ga0207703_10475113 | 3300026035 | Bacteria | 1171 |
| 489 | Ga0207639_10078976 | 3300026041 | Bacteria | 2599 |
| 490 | Ga0207639_10238815 | 3300026041 | Bacteria | 1579 |
| 491 | Ga0207639_10572555 | 3300026041 | Bacteria | 1039 |
| 492 | Ga0207639_10599694 | 3300026041 | Bacteria | 1015 |
| 493 | Ga0207639_11129528 | 3300026041 | Bacteria | 735 |
| 494 | Ga0207678_10024550 | 3300026067 | Bacteria | 5265 |
| 495 | Ga0207678_10048527 | 3300026067 | Bacteria | 3669 |
| 496 | Ga0207678_10093941 | 3300026067 | Bacteria | 2562 |
| 497 | Ga0207678_10094956 | 3300026067 | Bacteria | 2548 |
| 498 | Ga0207678_10199547 | 3300026067 | Bacteria | 1710 |
| 499 | Ga0207678_10289318 | 3300026067 | Bacteria | 1407 |
| 500 | Ga0207708_10725563 | 3300026075 | Bacteria | 851 |
| 501 | Ga0207702_10003075 | 3300026078 | Bacteria | 15498 |
| 502 | Ga0207702_10363622 | 3300026078 | Bacteria | 1387 |
| 503 | Ga0207641_10380706 | 3300026088 | Bacteria | 1351 |
| 504 | Ga0207641_10656443 | 3300026088 | Bacteria | 1030 |
| 505 | Ga0207648_10111099 | 3300026089 | Bacteria | 2406 |
| 506 | Ga0207648_10117176 | 3300026089 | Bacteria | 2341 |
| 507 | Ga0207648_10529890 | 3300026089 | Bacteria | 1080 |
| 508 | Ga0207676_10338008 | 3300026095 | Bacteria | 1388 |
| 509 | Ga0207674_10003708 | 3300026116 | Bacteria | 18660 |
| 510 | Ga0207674_10033510 | 3300026116 | Bacteria | 5377 |
| 511 | Ga0207674_10400024 | 3300026116 | Bacteria | 1327 |
| 512 | Ga0207675_100043240 | 3300026118 | Bacteria | 4207 |
| 513 | Ga0207675_100048585 | 3300026118 | Bacteria | 3961 |
| 514 | Ga0207683_10019513 | 3300026121 | Bacteria | 5789 |
| 515 | Ga0207683_10043506 | 3300026121 | Bacteria | 3925 |
| 516 | Ga0207683_10051303 | 3300026121 | Bacteria | 3614 |
| 517 | Ga0207683_10075599 | 3300026121 | Bacteria | 2981 |
| 518 | Ga0207683_10102080 | 3300026121 | Bacteria | 2561 |
| 519 | Ga0207683_10198600 | 3300026121 | Bacteria | 1823 |
| 520 | Ga0207683_10387816 | 3300026121 | Bacteria | 1284 |
| 521 | Ga0207683_10692265 | 3300026121 | Bacteria | 945 |
| 522 | Ga0207683_10911092 | 3300026121 | Bacteria | 816 |
| 523 | Ga0207698_10117280 | 3300026142 | Bacteria | 2245 |
| 524 | Ga0207698_10174301 | 3300026142 | Bacteria | 1897 |
| 525 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 526 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 527 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 528 | Ga0209813_10090542 | 3300027866 | Bacteria | 1026 |
| 529 | Ga0207428_10302262 | 3300027907 | Bacteria | 1184 |
| 530 | Ga0268266_10000680 | 3300028379 | Bacteria | 45937 |
| 531 | Ga0268266_10002169 | 3300028379 | Bacteria | 21507 |
| 532 | Ga0268266_10024779 | 3300028379 | Bacteria | 5105 |
| 533 | Ga0268266_10096578 | 3300028379 | Bacteria | 2597 |
| 534 | Ga0268266_10098886 | 3300028379 | Bacteria | 2568 |
| 535 | Ga0268266_10133948 | 3300028379 | Bacteria | 2218 |
| 536 | Ga0268266_10392226 | 3300028379 | Bacteria | 1311 |
| 537 | Ga0268266_10508727 | 3300028379 | Bacteria | 1150 |
| 538 | Ga0268265_10028819 | 3300028380 | Bacteria | 3979 |
| 539 | Ga0268265_10120452 | 3300028380 | Bacteria | 2161 |
| 540 | Ga0268265_10498026 | 3300028380 | Bacteria | 1147 |
| 541 | Ga0268265_10727038 | 3300028380 | Bacteria | 961 |
| 542 | Ga0268264_10211583 | 3300028381 | Bacteria | 1780 |
| 543 | Ga0268264_10360833 | 3300028381 | Bacteria | 1386 |
| 544 | Ga0268264_11005879 | 3300028381 | Bacteria | 840 |
| 545 | Ga0265323_10016069 | 3300028653 | Bacteria | 2929 |
| 546 | Ga0265336_10013367 | 3300028666 | Bacteria | 2738 |
| 547 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 548 | Ga0307515_10093325 | 3300028794 | Bacteria | 3733 |
| 549 | Ga0307515_10280782 | 3300028794 | Bacteria | 1373 |
| 550 | Ga0265338_10000835 | 3300028800 | Bacteria | 51961 |
| 551 | Ga0265324_10019533 | 3300029957 | Bacteria | 2441 |
| 552 | Ga0307512_10302631 | 3300030522 | Bacteria | 743 |
| 553 | Ga0265330_10021122 | 3300031235 | Bacteria | 2974 |
| 554 | Ga0265330_10023914 | 3300031235 | Bacteria | 2772 |
| 555 | Ga0265330_10070163 | 3300031235 | Bacteria | 1516 |
| 556 | Ga0265332_10118417 | 3300031238 | Bacteria | 1113 |
| 557 | Ga0265332_10207671 | 3300031238 | Bacteria | 813 |
| 558 | Ga0265325_10035551 | 3300031241 | Bacteria | 2645 |
| 559 | Ga0265340_10000884 | 3300031247 | Bacteria | 16974 |
| 560 | Ga0265340_10035059 | 3300031247 | Bacteria | 2493 |
| 561 | Ga0265339_10004328 | 3300031249 | Bacteria | 9706 |
| 562 | Ga0265339_10016094 | 3300031249 | Bacteria | 4467 |
| 563 | Ga0265339_10083650 | 3300031249 | Bacteria | 1683 |
| 564 | Ga0265316_10359186 | 3300031344 | Bacteria | 1053 |
| 565 | Ga0307513_10057077 | 3300031456 | Bacteria | 4163 |
| 566 | Ga0307513_10182197 | 3300031456 | Bacteria | 1962 |
| 567 | Ga0307513_10371673 | 3300031456 | Bacteria | 1172 |
| 568 | Ga0307509_10084646 | 3300031507 | Bacteria | 3266 |
| 569 | Ga0307408_100505017 | 3300031548 | Bacteria | 1059 |
| 570 | Ga0265313_10041621 | 3300031595 | Bacteria | 2262 |
| 571 | Ga0307508_10000108 | 3300031616 | Bacteria | 97443 |
| 572 | Ga0265314_10003949 | 3300031711 | Bacteria | 14062 |
| 573 | Ga0265314_10124640 | 3300031711 | Bacteria | 1616 |
| 574 | Ga0265342_10147385 | 3300031712 | Bacteria | 1309 |
| 575 | Ga0307516_10151857 | 3300031730 | Bacteria | 2075 |
| 576 | Ga0307516_10192455 | 3300031730 | Bacteria | 1765 |
| 577 | Ga0307516_10610540 | 3300031730 | Bacteria | 745 |
| 578 | Ga0307405_10241741 | 3300031731 | Bacteria | 1338 |
| 579 | Ga0307406_10127422 | 3300031901 | Bacteria | 1781 |
| 580 | Ga0307406_10150823 | 3300031901 | Bacteria | 1658 |
| 581 | Ga0307412_10431601 | 3300031911 | Bacteria | 1080 |
| 582 | Ga0307412_10998363 | 3300031911 | Bacteria | 739 |
| 583 | Ga0307416_100267044 | 3300032002 | Bacteria | 1677 |
| 584 | Ga0307416_100415049 | 3300032002 | Bacteria | 1388 |
| 585 | Ga0307416_102306814 | 3300032002 | Bacteria | 638 |
| 586 | Ga0307414_10434577 | 3300032004 | Bacteria | 1148 |
| 587 | Ga0307411_10065225 | 3300032005 | Bacteria | 2442 |
| 588 | Ga0307415_100054255 | 3300032126 | Bacteria | 2735 |
| 589 | Ga0307415_100085248 | 3300032126 | Bacteria | 2269 |
| 590 | Ga0307415_100321899 | 3300032126 | Bacteria | 1290 |
| 591 | Ga0307510_10010287 | 3300033180 | Bacteria | 11113 |
| 592 | Ga0307510_10200456 | 3300033180 | Bacteria | 1531 |
| 593 | Ga0316215_1005545 | 3300033544 | Bacteria | 1219 |
| 594 | Ga0373926_0132099 | 3300035083 | Bacteria | 946 |
| 595 | Ga0373944_0275669 | 3300035089 | Bacteria | 626 |
| 596 | Ga0373923_0060610 | 3300035111 | Bacteria | 1607 |
| 597 | Ga0373932_0026257 | 3300035112 | Bacteria | 1583 |
| 598 | Ga0373932_0116569 | 3300035112 | Bacteria | 886 |
| 599 | Ga0373941_0142888 | 3300035115 | Bacteria | 872 |
| 600 | Ga0373945_0204677 | 3300035116 | Bacteria | 821 |
| 601 | Ga0373954_0024673 | 3300035118 | Bacteria | 2742 |
| 602 | Ga0373955_0225677 | 3300035172 | Bacteria | 1120 |
| 603 | Ga0373962_0212440 | 3300035242 | Bacteria | 659 |
| 604 | Ga0373931_0003001 | 3300035691 | Bacteria | 7533 |
| 605 | Ga0373931_0091713 | 3300035691 | Bacteria | 1694 |
| 606 | Ga0373927_0003306 | 3300035695 | Bacteria | 11600 |
| 607 | Ga0373927_0153238 | 3300035695 | Bacteria | 1509 |
| 608 | Ga0373927_0235163 | 3300035695 | Bacteria | 1204 |
| 609 | Ga0373947_0023036 | 3300035725 | Bacteria | 3619 |
| 610 | Ga0373947_0213774 | 3300035725 | Bacteria | 1266 |
| 611 | Ga0373937_0078308 | 3300036401 | Bacteria | 3055 |
| 612 | Ga0373937_0428902 | 3300036401 | Bacteria | 1255 |
| 613 | Ga0372808_020771 | 3300036459 | Bacteria | 944 |
| 614 | Ga0373925_0077409 | 3300037068 | Bacteria | 2524 |
| 615 | Ga0373925_0174161 | 3300037068 | Bacteria | 1700 |
| 616 | Ga0373925_0328147 | 3300037068 | Bacteria | 1239 |
| 617 | Ga0373925_0636194 | 3300037068 | Bacteria | 879 |
| 618 | Ga0395900_0109182 | 3300037418 | Bacteria | 2842 |
| 619 | Ga0395905_0499162 | 3300037471 | Bacteria | 1117 |
| 620 | Ga0436364_1450038 | 3300037853 | Bacteria | 2404 |
| 621 | Ga0395901_0380417 | 3300038443 | Bacteria | 1453 |
| 622 | Ga0395901_1068423 | 3300038443 | Bacteria | 779 |
| 623 | Ga0436365_0168484 | 3300039437 | Bacteria | 6646 |
| 624 | Ga0436365_1582279 | 3300039437 | Bacteria | 2245 |
| 625 | Ga0436360_0023737 | 3300039438 | Bacteria | 1902 |
| 626 | Ga0436360_1245929 | 3300039438 | Bacteria | 673 |
| 627 | Ga0436363_0159943 | 3300039450 | Bacteria | 1083 |
| 628 | Ga0436363_1166950 | 3300039450 | Bacteria | 674 |
| 629 | Ga0436363_1403617 | 3300039450 | Bacteria | 3318 |
| 630 | Ga0436362_0181511 | 3300039453 | Bacteria | 1872 |
| 631 | Ga0451802_0623261 | 3300041460 | Bacteria | 952 |
| 632 | Ga0451807_1001866 | 3300041486 | Bacteria | 728 |
| 633 | Ga0451807_1667569 | 3300041486 | Bacteria | 779 |
| 634 | Ga0451807_1946340 | 3300041486 | Bacteria | 1094 |
| 635 | Ga0451833_0048398 | 3300041491 | Bacteria | 561 |
| 636 | Ga0451835_1012982 | 3300041492 | Bacteria | 696 |
| 637 | Ga0451839_0736368 | 3300041496 | Bacteria | 740 |
| 638 | Ga0466964_0565191 | 3300044706 | Bacteria | 619 |
| 639 | Ga0466957_0564762 | 3300044842 | Bacteria | 794 |
| 640 | Ga0466960_0247273 | 3300044901 | Bacteria | 990 |
| 641 | Ga0466967_0682013 | 3300045976 | Bacteria | 1017 |
| 642 | Ga0466967_0702043 | 3300045976 | Bacteria | 1002 |
| 643 | Ga0466967_1024621 | 3300045976 | Bacteria | 822 |
| 644 | Ga0495617_051254 | 3300046452 | Bacteria | 1372 |
| 645 | Ga0495603_0010419 | 3300046455 | Bacteria | 5630 |
| 646 | Ga0495603_0016067 | 3300046455 | Bacteria | 4525 |
| 647 | Ga0495603_0056389 | 3300046455 | Bacteria | 2326 |
| 648 | Ga0495603_0173014 | 3300046455 | Bacteria | 1250 |
| 649 | Ga0495603_0364080 | 3300046455 | Bacteria | 829 |
| 650 | Ga0495590_0336458 | 3300046457 | Bacteria | 572 |
| 651 | Ga0495629_0077987 | 3300046459 | Bacteria | 2313 |
| 652 | Ga0495638_0094374 | 3300046460 | Bacteria | 1798 |
| 653 | Ga0495638_0134796 | 3300046460 | Bacteria | 1447 |
| 654 | Ga0495638_0156987 | 3300046460 | Bacteria | 1315 |
| 655 | Ga0495651_0780390 | 3300046462 | Bacteria | 591 |
| 656 | Ga0495650_0099227 | 3300046471 | Bacteria | 1096 |
| 657 | Ga0495582_0028352 | 3300046473 | Bacteria | 3073 |
| 658 | Ga0495639_0062306 | 3300046475 | Bacteria | 1711 |
| 659 | Ga0495585_0131359 | 3300046492 | Bacteria | 1317 |
| 660 | Ga0495594_0129264 | 3300046499 | Bacteria | 1430 |
| 661 | Ga0495596_0063536 | 3300046500 | Bacteria | 1436 |
| 662 | Ga0495583_0210154 | 3300046506 | Bacteria | 789 |
| 663 | Ga0495606_0132216 | 3300046507 | Bacteria | 1482 |
| 664 | Ga0495606_0204613 | 3300046507 | Bacteria | 1122 |
| 665 | Ga0495610_0028391 | 3300046512 | Bacteria | 2960 |
| 666 | Ga0495610_0159647 | 3300046512 | Bacteria | 954 |
| 667 | Ga0495616_0328317 | 3300046513 | Bacteria | 641 |
| 668 | Ga0495620_0186358 | 3300046515 | Bacteria | 801 |
| 669 | Ga0495630_0196993 | 3300046517 | Bacteria | 1537 |
| 670 | Ga0495631_0090236 | 3300046518 | Bacteria | 1319 |
| 671 | Ga0495644_0069318 | 3300046523 | Bacteria | 1325 |
| 672 | Ga0495644_0147410 | 3300046523 | Bacteria | 900 |
| 673 | Ga0495648_0001251 | 3300046524 | Bacteria | 25398 |
| 674 | Ga0495648_0320809 | 3300046524 | Bacteria | 718 |
| 675 | Ga0495654_0165764 | 3300046530 | Bacteria | 967 |
| 676 | Ga0495665_0246776 | 3300046531 | Bacteria | 920 |
| 677 | Ga0495640_0577440 | 3300046533 | Bacteria | 680 |
| 678 | Ga0495587_0283480 | 3300046536 | Bacteria | 928 |
| 679 | Ga0495609_0043250 | 3300046538 | Bacteria | 2022 |
| 680 | Ga0495609_0050883 | 3300046538 | Bacteria | 1846 |
| 681 | Ga0495609_0161223 | 3300046538 | Bacteria | 950 |
| 682 | Ga0495621_0010649 | 3300046539 | Bacteria | 2821 |
| 683 | Ga0495645_0110908 | 3300046543 | Bacteria | 1941 |
| 684 | Ga0495645_0123252 | 3300046543 | Bacteria | 1823 |
| 685 | Ga0495622_0044765 | 3300046557 | Bacteria | 2057 |
| 686 | Ga0495622_0297899 | 3300046557 | Bacteria | 703 |
| 687 | Ga0495656_0003421 | 3300046615 | Bacteria | 5364 |
| 688 | Ga0495656_0009022 | 3300046615 | Bacteria | 3579 |
| 689 | Ga0495656_0028898 | 3300046615 | Bacteria | 2228 |
| 690 | Ga0495656_0030100 | 3300046615 | Bacteria | 2192 |
| 691 | Ga0495668_0125789 | 3300046616 | Bacteria | 1403 |
| 692 | Ga0495668_0166092 | 3300046616 | Bacteria | 1209 |
| 693 | Ga0495668_0208085 | 3300046616 | Bacteria | 1071 |
| 694 | Ga0495668_0630773 | 3300046616 | Bacteria | 592 |
| 695 | Ga0495625_0067931 | 3300046660 | Bacteria | 2507 |
| 696 | Ga0495625_0273687 | 3300046660 | Bacteria | 1089 |
| 697 | Ga0495625_0295610 | 3300046660 | Bacteria | 1038 |
| 698 | Ga0495625_0373557 | 3300046660 | Bacteria | 896 |
| 699 | Ga0495625_0465578 | 3300046660 | Bacteria | 778 |
| 700 | Ga0495659_0033870 | 3300046664 | Bacteria | 1794 |
| 701 | Ga0495659_0058120 | 3300046664 | Bacteria | 1422 |
| 702 | Ga0495588_0281158 | 3300046674 | Bacteria | 877 |
| 703 | Ga0495599_0008234 | 3300046678 | Bacteria | 6340 |
| 704 | Ga0495623_0218694 | 3300046679 | Bacteria | 1087 |
| 705 | Ga0495647_0402293 | 3300046681 | Bacteria | 629 |
| 706 | Ga0495669_0015183 | 3300046684 | Bacteria | 3296 |
| 707 | Ga0495669_0064842 | 3300046684 | Bacteria | 1657 |
| 708 | Ga0495669_0083825 | 3300046684 | Bacteria | 1465 |
| 709 | Ga0495669_0170181 | 3300046684 | Bacteria | 1036 |
| 710 | Ga0495669_0316731 | 3300046684 | Bacteria | 753 |
| 711 | Ga0495613_0782777 | 3300046689 | Bacteria | 623 |
| 712 | Ga0495624_0123097 | 3300046690 | Bacteria | 1593 |
| 713 | Ga0495670_0096732 | 3300046691 | Bacteria | 1516 |
| 714 | Ga0495671_0115441 | 3300046692 | Bacteria | 1311 |
| 715 | Ga0495671_0170410 | 3300046692 | Bacteria | 1058 |
| 716 | Ga0495649_0186263 | 3300046694 | Bacteria | 1081 |
| 717 | Ga0495649_0394862 | 3300046694 | Bacteria | 695 |
| 718 | Ga0495589_0095626 | 3300046794 | Bacteria | 1441 |
| 719 | Ga0495589_0142352 | 3300046794 | Bacteria | 1148 |
| 720 | Ga0495589_0169547 | 3300046794 | Bacteria | 1038 |
| 721 | Ga0495600_0143564 | 3300046809 | Bacteria | 1548 |
| 722 | Ga0495581_0131300 | 3300047315 | Bacteria | 1459 |
| 723 | Ga0495581_0202275 | 3300047315 | Bacteria | 1162 |
| 724 | Ga0495581_0602697 | 3300047315 | Bacteria | 636 |
| 725 | Ga0495604_0214928 | 3300047317 | Bacteria | 1327 |
| 726 | Ga0495604_0265593 | 3300047317 | Bacteria | 1165 |
| 727 | Ga0495636_0030621 | 3300047318 | Bacteria | 2201 |
| 728 | Ga0495674_0198480 | 3300047319 | Bacteria | 1665 |
| 729 | Ga0495672_0339280 | 3300047320 | Bacteria | 701 |
| 730 | Ga0495676_0062458 | 3300047321 | Bacteria | 2908 |
| 731 | Ga0495683_0047765 | 3300047323 | Bacteria | 2147 |
| 732 | Ga0495683_0128105 | 3300047323 | Bacteria | 1199 |
| 733 | Ga0495685_086272 | 3300047447 | Bacteria | 1043 |
| 734 | Ga0495685_114679 | 3300047447 | Bacteria | 886 |
| 735 | Ga0495686_0127380 | 3300047472 | Bacteria | 1513 |
| 736 | Ga0495686_0490492 | 3300047472 | Bacteria | 648 |
| 737 | Ga0495602_0671054 | 3300048088 | Bacteria | 706 |
| 738 | Ga0495626_0176548 | 3300048091 | Bacteria | 888 |
| 739 | Ga0496100_0048756 | 3300048903 | Bacteria | 2735 |
| 740 | Ga0496100_0081491 | 3300048903 | Bacteria | 2186 |
| 741 | Ga0496101_0008281 | 3300048904 | Bacteria | 6792 |
| 742 | Ga0496101_0044430 | 3300048904 | Bacteria | 3179 |
| 743 | Ga0496101_0319134 | 3300048904 | Bacteria | 1219 |
| 744 | Ga0496102_0001453 | 3300048905 | Bacteria | 20988 |
| 745 | Ga0496102_0043946 | 3300048905 | Bacteria | 4052 |
| 746 | Ga0496102_0327127 | 3300048905 | Bacteria | 1444 |
| 747 | Ga0496102_0339395 | 3300048905 | Bacteria | 1415 |
| 748 | Ga0496102_1324930 | 3300048905 | Bacteria | 639 |
| 749 | Ga0496103_0010530 | 3300048906 | Bacteria | 5475 |
| 750 | Ga0496103_0056754 | 3300048906 | Bacteria | 2431 |
| 751 | Ga0496103_0674250 | 3300048906 | Bacteria | 656 |
| 752 | Ga0496104_0027853 | 3300048907 | Bacteria | 5231 |
| 753 | Ga0496104_0135896 | 3300048907 | Bacteria | 2362 |
| 754 | Ga0496104_0271160 | 3300048907 | Bacteria | 1609 |
| 755 | Ga0496104_0373628 | 3300048907 | Bacteria | 1338 |
| 756 | Ga0496104_0618479 | 3300048907 | Bacteria | 993 |
| 757 | Ga0496105_0005368 | 3300048908 | Bacteria | 9717 |
| 758 | Ga0496105_0197778 | 3300048908 | Bacteria | 1641 |
| 759 | Ga0496105_0864316 | 3300048908 | Bacteria | 684 |
| 760 | Ga0496106_0003462 | 3300048909 | Bacteria | 11759 |
| 761 | Ga0496106_0007634 | 3300048909 | Bacteria | 7998 |
| 762 | Ga0496106_0076324 | 3300048909 | Bacteria | 2568 |
| 763 | Ga0496106_0199556 | 3300048909 | Bacteria | 1592 |
| 764 | Ga0496106_0257845 | 3300048909 | Bacteria | 1395 |
| 765 | Ga0496106_0478127 | 3300048909 | Bacteria | 1001 |
| 766 | Ga0496107_0008406 | 3300048910 | Bacteria | 7144 |
| 767 | Ga0496107_0019887 | 3300048910 | Bacteria | 4741 |
| 768 | Ga0496107_0029236 | 3300048910 | Bacteria | 3920 |
| 769 | Ga0496107_0092416 | 3300048910 | Bacteria | 2212 |
| 770 | Ga0496107_0171756 | 3300048910 | Bacteria | 1609 |
| 771 | Ga0496107_0352387 | 3300048910 | Bacteria | 1095 |
| 772 | Ga0496108_0034768 | 3300048911 | Bacteria | 4187 |
| 773 | Ga0496108_0039651 | 3300048911 | Bacteria | 3925 |
| 774 | Ga0496108_0104749 | 3300048911 | Bacteria | 2414 |
| 775 | Ga0496109_0090477 | 3300048912 | Bacteria | 2830 |
| 776 | Ga0496109_0652160 | 3300048912 | Bacteria | 989 |
| 777 | Ga0496110_0009850 | 3300048913 | Bacteria | 7745 |
| 778 | Ga0496110_0015996 | 3300048913 | Bacteria | 6256 |
| 779 | Ga0496111_0024623 | 3300048914 | Bacteria | 4241 |
| 780 | Ga0496111_0039977 | 3300048914 | Bacteria | 3364 |
| 781 | Ga0496111_0231979 | 3300048914 | Bacteria | 1371 |
| 782 | Ga0496112_0042992 | 3300048915 | Bacteria | 4422 |
| 783 | Ga0496112_0051842 | 3300048915 | Bacteria | 4025 |
| 784 | Ga0496112_0078349 | 3300048915 | Bacteria | 3268 |
| 785 | Ga0496113_0023859 | 3300048916 | Bacteria | 4342 |
| 786 | Ga0496113_0032245 | 3300048916 | Bacteria | 3807 |
| 787 | Ga0496113_0047640 | 3300048916 | Bacteria | 3186 |
| 788 | Ga0496113_0114650 | 3300048916 | Bacteria | 2101 |
| 789 | Ga0496113_0174611 | 3300048916 | Bacteria | 1702 |
| 790 | Ga0496113_0548004 | 3300048916 | Bacteria | 928 |
| 791 | Ga0496114_0022794 | 3300048917 | Bacteria | 5103 |
| 792 | Ga0496114_0037886 | 3300048917 | Bacteria | 3989 |
| 793 | Ga0496114_0063296 | 3300048917 | Bacteria | 3097 |
| 794 | Ga0496115_0004695 | 3300048918 | Bacteria | 9904 |
| 795 | Ga0496115_0027446 | 3300048918 | Bacteria | 4453 |
| 796 | Ga0496115_0109423 | 3300048918 | Bacteria | 2269 |
| 797 | Ga0496115_0444017 | 3300048918 | Bacteria | 1049 |
| 798 | Ga0496115_0910449 | 3300048918 | Bacteria | 678 |
| 799 | Ga0496117_0228952 | 3300048920 | Bacteria | 1029 |
| 800 | Ga0496118_0096208 | 3300048921 | Bacteria | 2019 |
| 801 | Ga0496118_0216458 | 3300048921 | Bacteria | 1119 |
| 802 | Ga0496121_0063692 | 3300048924 | Bacteria | 3010 |
| 803 | Ga0496121_0070730 | 3300048924 | Bacteria | 2809 |
| 804 | Ga0496121_0216414 | 3300048924 | Bacteria | 1353 |
| 805 | Ga0496121_0282937 | 3300048924 | Bacteria | 1133 |
| 806 | Ga0496121_0311718 | 3300048924 | Bacteria | 1063 |
| 807 | Ga0496124_0046885 | 3300048927 | Bacteria | 3699 |
| 808 | Ga0496124_0180542 | 3300048927 | Bacteria | 1625 |
| 809 | Ga0496124_0305447 | 3300048927 | Bacteria | 1147 |
| 810 | Ga0496125_0047124 | 3300048928 | Bacteria | 3608 |
| 811 | Ga0496125_0208382 | 3300048928 | Bacteria | 1272 |
| 812 | Ga0496125_0354947 | 3300048928 | Bacteria | 874 |
| 813 | Ga0496126_0011555 | 3300048929 | Bacteria | 9118 |
| 814 | Ga0496126_0014534 | 3300048929 | Bacteria | 7952 |
| 815 | Ga0496126_0062393 | 3300048929 | Bacteria | 3344 |
| 816 | Ga0496126_0073518 | 3300048929 | Bacteria | 3039 |
| 817 | Ga0496126_0117515 | 3300048929 | Bacteria | 2310 |
| 818 | Ga0496126_0145240 | 3300048929 | Bacteria | 2038 |
| 819 | Ga0496126_0242181 | 3300048929 | Bacteria | 1506 |
| 820 | Ga0496126_0267846 | 3300048929 | Bacteria | 1418 |
| 821 | Ga0496126_0283596 | 3300048929 | Bacteria | 1371 |
| 822 | Ga0496126_0371971 | 3300048929 | Bacteria | 1165 |
| 823 | Ga0496126_0480060 | 3300048929 | Bacteria | 996 |
| 824 | Ga0501031_0160646 | 3300049568 | Bacteria | 1469 |
| 825 | Ga0501033_0150909 | 3300049570 | Bacteria | 1676 |
| 826 | Ga0501033_0308273 | 3300049570 | Bacteria | 1113 |
| 827 | Ga0501034_0048287 | 3300049571 | Bacteria | 4296 |
| 828 | Ga0501036_1306400 | 3300049572 | Bacteria | 589 |
| 829 | Ga0501037_0249504 | 3300049573 | Bacteria | 1242 |
| 830 | Ga0501038_0124216 | 3300049574 | Bacteria | 2125 |
| 831 | Ga0501038_0561556 | 3300049574 | Bacteria | 867 |
| 832 | Ga0501039_0164864 | 3300049575 | Bacteria | 1742 |
| 833 | Ga0501042_0346240 | 3300049578 | Bacteria | 1075 |
| 834 | Ga0501043_0330162 | 3300049579 | Bacteria | 1161 |
| 835 | Ga0501046_0019136 | 3300049580 | Bacteria | 5681 |
| 836 | Ga0501046_0134887 | 3300049580 | Bacteria | 1870 |
| 837 | Ga0501047_0020926 | 3300049581 | Bacteria | 6283 |
| 838 | Ga0501067_0035210 | 3300049583 | Bacteria | 2780 |
| 839 | Ga0501067_0044688 | 3300049583 | Bacteria | 2461 |
| 840 | Ga0501068_0027765 | 3300049584 | Bacteria | 3344 |
| 841 | Ga0501068_0273486 | 3300049584 | Bacteria | 1079 |
| 842 | Ga0501069_0057654 | 3300049585 | Bacteria | 2166 |
| 843 | Ga0501069_0203031 | 3300049585 | Bacteria | 1149 |
| 844 | Ga0501070_0008271 | 3300049586 | Bacteria | 8797 |
| 845 | Ga0501071_0187713 | 3300049587 | Bacteria | 1550 |
| 846 | Ga0501071_0370302 | 3300049587 | Bacteria | 1092 |
| 847 | Ga0501071_0392019 | 3300049587 | Bacteria | 1060 |
| 848 | Ga0501073_0008815 | 3300049589 | Bacteria | 7460 |
| 849 | Ga0501074_0015460 | 3300049590 | Bacteria | 5548 |
| 850 | Ga0501075_0611963 | 3300049591 | Bacteria | 831 |
| 851 | Ga0501076_0098020 | 3300049592 | Bacteria | 2362 |
| 852 | Ga0501076_0146208 | 3300049592 | Bacteria | 1922 |
| 853 | Ga0501079_0385992 | 3300049741 | Bacteria | 1098 |
| 854 | Ga0501080_0016296 | 3300049742 | Bacteria | 6861 |
| 855 | Ga0501080_0249895 | 3300049742 | Bacteria | 1617 |
| 856 | Ga0501035_0082361 | 3300049822 | Bacteria | 2839 |
| 857 | Ga0501044_0017082 | 3300049823 | Bacteria | 7787 |
| 858 | Ga0501045_0379058 | 3300049824 | Bacteria | 1053 |
| 859 | Ga0501045_0471835 | 3300049824 | Bacteria | 932 |
| 860 | nmdc:mga03683_19812_c1 | 3300050489 | Bacteria | 2573 |
| 861 | nmdc:mga03683_279409_c1 | 3300050489 | Bacteria | 780 |
| 862 | nmdc:mga03683_402934_c1 | 3300050489 | Bacteria | 653 |
| 863 | nmdc:mga03n38_164796_c1 | 3300050490 | Bacteria | 1125 |
| 864 | nmdc:mga03n38_287851_c1 | 3300050490 | Bacteria | 879 |
| 865 | nmdc:mga03n38_298337_c1 | 3300050490 | Bacteria | 865 |
| 866 | nmdc:mga00v17_211293_c1 | 3300050491 | Bacteria | 1256 |
| 867 | nmdc:mga00v17_87918_c1 | 3300050491 | Bacteria | 1948 |
| 868 | nmdc:mga0yw44_103713_c1 | 3300050492 | Bacteria | 1814 |
| 869 | nmdc:mga0yw44_189590_c1 | 3300050492 | Bacteria | 1356 |
| 870 | nmdc:mga0yw44_265923_c1 | 3300050492 | Bacteria | 1144 |
| 871 | nmdc:mga0yw44_30731_c1 | 3300050492 | Bacteria | 3117 |
| 872 | nmdc:mga0yw44_3728_c1 | 3300050492 | Bacteria | 6824 |
| 873 | nmdc:mga0yw44_971088_c1 | 3300050492 | Bacteria | 575 |
| 874 | nmdc:mga0k408_11114_c1 | 3300050493 | Bacteria | 2513 |
| 875 | nmdc:mga0k408_332175_c1 | 3300050493 | Bacteria | 907 |
| 876 | nmdc:mga0k408_46281_c1 | 3300050493 | Bacteria | 2512 |
| 877 | nmdc:mga06z11_31889_c1 | 3300050494 | Bacteria | 2565 |
| 878 | nmdc:mga06z11_386642_c1 | 3300050494 | Bacteria | 841 |
| 879 | nmdc:mga06z11_494596_c1 | 3300050494 | Bacteria | 741 |
| 880 | nmdc:mga04h51_414475_c1 | 3300050495 | Bacteria | 566 |
| 881 | nmdc:mga04h51_97303_c1 | 3300050495 | Bacteria | 1068 |
| 882 | nmdc:mga07m45_148798_c1 | 3300050496 | Bacteria | 1357 |
| 883 | nmdc:mga07m45_43287_c1 | 3300050496 | Bacteria | 2524 |
| 884 | nmdc:mga07m45_9877_c1 | 3300050496 | Bacteria | 4965 |
| 885 | nmdc:mga05p37_573050_c1 | 3300050507 | Bacteria | 1280 |
| 886 | nmdc:mga09592_688562_c1 | 3300050508 | Bacteria | 871 |
| 887 | nmdc:mga08y16_170224_c1 | 3300050511 | Bacteria | 2262 |
| 888 | nmdc:mga08y16_66686_c1 | 3300050511 | Bacteria | 3756 |
| 889 | nmdc:mga0n895_187543_c1 | 3300050512 | Bacteria | 2099 |
| 890 | nmdc:mga0rr50_512824_c1 | 3300050513 | Bacteria | 1020 |
| 891 | nmdc:mga0rr50_669647_c1 | 3300050513 | Bacteria | 885 |
| 892 | nmdc:mga0a205_229797_c1 | 3300050515 | Bacteria | 1738 |
| 893 | nmdc:mga0sz30_37500_c1 | 3300050516 | Bacteria | 2029 |
| 894 | Ga0495612_0038738 | 3300053078 | Bacteria | 1937 |
| 895 | Ga0495612_0179654 | 3300053078 | Bacteria | 929 |
| 896 | Ga0495655_0074640 | 3300053083 | Bacteria | 956 |
| 897 | Ga0495595_0067844 | 3300053084 | Bacteria | 1681 |
| 898 | Ga0500578_0453093 | 3300053086 | Bacteria | 730 |
| 899 | Ga0500646_0024926 | 3300053090 | Bacteria | 1613 |
| 900 | Ga0500646_0110726 | 3300053090 | Bacteria | 873 |
| 901 | Ga0500583_0011614 | 3300053092 | Bacteria | 3327 |
| 902 | Ga0500651_0084520 | 3300053093 | Bacteria | 1962 |
| 903 | Ga0500641_0006112 | 3300053096 | Bacteria | 4267 |
| 904 | Ga0500641_0013194 | 3300053096 | Bacteria | 3033 |
| 905 | Ga0500562_083418 | 3300053108 | Bacteria | 865 |
| 906 | Ga0500572_000099 | 3300053111 | Bacteria | 28590 |
| 907 | Ga0500582_160514 | 3300053114 | Bacteria | 773 |
| 908 | Ga0500594_0025287 | 3300053118 | Bacteria | 1520 |
| 909 | Ga0500595_000506 | 3300053119 | Bacteria | 23559 |
| 910 | Ga0500595_000631 | 3300053119 | Bacteria | 21077 |
| 911 | Ga0500655_090724 | 3300053133 | Bacteria | 634 |
| 912 | Ga0500658_0072400 | 3300053134 | Bacteria | 1457 |
| 913 | Ga0500559_0000238 | 3300053136 | Bacteria | 43775 |
| 914 | Ga0500561_0044808 | 3300053137 | Bacteria | 1184 |
| 915 | Ga0500568_0206216 | 3300053139 | Bacteria | 719 |
| 916 | Ga0500577_0077432 | 3300053142 | Bacteria | 1318 |
| 917 | Ga0500577_0189174 | 3300053142 | Bacteria | 885 |
| 918 | Ga0500589_055504 | 3300053147 | Bacteria | 1828 |
| 919 | Ga0500627_0155115 | 3300053158 | Bacteria | 1034 |
| 920 | Ga0500634_0082379 | 3300053161 | Bacteria | 1654 |
| 921 | Ga0500638_002747 | 3300053162 | Bacteria | 6264 |
| 922 | Ga0500638_070154 | 3300053162 | Bacteria | 1676 |
| 923 | Ga0500636_0056756 | 3300053177 | Bacteria | 2292 |
| 924 | Ga0500637_0000350 | 3300053178 | Bacteria | 17499 |
| 925 | Ga0500637_0076292 | 3300053178 | Bacteria | 1933 |
| 926 | Ga0500637_0128472 | 3300053178 | Bacteria | 1470 |
| 927 | Ga0500576_045994 | 3300053725 | Bacteria | 1952 |
| 928 | Ga0500611_108289 | 3300053727 | Bacteria | 728 |
| 929 | Ga0500645_022804 | 3300053730 | Bacteria | 1921 |
| 930 | Ga0500596_002870 | 3300053735 | Bacteria | 3357 |
| 931 | Ga0501084_1047699 | 3300054114 | Bacteria | 685 |
| 932 | Ga0501082_0355885 | 3300060353 | Bacteria | 1277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0308273 | Ga0501033_0308273_23_463 | 141 |
| 2 | 3300049572 | Ga0501036_1306400 | Ga0501036_1306400_26_466 | 141 |
| 3 | 3300028653 | Ga0265323_10016069 | Ga0265323_100160692 | 152 |
| 4 | 3300028666 | Ga0265336_10013367 | Ga0265336_100133673 | 152 |
| 5 | 3300028800 | Ga0265338_10000835 | Ga0265338_1000083513 | 152 |
| 6 | 3300029957 | Ga0265324_10019533 | Ga0265324_100195332 | 152 |
| 7 | iso_pu_bacteria | 2513237161 | 2514014783 | 152 |
| 8 | iso_pu_bacteria | 2515154112 | 2515627541 | 152 |
| 9 | iso_pu_bacteria | 2617270735 | 2617352166 | 152 |
| 10 | iso_pu_bacteria | 2802429603 | 2805915537 | 152 |
| 11 | iso_pu_bacteria | 2824671348 | 2824675729 | 152 |
| 12 | iso_pu_bacteria | 2824687955 | 2824691426 | 152 |
| 13 | iso_pu_bacteria | 2824696289 | 2824699708 | 152 |
| 14 | iso_pu_bacteria | 2824773399 | 2824779817 | 152 |
| 15 | iso_pu_bacteria | 2838122688 | 2838124591 | 152 |
| 16 | iso_pu_bacteria | 2841941048 | 2841945278 | 152 |
| 17 | iso_pu_bacteria | 2841949485 | 2841952067 | 152 |
| 18 | iso_pu_bacteria | 2841966195 | 2841970547 | 152 |
| 19 | iso_pu_bacteria | 2841974524 | 2841981796 | 152 |
| 20 | iso_pu_bacteria | 2841983080 | 2841985074 | 152 |
| 21 | iso_pu_bacteria | 2844315083 | 2844315440 | 152 |
| 22 | iso_pu_bacteria | 2847939898 | 2847942231 | 152 |
| 23 | iso_pu_bacteria | 2903727486 | 2903732284 | 152 |
| 24 | iso_pu_bacteria | 2906602504 | 2906604351 | 152 |
| 25 | iso_pu_bacteria | 2932794094 | 2932794241 | 152 |
| 26 | iso_pu_bacteria | 2932801729 | 2932808165 | 152 |
| 27 | iso_pu_bacteria | 2935883170 | 2935890018 | 152 |
| 28 | iso_pu_bacteria | 3005594810 | 3005595131 | 152 |
| 29 | iso_pu_bacteria | 3005718088 | 3005718377 | 152 |
| 30 | iso_pu_bacteria | 8006926726 | 8006933277 | 152 |
| 31 | 3300010375 | Ga0105239_10544550 | Ga0105239_105445502 | 153 |
| 32 | 3300048927 | Ga0496124_0046885 | Ga0496124_0046885_721_1191 | 153 |
| 33 | 3300048928 | Ga0496125_0047124 | Ga0496125_0047124_227_697 | 153 |
| 34 | 3300025321 | Ga0207656_10465633 | Ga0207656_104656331 | 154 |
| 35 | 3300039450 | Ga0436363_1403617 | Ga0436363_1403617_1301_1777 | 154 |
| 36 | 3300005467 | Ga0070706_100072375 | Ga0070706_1000723752 | 155 |
| 37 | 3300005471 | Ga0070698_100084471 | Ga0070698_1000844713 | 155 |
| 38 | 3300005536 | Ga0070697_100399786 | Ga0070697_1003997862 | 155 |
| 39 | 3300013296 | Ga0157374_10708571 | Ga0157374_107085711 | 155 |
| 40 | 3300025910 | Ga0207684_10201526 | Ga0207684_102015262 | 155 |
| 41 | 3300025939 | Ga0207665_10188122 | Ga0207665_101881221 | 155 |
| 42 | 3300048905 | Ga0496102_0327127 | Ga0496102_0327127_670_1140 | 155 |
| 43 | 3300048907 | Ga0496104_0373628 | Ga0496104_0373628_333_803 | 155 |
| 44 | 3300048915 | Ga0496112_0051842 | Ga0496112_0051842_214_684 | 155 |
| 45 | 3300005435 | Ga0070714_100105094 | Ga0070714_1001050943 | 156 |
| 46 | 3300005436 | Ga0070713_100055042 | Ga0070713_1000550422 | 156 |
| 47 | 3300005437 | Ga0070710_10003286 | Ga0070710_100032863 | 156 |
| 48 | 3300005439 | Ga0070711_100000745 | Ga0070711_1000007455 | 156 |
| 49 | 3300005530 | Ga0070679_100080723 | Ga0070679_1000807233 | 156 |
| 50 | 3300005614 | Ga0068856_100473876 | Ga0068856_1004738762 | 156 |
| 51 | 3300006175 | Ga0070712_100280156 | Ga0070712_1002801561 | 156 |
| 52 | 3300014969 | Ga0157376_11136703 | Ga0157376_111367031 | 156 |
| 53 | 3300021384 | Ga0213876_10032614 | Ga0213876_100326142 | 156 |
| 54 | 3300025898 | Ga0207692_10015075 | Ga0207692_100150753 | 156 |
| 55 | 3300025906 | Ga0207699_10000309 | Ga0207699_1000030924 | 156 |
| 56 | 3300025915 | Ga0207693_10108972 | Ga0207693_101089722 | 156 |
| 57 | 3300025916 | Ga0207663_10001983 | Ga0207663_100019832 | 156 |
| 58 | 3300025928 | Ga0207700_10049134 | Ga0207700_100491344 | 156 |
| 59 | 3300025929 | Ga0207664_10175665 | Ga0207664_101756652 | 156 |
| 60 | 3300025939 | Ga0207665_10053824 | Ga0207665_100538242 | 156 |
| 61 | 3300035242 | Ga0373962_0212440 | Ga0373962_0212440_28_504 | 156 |
| 62 | 3300039437 | Ga0436365_0168484 | Ga0436365_0168484_2742_3221 | 156 |
| 63 | 3300039438 | Ga0436360_1245929 | Ga0436360_1245929_109_588 | 156 |
| 64 | 3300039450 | Ga0436363_1166950 | Ga0436363_1166950_53_532 | 156 |
| 65 | 3300039453 | Ga0436362_0181511 | Ga0436362_0181511_1339_1818 | 156 |
| 66 | 3300044901 | Ga0466960_0247273 | Ga0466960_0247273_217_756 | 156 |
| 67 | 3300048924 | Ga0496121_0282937 | Ga0496121_0282937_382_861 | 156 |
| 68 | 3300048929 | Ga0496126_0371971 | Ga0496126_0371971_538_1017 | 156 |
| 69 | 3300049570 | Ga0501033_0150909 | Ga0501033_0150909_1027_1512 | 156 |
| 70 | 3300049571 | Ga0501034_0048287 | Ga0501034_0048287_630_1115 | 156 |
| 71 | 3300049574 | Ga0501038_0124216 | Ga0501038_0124216_1502_1987 | 156 |
| 72 | 3300049575 | Ga0501039_0164864 | Ga0501039_0164864_623_1108 | 156 |
| 73 | 3300049579 | Ga0501043_0330162 | Ga0501043_0330162_73_558 | 156 |
| 74 | 3300049580 | Ga0501046_0134887 | Ga0501046_0134887_131_616 | 156 |
| 75 | 3300049584 | Ga0501068_0027765 | Ga0501068_0027765_528_1013 | 156 |
| 76 | 3300049585 | Ga0501069_0057654 | Ga0501069_0057654_434_919 | 156 |
| 77 | 3300049587 | Ga0501071_0370302 | Ga0501071_0370302_41_526 | 156 |
| 78 | 3300049822 | Ga0501035_0082361 | Ga0501035_0082361_660_1145 | 156 |
| 79 | 3300003214 | JGI25165J46597_1014365 | JGI25165J46597_10143652 | 157 |
| 80 | 3300003322 | rootL2_10096256 | rootL2_100962561 | 157 |
| 81 | 3300005445 | Ga0070708_100263882 | Ga0070708_1002638822 | 157 |
| 82 | 3300005467 | Ga0070706_100493931 | Ga0070706_1004939312 | 157 |
| 83 | 3300005468 | Ga0070707_100560281 | Ga0070707_1005602812 | 157 |
| 84 | 3300005536 | Ga0070697_100436918 | Ga0070697_1004369181 | 157 |
| 85 | 3300005548 | Ga0070665_100790605 | Ga0070665_1007906051 | 157 |
| 86 | 3300006028 | Ga0070717_10124111 | Ga0070717_101241112 | 157 |
| 87 | 3300006163 | Ga0070715_10043682 | Ga0070715_100436822 | 157 |
| 88 | 3300006175 | Ga0070712_100161542 | Ga0070712_1001615422 | 157 |
| 89 | 3300007265 | Ga0099794_10230174 | Ga0099794_102301742 | 157 |
| 90 | 3300009545 | Ga0105237_10043269 | Ga0105237_100432692 | 157 |
| 91 | 3300009553 | Ga0105249_10340165 | Ga0105249_103401652 | 157 |
| 92 | 3300010159 | Ga0099796_10017101 | Ga0099796_100171013 | 157 |
| 93 | 3300013306 | Ga0163162_10528306 | Ga0163162_105283062 | 157 |
| 94 | 3300025261 | Ga0209233_1028045 | Ga0209233_10280451 | 157 |
| 95 | 3300025272 | Ga0209455_1002223 | Ga0209455_10022238 | 157 |
| 96 | 3300025898 | Ga0207692_10170389 | Ga0207692_101703892 | 157 |
| 97 | 3300025905 | Ga0207685_10501513 | Ga0207685_105015131 | 157 |
| 98 | 3300025906 | Ga0207699_10436859 | Ga0207699_104368592 | 157 |
| 99 | 3300025908 | Ga0207643_10631469 | Ga0207643_106314691 | 157 |
| 100 | 3300025910 | Ga0207684_10836656 | Ga0207684_108366561 | 157 |
| 101 | 3300025915 | Ga0207693_10092682 | Ga0207693_100926822 | 157 |
| 102 | 3300025961 | Ga0207712_10239357 | Ga0207712_102393572 | 157 |
| 103 | 3300028379 | Ga0268266_10392226 | Ga0268266_103922262 | 157 |
| 104 | 3300031249 | Ga0265339_10016094 | Ga0265339_100160945 | 157 |
| 105 | 3300033544 | Ga0316215_1005545 | Ga0316215_10055451 | 157 |
| 106 | 3300035089 | Ga0373944_0275669 | Ga0373944_0275669_34_510 | 157 |
| 107 | 3300035691 | Ga0373931_0091713 | Ga0373931_0091713_164_640 | 157 |
| 108 | 3300035695 | Ga0373927_0003306 | Ga0373927_0003306_996_1472 | 157 |
| 109 | 3300035725 | Ga0373947_0023036 | Ga0373947_0023036_1542_2018 | 157 |
| 110 | 3300036459 | Ga0372808_020771 | Ga0372808_020771_212_691 | 157 |
| 111 | 3300037068 | Ga0373925_0077409 | Ga0373925_0077409_983_1459 | 157 |
| 112 | 3300044706 | Ga0466964_0565191 | Ga0466964_0565191_110_583 | 157 |
| 113 | 3300044842 | Ga0466957_0564762 | Ga0466957_0564762_261_734 | 157 |
| 114 | 3300045976 | Ga0466967_0702043 | Ga0466967_0702043_276_749 | 157 |
| 115 | 3300045976 | Ga0466967_1024621 | Ga0466967_1024621_149_628 | 157 |
| 116 | 3300046455 | Ga0495603_0364080 | Ga0495603_0364080_100_576 | 157 |
| 117 | 3300046517 | Ga0495630_0196993 | Ga0495630_0196993_337_813 | 157 |
| 118 | 3300048907 | Ga0496104_0135896 | Ga0496104_0135896_73_549 | 157 |
| 119 | 3300048911 | Ga0496108_0039651 | Ga0496108_0039651_1890_2366 | 157 |
| 120 | 3300048916 | Ga0496113_0114650 | Ga0496113_0114650_36_512 | 157 |
| 121 | 3300048917 | Ga0496114_0037886 | Ga0496114_0037886_2732_3208 | 157 |
| 122 | 3300048918 | Ga0496115_0109423 | Ga0496115_0109423_1236_1712 | 157 |
| 123 | 3300048918 | Ga0496115_0444017 | Ga0496115_0444017_230_706 | 157 |
| 124 | 3300048918 | Ga0496115_0910449 | Ga0496115_0910449_112_588 | 157 |
| 125 | 3300048921 | Ga0496118_0096208 | Ga0496118_0096208_576_1052 | 157 |
| 126 | 3300048929 | Ga0496126_0242181 | Ga0496126_0242181_679_1155 | 157 |
| 127 | 3300048929 | Ga0496126_0267846 | Ga0496126_0267846_529_1005 | 157 |
| 128 | 3300053178 | Ga0500637_0076292 | Ga0500637_0076292_53_529 | 157 |
| 129 | 3300005327 | Ga0070658_10014893 | Ga0070658_100148932 | 158 |
| 130 | 3300005329 | Ga0070683_100023757 | Ga0070683_1000237579 | 158 |
| 131 | 3300005329 | Ga0070683_100026678 | Ga0070683_1000266782 | 158 |
| 132 | 3300005339 | Ga0070660_100002091 | Ga0070660_10000209110 | 158 |
| 133 | 3300005344 | Ga0070661_100380440 | Ga0070661_1003804402 | 158 |
| 134 | 3300005366 | Ga0070659_100379757 | Ga0070659_1003797571 | 158 |
| 135 | 3300005434 | Ga0070709_10003366 | Ga0070709_100033667 | 158 |
| 136 | 3300005434 | Ga0070709_10992061 | Ga0070709_109920611 | 158 |
| 137 | 3300005435 | Ga0070714_100077968 | Ga0070714_1000779683 | 158 |
| 138 | 3300005437 | Ga0070710_10030798 | Ga0070710_100307983 | 158 |
| 139 | 3300005439 | Ga0070711_100015345 | Ga0070711_1000153453 | 158 |
| 140 | 3300005458 | Ga0070681_10233050 | Ga0070681_102330501 | 158 |
| 141 | 3300005467 | Ga0070706_100585893 | Ga0070706_1005858931 | 158 |
| 142 | 3300005471 | Ga0070698_100904999 | Ga0070698_1009049991 | 158 |
| 143 | 3300005530 | Ga0070679_100038806 | Ga0070679_1000388065 | 158 |
| 144 | 3300005535 | Ga0070684_100004519 | Ga0070684_1000045194 | 158 |
| 145 | 3300005535 | Ga0070684_100016992 | Ga0070684_1000169924 | 158 |
| 146 | 3300005536 | Ga0070697_100399205 | Ga0070697_1003992052 | 158 |
| 147 | 3300005545 | Ga0070695_100889492 | Ga0070695_1008894921 | 158 |
| 148 | 3300005563 | Ga0068855_100494392 | Ga0068855_1004943922 | 158 |
| 149 | 3300005577 | Ga0068857_100021483 | Ga0068857_1000214837 | 158 |
| 150 | 3300005577 | Ga0068857_100272157 | Ga0068857_1002721572 | 158 |
| 151 | 3300005614 | Ga0068856_100014372 | Ga0068856_1000143726 | 158 |
| 152 | 3300005616 | Ga0068852_100004787 | Ga0068852_1000047875 | 158 |
| 153 | 3300005983 | Ga0081540_1117597 | Ga0081540_11175972 | 158 |
| 154 | 3300006028 | Ga0070717_10000269 | Ga0070717_1000026918 | 158 |
| 155 | 3300006028 | Ga0070717_10239814 | Ga0070717_102398142 | 158 |
| 156 | 3300006163 | Ga0070715_10009248 | Ga0070715_100092482 | 158 |
| 157 | 3300006173 | Ga0070716_100054308 | Ga0070716_1000543082 | 158 |
| 158 | 3300006175 | Ga0070712_100006808 | Ga0070712_1000068087 | 158 |
| 159 | 3300009093 | Ga0105240_10002943 | Ga0105240_100029439 | 158 |
| 160 | 3300009545 | Ga0105237_10083496 | Ga0105237_100834963 | 158 |
| 161 | 3300009551 | Ga0105238_10006820 | Ga0105238_100068205 | 158 |
| 162 | 3300010375 | Ga0105239_10013186 | Ga0105239_100131865 | 158 |
| 163 | 3300013104 | Ga0157370_10019039 | Ga0157370_100190392 | 158 |
| 164 | 3300013105 | Ga0157369_10006724 | Ga0157369_100067249 | 158 |
| 165 | 3300013105 | Ga0157369_10749753 | Ga0157369_107497533 | 158 |
| 166 | 3300014968 | Ga0157379_11068753 | Ga0157379_110687531 | 158 |
| 167 | 3300021441 | Ga0213871_10150037 | Ga0213871_101500371 | 158 |
| 168 | 3300025910 | Ga0207684_10235799 | Ga0207684_102357992 | 158 |
| 169 | 3300025912 | Ga0207707_10004049 | Ga0207707_100040497 | 158 |
| 170 | 3300025913 | Ga0207695_10158317 | Ga0207695_101583172 | 158 |
| 171 | 3300025914 | Ga0207671_10060067 | Ga0207671_100600672 | 158 |
| 172 | 3300025915 | Ga0207693_10036569 | Ga0207693_100365693 | 158 |
| 173 | 3300025916 | Ga0207663_10053409 | Ga0207663_100534092 | 158 |
| 174 | 3300025917 | Ga0207660_10039770 | Ga0207660_100397703 | 158 |
| 175 | 3300025919 | Ga0207657_10003634 | Ga0207657_1000363415 | 158 |
| 176 | 3300025919 | Ga0207657_10322449 | Ga0207657_103224491 | 158 |
| 177 | 3300025920 | Ga0207649_10105847 | Ga0207649_101058471 | 158 |
| 178 | 3300025921 | Ga0207652_10002638 | Ga0207652_100026389 | 158 |
| 179 | 3300025924 | Ga0207694_11317947 | Ga0207694_113179471 | 158 |
| 180 | 3300025929 | Ga0207664_10055752 | Ga0207664_100557523 | 158 |
| 181 | 3300025929 | Ga0207664_10280396 | Ga0207664_102803961 | 158 |
| 182 | 3300025939 | Ga0207665_10035091 | Ga0207665_100350913 | 158 |
| 183 | 3300025944 | Ga0207661_10001804 | Ga0207661_100018046 | 158 |
| 184 | 3300025944 | Ga0207661_10007278 | Ga0207661_100072784 | 158 |
| 185 | 3300025949 | Ga0207667_10008204 | Ga0207667_100082045 | 158 |
| 186 | 3300025981 | Ga0207640_11044766 | Ga0207640_110447661 | 158 |
| 187 | 3300026116 | Ga0207674_10003708 | Ga0207674_1000370817 | 158 |
| 188 | 3300026142 | Ga0207698_10117280 | Ga0207698_101172802 | 158 |
| 189 | 3300031235 | Ga0265330_10021122 | Ga0265330_100211223 | 158 |
| 190 | 3300031235 | Ga0265330_10023914 | Ga0265330_100239142 | 158 |
| 191 | 3300031235 | Ga0265330_10070163 | Ga0265330_100701632 | 158 |
| 192 | 3300031238 | Ga0265332_10118417 | Ga0265332_101184172 | 158 |
| 193 | 3300031238 | Ga0265332_10207671 | Ga0265332_102076711 | 158 |
| 194 | 3300031241 | Ga0265325_10035551 | Ga0265325_100355513 | 158 |
| 195 | 3300031247 | Ga0265340_10000884 | Ga0265340_1000088413 | 158 |
| 196 | 3300031247 | Ga0265340_10035059 | Ga0265340_100350592 | 158 |
| 197 | 3300031249 | Ga0265339_10004328 | Ga0265339_100043288 | 158 |
| 198 | 3300031249 | Ga0265339_10083650 | Ga0265339_100836501 | 158 |
| 199 | 3300031344 | Ga0265316_10359186 | Ga0265316_103591862 | 158 |
| 200 | 3300031595 | Ga0265313_10041621 | Ga0265313_100416212 | 158 |
| 201 | 3300031616 | Ga0307508_10000108 | Ga0307508_1000010865 | 158 |
| 202 | 3300031711 | Ga0265314_10124640 | Ga0265314_101246402 | 158 |
| 203 | 3300031712 | Ga0265342_10147385 | Ga0265342_101473852 | 158 |
| 204 | 3300035111 | Ga0373923_0060610 | Ga0373923_0060610_940_1419 | 158 |
| 205 | 3300035695 | Ga0373927_0235163 | Ga0373927_0235163_414_935 | 158 |
| 206 | 3300036401 | Ga0373937_0078308 | Ga0373937_0078308_1342_1821 | 158 |
| 207 | 3300037853 | Ga0436364_1450038 | Ga0436364_1450038_1065_1550 | 158 |
| 208 | 3300039437 | Ga0436365_1582279 | Ga0436365_1582279_61_546 | 158 |
| 209 | 3300039438 | Ga0436360_0023737 | Ga0436360_0023737_821_1297 | 158 |
| 210 | 3300039450 | Ga0436363_0159943 | Ga0436363_0159943_437_922 | 158 |
| 211 | 3300046524 | Ga0495648_0001251 | Ga0495648_0001251_3711_4190 | 158 |
| 212 | 3300046543 | Ga0495645_0123252 | Ga0495645_0123252_717_1238 | 158 |
| 213 | 3300046679 | Ga0495623_0218694 | Ga0495623_0218694_371_850 | 158 |
| 214 | 3300046689 | Ga0495613_0782777 | Ga0495613_0782777_46_528 | 158 |
| 215 | 3300047315 | Ga0495581_0602697 | Ga0495581_0602697_120_599 | 158 |
| 216 | 3300047317 | Ga0495604_0265593 | Ga0495604_0265593_633_1154 | 158 |
| 217 | 3300047319 | Ga0495674_0198480 | Ga0495674_0198480_541_1062 | 158 |
| 218 | 3300048929 | Ga0496126_0073518 | Ga0496126_0073518_33_512 | 158 |
| 219 | 3300049580 | Ga0501046_0019136 | Ga0501046_0019136_4336_4815 | 158 |
| 220 | 3300049581 | Ga0501047_0020926 | Ga0501047_0020926_2659_3153 | 158 |
| 221 | 3300049586 | Ga0501070_0008271 | Ga0501070_0008271_5639_6133 | 158 |
| 222 | 3300049589 | Ga0501073_0008815 | Ga0501073_0008815_1877_2371 | 158 |
| 223 | 3300049590 | Ga0501074_0015460 | Ga0501074_0015460_747_1241 | 158 |
| 224 | 3300049742 | Ga0501080_0016296 | Ga0501080_0016296_662_1156 | 158 |
| 225 | 3300049823 | Ga0501044_0017082 | Ga0501044_0017082_2379_2873 | 158 |
| 226 | 3300003322 | rootL2_10045963 | rootL2_100459632 | 159 |
| 227 | 3300005435 | Ga0070714_100003204 | Ga0070714_1000032045 | 159 |
| 228 | 3300005439 | Ga0070711_100014756 | Ga0070711_1000147567 | 159 |
| 229 | 3300006028 | Ga0070717_10004197 | Ga0070717_100041972 | 159 |
| 230 | 3300006173 | Ga0070716_100024130 | Ga0070716_1000241303 | 159 |
| 231 | 3300025898 | Ga0207692_10005362 | Ga0207692_100053622 | 159 |
| 232 | 3300025906 | Ga0207699_10090360 | Ga0207699_100903602 | 159 |
| 233 | 3300025915 | Ga0207693_10002279 | Ga0207693_100022794 | 159 |
| 234 | 3300025916 | Ga0207663_10002139 | Ga0207663_100021399 | 159 |
| 235 | 3300025928 | Ga0207700_10016746 | Ga0207700_100167464 | 159 |
| 236 | 3300025929 | Ga0207664_10042185 | Ga0207664_100421855 | 159 |
| 237 | 3300025939 | Ga0207665_10002452 | Ga0207665_100024524 | 159 |
| 238 | 3300048088 | Ga0495602_0671054 | Ga0495602_0671054_120_677 | 159 |
| 239 | 3300053096 | Ga0500641_0013194 | Ga0500641_0013194_1691_2176 | 159 |
| 240 | 3300005439 | Ga0070711_100342468 | Ga0070711_1003424682 | 160 |
| 241 | 3300025900 | Ga0207710_10136584 | Ga0207710_101365842 | 160 |
| 242 | 3300035118 | Ga0373954_0024673 | Ga0373954_0024673_772_1365 | 160 |
| 243 | 3300046543 | Ga0495645_0110908 | Ga0495645_0110908_94_687 | 160 |
| 244 | 3300046678 | Ga0495599_0008234 | Ga0495599_0008234_410_1003 | 160 |
| 245 | 3300053078 | Ga0495612_0038738 | Ga0495612_0038738_935_1528 | 160 |
| 246 | 3300053084 | Ga0495595_0067844 | Ga0495595_0067844_34_522 | 160 |
| 247 | 3300033180 | Ga0307510_10200456 | Ga0307510_102004562 | 161 |
| 248 | 3300048924 | Ga0496121_0216414 | Ga0496121_0216414_690_1181 | 162 |
| 249 | 3300053078 | Ga0495612_0179654 | Ga0495612_0179654_122_619 | 162 |
| 250 | iso_pu_bacteria | 2904690495 | 2904691119 | 162 |
| 251 | iso_pu_bacteria | 2908756301 | 2908756513 | 162 |
| 252 | 3300010159 | Ga0099796_10011515 | Ga0099796_100115152 | 163 |
| 253 | 3300046460 | Ga0495638_0134796 | Ga0495638_0134796_175_672 | 163 |
| 254 | 3300053092 | Ga0500583_0011614 | Ga0500583_0011614_376_873 | 163 |
| 255 | 3300053118 | Ga0500594_0025287 | Ga0500594_0025287_979_1476 | 163 |
| 256 | 3300053142 | Ga0500577_0077432 | Ga0500577_0077432_733_1230 | 163 |
| 257 | 3300053161 | Ga0500634_0082379 | Ga0500634_0082379_604_1101 | 163 |
| 258 | 3300003659 | JGI25404J52841_10029009 | JGI25404J52841_100290092 | 164 |
| 259 | 3300005356 | Ga0070674_100427848 | Ga0070674_1004278481 | 164 |
| 260 | 3300005983 | Ga0081540_1018775 | Ga0081540_10187751 | 164 |
| 261 | 3300006038 | Ga0075365_10254392 | Ga0075365_102543921 | 164 |
| 262 | 3300006195 | Ga0075366_10450007 | Ga0075366_104500071 | 164 |
| 263 | 3300006353 | Ga0075370_10561316 | Ga0075370_105613161 | 164 |
| 264 | 3300025297 | Ga0209758_1010347 | Ga0209758_10103472 | 164 |
| 265 | 3300025981 | Ga0207640_11616702 | Ga0207640_116167021 | 164 |
| 266 | 3300026041 | Ga0207639_10572555 | Ga0207639_105725552 | 164 |
| 267 | 3300030522 | Ga0307512_10302631 | Ga0307512_103026311 | 164 |
| 268 | 3300041496 | Ga0451839_0736368 | Ga0451839_0736368_102_599 | 164 |
| 269 | 3300046473 | Ga0495582_0028352 | Ga0495582_0028352_1310_1807 | 164 |
| 270 | 3300046531 | Ga0495665_0246776 | Ga0495665_0246776_352_849 | 164 |
| 271 | 3300046533 | Ga0495640_0577440 | Ga0495640_0577440_59_556 | 164 |
| 272 | 3300047315 | Ga0495581_0131300 | Ga0495581_0131300_851_1348 | 164 |
| 273 | 3300048929 | Ga0496126_0117515 | Ga0496126_0117515_353_871 | 164 |
| 274 | 3300053090 | Ga0500646_0024926 | Ga0500646_0024926_741_1241 | 164 |
| 275 | 3300053111 | Ga0500572_000099 | Ga0500572_000099_17537_18055 | 164 |
| 276 | 3300053136 | Ga0500559_0000238 | Ga0500559_0000238_10841_11359 | 164 |
| 277 | 3300053177 | Ga0500636_0056756 | Ga0500636_0056756_956_1474 | 164 |
| 278 | 3300053725 | Ga0500576_045994 | Ga0500576_045994_1209_1727 | 164 |
| 279 | 3300053735 | Ga0500596_002870 | Ga0500596_002870_674_1192 | 164 |
| 280 | 3300005343 | Ga0070687_100789260 | Ga0070687_1007892601 | 165 |
| 281 | 3300005347 | Ga0070668_100052404 | Ga0070668_1000524043 | 165 |
| 282 | 3300005347 | Ga0070668_100052629 | Ga0070668_1000526292 | 165 |
| 283 | 3300005356 | Ga0070674_100548676 | Ga0070674_1005486761 | 165 |
| 284 | 3300005367 | Ga0070667_100057192 | Ga0070667_1000571921 | 165 |
| 285 | 3300005438 | Ga0070701_10087544 | Ga0070701_100875441 | 165 |
| 286 | 3300005441 | Ga0070700_100711335 | Ga0070700_1007113351 | 165 |
| 287 | 3300005455 | Ga0070663_100858687 | Ga0070663_1008586871 | 165 |
| 288 | 3300005456 | Ga0070678_100048833 | Ga0070678_1000488334 | 165 |
| 289 | 3300005456 | Ga0070678_100185861 | Ga0070678_1001858611 | 165 |
| 290 | 3300005459 | Ga0068867_100049258 | Ga0068867_1000492583 | 165 |
| 291 | 3300005539 | Ga0068853_100203859 | Ga0068853_1002038591 | 165 |
| 292 | 3300005543 | Ga0070672_100047552 | Ga0070672_1000475523 | 165 |
| 293 | 3300005544 | Ga0070686_100069204 | Ga0070686_1000692042 | 165 |
| 294 | 3300005546 | Ga0070696_100935292 | Ga0070696_1009352921 | 165 |
| 295 | 3300005718 | Ga0068866_10021203 | Ga0068866_100212033 | 165 |
| 296 | 3300005719 | Ga0068861_100052249 | Ga0068861_1000522492 | 165 |
| 297 | 3300005843 | Ga0068860_100130560 | Ga0068860_1001305603 | 165 |
| 298 | 3300005844 | Ga0068862_100259184 | Ga0068862_1002591842 | 165 |
| 299 | 3300006038 | Ga0075365_10281124 | Ga0075365_102811242 | 165 |
| 300 | 3300006177 | Ga0075362_10124324 | Ga0075362_101243242 | 165 |
| 301 | 3300006237 | Ga0097621_100068907 | Ga0097621_1000689073 | 165 |
| 302 | 3300006881 | Ga0068865_100017842 | Ga0068865_1000178423 | 165 |
| 303 | 3300006881 | Ga0068865_100601009 | Ga0068865_1006010091 | 165 |
| 304 | 3300009094 | Ga0111539_10061321 | Ga0111539_100613215 | 165 |
| 305 | 3300009098 | Ga0105245_10074999 | Ga0105245_100749993 | 165 |
| 306 | 3300009148 | Ga0105243_10045318 | Ga0105243_100453181 | 165 |
| 307 | 3300009176 | Ga0105242_10711023 | Ga0105242_107110231 | 165 |
| 308 | 3300009545 | Ga0105237_10865440 | Ga0105237_108654401 | 165 |
| 309 | 3300009553 | Ga0105249_10262698 | Ga0105249_102626982 | 165 |
| 310 | 3300011119 | Ga0105246_10109633 | Ga0105246_101096331 | 165 |
| 311 | 3300013297 | Ga0157378_10257569 | Ga0157378_102575691 | 165 |
| 312 | 3300013306 | Ga0163162_10455550 | Ga0163162_104555501 | 165 |
| 313 | 3300014326 | Ga0157380_10149254 | Ga0157380_101492542 | 165 |
| 314 | 3300014969 | Ga0157376_10701271 | Ga0157376_107012711 | 165 |
| 315 | 3300017792 | Ga0163161_10080606 | Ga0163161_100806063 | 165 |
| 316 | 3300017792 | Ga0163161_10272828 | Ga0163161_102728282 | 165 |
| 317 | 3300025302 | Ga0207426_1112741 | Ga0207426_11127411 | 165 |
| 318 | 3300025315 | Ga0207697_10023965 | Ga0207697_100239652 | 165 |
| 319 | 3300025899 | Ga0207642_10035126 | Ga0207642_100351261 | 165 |
| 320 | 3300025901 | Ga0207688_10010585 | Ga0207688_100105853 | 165 |
| 321 | 3300025919 | Ga0207657_10210687 | Ga0207657_102106871 | 165 |
| 322 | 3300025927 | Ga0207687_10023004 | Ga0207687_100230043 | 165 |
| 323 | 3300025931 | Ga0207644_10385830 | Ga0207644_103858301 | 165 |
| 324 | 3300025932 | Ga0207690_10891055 | Ga0207690_108910551 | 165 |
| 325 | 3300025933 | Ga0207706_10025700 | Ga0207706_100257002 | 165 |
| 326 | 3300025933 | Ga0207706_10323700 | Ga0207706_103237001 | 165 |
| 327 | 3300025934 | Ga0207686_10366762 | Ga0207686_103667622 | 165 |
| 328 | 3300025935 | Ga0207709_10418209 | Ga0207709_104182091 | 165 |
| 329 | 3300025935 | Ga0207709_10957997 | Ga0207709_109579971 | 165 |
| 330 | 3300025937 | Ga0207669_10055249 | Ga0207669_100552492 | 165 |
| 331 | 3300025938 | Ga0207704_10031422 | Ga0207704_100314222 | 165 |
| 332 | 3300025938 | Ga0207704_10601907 | Ga0207704_106019071 | 165 |
| 333 | 3300025940 | Ga0207691_10060550 | Ga0207691_100605503 | 165 |
| 334 | 3300025941 | Ga0207711_10583776 | Ga0207711_105837762 | 165 |
| 335 | 3300025945 | Ga0207679_10171579 | Ga0207679_101715791 | 165 |
| 336 | 3300025972 | Ga0207668_10073979 | Ga0207668_100739794 | 165 |
| 337 | 3300025972 | Ga0207668_10406272 | Ga0207668_104062721 | 165 |
| 338 | 3300025986 | Ga0207658_11224375 | Ga0207658_112243751 | 165 |
| 339 | 3300026041 | Ga0207639_10238815 | Ga0207639_102388152 | 165 |
| 340 | 3300026067 | Ga0207678_10048527 | Ga0207678_100485271 | 165 |
| 341 | 3300026075 | Ga0207708_10725563 | Ga0207708_107255632 | 165 |
| 342 | 3300026089 | Ga0207648_10117176 | Ga0207648_101171763 | 165 |
| 343 | 3300026118 | Ga0207675_100043240 | Ga0207675_1000432402 | 165 |
| 344 | 3300026121 | Ga0207683_10043506 | Ga0207683_100435064 | 165 |
| 345 | 3300026121 | Ga0207683_10075599 | Ga0207683_100755993 | 165 |
| 346 | 3300027907 | Ga0207428_10302262 | Ga0207428_103022622 | 165 |
| 347 | 3300028380 | Ga0268265_10120452 | Ga0268265_101204522 | 165 |
| 348 | 3300037418 | Ga0395900_0109182 | Ga0395900_0109182_371_880 | 165 |
| 349 | 3300038443 | Ga0395901_1068423 | Ga0395901_1068423_21_530 | 165 |
| 350 | 3300045976 | Ga0466967_0682013 | Ga0466967_0682013_430_939 | 165 |
| 351 | 3300046506 | Ga0495583_0210154 | Ga0495583_0210154_141_644 | 165 |
| 352 | 3300046615 | Ga0495656_0009022 | Ga0495656_0009022_2830_3333 | 165 |
| 353 | 3300046664 | Ga0495659_0058120 | Ga0495659_0058120_165_668 | 165 |
| 354 | 3300046684 | Ga0495669_0015183 | Ga0495669_0015183_140_643 | 165 |
| 355 | 3300046684 | Ga0495669_0170181 | Ga0495669_0170181_486_986 | 165 |
| 356 | 3300046684 | Ga0495669_0316731 | Ga0495669_0316731_227_730 | 165 |
| 357 | 3300047447 | Ga0495685_086272 | Ga0495685_086272_468_971 | 165 |
| 358 | 3300047472 | Ga0495686_0127380 | Ga0495686_0127380_80_583 | 165 |
| 359 | 3300048905 | Ga0496102_0339395 | Ga0496102_0339395_814_1317 | 165 |
| 360 | 3300048909 | Ga0496106_0257845 | Ga0496106_0257845_539_1042 | 165 |
| 361 | 3300048910 | Ga0496107_0092416 | Ga0496107_0092416_246_749 | 165 |
| 362 | 3300048917 | Ga0496114_0063296 | Ga0496114_0063296_242_745 | 165 |
| 363 | 3300049568 | Ga0501031_0160646 | Ga0501031_0160646_942_1445 | 165 |
| 364 | 3300049573 | Ga0501037_0249504 | Ga0501037_0249504_718_1221 | 165 |
| 365 | 3300049574 | Ga0501038_0561556 | Ga0501038_0561556_125_628 | 165 |
| 366 | 3300049587 | Ga0501071_0392019 | Ga0501071_0392019_349_852 | 165 |
| 367 | 3300049592 | Ga0501076_0146208 | Ga0501076_0146208_1184_1687 | 165 |
| 368 | 3300049741 | Ga0501079_0385992 | Ga0501079_0385992_38_541 | 165 |
| 369 | 3300049742 | Ga0501080_0249895 | Ga0501080_0249895_337_840 | 165 |
| 370 | 3300049824 | Ga0501045_0379058 | Ga0501045_0379058_254_757 | 165 |
| 371 | 3300049824 | Ga0501045_0471835 | Ga0501045_0471835_15_518 | 165 |
| 372 | 3300050492 | nmdc:mga0yw44_971088_c1 | nmdc:mga0yw44_971088_c1_49_552 | 165 |
| 373 | 3300050511 | nmdc:mga08y16_66686_c1 | nmdc:mga08y16_66686_c1_536_1039 | 165 |
| 374 | 3300053083 | Ga0495655_0074640 | Ga0495655_0074640_148_648 | 165 |
| 375 | 3300053139 | Ga0500568_0206216 | Ga0500568_0206216_78_581 | 165 |
| 376 | 3300054114 | Ga0501084_1047699 | Ga0501084_1047699_134_637 | 165 |
| 377 | 3300060353 | Ga0501082_0355885 | Ga0501082_0355885_264_767 | 165 |
| 378 | 3300003203 | JGI25406J46586_10012434 | JGI25406J46586_100124342 | 166 |
| 379 | 3300003322 | rootL2_10110173 | rootL2_101101733 | 166 |
| 380 | 3300003659 | JGI25404J52841_10003473 | JGI25404J52841_100034733 | 166 |
| 381 | 3300003659 | JGI25404J52841_10014495 | JGI25404J52841_100144952 | 166 |
| 382 | 3300003659 | JGI25404J52841_10017249 | JGI25404J52841_100172492 | 166 |
| 383 | 3300003911 | JGI25405J52794_10029568 | JGI25405J52794_100295682 | 166 |
| 384 | 3300003911 | JGI25405J52794_10038265 | JGI25405J52794_100382652 | 166 |
| 385 | 3300005327 | Ga0070658_10161129 | Ga0070658_101611292 | 166 |
| 386 | 3300005327 | Ga0070658_10207026 | Ga0070658_102070261 | 166 |
| 387 | 3300005328 | Ga0070676_10269668 | Ga0070676_102696681 | 166 |
| 388 | 3300005334 | Ga0068869_100153340 | Ga0068869_1001533402 | 166 |
| 389 | 3300005334 | Ga0068869_100272752 | Ga0068869_1002727522 | 166 |
| 390 | 3300005334 | Ga0068869_101690795 | Ga0068869_1016907951 | 166 |
| 391 | 3300005336 | Ga0070680_100081500 | Ga0070680_1000815001 | 166 |
| 392 | 3300005338 | Ga0068868_100034114 | Ga0068868_1000341141 | 166 |
| 393 | 3300005339 | Ga0070660_100207546 | Ga0070660_1002075461 | 166 |
| 394 | 3300005340 | Ga0070689_100446774 | Ga0070689_1004467741 | 166 |
| 395 | 3300005340 | Ga0070689_101212350 | Ga0070689_1012123501 | 166 |
| 396 | 3300005343 | Ga0070687_101264114 | Ga0070687_1012641141 | 166 |
| 397 | 3300005347 | Ga0070668_100038776 | Ga0070668_1000387762 | 166 |
| 398 | 3300005347 | Ga0070668_100065717 | Ga0070668_1000657172 | 166 |
| 399 | 3300005347 | Ga0070668_100081584 | Ga0070668_1000815843 | 166 |
| 400 | 3300005347 | Ga0070668_100093078 | Ga0070668_1000930782 | 166 |
| 401 | 3300005353 | Ga0070669_100112510 | Ga0070669_1001125101 | 166 |
| 402 | 3300005354 | Ga0070675_100166479 | Ga0070675_1001664792 | 166 |
| 403 | 3300005354 | Ga0070675_100214135 | Ga0070675_1002141352 | 166 |
| 404 | 3300005354 | Ga0070675_100246901 | Ga0070675_1002469012 | 166 |
| 405 | 3300005354 | Ga0070675_100524883 | Ga0070675_1005248832 | 166 |
| 406 | 3300005355 | Ga0070671_100139781 | Ga0070671_1001397812 | 166 |
| 407 | 3300005355 | Ga0070671_100615204 | Ga0070671_1006152042 | 166 |
| 408 | 3300005356 | Ga0070674_100461309 | Ga0070674_1004613092 | 166 |
| 409 | 3300005356 | Ga0070674_100781989 | Ga0070674_1007819892 | 166 |
| 410 | 3300005364 | Ga0070673_100197544 | Ga0070673_1001975442 | 166 |
| 411 | 3300005364 | Ga0070673_100284219 | Ga0070673_1002842192 | 166 |
| 412 | 3300005364 | Ga0070673_101336580 | Ga0070673_1013365801 | 166 |
| 413 | 3300005365 | Ga0070688_100183024 | Ga0070688_1001830241 | 166 |
| 414 | 3300005365 | Ga0070688_100574830 | Ga0070688_1005748301 | 166 |
| 415 | 3300005366 | Ga0070659_100100796 | Ga0070659_1001007962 | 166 |
| 416 | 3300005367 | Ga0070667_100599446 | Ga0070667_1005994461 | 166 |
| 417 | 3300005436 | Ga0070713_100289224 | Ga0070713_1002892242 | 166 |
| 418 | 3300005437 | Ga0070710_10237258 | Ga0070710_102372582 | 166 |
| 419 | 3300005441 | Ga0070700_100150599 | Ga0070700_1001505991 | 166 |
| 420 | 3300005441 | Ga0070700_100822968 | Ga0070700_1008229681 | 166 |
| 421 | 3300005455 | Ga0070663_100011469 | Ga0070663_1000114691 | 166 |
| 422 | 3300005455 | Ga0070663_100022407 | Ga0070663_1000224072 | 166 |
| 423 | 3300005455 | Ga0070663_100082416 | Ga0070663_1000824162 | 166 |
| 424 | 3300005455 | Ga0070663_100204768 | Ga0070663_1002047682 | 166 |
| 425 | 3300005456 | Ga0070678_100011085 | Ga0070678_1000110852 | 166 |
| 426 | 3300005456 | Ga0070678_100064850 | Ga0070678_1000648503 | 166 |
| 427 | 3300005456 | Ga0070678_100152067 | Ga0070678_1001520672 | 166 |
| 428 | 3300005456 | Ga0070678_100159924 | Ga0070678_1001599242 | 166 |
| 429 | 3300005457 | Ga0070662_100097724 | Ga0070662_1000977243 | 166 |
| 430 | 3300005458 | Ga0070681_10041643 | Ga0070681_100416435 | 166 |
| 431 | 3300005459 | Ga0068867_100393149 | Ga0068867_1003931492 | 166 |
| 432 | 3300005459 | Ga0068867_100407017 | Ga0068867_1004070171 | 166 |
| 433 | 3300005459 | Ga0068867_100603275 | Ga0068867_1006032752 | 166 |
| 434 | 3300005466 | Ga0070685_10132615 | Ga0070685_101326152 | 166 |
| 435 | 3300005466 | Ga0070685_10296082 | Ga0070685_102960821 | 166 |
| 436 | 3300005467 | Ga0070706_101528771 | Ga0070706_1015287711 | 166 |
| 437 | 3300005471 | Ga0070698_101814548 | Ga0070698_1018145481 | 166 |
| 438 | 3300005518 | Ga0070699_100506767 | Ga0070699_1005067671 | 166 |
| 439 | 3300005530 | Ga0070679_100028386 | Ga0070679_1000283864 | 166 |
| 440 | 3300005535 | Ga0070684_100159841 | Ga0070684_1001598411 | 166 |
| 441 | 3300005535 | Ga0070684_100752393 | Ga0070684_1007523931 | 166 |
| 442 | 3300005539 | Ga0068853_100430451 | Ga0068853_1004304512 | 166 |
| 443 | 3300005539 | Ga0068853_101055805 | Ga0068853_1010558051 | 166 |
| 444 | 3300005543 | Ga0070672_100119640 | Ga0070672_1001196402 | 166 |
| 445 | 3300005543 | Ga0070672_100382019 | Ga0070672_1003820192 | 166 |
| 446 | 3300005544 | Ga0070686_100181281 | Ga0070686_1001812813 | 166 |
| 447 | 3300005548 | Ga0070665_100038779 | Ga0070665_1000387794 | 166 |
| 448 | 3300005548 | Ga0070665_100084569 | Ga0070665_1000845694 | 166 |
| 449 | 3300005548 | Ga0070665_100143395 | Ga0070665_1001433952 | 166 |
| 450 | 3300005548 | Ga0070665_100159117 | Ga0070665_1001591175 | 166 |
| 451 | 3300005548 | Ga0070665_100227433 | Ga0070665_1002274333 | 166 |
| 452 | 3300005548 | Ga0070665_100487636 | Ga0070665_1004876363 | 166 |
| 453 | 3300005563 | Ga0068855_100021984 | Ga0068855_1000219842 | 166 |
| 454 | 3300005563 | Ga0068855_100039709 | Ga0068855_1000397093 | 166 |
| 455 | 3300005563 | Ga0068855_100111720 | Ga0068855_1001117204 | 166 |
| 456 | 3300005564 | Ga0070664_100118017 | Ga0070664_1001180173 | 166 |
| 457 | 3300005577 | Ga0068857_100268057 | Ga0068857_1002680572 | 166 |
| 458 | 3300005577 | Ga0068857_100493160 | Ga0068857_1004931602 | 166 |
| 459 | 3300005578 | Ga0068854_100010964 | Ga0068854_1000109643 | 166 |
| 460 | 3300005578 | Ga0068854_100661758 | Ga0068854_1006617581 | 166 |
| 461 | 3300005614 | Ga0068856_100000540 | Ga0068856_1000005404 | 166 |
| 462 | 3300005614 | Ga0068856_100288133 | Ga0068856_1002881332 | 166 |
| 463 | 3300005614 | Ga0068856_100447966 | Ga0068856_1004479662 | 166 |
| 464 | 3300005615 | Ga0070702_100617486 | Ga0070702_1006174861 | 166 |
| 465 | 3300005615 | Ga0070702_101000616 | Ga0070702_1010006161 | 166 |
| 466 | 3300005616 | Ga0068852_100123844 | Ga0068852_1001238442 | 166 |
| 467 | 3300005617 | Ga0068859_100200649 | Ga0068859_1002006492 | 166 |
| 468 | 3300005617 | Ga0068859_100201023 | Ga0068859_1002010232 | 166 |
| 469 | 3300005618 | Ga0068864_100378585 | Ga0068864_1003785851 | 166 |
| 470 | 3300005618 | Ga0068864_100396125 | Ga0068864_1003961251 | 166 |
| 471 | 3300005718 | Ga0068866_10353099 | Ga0068866_103530992 | 166 |
| 472 | 3300005719 | Ga0068861_100194902 | Ga0068861_1001949022 | 166 |
| 473 | 3300005840 | Ga0068870_10063270 | Ga0068870_100632702 | 166 |
| 474 | 3300005842 | Ga0068858_100049531 | Ga0068858_1000495315 | 166 |
| 475 | 3300005842 | Ga0068858_100063701 | Ga0068858_1000637014 | 166 |
| 476 | 3300005842 | Ga0068858_100085133 | Ga0068858_1000851333 | 166 |
| 477 | 3300005842 | Ga0068858_100249542 | Ga0068858_1002495422 | 166 |
| 478 | 3300005843 | Ga0068860_100233797 | Ga0068860_1002337972 | 166 |
| 479 | 3300005843 | Ga0068860_100333779 | Ga0068860_1003337792 | 166 |
| 480 | 3300005843 | Ga0068860_100528878 | Ga0068860_1005288783 | 166 |
| 481 | 3300005844 | Ga0068862_100037181 | Ga0068862_1000371815 | 166 |
| 482 | 3300005844 | Ga0068862_100551300 | Ga0068862_1005513002 | 166 |
| 483 | 3300005937 | Ga0081455_10003799 | Ga0081455_100037999 | 166 |
| 484 | 3300005937 | Ga0081455_10016122 | Ga0081455_100161227 | 166 |
| 485 | 3300005937 | Ga0081455_10023378 | Ga0081455_100233782 | 166 |
| 486 | 3300005937 | Ga0081455_10024424 | Ga0081455_100244247 | 166 |
| 487 | 3300005981 | Ga0081538_10022806 | Ga0081538_100228063 | 166 |
| 488 | 3300005983 | Ga0081540_1001162 | Ga0081540_100116222 | 166 |
| 489 | 3300005983 | Ga0081540_1005031 | Ga0081540_10050315 | 166 |
| 490 | 3300005983 | Ga0081540_1007496 | Ga0081540_10074966 | 166 |
| 491 | 3300005983 | Ga0081540_1009260 | Ga0081540_10092608 | 166 |
| 492 | 3300005983 | Ga0081540_1012233 | Ga0081540_10122336 | 166 |
| 493 | 3300005983 | Ga0081540_1074124 | Ga0081540_10741242 | 166 |
| 494 | 3300005983 | Ga0081540_1123230 | Ga0081540_11232301 | 166 |
| 495 | 3300005985 | Ga0081539_10000966 | Ga0081539_1000096628 | 166 |
| 496 | 3300005985 | Ga0081539_10046027 | Ga0081539_100460272 | 166 |
| 497 | 3300006038 | Ga0075365_10007222 | Ga0075365_100072226 | 166 |
| 498 | 3300006038 | Ga0075365_10055244 | Ga0075365_100552442 | 166 |
| 499 | 3300006038 | Ga0075365_10104789 | Ga0075365_101047892 | 166 |
| 500 | 3300006038 | Ga0075365_10200035 | Ga0075365_102000352 | 166 |
| 501 | 3300006042 | Ga0075368_10212815 | Ga0075368_102128152 | 166 |
| 502 | 3300006042 | Ga0075368_10279892 | Ga0075368_102798921 | 166 |
| 503 | 3300006048 | Ga0075363_100016896 | Ga0075363_1000168965 | 166 |
| 504 | 3300006048 | Ga0075363_100028560 | Ga0075363_1000285602 | 166 |
| 505 | 3300006048 | Ga0075363_100053851 | Ga0075363_1000538511 | 166 |
| 506 | 3300006048 | Ga0075363_100277746 | Ga0075363_1002777461 | 166 |
| 507 | 3300006051 | Ga0075364_10031529 | Ga0075364_100315293 | 166 |
| 508 | 3300006051 | Ga0075364_10305866 | Ga0075364_103058662 | 166 |
| 509 | 3300006051 | Ga0075364_10455731 | Ga0075364_104557311 | 166 |
| 510 | 3300006163 | Ga0070715_10213412 | Ga0070715_102134122 | 166 |
| 511 | 3300006173 | Ga0070716_100330371 | Ga0070716_1003303711 | 166 |
| 512 | 3300006175 | Ga0070712_100105562 | Ga0070712_1001055621 | 166 |
| 513 | 3300006177 | Ga0075362_10017408 | Ga0075362_100174083 | 166 |
| 514 | 3300006177 | Ga0075362_10091355 | Ga0075362_100913553 | 166 |
| 515 | 3300006177 | Ga0075362_10187535 | Ga0075362_101875352 | 166 |
| 516 | 3300006178 | Ga0075367_10204281 | Ga0075367_102042811 | 166 |
| 517 | 3300006178 | Ga0075367_10421047 | Ga0075367_104210471 | 166 |
| 518 | 3300006186 | Ga0075369_10016235 | Ga0075369_100162352 | 166 |
| 519 | 3300006186 | Ga0075369_10034714 | Ga0075369_100347143 | 166 |
| 520 | 3300006186 | Ga0075369_10148024 | Ga0075369_101480242 | 166 |
| 521 | 3300006186 | Ga0075369_10157110 | Ga0075369_101571102 | 166 |
| 522 | 3300006195 | Ga0075366_10030691 | Ga0075366_100306913 | 166 |
| 523 | 3300006195 | Ga0075366_10137217 | Ga0075366_101372172 | 166 |
| 524 | 3300006237 | Ga0097621_100094411 | Ga0097621_1000944112 | 166 |
| 525 | 3300006353 | Ga0075370_10021423 | Ga0075370_100214235 | 166 |
| 526 | 3300006353 | Ga0075370_10131295 | Ga0075370_101312952 | 166 |
| 527 | 3300006353 | Ga0075370_10377985 | Ga0075370_103779851 | 166 |
| 528 | 3300006358 | Ga0068871_100564787 | Ga0068871_1005647872 | 166 |
| 529 | 3300006358 | Ga0068871_100945052 | Ga0068871_1009450522 | 166 |
| 530 | 3300006844 | Ga0075428_100125897 | Ga0075428_1001258972 | 166 |
| 531 | 3300006871 | Ga0075434_100315212 | Ga0075434_1003152122 | 166 |
| 532 | 3300006880 | Ga0075429_100459510 | Ga0075429_1004595102 | 166 |
| 533 | 3300006881 | Ga0068865_100129004 | Ga0068865_1001290042 | 166 |
| 534 | 3300006881 | Ga0068865_100587428 | Ga0068865_1005874281 | 166 |
| 535 | 3300006881 | Ga0068865_100647124 | Ga0068865_1006471241 | 166 |
| 536 | 3300006881 | Ga0068865_100807603 | Ga0068865_1008076032 | 166 |
| 537 | 3300006914 | Ga0075436_100637026 | Ga0075436_1006370261 | 166 |
| 538 | 3300006931 | Ga0097620_100200641 | Ga0097620_1002006411 | 166 |
| 539 | 3300006931 | Ga0097620_100201032 | Ga0097620_1002010322 | 166 |
| 540 | 3300006942 | Ga0099824_1006119 | Ga0099824_100611919 | 166 |
| 541 | 3300006943 | Ga0099822_1014043 | Ga0099822_10140439 | 166 |
| 542 | 3300007788 | Ga0099795_10006732 | Ga0099795_100067323 | 166 |
| 543 | 3300007788 | Ga0099795_10012369 | Ga0099795_100123693 | 166 |
| 544 | 3300009093 | Ga0105240_10113703 | Ga0105240_101137031 | 166 |
| 545 | 3300009098 | Ga0105245_10181113 | Ga0105245_101811132 | 166 |
| 546 | 3300009098 | Ga0105245_10337206 | Ga0105245_103372061 | 166 |
| 547 | 3300009101 | Ga0105247_10028777 | Ga0105247_100287771 | 166 |
| 548 | 3300009101 | Ga0105247_10078744 | Ga0105247_100787442 | 166 |
| 549 | 3300009101 | Ga0105247_10140941 | Ga0105247_101409411 | 166 |
| 550 | 3300009148 | Ga0105243_10539593 | Ga0105243_105395931 | 166 |
| 551 | 3300009148 | Ga0105243_10619255 | Ga0105243_106192552 | 166 |
| 552 | 3300009174 | Ga0105241_10125496 | Ga0105241_101254962 | 166 |
| 553 | 3300009176 | Ga0105242_10039799 | Ga0105242_100397993 | 166 |
| 554 | 3300009177 | Ga0105248_10023017 | Ga0105248_100230174 | 166 |
| 555 | 3300009177 | Ga0105248_10314212 | Ga0105248_103142122 | 166 |
| 556 | 3300009177 | Ga0105248_11020580 | Ga0105248_110205802 | 166 |
| 557 | 3300009545 | Ga0105237_10528926 | Ga0105237_105289261 | 166 |
| 558 | 3300009551 | Ga0105238_10087183 | Ga0105238_100871832 | 166 |
| 559 | 3300009551 | Ga0105238_10213127 | Ga0105238_102131272 | 166 |
| 560 | 3300009553 | Ga0105249_10416025 | Ga0105249_104160251 | 166 |
| 561 | 3300009553 | Ga0105249_11715565 | Ga0105249_117155652 | 166 |
| 562 | 3300010159 | Ga0099796_10219691 | Ga0099796_102196911 | 166 |
| 563 | 3300010375 | Ga0105239_10039840 | Ga0105239_100398404 | 166 |
| 564 | 3300010375 | Ga0105239_10060392 | Ga0105239_100603922 | 166 |
| 565 | 3300010375 | Ga0105239_10073624 | Ga0105239_100736243 | 166 |
| 566 | 3300010375 | Ga0105239_10146156 | Ga0105239_101461563 | 166 |
| 567 | 3300010375 | Ga0105239_10592338 | Ga0105239_105923382 | 166 |
| 568 | 3300011119 | Ga0105246_10004242 | Ga0105246_100042425 | 166 |
| 569 | 3300011119 | Ga0105246_10061626 | Ga0105246_100616262 | 166 |
| 570 | 3300011119 | Ga0105246_10425285 | Ga0105246_104252851 | 166 |
| 571 | 3300012483 | Ga0157337_1019336 | Ga0157337_10193361 | 166 |
| 572 | 3300013104 | Ga0157370_10055288 | Ga0157370_100552882 | 166 |
| 573 | 3300013105 | Ga0157369_11179679 | Ga0157369_111796792 | 166 |
| 574 | 3300013296 | Ga0157374_10110606 | Ga0157374_101106063 | 166 |
| 575 | 3300013297 | Ga0157378_10119537 | Ga0157378_101195373 | 166 |
| 576 | 3300013297 | Ga0157378_10177987 | Ga0157378_101779871 | 166 |
| 577 | 3300013297 | Ga0157378_10344116 | Ga0157378_103441162 | 166 |
| 578 | 3300013297 | Ga0157378_11639592 | Ga0157378_116395921 | 166 |
| 579 | 3300013306 | Ga0163162_10007574 | Ga0163162_100075745 | 166 |
| 580 | 3300013306 | Ga0163162_10315174 | Ga0163162_103151742 | 166 |
| 581 | 3300013306 | Ga0163162_11197798 | Ga0163162_111977981 | 166 |
| 582 | 3300013307 | Ga0157372_12623184 | Ga0157372_126231841 | 166 |
| 583 | 3300013308 | Ga0157375_10247981 | Ga0157375_102479812 | 166 |
| 584 | 3300013308 | Ga0157375_10272575 | Ga0157375_102725752 | 166 |
| 585 | 3300013308 | Ga0157375_10292148 | Ga0157375_102921482 | 166 |
| 586 | 3300013308 | Ga0157375_11010552 | Ga0157375_110105521 | 166 |
| 587 | 3300014325 | Ga0163163_10068804 | Ga0163163_100688043 | 166 |
| 588 | 3300014325 | Ga0163163_10088341 | Ga0163163_100883413 | 166 |
| 589 | 3300014325 | Ga0163163_10237236 | Ga0163163_102372362 | 166 |
| 590 | 3300014325 | Ga0163163_10322212 | Ga0163163_103222121 | 166 |
| 591 | 3300014325 | Ga0163163_10882382 | Ga0163163_108823821 | 166 |
| 592 | 3300014325 | Ga0163163_11046677 | Ga0163163_110466771 | 166 |
| 593 | 3300014326 | Ga0157380_10027065 | Ga0157380_100270653 | 166 |
| 594 | 3300014326 | Ga0157380_10332147 | Ga0157380_103321471 | 166 |
| 595 | 3300014326 | Ga0157380_11081999 | Ga0157380_110819991 | 166 |
| 596 | 3300014326 | Ga0157380_11411552 | Ga0157380_114115522 | 166 |
| 597 | 3300014745 | Ga0157377_10131013 | Ga0157377_101310131 | 166 |
| 598 | 3300014745 | Ga0157377_10735503 | Ga0157377_107355031 | 166 |
| 599 | 3300014745 | Ga0157377_10750139 | Ga0157377_107501391 | 166 |
| 600 | 3300014968 | Ga0157379_10192840 | Ga0157379_101928402 | 166 |
| 601 | 3300014969 | Ga0157376_10110109 | Ga0157376_101101091 | 166 |
| 602 | 3300014969 | Ga0157376_10147227 | Ga0157376_101472272 | 166 |
| 603 | 3300015262 | Ga0182007_10167031 | Ga0182007_101670311 | 166 |
| 604 | 3300017792 | Ga0163161_10573798 | Ga0163161_105737982 | 166 |
| 605 | 3300025261 | Ga0209233_1023807 | Ga0209233_10238072 | 166 |
| 606 | 3300025297 | Ga0209758_1006028 | Ga0209758_10060285 | 166 |
| 607 | 3300025297 | Ga0209758_1070185 | Ga0209758_10701852 | 166 |
| 608 | 3300025315 | Ga0207697_10013036 | Ga0207697_100130362 | 166 |
| 609 | 3300025899 | Ga0207642_10157253 | Ga0207642_101572531 | 166 |
| 610 | 3300025899 | Ga0207642_10409132 | Ga0207642_104091321 | 166 |
| 611 | 3300025900 | Ga0207710_10028750 | Ga0207710_100287501 | 166 |
| 612 | 3300025900 | Ga0207710_10070899 | Ga0207710_100708992 | 166 |
| 613 | 3300025900 | Ga0207710_10108829 | Ga0207710_101088292 | 166 |
| 614 | 3300025900 | Ga0207710_10112693 | Ga0207710_101126932 | 166 |
| 615 | 3300025901 | Ga0207688_10026527 | Ga0207688_100265272 | 166 |
| 616 | 3300025901 | Ga0207688_10046897 | Ga0207688_100468973 | 166 |
| 617 | 3300025901 | Ga0207688_10061701 | Ga0207688_100617012 | 166 |
| 618 | 3300025901 | Ga0207688_10263506 | Ga0207688_102635062 | 166 |
| 619 | 3300025903 | Ga0207680_10393967 | Ga0207680_103939672 | 166 |
| 620 | 3300025904 | Ga0207647_10100687 | Ga0207647_101006871 | 166 |
| 621 | 3300025907 | Ga0207645_10442535 | Ga0207645_104425351 | 166 |
| 622 | 3300025908 | Ga0207643_10186796 | Ga0207643_101867962 | 166 |
| 623 | 3300025909 | Ga0207705_10357472 | Ga0207705_103574722 | 166 |
| 624 | 3300025911 | Ga0207654_10096908 | Ga0207654_100969082 | 166 |
| 625 | 3300025911 | Ga0207654_10129163 | Ga0207654_101291632 | 166 |
| 626 | 3300025912 | Ga0207707_10084173 | Ga0207707_100841732 | 166 |
| 627 | 3300025913 | Ga0207695_10308117 | Ga0207695_103081172 | 166 |
| 628 | 3300025914 | Ga0207671_10163465 | Ga0207671_101634652 | 166 |
| 629 | 3300025914 | Ga0207671_11221270 | Ga0207671_112212701 | 166 |
| 630 | 3300025915 | Ga0207693_10037840 | Ga0207693_100378401 | 166 |
| 631 | 3300025917 | Ga0207660_10258781 | Ga0207660_102587811 | 166 |
| 632 | 3300025919 | Ga0207657_10092864 | Ga0207657_100928643 | 166 |
| 633 | 3300025920 | Ga0207649_10379231 | Ga0207649_103792311 | 166 |
| 634 | 3300025921 | Ga0207652_10097756 | Ga0207652_100977562 | 166 |
| 635 | 3300025923 | Ga0207681_10100674 | Ga0207681_101006741 | 166 |
| 636 | 3300025924 | Ga0207694_10112473 | Ga0207694_101124732 | 166 |
| 637 | 3300025925 | Ga0207650_10328321 | Ga0207650_103283212 | 166 |
| 638 | 3300025925 | Ga0207650_10473929 | Ga0207650_104739292 | 166 |
| 639 | 3300025925 | Ga0207650_10477105 | Ga0207650_104771051 | 166 |
| 640 | 3300025925 | Ga0207650_10777394 | Ga0207650_107773941 | 166 |
| 641 | 3300025926 | Ga0207659_10159889 | Ga0207659_101598892 | 166 |
| 642 | 3300025926 | Ga0207659_10223616 | Ga0207659_102236161 | 166 |
| 643 | 3300025926 | Ga0207659_10324128 | Ga0207659_103241281 | 166 |
| 644 | 3300025926 | Ga0207659_10569531 | Ga0207659_105695312 | 166 |
| 645 | 3300025927 | Ga0207687_10024543 | Ga0207687_100245432 | 166 |
| 646 | 3300025927 | Ga0207687_10871268 | Ga0207687_108712681 | 166 |
| 647 | 3300025931 | Ga0207644_10438468 | Ga0207644_104384683 | 166 |
| 648 | 3300025931 | Ga0207644_11229092 | Ga0207644_112290921 | 166 |
| 649 | 3300025933 | Ga0207706_10088312 | Ga0207706_100883123 | 166 |
| 650 | 3300025935 | Ga0207709_10413595 | Ga0207709_104135952 | 166 |
| 651 | 3300025935 | Ga0207709_10954767 | Ga0207709_109547671 | 166 |
| 652 | 3300025937 | Ga0207669_10300119 | Ga0207669_103001192 | 166 |
| 653 | 3300025938 | Ga0207704_10178562 | Ga0207704_101785622 | 166 |
| 654 | 3300025938 | Ga0207704_10646143 | Ga0207704_106461432 | 166 |
| 655 | 3300025939 | Ga0207665_10066823 | Ga0207665_100668231 | 166 |
| 656 | 3300025939 | Ga0207665_10203579 | Ga0207665_102035791 | 166 |
| 657 | 3300025940 | Ga0207691_10058603 | Ga0207691_100586033 | 166 |
| 658 | 3300025940 | Ga0207691_10313472 | Ga0207691_103134721 | 166 |
| 659 | 3300025941 | Ga0207711_10155096 | Ga0207711_101550962 | 166 |
| 660 | 3300025941 | Ga0207711_10217312 | Ga0207711_102173122 | 166 |
| 661 | 3300025942 | Ga0207689_10196723 | Ga0207689_101967232 | 166 |
| 662 | 3300025945 | Ga0207679_10103763 | Ga0207679_101037634 | 166 |
| 663 | 3300025949 | Ga0207667_10046583 | Ga0207667_100465833 | 166 |
| 664 | 3300025949 | Ga0207667_10391628 | Ga0207667_103916281 | 166 |
| 665 | 3300025949 | Ga0207667_10539508 | Ga0207667_105395081 | 166 |
| 666 | 3300025960 | Ga0207651_10292405 | Ga0207651_102924052 | 166 |
| 667 | 3300025960 | Ga0207651_10514015 | Ga0207651_105140152 | 166 |
| 668 | 3300025972 | Ga0207668_10186108 | Ga0207668_101861081 | 166 |
| 669 | 3300025972 | Ga0207668_10557764 | Ga0207668_105577642 | 166 |
| 670 | 3300025981 | Ga0207640_10011851 | Ga0207640_100118513 | 166 |
| 671 | 3300025981 | Ga0207640_10714416 | Ga0207640_107144161 | 166 |
| 672 | 3300026023 | Ga0207677_10028438 | Ga0207677_100284382 | 166 |
| 673 | 3300026023 | Ga0207677_10117463 | Ga0207677_101174632 | 166 |
| 674 | 3300026035 | Ga0207703_10034719 | Ga0207703_100347192 | 166 |
| 675 | 3300026035 | Ga0207703_10186095 | Ga0207703_101860951 | 166 |
| 676 | 3300026035 | Ga0207703_10409057 | Ga0207703_104090572 | 166 |
| 677 | 3300026035 | Ga0207703_10475113 | Ga0207703_104751131 | 166 |
| 678 | 3300026041 | Ga0207639_10078976 | Ga0207639_100789762 | 166 |
| 679 | 3300026041 | Ga0207639_10599694 | Ga0207639_105996942 | 166 |
| 680 | 3300026041 | Ga0207639_11129528 | Ga0207639_111295281 | 166 |
| 681 | 3300026067 | Ga0207678_10024550 | Ga0207678_100245504 | 166 |
| 682 | 3300026067 | Ga0207678_10093941 | Ga0207678_100939413 | 166 |
| 683 | 3300026067 | Ga0207678_10094956 | Ga0207678_100949563 | 166 |
| 684 | 3300026067 | Ga0207678_10199547 | Ga0207678_101995472 | 166 |
| 685 | 3300026067 | Ga0207678_10289318 | Ga0207678_102893182 | 166 |
| 686 | 3300026078 | Ga0207702_10003075 | Ga0207702_100030754 | 166 |
| 687 | 3300026078 | Ga0207702_10363622 | Ga0207702_103636222 | 166 |
| 688 | 3300026088 | Ga0207641_10380706 | Ga0207641_103807062 | 166 |
| 689 | 3300026088 | Ga0207641_10656443 | Ga0207641_106564432 | 166 |
| 690 | 3300026089 | Ga0207648_10111099 | Ga0207648_101110992 | 166 |
| 691 | 3300026089 | Ga0207648_10529890 | Ga0207648_105298901 | 166 |
| 692 | 3300026095 | Ga0207676_10338008 | Ga0207676_103380081 | 166 |
| 693 | 3300026116 | Ga0207674_10033510 | Ga0207674_100335105 | 166 |
| 694 | 3300026116 | Ga0207674_10400024 | Ga0207674_104000241 | 166 |
| 695 | 3300026118 | Ga0207675_100048585 | Ga0207675_1000485852 | 166 |
| 696 | 3300026121 | Ga0207683_10019513 | Ga0207683_100195138 | 166 |
| 697 | 3300026121 | Ga0207683_10051303 | Ga0207683_100513033 | 166 |
| 698 | 3300026121 | Ga0207683_10102080 | Ga0207683_101020802 | 166 |
| 699 | 3300026121 | Ga0207683_10198600 | Ga0207683_101986002 | 166 |
| 700 | 3300026121 | Ga0207683_10387816 | Ga0207683_103878161 | 166 |
| 701 | 3300026121 | Ga0207683_10692265 | Ga0207683_106922652 | 166 |
| 702 | 3300026121 | Ga0207683_10911092 | Ga0207683_109110921 | 166 |
| 703 | 3300026142 | Ga0207698_10174301 | Ga0207698_101743012 | 166 |
| 704 | 3300027357 | Ga0209589_1000021 | Ga0209589_100002135 | 166 |
| 705 | 3300027361 | Ga0209489_100028 | Ga0209489_10002835 | 166 |
| 706 | 3300027363 | Ga0209700_100037 | Ga0209700_10003735 | 166 |
| 707 | 3300027866 | Ga0209813_10090542 | Ga0209813_100905421 | 166 |
| 708 | 3300028379 | Ga0268266_10000680 | Ga0268266_100006804 | 166 |
| 709 | 3300028379 | Ga0268266_10002169 | Ga0268266_100021693 | 166 |
| 710 | 3300028379 | Ga0268266_10024779 | Ga0268266_100247798 | 166 |
| 711 | 3300028379 | Ga0268266_10096578 | Ga0268266_100965783 | 166 |
| 712 | 3300028379 | Ga0268266_10098886 | Ga0268266_100988862 | 166 |
| 713 | 3300028379 | Ga0268266_10133948 | Ga0268266_101339482 | 166 |
| 714 | 3300028379 | Ga0268266_10508727 | Ga0268266_105087271 | 166 |
| 715 | 3300028380 | Ga0268265_10028819 | Ga0268265_100288195 | 166 |
| 716 | 3300028380 | Ga0268265_10498026 | Ga0268265_104980261 | 166 |
| 717 | 3300028380 | Ga0268265_10727038 | Ga0268265_107270381 | 166 |
| 718 | 3300028381 | Ga0268264_10211583 | Ga0268264_102115831 | 166 |
| 719 | 3300028381 | Ga0268264_10360833 | Ga0268264_103608332 | 166 |
| 720 | 3300028381 | Ga0268264_11005879 | Ga0268264_110058792 | 166 |
| 721 | 3300028786 | Ga0307517_10000175 | Ga0307517_1000017526 | 166 |
| 722 | 3300028794 | Ga0307515_10093325 | Ga0307515_100933252 | 166 |
| 723 | 3300028794 | Ga0307515_10280782 | Ga0307515_102807821 | 166 |
| 724 | 3300031456 | Ga0307513_10057077 | Ga0307513_100570774 | 166 |
| 725 | 3300031456 | Ga0307513_10182197 | Ga0307513_101821972 | 166 |
| 726 | 3300031456 | Ga0307513_10371673 | Ga0307513_103716732 | 166 |
| 727 | 3300031507 | Ga0307509_10084646 | Ga0307509_100846462 | 166 |
| 728 | 3300031548 | Ga0307408_100505017 | Ga0307408_1005050172 | 166 |
| 729 | 3300031711 | Ga0265314_10003949 | Ga0265314_100039492 | 166 |
| 730 | 3300031730 | Ga0307516_10151857 | Ga0307516_101518572 | 166 |
| 731 | 3300031730 | Ga0307516_10192455 | Ga0307516_101924552 | 166 |
| 732 | 3300031730 | Ga0307516_10610540 | Ga0307516_106105401 | 166 |
| 733 | 3300031731 | Ga0307405_10241741 | Ga0307405_102417411 | 166 |
| 734 | 3300031901 | Ga0307406_10127422 | Ga0307406_101274222 | 166 |
| 735 | 3300031901 | Ga0307406_10150823 | Ga0307406_101508231 | 166 |
| 736 | 3300031911 | Ga0307412_10431601 | Ga0307412_104316012 | 166 |
| 737 | 3300031911 | Ga0307412_10998363 | Ga0307412_109983631 | 166 |
| 738 | 3300032002 | Ga0307416_100267044 | Ga0307416_1002670442 | 166 |
| 739 | 3300032002 | Ga0307416_100415049 | Ga0307416_1004150492 | 166 |
| 740 | 3300032002 | Ga0307416_102306814 | Ga0307416_1023068141 | 166 |
| 741 | 3300032004 | Ga0307414_10434577 | Ga0307414_104345771 | 166 |
| 742 | 3300032005 | Ga0307411_10065225 | Ga0307411_100652252 | 166 |
| 743 | 3300032126 | Ga0307415_100054255 | Ga0307415_1000542553 | 166 |
| 744 | 3300032126 | Ga0307415_100085248 | Ga0307415_1000852483 | 166 |
| 745 | 3300032126 | Ga0307415_100321899 | Ga0307415_1003218992 | 166 |
| 746 | 3300033180 | Ga0307510_10010287 | Ga0307510_100102874 | 166 |
| 747 | 3300035083 | Ga0373926_0132099 | Ga0373926_0132099_314_820 | 166 |
| 748 | 3300035112 | Ga0373932_0026257 | Ga0373932_0026257_153_653 | 166 |
| 749 | 3300035112 | Ga0373932_0116569 | Ga0373932_0116569_141_644 | 166 |
| 750 | 3300035115 | Ga0373941_0142888 | Ga0373941_0142888_205_708 | 166 |
| 751 | 3300035116 | Ga0373945_0204677 | Ga0373945_0204677_235_741 | 166 |
| 752 | 3300035172 | Ga0373955_0225677 | Ga0373955_0225677_169_672 | 166 |
| 753 | 3300035691 | Ga0373931_0003001 | Ga0373931_0003001_3894_4397 | 166 |
| 754 | 3300035695 | Ga0373927_0153238 | Ga0373927_0153238_187_690 | 166 |
| 755 | 3300035725 | Ga0373947_0213774 | Ga0373947_0213774_724_1233 | 166 |
| 756 | 3300036401 | Ga0373937_0428902 | Ga0373937_0428902_485_988 | 166 |
| 757 | 3300037068 | Ga0373925_0174161 | Ga0373925_0174161_1169_1678 | 166 |
| 758 | 3300037068 | Ga0373925_0328147 | Ga0373925_0328147_75_578 | 166 |
| 759 | 3300037068 | Ga0373925_0636194 | Ga0373925_0636194_46_555 | 166 |
| 760 | 3300037471 | Ga0395905_0499162 | Ga0395905_0499162_127_633 | 166 |
| 761 | 3300038443 | Ga0395901_0380417 | Ga0395901_0380417_73_576 | 166 |
| 762 | 3300041460 | Ga0451802_0623261 | Ga0451802_0623261_66_572 | 166 |
| 763 | 3300041486 | Ga0451807_1001866 | Ga0451807_1001866_92_592 | 166 |
| 764 | 3300041486 | Ga0451807_1667569 | Ga0451807_1667569_101_604 | 166 |
| 765 | 3300041486 | Ga0451807_1946340 | Ga0451807_1946340_557_1063 | 166 |
| 766 | 3300041491 | Ga0451833_0048398 | Ga0451833_0048398_47_550 | 166 |
| 767 | 3300041492 | Ga0451835_1012982 | Ga0451835_1012982_164_667 | 166 |
| 768 | 3300046452 | Ga0495617_051254 | Ga0495617_051254_745_1251 | 166 |
| 769 | 3300046455 | Ga0495603_0010419 | Ga0495603_0010419_2994_3494 | 166 |
| 770 | 3300046455 | Ga0495603_0016067 | Ga0495603_0016067_1540_2046 | 166 |
| 771 | 3300046455 | Ga0495603_0056389 | Ga0495603_0056389_1552_2058 | 166 |
| 772 | 3300046455 | Ga0495603_0173014 | Ga0495603_0173014_17_523 | 166 |
| 773 | 3300046457 | Ga0495590_0336458 | Ga0495590_0336458_37_543 | 166 |
| 774 | 3300046459 | Ga0495629_0077987 | Ga0495629_0077987_539_1045 | 166 |
| 775 | 3300046460 | Ga0495638_0094374 | Ga0495638_0094374_995_1501 | 166 |
| 776 | 3300046460 | Ga0495638_0156987 | Ga0495638_0156987_434_940 | 166 |
| 777 | 3300046462 | Ga0495651_0780390 | Ga0495651_0780390_26_559 | 166 |
| 778 | 3300046471 | Ga0495650_0099227 | Ga0495650_0099227_431_937 | 166 |
| 779 | 3300046475 | Ga0495639_0062306 | Ga0495639_0062306_14_514 | 166 |
| 780 | 3300046492 | Ga0495585_0131359 | Ga0495585_0131359_149_655 | 166 |
| 781 | 3300046499 | Ga0495594_0129264 | Ga0495594_0129264_59_565 | 166 |
| 782 | 3300046500 | Ga0495596_0063536 | Ga0495596_0063536_586_1092 | 166 |
| 783 | 3300046507 | Ga0495606_0132216 | Ga0495606_0132216_551_1057 | 166 |
| 784 | 3300046507 | Ga0495606_0204613 | Ga0495606_0204613_538_1041 | 166 |
| 785 | 3300046512 | Ga0495610_0028391 | Ga0495610_0028391_1802_2308 | 166 |
| 786 | 3300046512 | Ga0495610_0159647 | Ga0495610_0159647_109_615 | 166 |
| 787 | 3300046513 | Ga0495616_0328317 | Ga0495616_0328317_27_530 | 166 |
| 788 | 3300046515 | Ga0495620_0186358 | Ga0495620_0186358_116_622 | 166 |
| 789 | 3300046518 | Ga0495631_0090236 | Ga0495631_0090236_782_1288 | 166 |
| 790 | 3300046523 | Ga0495644_0069318 | Ga0495644_0069318_70_576 | 166 |
| 791 | 3300046523 | Ga0495644_0147410 | Ga0495644_0147410_223_729 | 166 |
| 792 | 3300046524 | Ga0495648_0320809 | Ga0495648_0320809_55_561 | 166 |
| 793 | 3300046530 | Ga0495654_0165764 | Ga0495654_0165764_357_863 | 166 |
| 794 | 3300046536 | Ga0495587_0283480 | Ga0495587_0283480_240_830 | 166 |
| 795 | 3300046538 | Ga0495609_0043250 | Ga0495609_0043250_277_783 | 166 |
| 796 | 3300046538 | Ga0495609_0050883 | Ga0495609_0050883_528_1028 | 166 |
| 797 | 3300046538 | Ga0495609_0161223 | Ga0495609_0161223_424_930 | 166 |
| 798 | 3300046539 | Ga0495621_0010649 | Ga0495621_0010649_612_1121 | 166 |
| 799 | 3300046557 | Ga0495622_0044765 | Ga0495622_0044765_533_1039 | 166 |
| 800 | 3300046557 | Ga0495622_0297899 | Ga0495622_0297899_103_603 | 166 |
| 801 | 3300046615 | Ga0495656_0003421 | Ga0495656_0003421_151_657 | 166 |
| 802 | 3300046615 | Ga0495656_0028898 | Ga0495656_0028898_591_1094 | 166 |
| 803 | 3300046615 | Ga0495656_0030100 | Ga0495656_0030100_1092_1598 | 166 |
| 804 | 3300046616 | Ga0495668_0125789 | Ga0495668_0125789_216_716 | 166 |
| 805 | 3300046616 | Ga0495668_0166092 | Ga0495668_0166092_629_1135 | 166 |
| 806 | 3300046616 | Ga0495668_0208085 | Ga0495668_0208085_208_714 | 166 |
| 807 | 3300046616 | Ga0495668_0630773 | Ga0495668_0630773_51_557 | 166 |
| 808 | 3300046660 | Ga0495625_0067931 | Ga0495625_0067931_493_1026 | 166 |
| 809 | 3300046660 | Ga0495625_0273687 | Ga0495625_0273687_530_1030 | 166 |
| 810 | 3300046660 | Ga0495625_0295610 | Ga0495625_0295610_41_544 | 166 |
| 811 | 3300046660 | Ga0495625_0373557 | Ga0495625_0373557_100_606 | 166 |
| 812 | 3300046660 | Ga0495625_0465578 | Ga0495625_0465578_28_534 | 166 |
| 813 | 3300046664 | Ga0495659_0033870 | Ga0495659_0033870_829_1335 | 166 |
| 814 | 3300046674 | Ga0495588_0281158 | Ga0495588_0281158_317_820 | 166 |
| 815 | 3300046681 | Ga0495647_0402293 | Ga0495647_0402293_84_590 | 166 |
| 816 | 3300046684 | Ga0495669_0064842 | Ga0495669_0064842_139_645 | 166 |
| 817 | 3300046684 | Ga0495669_0083825 | Ga0495669_0083825_264_764 | 166 |
| 818 | 3300046690 | Ga0495624_0123097 | Ga0495624_0123097_148_648 | 166 |
| 819 | 3300046691 | Ga0495670_0096732 | Ga0495670_0096732_842_1348 | 166 |
| 820 | 3300046692 | Ga0495671_0115441 | Ga0495671_0115441_558_1064 | 166 |
| 821 | 3300046692 | Ga0495671_0170410 | Ga0495671_0170410_57_563 | 166 |
| 822 | 3300046694 | Ga0495649_0186263 | Ga0495649_0186263_110_616 | 166 |
| 823 | 3300046694 | Ga0495649_0394862 | Ga0495649_0394862_98_598 | 166 |
| 824 | 3300046794 | Ga0495589_0095626 | Ga0495589_0095626_566_1072 | 166 |
| 825 | 3300046794 | Ga0495589_0142352 | Ga0495589_0142352_366_866 | 166 |
| 826 | 3300046794 | Ga0495589_0169547 | Ga0495589_0169547_322_822 | 166 |
| 827 | 3300046809 | Ga0495600_0143564 | Ga0495600_0143564_377_910 | 166 |
| 828 | 3300047315 | Ga0495581_0202275 | Ga0495581_0202275_345_854 | 166 |
| 829 | 3300047317 | Ga0495604_0214928 | Ga0495604_0214928_247_753 | 166 |
| 830 | 3300047318 | Ga0495636_0030621 | Ga0495636_0030621_538_1044 | 166 |
| 831 | 3300047320 | Ga0495672_0339280 | Ga0495672_0339280_164_670 | 166 |
| 832 | 3300047321 | Ga0495676_0062458 | Ga0495676_0062458_1335_1844 | 166 |
| 833 | 3300047323 | Ga0495683_0047765 | Ga0495683_0047765_1624_2130 | 166 |
| 834 | 3300047323 | Ga0495683_0128105 | Ga0495683_0128105_128_634 | 166 |
| 835 | 3300047447 | Ga0495685_114679 | Ga0495685_114679_261_767 | 166 |
| 836 | 3300047472 | Ga0495686_0490492 | Ga0495686_0490492_94_600 | 166 |
| 837 | 3300048091 | Ga0495626_0176548 | Ga0495626_0176548_74_580 | 166 |
| 838 | 3300048903 | Ga0496100_0048756 | Ga0496100_0048756_2042_2545 | 166 |
| 839 | 3300048903 | Ga0496100_0081491 | Ga0496100_0081491_1584_2087 | 166 |
| 840 | 3300048904 | Ga0496101_0008281 | Ga0496101_0008281_2119_2622 | 166 |
| 841 | 3300048904 | Ga0496101_0044430 | Ga0496101_0044430_1710_2213 | 166 |
| 842 | 3300048904 | Ga0496101_0319134 | Ga0496101_0319134_312_818 | 166 |
| 843 | 3300048905 | Ga0496102_0001453 | Ga0496102_0001453_3823_4326 | 166 |
| 844 | 3300048905 | Ga0496102_0043946 | Ga0496102_0043946_1978_2481 | 166 |
| 845 | 3300048905 | Ga0496102_1324930 | Ga0496102_1324930_85_591 | 166 |
| 846 | 3300048906 | Ga0496103_0010530 | Ga0496103_0010530_2931_3434 | 166 |
| 847 | 3300048906 | Ga0496103_0056754 | Ga0496103_0056754_1778_2281 | 166 |
| 848 | 3300048906 | Ga0496103_0674250 | Ga0496103_0674250_12_518 | 166 |
| 849 | 3300048907 | Ga0496104_0027853 | Ga0496104_0027853_4373_4876 | 166 |
| 850 | 3300048907 | Ga0496104_0271160 | Ga0496104_0271160_772_1275 | 166 |
| 851 | 3300048907 | Ga0496104_0618479 | Ga0496104_0618479_44_550 | 166 |
| 852 | 3300048908 | Ga0496105_0005368 | Ga0496105_0005368_5075_5578 | 166 |
| 853 | 3300048908 | Ga0496105_0197778 | Ga0496105_0197778_871_1374 | 166 |
| 854 | 3300048908 | Ga0496105_0864316 | Ga0496105_0864316_25_531 | 166 |
| 855 | 3300048909 | Ga0496106_0003462 | Ga0496106_0003462_10002_10505 | 166 |
| 856 | 3300048909 | Ga0496106_0007634 | Ga0496106_0007634_4830_5339 | 166 |
| 857 | 3300048909 | Ga0496106_0076324 | Ga0496106_0076324_148_651 | 166 |
| 858 | 3300048909 | Ga0496106_0199556 | Ga0496106_0199556_364_870 | 166 |
| 859 | 3300048909 | Ga0496106_0478127 | Ga0496106_0478127_395_901 | 166 |
| 860 | 3300048910 | Ga0496107_0008406 | Ga0496107_0008406_3746_4255 | 166 |
| 861 | 3300048910 | Ga0496107_0019887 | Ga0496107_0019887_2453_2956 | 166 |
| 862 | 3300048910 | Ga0496107_0029236 | Ga0496107_0029236_2234_2737 | 166 |
| 863 | 3300048910 | Ga0496107_0171756 | Ga0496107_0171756_888_1394 | 166 |
| 864 | 3300048910 | Ga0496107_0352387 | Ga0496107_0352387_530_1036 | 166 |
| 865 | 3300048911 | Ga0496108_0034768 | Ga0496108_0034768_335_838 | 166 |
| 866 | 3300048911 | Ga0496108_0104749 | Ga0496108_0104749_180_683 | 166 |
| 867 | 3300048912 | Ga0496109_0090477 | Ga0496109_0090477_169_678 | 166 |
| 868 | 3300048912 | Ga0496109_0652160 | Ga0496109_0652160_143_646 | 166 |
| 869 | 3300048913 | Ga0496110_0009850 | Ga0496110_0009850_2343_2846 | 166 |
| 870 | 3300048913 | Ga0496110_0015996 | Ga0496110_0015996_4152_4655 | 166 |
| 871 | 3300048914 | Ga0496111_0024623 | Ga0496111_0024623_2177_2680 | 166 |
| 872 | 3300048914 | Ga0496111_0039977 | Ga0496111_0039977_2136_2639 | 166 |
| 873 | 3300048914 | Ga0496111_0231979 | Ga0496111_0231979_342_845 | 166 |
| 874 | 3300048915 | Ga0496112_0042992 | Ga0496112_0042992_2738_3241 | 166 |
| 875 | 3300048915 | Ga0496112_0078349 | Ga0496112_0078349_1431_1940 | 166 |
| 876 | 3300048916 | Ga0496113_0023859 | Ga0496113_0023859_860_1369 | 166 |
| 877 | 3300048916 | Ga0496113_0032245 | Ga0496113_0032245_3149_3652 | 166 |
| 878 | 3300048916 | Ga0496113_0047640 | Ga0496113_0047640_196_702 | 166 |
| 879 | 3300048916 | Ga0496113_0174611 | Ga0496113_0174611_1000_1503 | 166 |
| 880 | 3300048916 | Ga0496113_0548004 | Ga0496113_0548004_14_517 | 166 |
| 881 | 3300048917 | Ga0496114_0022794 | Ga0496114_0022794_356_859 | 166 |
| 882 | 3300048918 | Ga0496115_0004695 | Ga0496115_0004695_3582_4085 | 166 |
| 883 | 3300048918 | Ga0496115_0027446 | Ga0496115_0027446_3093_3596 | 166 |
| 884 | 3300048920 | Ga0496117_0228952 | Ga0496117_0228952_273_779 | 166 |
| 885 | 3300048921 | Ga0496118_0216458 | Ga0496118_0216458_264_770 | 166 |
| 886 | 3300048924 | Ga0496121_0063692 | Ga0496121_0063692_886_1392 | 166 |
| 887 | 3300048924 | Ga0496121_0070730 | Ga0496121_0070730_578_1084 | 166 |
| 888 | 3300048924 | Ga0496121_0311718 | Ga0496121_0311718_116_622 | 166 |
| 889 | 3300048927 | Ga0496124_0180542 | Ga0496124_0180542_297_803 | 166 |
| 890 | 3300048927 | Ga0496124_0305447 | Ga0496124_0305447_70_576 | 166 |
| 891 | 3300048928 | Ga0496125_0208382 | Ga0496125_0208382_76_582 | 166 |
| 892 | 3300048928 | Ga0496125_0354947 | Ga0496125_0354947_357_863 | 166 |
| 893 | 3300048929 | Ga0496126_0011555 | Ga0496126_0011555_238_741 | 166 |
| 894 | 3300048929 | Ga0496126_0014534 | Ga0496126_0014534_5563_6069 | 166 |
| 895 | 3300048929 | Ga0496126_0062393 | Ga0496126_0062393_606_1112 | 166 |
| 896 | 3300048929 | Ga0496126_0145240 | Ga0496126_0145240_526_1167 | 166 |
| 897 | 3300048929 | Ga0496126_0283596 | Ga0496126_0283596_612_1118 | 166 |
| 898 | 3300048929 | Ga0496126_0480060 | Ga0496126_0480060_49_555 | 166 |
| 899 | 3300049578 | Ga0501042_0346240 | Ga0501042_0346240_546_1052 | 166 |
| 900 | 3300049583 | Ga0501067_0035210 | Ga0501067_0035210_306_806 | 166 |
| 901 | 3300049583 | Ga0501067_0044688 | Ga0501067_0044688_1923_2429 | 166 |
| 902 | 3300049584 | Ga0501068_0273486 | Ga0501068_0273486_292_798 | 166 |
| 903 | 3300049585 | Ga0501069_0203031 | Ga0501069_0203031_487_993 | 166 |
| 904 | 3300049587 | Ga0501071_0187713 | Ga0501071_0187713_578_1084 | 166 |
| 905 | 3300049591 | Ga0501075_0611963 | Ga0501075_0611963_295_801 | 166 |
| 906 | 3300049592 | Ga0501076_0098020 | Ga0501076_0098020_630_1130 | 166 |
| 907 | 3300050489 | nmdc:mga03683_19812_c1 | nmdc:mga03683_19812_c1_130_636 | 166 |
| 908 | 3300050489 | nmdc:mga03683_279409_c1 | nmdc:mga03683_279409_c1_251_757 | 166 |
| 909 | 3300050489 | nmdc:mga03683_402934_c1 | nmdc:mga03683_402934_c1_78_581 | 166 |
| 910 | 3300050490 | nmdc:mga03n38_164796_c1 | nmdc:mga03n38_164796_c1_574_1080 | 166 |
| 911 | 3300050490 | nmdc:mga03n38_287851_c1 | nmdc:mga03n38_287851_c1_297_803 | 166 |
| 912 | 3300050490 | nmdc:mga03n38_298337_c1 | nmdc:mga03n38_298337_c1_36_542 | 166 |
| 913 | 3300050491 | nmdc:mga00v17_211293_c1 | nmdc:mga00v17_211293_c1_399_905 | 166 |
| 914 | 3300050491 | nmdc:mga00v17_87918_c1 | nmdc:mga00v17_87918_c1_1345_1851 | 166 |
| 915 | 3300050492 | nmdc:mga0yw44_103713_c1 | nmdc:mga0yw44_103713_c1_622_1128 | 166 |
| 916 | 3300050492 | nmdc:mga0yw44_189590_c1 | nmdc:mga0yw44_189590_c1_840_1346 | 166 |
| 917 | 3300050492 | nmdc:mga0yw44_265923_c1 | nmdc:mga0yw44_265923_c1_297_803 | 166 |
| 918 | 3300050492 | nmdc:mga0yw44_30731_c1 | nmdc:mga0yw44_30731_c1_196_702 | 166 |
| 919 | 3300050492 | nmdc:mga0yw44_3728_c1 | nmdc:mga0yw44_3728_c1_5088_5594 | 166 |
| 920 | 3300050493 | nmdc:mga0k408_11114_c1 | nmdc:mga0k408_11114_c1_1072_1578 | 166 |
| 921 | 3300050493 | nmdc:mga0k408_332175_c1 | nmdc:mga0k408_332175_c1_378_884 | 166 |
| 922 | 3300050493 | nmdc:mga0k408_46281_c1 | nmdc:mga0k408_46281_c1_756_1262 | 166 |
| 923 | 3300050494 | nmdc:mga06z11_31889_c1 | nmdc:mga06z11_31889_c1_762_1268 | 166 |
| 924 | 3300050494 | nmdc:mga06z11_386642_c1 | nmdc:mga06z11_386642_c1_185_691 | 166 |
| 925 | 3300050494 | nmdc:mga06z11_494596_c1 | nmdc:mga06z11_494596_c1_77_583 | 166 |
| 926 | 3300050495 | nmdc:mga04h51_414475_c1 | nmdc:mga04h51_414475_c1_24_530 | 166 |
| 927 | 3300050495 | nmdc:mga04h51_97303_c1 | nmdc:mga04h51_97303_c1_252_758 | 166 |
| 928 | 3300050496 | nmdc:mga07m45_148798_c1 | nmdc:mga07m45_148798_c1_784_1290 | 166 |
| 929 | 3300050496 | nmdc:mga07m45_43287_c1 | nmdc:mga07m45_43287_c1_1482_1988 | 166 |
| 930 | 3300050496 | nmdc:mga07m45_9877_c1 | nmdc:mga07m45_9877_c1_4142_4648 | 166 |
| 931 | 3300050507 | nmdc:mga05p37_573050_c1 | nmdc:mga05p37_573050_c1_268_774 | 166 |
| 932 | 3300050508 | nmdc:mga09592_688562_c1 | nmdc:mga09592_688562_c1_318_824 | 166 |
| 933 | 3300050511 | nmdc:mga08y16_170224_c1 | nmdc:mga08y16_170224_c1_49_555 | 166 |
| 934 | 3300050512 | nmdc:mga0n895_187543_c1 | nmdc:mga0n895_187543_c1_850_1350 | 166 |
| 935 | 3300050513 | nmdc:mga0rr50_512824_c1 | nmdc:mga0rr50_512824_c1_503_1009 | 166 |
| 936 | 3300050513 | nmdc:mga0rr50_669647_c1 | nmdc:mga0rr50_669647_c1_227_727 | 166 |
| 937 | 3300050515 | nmdc:mga0a205_229797_c1 | nmdc:mga0a205_229797_c1_583_1089 | 166 |
| 938 | 3300050516 | nmdc:mga0sz30_37500_c1 | nmdc:mga0sz30_37500_c1_227_733 | 166 |
| 939 | 3300053086 | Ga0500578_0453093 | Ga0500578_0453093_47_553 | 166 |
| 940 | 3300053090 | Ga0500646_0110726 | Ga0500646_0110726_26_532 | 166 |
| 941 | 3300053093 | Ga0500651_0084520 | Ga0500651_0084520_735_1241 | 166 |
| 942 | 3300053096 | Ga0500641_0006112 | Ga0500641_0006112_989_1495 | 166 |
| 943 | 3300053108 | Ga0500562_083418 | Ga0500562_083418_299_805 | 166 |
| 944 | 3300053114 | Ga0500582_160514 | Ga0500582_160514_207_713 | 166 |
| 945 | 3300053119 | Ga0500595_000506 | Ga0500595_000506_819_1328 | 166 |
| 946 | 3300053119 | Ga0500595_000631 | Ga0500595_000631_10631_11137 | 166 |
| 947 | 3300053133 | Ga0500655_090724 | Ga0500655_090724_84_590 | 166 |
| 948 | 3300053134 | Ga0500658_0072400 | Ga0500658_0072400_237_743 | 166 |
| 949 | 3300053137 | Ga0500561_0044808 | Ga0500561_0044808_208_714 | 166 |
| 950 | 3300053142 | Ga0500577_0189174 | Ga0500577_0189174_321_827 | 166 |
| 951 | 3300053147 | Ga0500589_055504 | Ga0500589_055504_478_984 | 166 |
| 952 | 3300053158 | Ga0500627_0155115 | Ga0500627_0155115_191_697 | 166 |
| 953 | 3300053162 | Ga0500638_002747 | Ga0500638_002747_1479_1988 | 166 |
| 954 | 3300053162 | Ga0500638_070154 | Ga0500638_070154_414_917 | 166 |
| 955 | 3300053178 | Ga0500637_0000350 | Ga0500637_0000350_3911_4420 | 166 |
| 956 | 3300053178 | Ga0500637_0128472 | Ga0500637_0128472_96_602 | 166 |
| 957 | 3300053727 | Ga0500611_108289 | Ga0500611_108289_86_592 | 166 |
| 958 | 3300053730 | Ga0500645_022804 | Ga0500645_022804_317_823 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zx1-assembly1.cif.gz_A | crystal structure of ent domain from t. brucei | 0.6784 | 98 | 160 |
| 2h5n-assembly1.cif.gz_B | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.5596 | 22 | 147 |
| 2h5n-assembly1.cif.gz_B | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.5434 | 22 | 147 |
| 5zx1-assembly1.cif.gz_A | crystal structure of ent domain from t. brucei | 0.519 | 98 | 160 |
| 2ou3-assembly1.cif.gz_B | crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution | 0.5122 | 4 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9M2M2_56_121_1.10.1240.40 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain | 0.84 | 98 | 147 | 1.10.1240.40 |
| af_I1JUF7_325_389_1.10.1240.40 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain | 0.7981 | 90 | 151 | 1.10.1240.40 |
| af_Q9M2Q2_35_103_1.10.3680.10 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.7674 | 101 | 160 | 1.10.3680.10 |
| af_I1JUF7_325_389_1.10.1240.40 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain | 0.7017 | 90 | 151 | 1.10.1240.40 |
| af_A0A0P0W487_245_310_1.10.1240.40 | Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain | 0.7008 | 80 | 150 | 1.10.1240.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q2S7K9-F1-model_v4 | Uncharacterized protein conserved in bacteria | 0.8194 | 1 | 150 |
|
| AF-X5MEQ8-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.811 | 1 | 152 |
|
| AF-Q2S7K9-F1-model_v4 | Uncharacterized protein conserved in bacteria | 0.8095 | 1 | 150 |
|
| AF-X5MEQ8-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.8016 | 1 | 152 |
|
| AF-A0A6B1GQA6-F1-model_v4 | TerB family tellurite resistance protein | 0.7878 | 2 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar