F486799

General Info

Members Datasets Scaffolds Average Seq Length
958 438 932 166

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0024673|Ga0373954_0024673_772_1365
Length 197
Sequence MSMRNRRGLRAWSFPPYIDGGRRCSGDAITRFRQEMMLDGLRQFIADVISPAAQEHRTFDDAGYRLAATALLVHVISLDGEPSEAERRKLHGLIESRFGLDPGTADQLIASATLIEGEAVDLYHFTSVIMRSVDEEGRLRIVEMMWELVYADGQVSEFEDNVVWRAADLLGVSSRDRIDLKHNVAARPPVPVVGTTG

Samples

Sample ID Description Type Environment
1 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
2 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
3 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
4 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
5 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
6 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
7 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
8 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
9 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
10 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
11 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
12 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
13 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
14 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
15 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
16 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
17 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
18 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
19 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
20 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
21 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
22 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
23 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
24 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
25 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
118 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
220 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
221 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
228 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
233 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
234 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
283 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
426 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
430 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
431 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
432 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
433 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.1
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.44
Nodule 2.3
Rhizoplane 6.68
Rhizosphere 74.01
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012434 3300003203 Bacteria 3693
2 JGI25165J46597_1014365 3300003214 Bacteria 1078
3 rootL2_10045963 3300003322 Bacteria 1730
4 rootL2_10096256 3300003322 Bacteria 1282
5 rootL2_10110173 3300003322 Bacteria 2825
6 JGI25404J52841_10003473 3300003659 Bacteria 3120
7 JGI25404J52841_10014495 3300003659 Bacteria 1712
8 JGI25404J52841_10017249 3300003659 Bacteria 1566
9 JGI25404J52841_10029009 3300003659 Bacteria 1187
10 JGI25405J52794_10029568 3300003911 Bacteria 1134
11 JGI25405J52794_10038265 3300003911 Bacteria 1010
12 Ga0070658_10014893 3300005327 Bacteria 6229
13 Ga0070658_10161129 3300005327 Bacteria 1882
14 Ga0070658_10207026 3300005327 Bacteria 1656
15 Ga0070676_10269668 3300005328 Bacteria 1143
16 Ga0070683_100023757 3300005329 Bacteria 5486
17 Ga0070683_100026678 3300005329 Bacteria 5205
18 Ga0068869_100153340 3300005334 Bacteria 1788
19 Ga0068869_100272752 3300005334 Bacteria 1358
20 Ga0068869_101690795 3300005334 Bacteria 565
21 Ga0070680_100081500 3300005336 Bacteria 2670
22 Ga0068868_100034114 3300005338 Bacteria 3927
23 Ga0070660_100002091 3300005339 Bacteria 13777
24 Ga0070660_100207546 3300005339 Bacteria 1590
25 Ga0070689_100446774 3300005340 Bacteria 1099
26 Ga0070689_101212350 3300005340 Bacteria 678
27 Ga0070687_100789260 3300005343 Bacteria 672
28 Ga0070687_101264114 3300005343 Bacteria 547
29 Ga0070661_100380440 3300005344 Bacteria 1113
30 Ga0070668_100038776 3300005347 Bacteria 3643
31 Ga0070668_100052404 3300005347 Bacteria 3145
32 Ga0070668_100052629 3300005347 Bacteria 3138
33 Ga0070668_100065717 3300005347 Bacteria 2813
34 Ga0070668_100081584 3300005347 Bacteria 2536
35 Ga0070668_100093078 3300005347 Bacteria 2378
36 Ga0070669_100112510 3300005353 Bacteria 2067
37 Ga0070675_100166479 3300005354 Bacteria 1899
38 Ga0070675_100214135 3300005354 Bacteria 1676
39 Ga0070675_100246901 3300005354 Bacteria 1561
40 Ga0070675_100524883 3300005354 Bacteria 1069
41 Ga0070671_100139781 3300005355 Bacteria 2043
42 Ga0070671_100615204 3300005355 Bacteria 939
43 Ga0070674_100427848 3300005356 Bacteria 1088
44 Ga0070674_100461309 3300005356 Bacteria 1051
45 Ga0070674_100548676 3300005356 Bacteria 969
46 Ga0070674_100781989 3300005356 Bacteria 823
47 Ga0070673_100197544 3300005364 Bacteria 1731
48 Ga0070673_100284219 3300005364 Bacteria 1452
49 Ga0070673_101336580 3300005364 Bacteria 674
50 Ga0070688_100183024 3300005365 Bacteria 1455
51 Ga0070688_100574830 3300005365 Bacteria 859
52 Ga0070659_100100796 3300005366 Bacteria 2324
53 Ga0070659_100379757 3300005366 Bacteria 1190
54 Ga0070667_100057192 3300005367 Bacteria 3296
55 Ga0070667_100599446 3300005367 Bacteria 1015
56 Ga0070709_10003366 3300005434 Bacteria 8596
57 Ga0070709_10992061 3300005434 Bacteria 668
58 Ga0070714_100003204 3300005435 Bacteria 12177
59 Ga0070714_100077968 3300005435 Bacteria 2879
60 Ga0070714_100105094 3300005435 Bacteria 2492
61 Ga0070713_100055042 3300005436 Bacteria 3304
62 Ga0070713_100289224 3300005436 Bacteria 1505
63 Ga0070710_10003286 3300005437 Bacteria 7665
64 Ga0070710_10030798 3300005437 Bacteria 2889
65 Ga0070710_10237258 3300005437 Bacteria 1167
66 Ga0070701_10087544 3300005438 Bacteria 1699
67 Ga0070711_100000745 3300005439 Bacteria 16987
68 Ga0070711_100014756 3300005439 Bacteria 4931
69 Ga0070711_100015345 3300005439 Bacteria 4848
70 Ga0070711_100342468 3300005439 Bacteria 1200
71 Ga0070700_100150599 3300005441 Bacteria 1591
72 Ga0070700_100711335 3300005441 Bacteria 800
73 Ga0070700_100822968 3300005441 Bacteria 750
74 Ga0070708_100263882 3300005445 Bacteria 1619
75 Ga0070663_100011469 3300005455 Bacteria 5566
76 Ga0070663_100022407 3300005455 Bacteria 4223
77 Ga0070663_100082416 3300005455 Bacteria 2366
78 Ga0070663_100204768 3300005455 Bacteria 1542
79 Ga0070663_100858687 3300005455 Bacteria 782
80 Ga0070678_100011085 3300005456 Bacteria 5542
81 Ga0070678_100048833 3300005456 Bacteria 3050
82 Ga0070678_100064850 3300005456 Bacteria 2709
83 Ga0070678_100152067 3300005456 Bacteria 1865
84 Ga0070678_100159924 3300005456 Bacteria 1823
85 Ga0070678_100185861 3300005456 Bacteria 1705
86 Ga0070662_100097724 3300005457 Bacteria 2216
87 Ga0070681_10041643 3300005458 Bacteria 4603
88 Ga0070681_10233050 3300005458 Bacteria 1755
89 Ga0068867_100049258 3300005459 Bacteria 3101
90 Ga0068867_100393149 3300005459 Bacteria 1168
91 Ga0068867_100407017 3300005459 Bacteria 1149
92 Ga0068867_100603275 3300005459 Bacteria 958
93 Ga0070685_10132615 3300005466 Bacteria 1560
94 Ga0070685_10296082 3300005466 Bacteria 1089
95 Ga0070706_100072375 3300005467 Bacteria 3190
96 Ga0070706_100493931 3300005467 Bacteria 1139
97 Ga0070706_100585893 3300005467 Bacteria 1037
98 Ga0070706_101528771 3300005467 Bacteria 610
99 Ga0070707_100560281 3300005468 Bacteria 1105
100 Ga0070698_100084471 3300005471 Bacteria 3163
101 Ga0070698_100904999 3300005471 Bacteria 828
102 Ga0070698_101814548 3300005471 Bacteria 563
103 Ga0070699_100506767 3300005518 Bacteria 1097
104 Ga0070679_100028386 3300005530 Bacteria 5516
105 Ga0070679_100038806 3300005530 Bacteria 4735
106 Ga0070679_100080723 3300005530 Bacteria 3242
107 Ga0070684_100004519 3300005535 Bacteria 10592
108 Ga0070684_100016992 3300005535 Bacteria 5962
109 Ga0070684_100159841 3300005535 Bacteria 2043
110 Ga0070684_100752393 3300005535 Bacteria 910
111 Ga0070697_100399205 3300005536 Bacteria 1193
112 Ga0070697_100399786 3300005536 Bacteria 1192
113 Ga0070697_100436918 3300005536 Bacteria 1139
114 Ga0068853_100203859 3300005539 Bacteria 1800
115 Ga0068853_100430451 3300005539 Bacteria 1239
116 Ga0068853_101055805 3300005539 Bacteria 783
117 Ga0070672_100047552 3300005543 Bacteria 3329
118 Ga0070672_100119640 3300005543 Bacteria 2155
119 Ga0070672_100382019 3300005543 Bacteria 1205
120 Ga0070686_100069204 3300005544 Bacteria 2304
121 Ga0070686_100181281 3300005544 Bacteria 1496
122 Ga0070695_100889492 3300005545 Bacteria 719
123 Ga0070696_100935292 3300005546 Bacteria 721
124 Ga0070665_100038779 3300005548 Bacteria 4789
125 Ga0070665_100084569 3300005548 Bacteria 3178
126 Ga0070665_100143395 3300005548 Bacteria 2392
127 Ga0070665_100159117 3300005548 Bacteria 2260
128 Ga0070665_100227433 3300005548 Bacteria 1865
129 Ga0070665_100487636 3300005548 Bacteria 1243
130 Ga0070665_100790605 3300005548 Bacteria 962
131 Ga0068855_100021984 3300005563 Bacteria 7648
132 Ga0068855_100039709 3300005563 Bacteria 5586
133 Ga0068855_100111720 3300005563 Bacteria 3137
134 Ga0068855_100494392 3300005563 Bacteria 1330
135 Ga0070664_100118017 3300005564 Bacteria 2321
136 Ga0068857_100021483 3300005577 Bacteria 5680
137 Ga0068857_100268057 3300005577 Bacteria 1569
138 Ga0068857_100272157 3300005577 Bacteria 1557
139 Ga0068857_100493160 3300005577 Bacteria 1149
140 Ga0068854_100010964 3300005578 Bacteria 5882
141 Ga0068854_100661758 3300005578 Bacteria 898
142 Ga0068856_100000540 3300005614 Bacteria 41724
143 Ga0068856_100014372 3300005614 Bacteria 7652
144 Ga0068856_100288133 3300005614 Bacteria 1659
145 Ga0068856_100447966 3300005614 Bacteria 1312
146 Ga0068856_100473876 3300005614 Bacteria 1273
147 Ga0070702_100617486 3300005615 Bacteria 815
148 Ga0070702_101000616 3300005615 Bacteria 662
149 Ga0068852_100004787 3300005616 Bacteria 9615
150 Ga0068852_100123844 3300005616 Bacteria 2371
151 Ga0068859_100200649 3300005617 Bacteria 2079
152 Ga0068859_100201023 3300005617 Bacteria 2077
153 Ga0068864_100378585 3300005618 Bacteria 1341
154 Ga0068864_100396125 3300005618 Bacteria 1311
155 Ga0068866_10021203 3300005718 Bacteria 2991
156 Ga0068866_10353099 3300005718 Bacteria 935
157 Ga0068861_100052249 3300005719 Bacteria 3105
158 Ga0068861_100194902 3300005719 Bacteria 1696
159 Ga0068870_10063270 3300005840 Bacteria 1995
160 Ga0068858_100049531 3300005842 Bacteria 3890
161 Ga0068858_100063701 3300005842 Bacteria 3411
162 Ga0068858_100085133 3300005842 Bacteria 2941
163 Ga0068858_100249542 3300005842 Bacteria 1685
164 Ga0068860_100130560 3300005843 Bacteria 2410
165 Ga0068860_100233797 3300005843 Bacteria 1786
166 Ga0068860_100333779 3300005843 Bacteria 1490
167 Ga0068860_100528878 3300005843 Bacteria 1179
168 Ga0068862_100037181 3300005844 Bacteria 4126
169 Ga0068862_100259184 3300005844 Bacteria 1587
170 Ga0068862_100551300 3300005844 Bacteria 1101
171 Ga0081455_10003799 3300005937 Bacteria 17228
172 Ga0081455_10016122 3300005937 Bacteria 7224
173 Ga0081455_10023378 3300005937 Bacteria 5752
174 Ga0081455_10024424 3300005937 Bacteria 5598
175 Ga0081538_10022806 3300005981 Bacteria 4521
176 Ga0081540_1001162 3300005983 Bacteria 23140
177 Ga0081540_1005031 3300005983 Bacteria 9920
178 Ga0081540_1007496 3300005983 Bacteria 7769
179 Ga0081540_1009260 3300005983 Bacteria 6793
180 Ga0081540_1012233 3300005983 Bacteria 5673
181 Ga0081540_1018775 3300005983 Bacteria 4227
182 Ga0081540_1074124 3300005983 Bacteria 1561
183 Ga0081540_1117597 3300005983 Bacteria 1110
184 Ga0081540_1123230 3300005983 Bacteria 1071
185 Ga0081539_10000966 3300005985 Bacteria 53690
186 Ga0081539_10046027 3300005985 Bacteria 2503
187 Ga0070717_10000269 3300006028 Bacteria 35470
188 Ga0070717_10004197 3300006028 Bacteria 10389
189 Ga0070717_10124111 3300006028 Bacteria 2215
190 Ga0070717_10239814 3300006028 Bacteria 1598
191 Ga0075365_10007222 3300006038 Bacteria 6205
192 Ga0075365_10055244 3300006038 Bacteria 2635
193 Ga0075365_10104789 3300006038 Bacteria 1939
194 Ga0075365_10200035 3300006038 Bacteria 1399
195 Ga0075365_10254392 3300006038 Bacteria 1235
196 Ga0075365_10281124 3300006038 Bacteria 1171
197 Ga0075368_10212815 3300006042 Bacteria 820
198 Ga0075368_10279892 3300006042 Bacteria 717
199 Ga0075363_100016896 3300006048 Bacteria 3610
200 Ga0075363_100028560 3300006048 Bacteria 2871
201 Ga0075363_100053851 3300006048 Bacteria 2151
202 Ga0075363_100277746 3300006048 Bacteria 969
203 Ga0075364_10031529 3300006051 Bacteria 3405
204 Ga0075364_10305866 3300006051 Bacteria 1082
205 Ga0075364_10455731 3300006051 Bacteria 874
206 Ga0070715_10009248 3300006163 Bacteria 3467
207 Ga0070715_10043682 3300006163 Bacteria 1891
208 Ga0070715_10213412 3300006163 Bacteria 988
209 Ga0070716_100024130 3300006173 Bacteria 3234
210 Ga0070716_100054308 3300006173 Bacteria 2288
211 Ga0070716_100330371 3300006173 Bacteria 1072
212 Ga0070712_100006808 3300006175 Bacteria 7115
213 Ga0070712_100105562 3300006175 Bacteria 2092
214 Ga0070712_100161542 3300006175 Bacteria 1730
215 Ga0070712_100280156 3300006175 Bacteria 1343
216 Ga0075362_10017408 3300006177 Bacteria 2960
217 Ga0075362_10091355 3300006177 Bacteria 1414
218 Ga0075362_10124324 3300006177 Bacteria 1223
219 Ga0075362_10187535 3300006177 Bacteria 1004
220 Ga0075367_10204281 3300006178 Bacteria 1235
221 Ga0075367_10421047 3300006178 Bacteria 845
222 Ga0075369_10016235 3300006186 Bacteria 3001
223 Ga0075369_10034714 3300006186 Bacteria 2141
224 Ga0075369_10148024 3300006186 Bacteria 1073
225 Ga0075369_10157110 3300006186 Bacteria 1041
226 Ga0075366_10030691 3300006195 Bacteria 3161
227 Ga0075366_10137217 3300006195 Bacteria 1477
228 Ga0075366_10450007 3300006195 Bacteria 794
229 Ga0097621_100068907 3300006237 Bacteria 2919
230 Ga0097621_100094411 3300006237 Bacteria 2508
231 Ga0075370_10021423 3300006353 Bacteria 3541
232 Ga0075370_10131295 3300006353 Bacteria 1461
233 Ga0075370_10377985 3300006353 Bacteria 848
234 Ga0075370_10561316 3300006353 Bacteria 691
235 Ga0068871_100564787 3300006358 Bacteria 1032
236 Ga0068871_100945052 3300006358 Bacteria 801
237 Ga0075428_100125897 3300006844 Bacteria 2788
238 Ga0075434_100315212 3300006871 Bacteria 1585
239 Ga0075429_100459510 3300006880 Bacteria 1116
240 Ga0068865_100017842 3300006881 Bacteria 4570
241 Ga0068865_100129004 3300006881 Bacteria 1892
242 Ga0068865_100587428 3300006881 Bacteria 940
243 Ga0068865_100601009 3300006881 Bacteria 930
244 Ga0068865_100647124 3300006881 Bacteria 898
245 Ga0068865_100807603 3300006881 Bacteria 810
246 Ga0075436_100637026 3300006914 Bacteria 787
247 Ga0097620_100200641 3300006931 Bacteria 2079
248 Ga0097620_100201032 3300006931 Bacteria 2077
249 Ga0099824_1006119 3300006942 Bacteria 16669
250 Ga0099822_1014043 3300006943 Bacteria 9278
251 Ga0099794_10230174 3300007265 Bacteria 953
252 Ga0099795_10006732 3300007788 Bacteria 3155
253 Ga0099795_10012369 3300007788 Bacteria 2586
254 Ga0105240_10002943 3300009093 Bacteria 26851
255 Ga0105240_10113703 3300009093 Bacteria 3271
256 Ga0111539_10061321 3300009094 Bacteria 4456
257 Ga0105245_10074999 3300009098 Bacteria 3078
258 Ga0105245_10181113 3300009098 Bacteria 2013
259 Ga0105245_10337206 3300009098 Bacteria 1490
260 Ga0105247_10028777 3300009101 Bacteria 3362
261 Ga0105247_10078744 3300009101 Bacteria 2074
262 Ga0105247_10140941 3300009101 Bacteria 1580
263 Ga0105243_10045318 3300009148 Bacteria 3455
264 Ga0105243_10539593 3300009148 Bacteria 1112
265 Ga0105243_10619255 3300009148 Bacteria 1045
266 Ga0105241_10125496 3300009174 Bacteria 2072
267 Ga0105242_10039799 3300009176 Bacteria 3785
268 Ga0105242_10711023 3300009176 Bacteria 984
269 Ga0105248_10023017 3300009177 Bacteria 6919
270 Ga0105248_10314212 3300009177 Bacteria 1765
271 Ga0105248_11020580 3300009177 Bacteria 935
272 Ga0105237_10043269 3300009545 Bacteria 4537
273 Ga0105237_10083496 3300009545 Bacteria 3185
274 Ga0105237_10528926 3300009545 Bacteria 1186
275 Ga0105237_10865440 3300009545 Bacteria 911
276 Ga0105238_10006820 3300009551 Bacteria 11404
277 Ga0105238_10087183 3300009551 Bacteria 3108
278 Ga0105238_10213127 3300009551 Bacteria 1908
279 Ga0105249_10262698 3300009553 Bacteria 1716
280 Ga0105249_10340165 3300009553 Bacteria 1517
281 Ga0105249_10416025 3300009553 Bacteria 1377
282 Ga0105249_11715565 3300009553 Bacteria 701
283 Ga0099796_10011515 3300010159 Bacteria 2469
284 Ga0099796_10017101 3300010159 Bacteria 2153
285 Ga0099796_10219691 3300010159 Bacteria 778
286 Ga0105239_10013186 3300010375 Bacteria 9184
287 Ga0105239_10039840 3300010375 Bacteria 5147
288 Ga0105239_10060392 3300010375 Bacteria 4161
289 Ga0105239_10073624 3300010375 Bacteria 3755
290 Ga0105239_10146156 3300010375 Bacteria 2637
291 Ga0105239_10544550 3300010375 Bacteria 1321
292 Ga0105239_10592338 3300010375 Bacteria 1264
293 Ga0105246_10004242 3300011119 Bacteria 8716
294 Ga0105246_10061626 3300011119 Bacteria 2611
295 Ga0105246_10109633 3300011119 Bacteria 2025
296 Ga0105246_10425285 3300011119 Bacteria 1110
297 Ga0157337_1019336 3300012483 Bacteria 616
298 Ga0157370_10019039 3300013104 Bacteria 6901
299 Ga0157370_10055288 3300013104 Bacteria 3782
300 Ga0157369_10006724 3300013105 Bacteria 13270
301 Ga0157369_10749753 3300013105 Bacteria 1004
302 Ga0157369_11179679 3300013105 Bacteria 782
303 Ga0157374_10110606 3300013296 Bacteria 2642
304 Ga0157374_10708571 3300013296 Bacteria 1020
305 Ga0157378_10119537 3300013297 Bacteria 2427
306 Ga0157378_10177987 3300013297 Bacteria 1999
307 Ga0157378_10257569 3300013297 Bacteria 1673
308 Ga0157378_10344116 3300013297 Bacteria 1455
309 Ga0157378_11639592 3300013297 Bacteria 689
310 Ga0163162_10007574 3300013306 Bacteria 10573
311 Ga0163162_10315174 3300013306 Bacteria 1697
312 Ga0163162_10455550 3300013306 Bacteria 1411
313 Ga0163162_10528306 3300013306 Bacteria 1309
314 Ga0163162_11197798 3300013306 Bacteria 862
315 Ga0157372_12623184 3300013307 Bacteria 578
316 Ga0157375_10247981 3300013308 Bacteria 1941
317 Ga0157375_10272575 3300013308 Bacteria 1854
318 Ga0157375_10292148 3300013308 Bacteria 1793
319 Ga0157375_11010552 3300013308 Bacteria 971
320 Ga0163163_10068804 3300014325 Bacteria 3524
321 Ga0163163_10088341 3300014325 Bacteria 3111
322 Ga0163163_10237236 3300014325 Bacteria 1873
323 Ga0163163_10322212 3300014325 Bacteria 1599
324 Ga0163163_10882382 3300014325 Bacteria 958
325 Ga0163163_11046677 3300014325 Bacteria 879
326 Ga0157380_10027065 3300014326 Bacteria 4357
327 Ga0157380_10149254 3300014326 Bacteria 2019
328 Ga0157380_10332147 3300014326 Bacteria 1414
329 Ga0157380_11081999 3300014326 Bacteria 840
330 Ga0157380_11411552 3300014326 Bacteria 747
331 Ga0157377_10131013 3300014745 Bacteria 1531
332 Ga0157377_10735503 3300014745 Bacteria 720
333 Ga0157377_10750139 3300014745 Bacteria 714
334 Ga0157379_10192840 3300014968 Bacteria 1841
335 Ga0157379_11068753 3300014968 Bacteria 772
336 Ga0157376_10110109 3300014969 Bacteria 2422
337 Ga0157376_10147227 3300014969 Bacteria 2119
338 Ga0157376_10701271 3300014969 Bacteria 1017
339 Ga0157376_11136703 3300014969 Bacteria 808
340 Ga0182007_10167031 3300015262 Bacteria 755
341 Ga0163161_10080606 3300017792 Bacteria 2396
342 Ga0163161_10272828 3300017792 Bacteria 1324
343 Ga0163161_10573798 3300017792 Bacteria 927
344 Ga0213876_10032614 3300021384 Bacteria 2746
345 Ga0213871_10150037 3300021441 Bacteria 709
346 Ga0209233_1023807 3300025261 Bacteria 1543
347 Ga0209233_1028045 3300025261 Bacteria 1356
348 Ga0209455_1002223 3300025272 Bacteria 7649
349 Ga0209758_1006028 3300025297 Bacteria 8946
350 Ga0209758_1010347 3300025297 Bacteria 5598
351 Ga0209758_1070185 3300025297 Bacteria 1106
352 Ga0207426_1112741 3300025302 Bacteria 683
353 Ga0207697_10013036 3300025315 Bacteria 3474
354 Ga0207697_10023965 3300025315 Bacteria 2499
355 Ga0207656_10465633 3300025321 Bacteria 640
356 Ga0207692_10005362 3300025898 Bacteria 5134
357 Ga0207692_10015075 3300025898 Bacteria 3392
358 Ga0207692_10170389 3300025898 Bacteria 1261
359 Ga0207642_10035126 3300025899 Bacteria 2138
360 Ga0207642_10157253 3300025899 Bacteria 1216
361 Ga0207642_10409132 3300025899 Bacteria 814
362 Ga0207710_10028750 3300025900 Bacteria 2414
363 Ga0207710_10070899 3300025900 Bacteria 1598
364 Ga0207710_10108829 3300025900 Bacteria 1314
365 Ga0207710_10112693 3300025900 Bacteria 1292
366 Ga0207710_10136584 3300025900 Bacteria 1181
367 Ga0207688_10010585 3300025901 Bacteria 5016
368 Ga0207688_10026527 3300025901 Bacteria 3186
369 Ga0207688_10046897 3300025901 Bacteria 2413
370 Ga0207688_10061701 3300025901 Bacteria 2113
371 Ga0207688_10263506 3300025901 Bacteria 1047
372 Ga0207680_10393967 3300025903 Bacteria 978
373 Ga0207647_10100687 3300025904 Bacteria 1715
374 Ga0207685_10501513 3300025905 Bacteria 639
375 Ga0207699_10000309 3300025906 Bacteria 26099
376 Ga0207699_10090360 3300025906 Bacteria 1921
377 Ga0207699_10436859 3300025906 Bacteria 937
378 Ga0207645_10442535 3300025907 Bacteria 877
379 Ga0207643_10186796 3300025908 Bacteria 1256
380 Ga0207643_10631469 3300025908 Bacteria 690
381 Ga0207705_10357472 3300025909 Bacteria 1126
382 Ga0207684_10201526 3300025910 Bacteria 1717
383 Ga0207684_10235799 3300025910 Bacteria 1578
384 Ga0207684_10836656 3300025910 Bacteria 776
385 Ga0207654_10096908 3300025911 Bacteria 1810
386 Ga0207654_10129163 3300025911 Bacteria 1597
387 Ga0207707_10004049 3300025912 Bacteria 12993
388 Ga0207707_10084173 3300025912 Bacteria 2777
389 Ga0207695_10158317 3300025913 Bacteria 2198
390 Ga0207695_10308117 3300025913 Bacteria 1474
391 Ga0207671_10060067 3300025914 Bacteria 2820
392 Ga0207671_10163465 3300025914 Bacteria 1725
393 Ga0207671_11221270 3300025914 Bacteria 587
394 Ga0207693_10002279 3300025915 Bacteria 16682
395 Ga0207693_10036569 3300025915 Bacteria 3871
396 Ga0207693_10037840 3300025915 Bacteria 3802
397 Ga0207693_10092682 3300025915 Bacteria 2367
398 Ga0207693_10108972 3300025915 Bacteria 2172
399 Ga0207663_10001983 3300025916 Bacteria 9708
400 Ga0207663_10002139 3300025916 Bacteria 9428
401 Ga0207663_10053409 3300025916 Bacteria 2524
402 Ga0207660_10039770 3300025917 Bacteria 3289
403 Ga0207660_10258781 3300025917 Bacteria 1376
404 Ga0207657_10003634 3300025919 Bacteria 16422
405 Ga0207657_10092864 3300025919 Bacteria 2514
406 Ga0207657_10210687 3300025919 Bacteria 1560
407 Ga0207657_10322449 3300025919 Bacteria 1221
408 Ga0207649_10105847 3300025920 Bacteria 1870
409 Ga0207649_10379231 3300025920 Bacteria 1053
410 Ga0207652_10002638 3300025921 Bacteria 15043
411 Ga0207652_10097756 3300025921 Bacteria 2588
412 Ga0207681_10100674 3300025923 Bacteria 2083
413 Ga0207694_10112473 3300025924 Bacteria 2167
414 Ga0207694_11317947 3300025924 Bacteria 611
415 Ga0207650_10328321 3300025925 Bacteria 1254
416 Ga0207650_10473929 3300025925 Bacteria 1044
417 Ga0207650_10477105 3300025925 Bacteria 1040
418 Ga0207650_10777394 3300025925 Bacteria 811
419 Ga0207659_10159889 3300025926 Bacteria 1767
420 Ga0207659_10223616 3300025926 Bacteria 1515
421 Ga0207659_10324128 3300025926 Bacteria 1272
422 Ga0207659_10569531 3300025926 Bacteria 964
423 Ga0207687_10023004 3300025927 Bacteria 4150
424 Ga0207687_10024543 3300025927 Bacteria 4029
425 Ga0207687_10871268 3300025927 Bacteria 770
426 Ga0207700_10016746 3300025928 Bacteria 4880
427 Ga0207700_10049134 3300025928 Bacteria 3136
428 Ga0207664_10042185 3300025929 Bacteria 3560
429 Ga0207664_10055752 3300025929 Bacteria 3137
430 Ga0207664_10175665 3300025929 Bacteria 1836
431 Ga0207664_10280396 3300025929 Bacteria 1462
432 Ga0207644_10385830 3300025931 Bacteria 1143
433 Ga0207644_10438468 3300025931 Bacteria 1072
434 Ga0207644_11229092 3300025931 Bacteria 630
435 Ga0207690_10891055 3300025932 Bacteria 738
436 Ga0207706_10025700 3300025933 Bacteria 5275
437 Ga0207706_10088312 3300025933 Bacteria 2725
438 Ga0207706_10323700 3300025933 Bacteria 1342
439 Ga0207686_10366762 3300025934 Bacteria 1088
440 Ga0207709_10413595 3300025935 Bacteria 1034
441 Ga0207709_10418209 3300025935 Bacteria 1029
442 Ga0207709_10954767 3300025935 Bacteria 699
443 Ga0207709_10957997 3300025935 Bacteria 698
444 Ga0207669_10055249 3300025937 Bacteria 2403
445 Ga0207669_10300119 3300025937 Bacteria 1220
446 Ga0207704_10031422 3300025938 Bacteria 2991
447 Ga0207704_10178562 3300025938 Bacteria 1532
448 Ga0207704_10601907 3300025938 Bacteria 900
449 Ga0207704_10646143 3300025938 Bacteria 871
450 Ga0207665_10002452 3300025939 Bacteria 12524
451 Ga0207665_10035091 3300025939 Bacteria 3327
452 Ga0207665_10053824 3300025939 Bacteria 2713
453 Ga0207665_10066823 3300025939 Bacteria 2447
454 Ga0207665_10188122 3300025939 Bacteria 1499
455 Ga0207665_10203579 3300025939 Bacteria 1443
456 Ga0207691_10058603 3300025940 Bacteria 3502
457 Ga0207691_10060550 3300025940 Bacteria 3439
458 Ga0207691_10313472 3300025940 Bacteria 1346
459 Ga0207711_10155096 3300025941 Bacteria 2069
460 Ga0207711_10217312 3300025941 Bacteria 1747
461 Ga0207711_10583776 3300025941 Bacteria 1043
462 Ga0207689_10196723 3300025942 Bacteria 1664
463 Ga0207661_10001804 3300025944 Bacteria 14632
464 Ga0207661_10007278 3300025944 Bacteria 7874
465 Ga0207679_10103763 3300025945 Bacteria 2229
466 Ga0207679_10171579 3300025945 Bacteria 1786
467 Ga0207667_10008204 3300025949 Bacteria 12430
468 Ga0207667_10046583 3300025949 Bacteria 4591
469 Ga0207667_10391628 3300025949 Bacteria 1415
470 Ga0207667_10539508 3300025949 Bacteria 1180
471 Ga0207651_10292405 3300025960 Bacteria 1351
472 Ga0207651_10514015 3300025960 Bacteria 1037
473 Ga0207712_10239357 3300025961 Bacteria 1461
474 Ga0207668_10073979 3300025972 Bacteria 2444
475 Ga0207668_10186108 3300025972 Bacteria 1642
476 Ga0207668_10406272 3300025972 Bacteria 1152
477 Ga0207668_10557764 3300025972 Bacteria 993
478 Ga0207640_10011851 3300025981 Bacteria 4949
479 Ga0207640_10714416 3300025981 Bacteria 860
480 Ga0207640_11044766 3300025981 Bacteria 720
481 Ga0207640_11616702 3300025981 Bacteria 584
482 Ga0207658_11224375 3300025986 Bacteria 686
483 Ga0207677_10028438 3300026023 Bacteria 3535
484 Ga0207677_10117463 3300026023 Bacteria 1994
485 Ga0207703_10034719 3300026035 Bacteria 4003
486 Ga0207703_10186095 3300026035 Bacteria 1836
487 Ga0207703_10409057 3300026035 Bacteria 1260
488 Ga0207703_10475113 3300026035 Bacteria 1171
489 Ga0207639_10078976 3300026041 Bacteria 2599
490 Ga0207639_10238815 3300026041 Bacteria 1579
491 Ga0207639_10572555 3300026041 Bacteria 1039
492 Ga0207639_10599694 3300026041 Bacteria 1015
493 Ga0207639_11129528 3300026041 Bacteria 735
494 Ga0207678_10024550 3300026067 Bacteria 5265
495 Ga0207678_10048527 3300026067 Bacteria 3669
496 Ga0207678_10093941 3300026067 Bacteria 2562
497 Ga0207678_10094956 3300026067 Bacteria 2548
498 Ga0207678_10199547 3300026067 Bacteria 1710
499 Ga0207678_10289318 3300026067 Bacteria 1407
500 Ga0207708_10725563 3300026075 Bacteria 851
501 Ga0207702_10003075 3300026078 Bacteria 15498
502 Ga0207702_10363622 3300026078 Bacteria 1387
503 Ga0207641_10380706 3300026088 Bacteria 1351
504 Ga0207641_10656443 3300026088 Bacteria 1030
505 Ga0207648_10111099 3300026089 Bacteria 2406
506 Ga0207648_10117176 3300026089 Bacteria 2341
507 Ga0207648_10529890 3300026089 Bacteria 1080
508 Ga0207676_10338008 3300026095 Bacteria 1388
509 Ga0207674_10003708 3300026116 Bacteria 18660
510 Ga0207674_10033510 3300026116 Bacteria 5377
511 Ga0207674_10400024 3300026116 Bacteria 1327
512 Ga0207675_100043240 3300026118 Bacteria 4207
513 Ga0207675_100048585 3300026118 Bacteria 3961
514 Ga0207683_10019513 3300026121 Bacteria 5789
515 Ga0207683_10043506 3300026121 Bacteria 3925
516 Ga0207683_10051303 3300026121 Bacteria 3614
517 Ga0207683_10075599 3300026121 Bacteria 2981
518 Ga0207683_10102080 3300026121 Bacteria 2561
519 Ga0207683_10198600 3300026121 Bacteria 1823
520 Ga0207683_10387816 3300026121 Bacteria 1284
521 Ga0207683_10692265 3300026121 Bacteria 945
522 Ga0207683_10911092 3300026121 Bacteria 816
523 Ga0207698_10117280 3300026142 Bacteria 2245
524 Ga0207698_10174301 3300026142 Bacteria 1897
525 Ga0209589_1000021 3300027357 Bacteria 186431
526 Ga0209489_100028 3300027361 Bacteria 186431
527 Ga0209700_100037 3300027363 Bacteria 186431
528 Ga0209813_10090542 3300027866 Bacteria 1026
529 Ga0207428_10302262 3300027907 Bacteria 1184
530 Ga0268266_10000680 3300028379 Bacteria 45937
531 Ga0268266_10002169 3300028379 Bacteria 21507
532 Ga0268266_10024779 3300028379 Bacteria 5105
533 Ga0268266_10096578 3300028379 Bacteria 2597
534 Ga0268266_10098886 3300028379 Bacteria 2568
535 Ga0268266_10133948 3300028379 Bacteria 2218
536 Ga0268266_10392226 3300028379 Bacteria 1311
537 Ga0268266_10508727 3300028379 Bacteria 1150
538 Ga0268265_10028819 3300028380 Bacteria 3979
539 Ga0268265_10120452 3300028380 Bacteria 2161
540 Ga0268265_10498026 3300028380 Bacteria 1147
541 Ga0268265_10727038 3300028380 Bacteria 961
542 Ga0268264_10211583 3300028381 Bacteria 1780
543 Ga0268264_10360833 3300028381 Bacteria 1386
544 Ga0268264_11005879 3300028381 Bacteria 840
545 Ga0265323_10016069 3300028653 Bacteria 2929
546 Ga0265336_10013367 3300028666 Bacteria 2738
547 Ga0307517_10000175 3300028786 Bacteria 105567
548 Ga0307515_10093325 3300028794 Bacteria 3733
549 Ga0307515_10280782 3300028794 Bacteria 1373
550 Ga0265338_10000835 3300028800 Bacteria 51961
551 Ga0265324_10019533 3300029957 Bacteria 2441
552 Ga0307512_10302631 3300030522 Bacteria 743
553 Ga0265330_10021122 3300031235 Bacteria 2974
554 Ga0265330_10023914 3300031235 Bacteria 2772
555 Ga0265330_10070163 3300031235 Bacteria 1516
556 Ga0265332_10118417 3300031238 Bacteria 1113
557 Ga0265332_10207671 3300031238 Bacteria 813
558 Ga0265325_10035551 3300031241 Bacteria 2645
559 Ga0265340_10000884 3300031247 Bacteria 16974
560 Ga0265340_10035059 3300031247 Bacteria 2493
561 Ga0265339_10004328 3300031249 Bacteria 9706
562 Ga0265339_10016094 3300031249 Bacteria 4467
563 Ga0265339_10083650 3300031249 Bacteria 1683
564 Ga0265316_10359186 3300031344 Bacteria 1053
565 Ga0307513_10057077 3300031456 Bacteria 4163
566 Ga0307513_10182197 3300031456 Bacteria 1962
567 Ga0307513_10371673 3300031456 Bacteria 1172
568 Ga0307509_10084646 3300031507 Bacteria 3266
569 Ga0307408_100505017 3300031548 Bacteria 1059
570 Ga0265313_10041621 3300031595 Bacteria 2262
571 Ga0307508_10000108 3300031616 Bacteria 97443
572 Ga0265314_10003949 3300031711 Bacteria 14062
573 Ga0265314_10124640 3300031711 Bacteria 1616
574 Ga0265342_10147385 3300031712 Bacteria 1309
575 Ga0307516_10151857 3300031730 Bacteria 2075
576 Ga0307516_10192455 3300031730 Bacteria 1765
577 Ga0307516_10610540 3300031730 Bacteria 745
578 Ga0307405_10241741 3300031731 Bacteria 1338
579 Ga0307406_10127422 3300031901 Bacteria 1781
580 Ga0307406_10150823 3300031901 Bacteria 1658
581 Ga0307412_10431601 3300031911 Bacteria 1080
582 Ga0307412_10998363 3300031911 Bacteria 739
583 Ga0307416_100267044 3300032002 Bacteria 1677
584 Ga0307416_100415049 3300032002 Bacteria 1388
585 Ga0307416_102306814 3300032002 Bacteria 638
586 Ga0307414_10434577 3300032004 Bacteria 1148
587 Ga0307411_10065225 3300032005 Bacteria 2442
588 Ga0307415_100054255 3300032126 Bacteria 2735
589 Ga0307415_100085248 3300032126 Bacteria 2269
590 Ga0307415_100321899 3300032126 Bacteria 1290
591 Ga0307510_10010287 3300033180 Bacteria 11113
592 Ga0307510_10200456 3300033180 Bacteria 1531
593 Ga0316215_1005545 3300033544 Bacteria 1219
594 Ga0373926_0132099 3300035083 Bacteria 946
595 Ga0373944_0275669 3300035089 Bacteria 626
596 Ga0373923_0060610 3300035111 Bacteria 1607
597 Ga0373932_0026257 3300035112 Bacteria 1583
598 Ga0373932_0116569 3300035112 Bacteria 886
599 Ga0373941_0142888 3300035115 Bacteria 872
600 Ga0373945_0204677 3300035116 Bacteria 821
601 Ga0373954_0024673 3300035118 Bacteria 2742
602 Ga0373955_0225677 3300035172 Bacteria 1120
603 Ga0373962_0212440 3300035242 Bacteria 659
604 Ga0373931_0003001 3300035691 Bacteria 7533
605 Ga0373931_0091713 3300035691 Bacteria 1694
606 Ga0373927_0003306 3300035695 Bacteria 11600
607 Ga0373927_0153238 3300035695 Bacteria 1509
608 Ga0373927_0235163 3300035695 Bacteria 1204
609 Ga0373947_0023036 3300035725 Bacteria 3619
610 Ga0373947_0213774 3300035725 Bacteria 1266
611 Ga0373937_0078308 3300036401 Bacteria 3055
612 Ga0373937_0428902 3300036401 Bacteria 1255
613 Ga0372808_020771 3300036459 Bacteria 944
614 Ga0373925_0077409 3300037068 Bacteria 2524
615 Ga0373925_0174161 3300037068 Bacteria 1700
616 Ga0373925_0328147 3300037068 Bacteria 1239
617 Ga0373925_0636194 3300037068 Bacteria 879
618 Ga0395900_0109182 3300037418 Bacteria 2842
619 Ga0395905_0499162 3300037471 Bacteria 1117
620 Ga0436364_1450038 3300037853 Bacteria 2404
621 Ga0395901_0380417 3300038443 Bacteria 1453
622 Ga0395901_1068423 3300038443 Bacteria 779
623 Ga0436365_0168484 3300039437 Bacteria 6646
624 Ga0436365_1582279 3300039437 Bacteria 2245
625 Ga0436360_0023737 3300039438 Bacteria 1902
626 Ga0436360_1245929 3300039438 Bacteria 673
627 Ga0436363_0159943 3300039450 Bacteria 1083
628 Ga0436363_1166950 3300039450 Bacteria 674
629 Ga0436363_1403617 3300039450 Bacteria 3318
630 Ga0436362_0181511 3300039453 Bacteria 1872
631 Ga0451802_0623261 3300041460 Bacteria 952
632 Ga0451807_1001866 3300041486 Bacteria 728
633 Ga0451807_1667569 3300041486 Bacteria 779
634 Ga0451807_1946340 3300041486 Bacteria 1094
635 Ga0451833_0048398 3300041491 Bacteria 561
636 Ga0451835_1012982 3300041492 Bacteria 696
637 Ga0451839_0736368 3300041496 Bacteria 740
638 Ga0466964_0565191 3300044706 Bacteria 619
639 Ga0466957_0564762 3300044842 Bacteria 794
640 Ga0466960_0247273 3300044901 Bacteria 990
641 Ga0466967_0682013 3300045976 Bacteria 1017
642 Ga0466967_0702043 3300045976 Bacteria 1002
643 Ga0466967_1024621 3300045976 Bacteria 822
644 Ga0495617_051254 3300046452 Bacteria 1372
645 Ga0495603_0010419 3300046455 Bacteria 5630
646 Ga0495603_0016067 3300046455 Bacteria 4525
647 Ga0495603_0056389 3300046455 Bacteria 2326
648 Ga0495603_0173014 3300046455 Bacteria 1250
649 Ga0495603_0364080 3300046455 Bacteria 829
650 Ga0495590_0336458 3300046457 Bacteria 572
651 Ga0495629_0077987 3300046459 Bacteria 2313
652 Ga0495638_0094374 3300046460 Bacteria 1798
653 Ga0495638_0134796 3300046460 Bacteria 1447
654 Ga0495638_0156987 3300046460 Bacteria 1315
655 Ga0495651_0780390 3300046462 Bacteria 591
656 Ga0495650_0099227 3300046471 Bacteria 1096
657 Ga0495582_0028352 3300046473 Bacteria 3073
658 Ga0495639_0062306 3300046475 Bacteria 1711
659 Ga0495585_0131359 3300046492 Bacteria 1317
660 Ga0495594_0129264 3300046499 Bacteria 1430
661 Ga0495596_0063536 3300046500 Bacteria 1436
662 Ga0495583_0210154 3300046506 Bacteria 789
663 Ga0495606_0132216 3300046507 Bacteria 1482
664 Ga0495606_0204613 3300046507 Bacteria 1122
665 Ga0495610_0028391 3300046512 Bacteria 2960
666 Ga0495610_0159647 3300046512 Bacteria 954
667 Ga0495616_0328317 3300046513 Bacteria 641
668 Ga0495620_0186358 3300046515 Bacteria 801
669 Ga0495630_0196993 3300046517 Bacteria 1537
670 Ga0495631_0090236 3300046518 Bacteria 1319
671 Ga0495644_0069318 3300046523 Bacteria 1325
672 Ga0495644_0147410 3300046523 Bacteria 900
673 Ga0495648_0001251 3300046524 Bacteria 25398
674 Ga0495648_0320809 3300046524 Bacteria 718
675 Ga0495654_0165764 3300046530 Bacteria 967
676 Ga0495665_0246776 3300046531 Bacteria 920
677 Ga0495640_0577440 3300046533 Bacteria 680
678 Ga0495587_0283480 3300046536 Bacteria 928
679 Ga0495609_0043250 3300046538 Bacteria 2022
680 Ga0495609_0050883 3300046538 Bacteria 1846
681 Ga0495609_0161223 3300046538 Bacteria 950
682 Ga0495621_0010649 3300046539 Bacteria 2821
683 Ga0495645_0110908 3300046543 Bacteria 1941
684 Ga0495645_0123252 3300046543 Bacteria 1823
685 Ga0495622_0044765 3300046557 Bacteria 2057
686 Ga0495622_0297899 3300046557 Bacteria 703
687 Ga0495656_0003421 3300046615 Bacteria 5364
688 Ga0495656_0009022 3300046615 Bacteria 3579
689 Ga0495656_0028898 3300046615 Bacteria 2228
690 Ga0495656_0030100 3300046615 Bacteria 2192
691 Ga0495668_0125789 3300046616 Bacteria 1403
692 Ga0495668_0166092 3300046616 Bacteria 1209
693 Ga0495668_0208085 3300046616 Bacteria 1071
694 Ga0495668_0630773 3300046616 Bacteria 592
695 Ga0495625_0067931 3300046660 Bacteria 2507
696 Ga0495625_0273687 3300046660 Bacteria 1089
697 Ga0495625_0295610 3300046660 Bacteria 1038
698 Ga0495625_0373557 3300046660 Bacteria 896
699 Ga0495625_0465578 3300046660 Bacteria 778
700 Ga0495659_0033870 3300046664 Bacteria 1794
701 Ga0495659_0058120 3300046664 Bacteria 1422
702 Ga0495588_0281158 3300046674 Bacteria 877
703 Ga0495599_0008234 3300046678 Bacteria 6340
704 Ga0495623_0218694 3300046679 Bacteria 1087
705 Ga0495647_0402293 3300046681 Bacteria 629
706 Ga0495669_0015183 3300046684 Bacteria 3296
707 Ga0495669_0064842 3300046684 Bacteria 1657
708 Ga0495669_0083825 3300046684 Bacteria 1465
709 Ga0495669_0170181 3300046684 Bacteria 1036
710 Ga0495669_0316731 3300046684 Bacteria 753
711 Ga0495613_0782777 3300046689 Bacteria 623
712 Ga0495624_0123097 3300046690 Bacteria 1593
713 Ga0495670_0096732 3300046691 Bacteria 1516
714 Ga0495671_0115441 3300046692 Bacteria 1311
715 Ga0495671_0170410 3300046692 Bacteria 1058
716 Ga0495649_0186263 3300046694 Bacteria 1081
717 Ga0495649_0394862 3300046694 Bacteria 695
718 Ga0495589_0095626 3300046794 Bacteria 1441
719 Ga0495589_0142352 3300046794 Bacteria 1148
720 Ga0495589_0169547 3300046794 Bacteria 1038
721 Ga0495600_0143564 3300046809 Bacteria 1548
722 Ga0495581_0131300 3300047315 Bacteria 1459
723 Ga0495581_0202275 3300047315 Bacteria 1162
724 Ga0495581_0602697 3300047315 Bacteria 636
725 Ga0495604_0214928 3300047317 Bacteria 1327
726 Ga0495604_0265593 3300047317 Bacteria 1165
727 Ga0495636_0030621 3300047318 Bacteria 2201
728 Ga0495674_0198480 3300047319 Bacteria 1665
729 Ga0495672_0339280 3300047320 Bacteria 701
730 Ga0495676_0062458 3300047321 Bacteria 2908
731 Ga0495683_0047765 3300047323 Bacteria 2147
732 Ga0495683_0128105 3300047323 Bacteria 1199
733 Ga0495685_086272 3300047447 Bacteria 1043
734 Ga0495685_114679 3300047447 Bacteria 886
735 Ga0495686_0127380 3300047472 Bacteria 1513
736 Ga0495686_0490492 3300047472 Bacteria 648
737 Ga0495602_0671054 3300048088 Bacteria 706
738 Ga0495626_0176548 3300048091 Bacteria 888
739 Ga0496100_0048756 3300048903 Bacteria 2735
740 Ga0496100_0081491 3300048903 Bacteria 2186
741 Ga0496101_0008281 3300048904 Bacteria 6792
742 Ga0496101_0044430 3300048904 Bacteria 3179
743 Ga0496101_0319134 3300048904 Bacteria 1219
744 Ga0496102_0001453 3300048905 Bacteria 20988
745 Ga0496102_0043946 3300048905 Bacteria 4052
746 Ga0496102_0327127 3300048905 Bacteria 1444
747 Ga0496102_0339395 3300048905 Bacteria 1415
748 Ga0496102_1324930 3300048905 Bacteria 639
749 Ga0496103_0010530 3300048906 Bacteria 5475
750 Ga0496103_0056754 3300048906 Bacteria 2431
751 Ga0496103_0674250 3300048906 Bacteria 656
752 Ga0496104_0027853 3300048907 Bacteria 5231
753 Ga0496104_0135896 3300048907 Bacteria 2362
754 Ga0496104_0271160 3300048907 Bacteria 1609
755 Ga0496104_0373628 3300048907 Bacteria 1338
756 Ga0496104_0618479 3300048907 Bacteria 993
757 Ga0496105_0005368 3300048908 Bacteria 9717
758 Ga0496105_0197778 3300048908 Bacteria 1641
759 Ga0496105_0864316 3300048908 Bacteria 684
760 Ga0496106_0003462 3300048909 Bacteria 11759
761 Ga0496106_0007634 3300048909 Bacteria 7998
762 Ga0496106_0076324 3300048909 Bacteria 2568
763 Ga0496106_0199556 3300048909 Bacteria 1592
764 Ga0496106_0257845 3300048909 Bacteria 1395
765 Ga0496106_0478127 3300048909 Bacteria 1001
766 Ga0496107_0008406 3300048910 Bacteria 7144
767 Ga0496107_0019887 3300048910 Bacteria 4741
768 Ga0496107_0029236 3300048910 Bacteria 3920
769 Ga0496107_0092416 3300048910 Bacteria 2212
770 Ga0496107_0171756 3300048910 Bacteria 1609
771 Ga0496107_0352387 3300048910 Bacteria 1095
772 Ga0496108_0034768 3300048911 Bacteria 4187
773 Ga0496108_0039651 3300048911 Bacteria 3925
774 Ga0496108_0104749 3300048911 Bacteria 2414
775 Ga0496109_0090477 3300048912 Bacteria 2830
776 Ga0496109_0652160 3300048912 Bacteria 989
777 Ga0496110_0009850 3300048913 Bacteria 7745
778 Ga0496110_0015996 3300048913 Bacteria 6256
779 Ga0496111_0024623 3300048914 Bacteria 4241
780 Ga0496111_0039977 3300048914 Bacteria 3364
781 Ga0496111_0231979 3300048914 Bacteria 1371
782 Ga0496112_0042992 3300048915 Bacteria 4422
783 Ga0496112_0051842 3300048915 Bacteria 4025
784 Ga0496112_0078349 3300048915 Bacteria 3268
785 Ga0496113_0023859 3300048916 Bacteria 4342
786 Ga0496113_0032245 3300048916 Bacteria 3807
787 Ga0496113_0047640 3300048916 Bacteria 3186
788 Ga0496113_0114650 3300048916 Bacteria 2101
789 Ga0496113_0174611 3300048916 Bacteria 1702
790 Ga0496113_0548004 3300048916 Bacteria 928
791 Ga0496114_0022794 3300048917 Bacteria 5103
792 Ga0496114_0037886 3300048917 Bacteria 3989
793 Ga0496114_0063296 3300048917 Bacteria 3097
794 Ga0496115_0004695 3300048918 Bacteria 9904
795 Ga0496115_0027446 3300048918 Bacteria 4453
796 Ga0496115_0109423 3300048918 Bacteria 2269
797 Ga0496115_0444017 3300048918 Bacteria 1049
798 Ga0496115_0910449 3300048918 Bacteria 678
799 Ga0496117_0228952 3300048920 Bacteria 1029
800 Ga0496118_0096208 3300048921 Bacteria 2019
801 Ga0496118_0216458 3300048921 Bacteria 1119
802 Ga0496121_0063692 3300048924 Bacteria 3010
803 Ga0496121_0070730 3300048924 Bacteria 2809
804 Ga0496121_0216414 3300048924 Bacteria 1353
805 Ga0496121_0282937 3300048924 Bacteria 1133
806 Ga0496121_0311718 3300048924 Bacteria 1063
807 Ga0496124_0046885 3300048927 Bacteria 3699
808 Ga0496124_0180542 3300048927 Bacteria 1625
809 Ga0496124_0305447 3300048927 Bacteria 1147
810 Ga0496125_0047124 3300048928 Bacteria 3608
811 Ga0496125_0208382 3300048928 Bacteria 1272
812 Ga0496125_0354947 3300048928 Bacteria 874
813 Ga0496126_0011555 3300048929 Bacteria 9118
814 Ga0496126_0014534 3300048929 Bacteria 7952
815 Ga0496126_0062393 3300048929 Bacteria 3344
816 Ga0496126_0073518 3300048929 Bacteria 3039
817 Ga0496126_0117515 3300048929 Bacteria 2310
818 Ga0496126_0145240 3300048929 Bacteria 2038
819 Ga0496126_0242181 3300048929 Bacteria 1506
820 Ga0496126_0267846 3300048929 Bacteria 1418
821 Ga0496126_0283596 3300048929 Bacteria 1371
822 Ga0496126_0371971 3300048929 Bacteria 1165
823 Ga0496126_0480060 3300048929 Bacteria 996
824 Ga0501031_0160646 3300049568 Bacteria 1469
825 Ga0501033_0150909 3300049570 Bacteria 1676
826 Ga0501033_0308273 3300049570 Bacteria 1113
827 Ga0501034_0048287 3300049571 Bacteria 4296
828 Ga0501036_1306400 3300049572 Bacteria 589
829 Ga0501037_0249504 3300049573 Bacteria 1242
830 Ga0501038_0124216 3300049574 Bacteria 2125
831 Ga0501038_0561556 3300049574 Bacteria 867
832 Ga0501039_0164864 3300049575 Bacteria 1742
833 Ga0501042_0346240 3300049578 Bacteria 1075
834 Ga0501043_0330162 3300049579 Bacteria 1161
835 Ga0501046_0019136 3300049580 Bacteria 5681
836 Ga0501046_0134887 3300049580 Bacteria 1870
837 Ga0501047_0020926 3300049581 Bacteria 6283
838 Ga0501067_0035210 3300049583 Bacteria 2780
839 Ga0501067_0044688 3300049583 Bacteria 2461
840 Ga0501068_0027765 3300049584 Bacteria 3344
841 Ga0501068_0273486 3300049584 Bacteria 1079
842 Ga0501069_0057654 3300049585 Bacteria 2166
843 Ga0501069_0203031 3300049585 Bacteria 1149
844 Ga0501070_0008271 3300049586 Bacteria 8797
845 Ga0501071_0187713 3300049587 Bacteria 1550
846 Ga0501071_0370302 3300049587 Bacteria 1092
847 Ga0501071_0392019 3300049587 Bacteria 1060
848 Ga0501073_0008815 3300049589 Bacteria 7460
849 Ga0501074_0015460 3300049590 Bacteria 5548
850 Ga0501075_0611963 3300049591 Bacteria 831
851 Ga0501076_0098020 3300049592 Bacteria 2362
852 Ga0501076_0146208 3300049592 Bacteria 1922
853 Ga0501079_0385992 3300049741 Bacteria 1098
854 Ga0501080_0016296 3300049742 Bacteria 6861
855 Ga0501080_0249895 3300049742 Bacteria 1617
856 Ga0501035_0082361 3300049822 Bacteria 2839
857 Ga0501044_0017082 3300049823 Bacteria 7787
858 Ga0501045_0379058 3300049824 Bacteria 1053
859 Ga0501045_0471835 3300049824 Bacteria 932
860 nmdc:mga03683_19812_c1 3300050489 Bacteria 2573
861 nmdc:mga03683_279409_c1 3300050489 Bacteria 780
862 nmdc:mga03683_402934_c1 3300050489 Bacteria 653
863 nmdc:mga03n38_164796_c1 3300050490 Bacteria 1125
864 nmdc:mga03n38_287851_c1 3300050490 Bacteria 879
865 nmdc:mga03n38_298337_c1 3300050490 Bacteria 865
866 nmdc:mga00v17_211293_c1 3300050491 Bacteria 1256
867 nmdc:mga00v17_87918_c1 3300050491 Bacteria 1948
868 nmdc:mga0yw44_103713_c1 3300050492 Bacteria 1814
869 nmdc:mga0yw44_189590_c1 3300050492 Bacteria 1356
870 nmdc:mga0yw44_265923_c1 3300050492 Bacteria 1144
871 nmdc:mga0yw44_30731_c1 3300050492 Bacteria 3117
872 nmdc:mga0yw44_3728_c1 3300050492 Bacteria 6824
873 nmdc:mga0yw44_971088_c1 3300050492 Bacteria 575
874 nmdc:mga0k408_11114_c1 3300050493 Bacteria 2513
875 nmdc:mga0k408_332175_c1 3300050493 Bacteria 907
876 nmdc:mga0k408_46281_c1 3300050493 Bacteria 2512
877 nmdc:mga06z11_31889_c1 3300050494 Bacteria 2565
878 nmdc:mga06z11_386642_c1 3300050494 Bacteria 841
879 nmdc:mga06z11_494596_c1 3300050494 Bacteria 741
880 nmdc:mga04h51_414475_c1 3300050495 Bacteria 566
881 nmdc:mga04h51_97303_c1 3300050495 Bacteria 1068
882 nmdc:mga07m45_148798_c1 3300050496 Bacteria 1357
883 nmdc:mga07m45_43287_c1 3300050496 Bacteria 2524
884 nmdc:mga07m45_9877_c1 3300050496 Bacteria 4965
885 nmdc:mga05p37_573050_c1 3300050507 Bacteria 1280
886 nmdc:mga09592_688562_c1 3300050508 Bacteria 871
887 nmdc:mga08y16_170224_c1 3300050511 Bacteria 2262
888 nmdc:mga08y16_66686_c1 3300050511 Bacteria 3756
889 nmdc:mga0n895_187543_c1 3300050512 Bacteria 2099
890 nmdc:mga0rr50_512824_c1 3300050513 Bacteria 1020
891 nmdc:mga0rr50_669647_c1 3300050513 Bacteria 885
892 nmdc:mga0a205_229797_c1 3300050515 Bacteria 1738
893 nmdc:mga0sz30_37500_c1 3300050516 Bacteria 2029
894 Ga0495612_0038738 3300053078 Bacteria 1937
895 Ga0495612_0179654 3300053078 Bacteria 929
896 Ga0495655_0074640 3300053083 Bacteria 956
897 Ga0495595_0067844 3300053084 Bacteria 1681
898 Ga0500578_0453093 3300053086 Bacteria 730
899 Ga0500646_0024926 3300053090 Bacteria 1613
900 Ga0500646_0110726 3300053090 Bacteria 873
901 Ga0500583_0011614 3300053092 Bacteria 3327
902 Ga0500651_0084520 3300053093 Bacteria 1962
903 Ga0500641_0006112 3300053096 Bacteria 4267
904 Ga0500641_0013194 3300053096 Bacteria 3033
905 Ga0500562_083418 3300053108 Bacteria 865
906 Ga0500572_000099 3300053111 Bacteria 28590
907 Ga0500582_160514 3300053114 Bacteria 773
908 Ga0500594_0025287 3300053118 Bacteria 1520
909 Ga0500595_000506 3300053119 Bacteria 23559
910 Ga0500595_000631 3300053119 Bacteria 21077
911 Ga0500655_090724 3300053133 Bacteria 634
912 Ga0500658_0072400 3300053134 Bacteria 1457
913 Ga0500559_0000238 3300053136 Bacteria 43775
914 Ga0500561_0044808 3300053137 Bacteria 1184
915 Ga0500568_0206216 3300053139 Bacteria 719
916 Ga0500577_0077432 3300053142 Bacteria 1318
917 Ga0500577_0189174 3300053142 Bacteria 885
918 Ga0500589_055504 3300053147 Bacteria 1828
919 Ga0500627_0155115 3300053158 Bacteria 1034
920 Ga0500634_0082379 3300053161 Bacteria 1654
921 Ga0500638_002747 3300053162 Bacteria 6264
922 Ga0500638_070154 3300053162 Bacteria 1676
923 Ga0500636_0056756 3300053177 Bacteria 2292
924 Ga0500637_0000350 3300053178 Bacteria 17499
925 Ga0500637_0076292 3300053178 Bacteria 1933
926 Ga0500637_0128472 3300053178 Bacteria 1470
927 Ga0500576_045994 3300053725 Bacteria 1952
928 Ga0500611_108289 3300053727 Bacteria 728
929 Ga0500645_022804 3300053730 Bacteria 1921
930 Ga0500596_002870 3300053735 Bacteria 3357
931 Ga0501084_1047699 3300054114 Bacteria 685
932 Ga0501082_0355885 3300060353 Bacteria 1277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0308273 Ga0501033_0308273_23_463 141
2 3300049572 Ga0501036_1306400 Ga0501036_1306400_26_466 141
3 3300028653 Ga0265323_10016069 Ga0265323_100160692 152
4 3300028666 Ga0265336_10013367 Ga0265336_100133673 152
5 3300028800 Ga0265338_10000835 Ga0265338_1000083513 152
6 3300029957 Ga0265324_10019533 Ga0265324_100195332 152
7 iso_pu_bacteria 2513237161 2514014783 152
8 iso_pu_bacteria 2515154112 2515627541 152
9 iso_pu_bacteria 2617270735 2617352166 152
10 iso_pu_bacteria 2802429603 2805915537 152
11 iso_pu_bacteria 2824671348 2824675729 152
12 iso_pu_bacteria 2824687955 2824691426 152
13 iso_pu_bacteria 2824696289 2824699708 152
14 iso_pu_bacteria 2824773399 2824779817 152
15 iso_pu_bacteria 2838122688 2838124591 152
16 iso_pu_bacteria 2841941048 2841945278 152
17 iso_pu_bacteria 2841949485 2841952067 152
18 iso_pu_bacteria 2841966195 2841970547 152
19 iso_pu_bacteria 2841974524 2841981796 152
20 iso_pu_bacteria 2841983080 2841985074 152
21 iso_pu_bacteria 2844315083 2844315440 152
22 iso_pu_bacteria 2847939898 2847942231 152
23 iso_pu_bacteria 2903727486 2903732284 152
24 iso_pu_bacteria 2906602504 2906604351 152
25 iso_pu_bacteria 2932794094 2932794241 152
26 iso_pu_bacteria 2932801729 2932808165 152
27 iso_pu_bacteria 2935883170 2935890018 152
28 iso_pu_bacteria 3005594810 3005595131 152
29 iso_pu_bacteria 3005718088 3005718377 152
30 iso_pu_bacteria 8006926726 8006933277 152
31 3300010375 Ga0105239_10544550 Ga0105239_105445502 153
32 3300048927 Ga0496124_0046885 Ga0496124_0046885_721_1191 153
33 3300048928 Ga0496125_0047124 Ga0496125_0047124_227_697 153
34 3300025321 Ga0207656_10465633 Ga0207656_104656331 154
35 3300039450 Ga0436363_1403617 Ga0436363_1403617_1301_1777 154
36 3300005467 Ga0070706_100072375 Ga0070706_1000723752 155
37 3300005471 Ga0070698_100084471 Ga0070698_1000844713 155
38 3300005536 Ga0070697_100399786 Ga0070697_1003997862 155
39 3300013296 Ga0157374_10708571 Ga0157374_107085711 155
40 3300025910 Ga0207684_10201526 Ga0207684_102015262 155
41 3300025939 Ga0207665_10188122 Ga0207665_101881221 155
42 3300048905 Ga0496102_0327127 Ga0496102_0327127_670_1140 155
43 3300048907 Ga0496104_0373628 Ga0496104_0373628_333_803 155
44 3300048915 Ga0496112_0051842 Ga0496112_0051842_214_684 155
45 3300005435 Ga0070714_100105094 Ga0070714_1001050943 156
46 3300005436 Ga0070713_100055042 Ga0070713_1000550422 156
47 3300005437 Ga0070710_10003286 Ga0070710_100032863 156
48 3300005439 Ga0070711_100000745 Ga0070711_1000007455 156
49 3300005530 Ga0070679_100080723 Ga0070679_1000807233 156
50 3300005614 Ga0068856_100473876 Ga0068856_1004738762 156
51 3300006175 Ga0070712_100280156 Ga0070712_1002801561 156
52 3300014969 Ga0157376_11136703 Ga0157376_111367031 156
53 3300021384 Ga0213876_10032614 Ga0213876_100326142 156
54 3300025898 Ga0207692_10015075 Ga0207692_100150753 156
55 3300025906 Ga0207699_10000309 Ga0207699_1000030924 156
56 3300025915 Ga0207693_10108972 Ga0207693_101089722 156
57 3300025916 Ga0207663_10001983 Ga0207663_100019832 156
58 3300025928 Ga0207700_10049134 Ga0207700_100491344 156
59 3300025929 Ga0207664_10175665 Ga0207664_101756652 156
60 3300025939 Ga0207665_10053824 Ga0207665_100538242 156
61 3300035242 Ga0373962_0212440 Ga0373962_0212440_28_504 156
62 3300039437 Ga0436365_0168484 Ga0436365_0168484_2742_3221 156
63 3300039438 Ga0436360_1245929 Ga0436360_1245929_109_588 156
64 3300039450 Ga0436363_1166950 Ga0436363_1166950_53_532 156
65 3300039453 Ga0436362_0181511 Ga0436362_0181511_1339_1818 156
66 3300044901 Ga0466960_0247273 Ga0466960_0247273_217_756 156
67 3300048924 Ga0496121_0282937 Ga0496121_0282937_382_861 156
68 3300048929 Ga0496126_0371971 Ga0496126_0371971_538_1017 156
69 3300049570 Ga0501033_0150909 Ga0501033_0150909_1027_1512 156
70 3300049571 Ga0501034_0048287 Ga0501034_0048287_630_1115 156
71 3300049574 Ga0501038_0124216 Ga0501038_0124216_1502_1987 156
72 3300049575 Ga0501039_0164864 Ga0501039_0164864_623_1108 156
73 3300049579 Ga0501043_0330162 Ga0501043_0330162_73_558 156
74 3300049580 Ga0501046_0134887 Ga0501046_0134887_131_616 156
75 3300049584 Ga0501068_0027765 Ga0501068_0027765_528_1013 156
76 3300049585 Ga0501069_0057654 Ga0501069_0057654_434_919 156
77 3300049587 Ga0501071_0370302 Ga0501071_0370302_41_526 156
78 3300049822 Ga0501035_0082361 Ga0501035_0082361_660_1145 156
79 3300003214 JGI25165J46597_1014365 JGI25165J46597_10143652 157
80 3300003322 rootL2_10096256 rootL2_100962561 157
81 3300005445 Ga0070708_100263882 Ga0070708_1002638822 157
82 3300005467 Ga0070706_100493931 Ga0070706_1004939312 157
83 3300005468 Ga0070707_100560281 Ga0070707_1005602812 157
84 3300005536 Ga0070697_100436918 Ga0070697_1004369181 157
85 3300005548 Ga0070665_100790605 Ga0070665_1007906051 157
86 3300006028 Ga0070717_10124111 Ga0070717_101241112 157
87 3300006163 Ga0070715_10043682 Ga0070715_100436822 157
88 3300006175 Ga0070712_100161542 Ga0070712_1001615422 157
89 3300007265 Ga0099794_10230174 Ga0099794_102301742 157
90 3300009545 Ga0105237_10043269 Ga0105237_100432692 157
91 3300009553 Ga0105249_10340165 Ga0105249_103401652 157
92 3300010159 Ga0099796_10017101 Ga0099796_100171013 157
93 3300013306 Ga0163162_10528306 Ga0163162_105283062 157
94 3300025261 Ga0209233_1028045 Ga0209233_10280451 157
95 3300025272 Ga0209455_1002223 Ga0209455_10022238 157
96 3300025898 Ga0207692_10170389 Ga0207692_101703892 157
97 3300025905 Ga0207685_10501513 Ga0207685_105015131 157
98 3300025906 Ga0207699_10436859 Ga0207699_104368592 157
99 3300025908 Ga0207643_10631469 Ga0207643_106314691 157
100 3300025910 Ga0207684_10836656 Ga0207684_108366561 157
101 3300025915 Ga0207693_10092682 Ga0207693_100926822 157
102 3300025961 Ga0207712_10239357 Ga0207712_102393572 157
103 3300028379 Ga0268266_10392226 Ga0268266_103922262 157
104 3300031249 Ga0265339_10016094 Ga0265339_100160945 157
105 3300033544 Ga0316215_1005545 Ga0316215_10055451 157
106 3300035089 Ga0373944_0275669 Ga0373944_0275669_34_510 157
107 3300035691 Ga0373931_0091713 Ga0373931_0091713_164_640 157
108 3300035695 Ga0373927_0003306 Ga0373927_0003306_996_1472 157
109 3300035725 Ga0373947_0023036 Ga0373947_0023036_1542_2018 157
110 3300036459 Ga0372808_020771 Ga0372808_020771_212_691 157
111 3300037068 Ga0373925_0077409 Ga0373925_0077409_983_1459 157
112 3300044706 Ga0466964_0565191 Ga0466964_0565191_110_583 157
113 3300044842 Ga0466957_0564762 Ga0466957_0564762_261_734 157
114 3300045976 Ga0466967_0702043 Ga0466967_0702043_276_749 157
115 3300045976 Ga0466967_1024621 Ga0466967_1024621_149_628 157
116 3300046455 Ga0495603_0364080 Ga0495603_0364080_100_576 157
117 3300046517 Ga0495630_0196993 Ga0495630_0196993_337_813 157
118 3300048907 Ga0496104_0135896 Ga0496104_0135896_73_549 157
119 3300048911 Ga0496108_0039651 Ga0496108_0039651_1890_2366 157
120 3300048916 Ga0496113_0114650 Ga0496113_0114650_36_512 157
121 3300048917 Ga0496114_0037886 Ga0496114_0037886_2732_3208 157
122 3300048918 Ga0496115_0109423 Ga0496115_0109423_1236_1712 157
123 3300048918 Ga0496115_0444017 Ga0496115_0444017_230_706 157
124 3300048918 Ga0496115_0910449 Ga0496115_0910449_112_588 157
125 3300048921 Ga0496118_0096208 Ga0496118_0096208_576_1052 157
126 3300048929 Ga0496126_0242181 Ga0496126_0242181_679_1155 157
127 3300048929 Ga0496126_0267846 Ga0496126_0267846_529_1005 157
128 3300053178 Ga0500637_0076292 Ga0500637_0076292_53_529 157
129 3300005327 Ga0070658_10014893 Ga0070658_100148932 158
130 3300005329 Ga0070683_100023757 Ga0070683_1000237579 158
131 3300005329 Ga0070683_100026678 Ga0070683_1000266782 158
132 3300005339 Ga0070660_100002091 Ga0070660_10000209110 158
133 3300005344 Ga0070661_100380440 Ga0070661_1003804402 158
134 3300005366 Ga0070659_100379757 Ga0070659_1003797571 158
135 3300005434 Ga0070709_10003366 Ga0070709_100033667 158
136 3300005434 Ga0070709_10992061 Ga0070709_109920611 158
137 3300005435 Ga0070714_100077968 Ga0070714_1000779683 158
138 3300005437 Ga0070710_10030798 Ga0070710_100307983 158
139 3300005439 Ga0070711_100015345 Ga0070711_1000153453 158
140 3300005458 Ga0070681_10233050 Ga0070681_102330501 158
141 3300005467 Ga0070706_100585893 Ga0070706_1005858931 158
142 3300005471 Ga0070698_100904999 Ga0070698_1009049991 158
143 3300005530 Ga0070679_100038806 Ga0070679_1000388065 158
144 3300005535 Ga0070684_100004519 Ga0070684_1000045194 158
145 3300005535 Ga0070684_100016992 Ga0070684_1000169924 158
146 3300005536 Ga0070697_100399205 Ga0070697_1003992052 158
147 3300005545 Ga0070695_100889492 Ga0070695_1008894921 158
148 3300005563 Ga0068855_100494392 Ga0068855_1004943922 158
149 3300005577 Ga0068857_100021483 Ga0068857_1000214837 158
150 3300005577 Ga0068857_100272157 Ga0068857_1002721572 158
151 3300005614 Ga0068856_100014372 Ga0068856_1000143726 158
152 3300005616 Ga0068852_100004787 Ga0068852_1000047875 158
153 3300005983 Ga0081540_1117597 Ga0081540_11175972 158
154 3300006028 Ga0070717_10000269 Ga0070717_1000026918 158
155 3300006028 Ga0070717_10239814 Ga0070717_102398142 158
156 3300006163 Ga0070715_10009248 Ga0070715_100092482 158
157 3300006173 Ga0070716_100054308 Ga0070716_1000543082 158
158 3300006175 Ga0070712_100006808 Ga0070712_1000068087 158
159 3300009093 Ga0105240_10002943 Ga0105240_100029439 158
160 3300009545 Ga0105237_10083496 Ga0105237_100834963 158
161 3300009551 Ga0105238_10006820 Ga0105238_100068205 158
162 3300010375 Ga0105239_10013186 Ga0105239_100131865 158
163 3300013104 Ga0157370_10019039 Ga0157370_100190392 158
164 3300013105 Ga0157369_10006724 Ga0157369_100067249 158
165 3300013105 Ga0157369_10749753 Ga0157369_107497533 158
166 3300014968 Ga0157379_11068753 Ga0157379_110687531 158
167 3300021441 Ga0213871_10150037 Ga0213871_101500371 158
168 3300025910 Ga0207684_10235799 Ga0207684_102357992 158
169 3300025912 Ga0207707_10004049 Ga0207707_100040497 158
170 3300025913 Ga0207695_10158317 Ga0207695_101583172 158
171 3300025914 Ga0207671_10060067 Ga0207671_100600672 158
172 3300025915 Ga0207693_10036569 Ga0207693_100365693 158
173 3300025916 Ga0207663_10053409 Ga0207663_100534092 158
174 3300025917 Ga0207660_10039770 Ga0207660_100397703 158
175 3300025919 Ga0207657_10003634 Ga0207657_1000363415 158
176 3300025919 Ga0207657_10322449 Ga0207657_103224491 158
177 3300025920 Ga0207649_10105847 Ga0207649_101058471 158
178 3300025921 Ga0207652_10002638 Ga0207652_100026389 158
179 3300025924 Ga0207694_11317947 Ga0207694_113179471 158
180 3300025929 Ga0207664_10055752 Ga0207664_100557523 158
181 3300025929 Ga0207664_10280396 Ga0207664_102803961 158
182 3300025939 Ga0207665_10035091 Ga0207665_100350913 158
183 3300025944 Ga0207661_10001804 Ga0207661_100018046 158
184 3300025944 Ga0207661_10007278 Ga0207661_100072784 158
185 3300025949 Ga0207667_10008204 Ga0207667_100082045 158
186 3300025981 Ga0207640_11044766 Ga0207640_110447661 158
187 3300026116 Ga0207674_10003708 Ga0207674_1000370817 158
188 3300026142 Ga0207698_10117280 Ga0207698_101172802 158
189 3300031235 Ga0265330_10021122 Ga0265330_100211223 158
190 3300031235 Ga0265330_10023914 Ga0265330_100239142 158
191 3300031235 Ga0265330_10070163 Ga0265330_100701632 158
192 3300031238 Ga0265332_10118417 Ga0265332_101184172 158
193 3300031238 Ga0265332_10207671 Ga0265332_102076711 158
194 3300031241 Ga0265325_10035551 Ga0265325_100355513 158
195 3300031247 Ga0265340_10000884 Ga0265340_1000088413 158
196 3300031247 Ga0265340_10035059 Ga0265340_100350592 158
197 3300031249 Ga0265339_10004328 Ga0265339_100043288 158
198 3300031249 Ga0265339_10083650 Ga0265339_100836501 158
199 3300031344 Ga0265316_10359186 Ga0265316_103591862 158
200 3300031595 Ga0265313_10041621 Ga0265313_100416212 158
201 3300031616 Ga0307508_10000108 Ga0307508_1000010865 158
202 3300031711 Ga0265314_10124640 Ga0265314_101246402 158
203 3300031712 Ga0265342_10147385 Ga0265342_101473852 158
204 3300035111 Ga0373923_0060610 Ga0373923_0060610_940_1419 158
205 3300035695 Ga0373927_0235163 Ga0373927_0235163_414_935 158
206 3300036401 Ga0373937_0078308 Ga0373937_0078308_1342_1821 158
207 3300037853 Ga0436364_1450038 Ga0436364_1450038_1065_1550 158
208 3300039437 Ga0436365_1582279 Ga0436365_1582279_61_546 158
209 3300039438 Ga0436360_0023737 Ga0436360_0023737_821_1297 158
210 3300039450 Ga0436363_0159943 Ga0436363_0159943_437_922 158
211 3300046524 Ga0495648_0001251 Ga0495648_0001251_3711_4190 158
212 3300046543 Ga0495645_0123252 Ga0495645_0123252_717_1238 158
213 3300046679 Ga0495623_0218694 Ga0495623_0218694_371_850 158
214 3300046689 Ga0495613_0782777 Ga0495613_0782777_46_528 158
215 3300047315 Ga0495581_0602697 Ga0495581_0602697_120_599 158
216 3300047317 Ga0495604_0265593 Ga0495604_0265593_633_1154 158
217 3300047319 Ga0495674_0198480 Ga0495674_0198480_541_1062 158
218 3300048929 Ga0496126_0073518 Ga0496126_0073518_33_512 158
219 3300049580 Ga0501046_0019136 Ga0501046_0019136_4336_4815 158
220 3300049581 Ga0501047_0020926 Ga0501047_0020926_2659_3153 158
221 3300049586 Ga0501070_0008271 Ga0501070_0008271_5639_6133 158
222 3300049589 Ga0501073_0008815 Ga0501073_0008815_1877_2371 158
223 3300049590 Ga0501074_0015460 Ga0501074_0015460_747_1241 158
224 3300049742 Ga0501080_0016296 Ga0501080_0016296_662_1156 158
225 3300049823 Ga0501044_0017082 Ga0501044_0017082_2379_2873 158
226 3300003322 rootL2_10045963 rootL2_100459632 159
227 3300005435 Ga0070714_100003204 Ga0070714_1000032045 159
228 3300005439 Ga0070711_100014756 Ga0070711_1000147567 159
229 3300006028 Ga0070717_10004197 Ga0070717_100041972 159
230 3300006173 Ga0070716_100024130 Ga0070716_1000241303 159
231 3300025898 Ga0207692_10005362 Ga0207692_100053622 159
232 3300025906 Ga0207699_10090360 Ga0207699_100903602 159
233 3300025915 Ga0207693_10002279 Ga0207693_100022794 159
234 3300025916 Ga0207663_10002139 Ga0207663_100021399 159
235 3300025928 Ga0207700_10016746 Ga0207700_100167464 159
236 3300025929 Ga0207664_10042185 Ga0207664_100421855 159
237 3300025939 Ga0207665_10002452 Ga0207665_100024524 159
238 3300048088 Ga0495602_0671054 Ga0495602_0671054_120_677 159
239 3300053096 Ga0500641_0013194 Ga0500641_0013194_1691_2176 159
240 3300005439 Ga0070711_100342468 Ga0070711_1003424682 160
241 3300025900 Ga0207710_10136584 Ga0207710_101365842 160
242 3300035118 Ga0373954_0024673 Ga0373954_0024673_772_1365 160
243 3300046543 Ga0495645_0110908 Ga0495645_0110908_94_687 160
244 3300046678 Ga0495599_0008234 Ga0495599_0008234_410_1003 160
245 3300053078 Ga0495612_0038738 Ga0495612_0038738_935_1528 160
246 3300053084 Ga0495595_0067844 Ga0495595_0067844_34_522 160
247 3300033180 Ga0307510_10200456 Ga0307510_102004562 161
248 3300048924 Ga0496121_0216414 Ga0496121_0216414_690_1181 162
249 3300053078 Ga0495612_0179654 Ga0495612_0179654_122_619 162
250 iso_pu_bacteria 2904690495 2904691119 162
251 iso_pu_bacteria 2908756301 2908756513 162
252 3300010159 Ga0099796_10011515 Ga0099796_100115152 163
253 3300046460 Ga0495638_0134796 Ga0495638_0134796_175_672 163
254 3300053092 Ga0500583_0011614 Ga0500583_0011614_376_873 163
255 3300053118 Ga0500594_0025287 Ga0500594_0025287_979_1476 163
256 3300053142 Ga0500577_0077432 Ga0500577_0077432_733_1230 163
257 3300053161 Ga0500634_0082379 Ga0500634_0082379_604_1101 163
258 3300003659 JGI25404J52841_10029009 JGI25404J52841_100290092 164
259 3300005356 Ga0070674_100427848 Ga0070674_1004278481 164
260 3300005983 Ga0081540_1018775 Ga0081540_10187751 164
261 3300006038 Ga0075365_10254392 Ga0075365_102543921 164
262 3300006195 Ga0075366_10450007 Ga0075366_104500071 164
263 3300006353 Ga0075370_10561316 Ga0075370_105613161 164
264 3300025297 Ga0209758_1010347 Ga0209758_10103472 164
265 3300025981 Ga0207640_11616702 Ga0207640_116167021 164
266 3300026041 Ga0207639_10572555 Ga0207639_105725552 164
267 3300030522 Ga0307512_10302631 Ga0307512_103026311 164
268 3300041496 Ga0451839_0736368 Ga0451839_0736368_102_599 164
269 3300046473 Ga0495582_0028352 Ga0495582_0028352_1310_1807 164
270 3300046531 Ga0495665_0246776 Ga0495665_0246776_352_849 164
271 3300046533 Ga0495640_0577440 Ga0495640_0577440_59_556 164
272 3300047315 Ga0495581_0131300 Ga0495581_0131300_851_1348 164
273 3300048929 Ga0496126_0117515 Ga0496126_0117515_353_871 164
274 3300053090 Ga0500646_0024926 Ga0500646_0024926_741_1241 164
275 3300053111 Ga0500572_000099 Ga0500572_000099_17537_18055 164
276 3300053136 Ga0500559_0000238 Ga0500559_0000238_10841_11359 164
277 3300053177 Ga0500636_0056756 Ga0500636_0056756_956_1474 164
278 3300053725 Ga0500576_045994 Ga0500576_045994_1209_1727 164
279 3300053735 Ga0500596_002870 Ga0500596_002870_674_1192 164
280 3300005343 Ga0070687_100789260 Ga0070687_1007892601 165
281 3300005347 Ga0070668_100052404 Ga0070668_1000524043 165
282 3300005347 Ga0070668_100052629 Ga0070668_1000526292 165
283 3300005356 Ga0070674_100548676 Ga0070674_1005486761 165
284 3300005367 Ga0070667_100057192 Ga0070667_1000571921 165
285 3300005438 Ga0070701_10087544 Ga0070701_100875441 165
286 3300005441 Ga0070700_100711335 Ga0070700_1007113351 165
287 3300005455 Ga0070663_100858687 Ga0070663_1008586871 165
288 3300005456 Ga0070678_100048833 Ga0070678_1000488334 165
289 3300005456 Ga0070678_100185861 Ga0070678_1001858611 165
290 3300005459 Ga0068867_100049258 Ga0068867_1000492583 165
291 3300005539 Ga0068853_100203859 Ga0068853_1002038591 165
292 3300005543 Ga0070672_100047552 Ga0070672_1000475523 165
293 3300005544 Ga0070686_100069204 Ga0070686_1000692042 165
294 3300005546 Ga0070696_100935292 Ga0070696_1009352921 165
295 3300005718 Ga0068866_10021203 Ga0068866_100212033 165
296 3300005719 Ga0068861_100052249 Ga0068861_1000522492 165
297 3300005843 Ga0068860_100130560 Ga0068860_1001305603 165
298 3300005844 Ga0068862_100259184 Ga0068862_1002591842 165
299 3300006038 Ga0075365_10281124 Ga0075365_102811242 165
300 3300006177 Ga0075362_10124324 Ga0075362_101243242 165
301 3300006237 Ga0097621_100068907 Ga0097621_1000689073 165
302 3300006881 Ga0068865_100017842 Ga0068865_1000178423 165
303 3300006881 Ga0068865_100601009 Ga0068865_1006010091 165
304 3300009094 Ga0111539_10061321 Ga0111539_100613215 165
305 3300009098 Ga0105245_10074999 Ga0105245_100749993 165
306 3300009148 Ga0105243_10045318 Ga0105243_100453181 165
307 3300009176 Ga0105242_10711023 Ga0105242_107110231 165
308 3300009545 Ga0105237_10865440 Ga0105237_108654401 165
309 3300009553 Ga0105249_10262698 Ga0105249_102626982 165
310 3300011119 Ga0105246_10109633 Ga0105246_101096331 165
311 3300013297 Ga0157378_10257569 Ga0157378_102575691 165
312 3300013306 Ga0163162_10455550 Ga0163162_104555501 165
313 3300014326 Ga0157380_10149254 Ga0157380_101492542 165
314 3300014969 Ga0157376_10701271 Ga0157376_107012711 165
315 3300017792 Ga0163161_10080606 Ga0163161_100806063 165
316 3300017792 Ga0163161_10272828 Ga0163161_102728282 165
317 3300025302 Ga0207426_1112741 Ga0207426_11127411 165
318 3300025315 Ga0207697_10023965 Ga0207697_100239652 165
319 3300025899 Ga0207642_10035126 Ga0207642_100351261 165
320 3300025901 Ga0207688_10010585 Ga0207688_100105853 165
321 3300025919 Ga0207657_10210687 Ga0207657_102106871 165
322 3300025927 Ga0207687_10023004 Ga0207687_100230043 165
323 3300025931 Ga0207644_10385830 Ga0207644_103858301 165
324 3300025932 Ga0207690_10891055 Ga0207690_108910551 165
325 3300025933 Ga0207706_10025700 Ga0207706_100257002 165
326 3300025933 Ga0207706_10323700 Ga0207706_103237001 165
327 3300025934 Ga0207686_10366762 Ga0207686_103667622 165
328 3300025935 Ga0207709_10418209 Ga0207709_104182091 165
329 3300025935 Ga0207709_10957997 Ga0207709_109579971 165
330 3300025937 Ga0207669_10055249 Ga0207669_100552492 165
331 3300025938 Ga0207704_10031422 Ga0207704_100314222 165
332 3300025938 Ga0207704_10601907 Ga0207704_106019071 165
333 3300025940 Ga0207691_10060550 Ga0207691_100605503 165
334 3300025941 Ga0207711_10583776 Ga0207711_105837762 165
335 3300025945 Ga0207679_10171579 Ga0207679_101715791 165
336 3300025972 Ga0207668_10073979 Ga0207668_100739794 165
337 3300025972 Ga0207668_10406272 Ga0207668_104062721 165
338 3300025986 Ga0207658_11224375 Ga0207658_112243751 165
339 3300026041 Ga0207639_10238815 Ga0207639_102388152 165
340 3300026067 Ga0207678_10048527 Ga0207678_100485271 165
341 3300026075 Ga0207708_10725563 Ga0207708_107255632 165
342 3300026089 Ga0207648_10117176 Ga0207648_101171763 165
343 3300026118 Ga0207675_100043240 Ga0207675_1000432402 165
344 3300026121 Ga0207683_10043506 Ga0207683_100435064 165
345 3300026121 Ga0207683_10075599 Ga0207683_100755993 165
346 3300027907 Ga0207428_10302262 Ga0207428_103022622 165
347 3300028380 Ga0268265_10120452 Ga0268265_101204522 165
348 3300037418 Ga0395900_0109182 Ga0395900_0109182_371_880 165
349 3300038443 Ga0395901_1068423 Ga0395901_1068423_21_530 165
350 3300045976 Ga0466967_0682013 Ga0466967_0682013_430_939 165
351 3300046506 Ga0495583_0210154 Ga0495583_0210154_141_644 165
352 3300046615 Ga0495656_0009022 Ga0495656_0009022_2830_3333 165
353 3300046664 Ga0495659_0058120 Ga0495659_0058120_165_668 165
354 3300046684 Ga0495669_0015183 Ga0495669_0015183_140_643 165
355 3300046684 Ga0495669_0170181 Ga0495669_0170181_486_986 165
356 3300046684 Ga0495669_0316731 Ga0495669_0316731_227_730 165
357 3300047447 Ga0495685_086272 Ga0495685_086272_468_971 165
358 3300047472 Ga0495686_0127380 Ga0495686_0127380_80_583 165
359 3300048905 Ga0496102_0339395 Ga0496102_0339395_814_1317 165
360 3300048909 Ga0496106_0257845 Ga0496106_0257845_539_1042 165
361 3300048910 Ga0496107_0092416 Ga0496107_0092416_246_749 165
362 3300048917 Ga0496114_0063296 Ga0496114_0063296_242_745 165
363 3300049568 Ga0501031_0160646 Ga0501031_0160646_942_1445 165
364 3300049573 Ga0501037_0249504 Ga0501037_0249504_718_1221 165
365 3300049574 Ga0501038_0561556 Ga0501038_0561556_125_628 165
366 3300049587 Ga0501071_0392019 Ga0501071_0392019_349_852 165
367 3300049592 Ga0501076_0146208 Ga0501076_0146208_1184_1687 165
368 3300049741 Ga0501079_0385992 Ga0501079_0385992_38_541 165
369 3300049742 Ga0501080_0249895 Ga0501080_0249895_337_840 165
370 3300049824 Ga0501045_0379058 Ga0501045_0379058_254_757 165
371 3300049824 Ga0501045_0471835 Ga0501045_0471835_15_518 165
372 3300050492 nmdc:mga0yw44_971088_c1 nmdc:mga0yw44_971088_c1_49_552 165
373 3300050511 nmdc:mga08y16_66686_c1 nmdc:mga08y16_66686_c1_536_1039 165
374 3300053083 Ga0495655_0074640 Ga0495655_0074640_148_648 165
375 3300053139 Ga0500568_0206216 Ga0500568_0206216_78_581 165
376 3300054114 Ga0501084_1047699 Ga0501084_1047699_134_637 165
377 3300060353 Ga0501082_0355885 Ga0501082_0355885_264_767 165
378 3300003203 JGI25406J46586_10012434 JGI25406J46586_100124342 166
379 3300003322 rootL2_10110173 rootL2_101101733 166
380 3300003659 JGI25404J52841_10003473 JGI25404J52841_100034733 166
381 3300003659 JGI25404J52841_10014495 JGI25404J52841_100144952 166
382 3300003659 JGI25404J52841_10017249 JGI25404J52841_100172492 166
383 3300003911 JGI25405J52794_10029568 JGI25405J52794_100295682 166
384 3300003911 JGI25405J52794_10038265 JGI25405J52794_100382652 166
385 3300005327 Ga0070658_10161129 Ga0070658_101611292 166
386 3300005327 Ga0070658_10207026 Ga0070658_102070261 166
387 3300005328 Ga0070676_10269668 Ga0070676_102696681 166
388 3300005334 Ga0068869_100153340 Ga0068869_1001533402 166
389 3300005334 Ga0068869_100272752 Ga0068869_1002727522 166
390 3300005334 Ga0068869_101690795 Ga0068869_1016907951 166
391 3300005336 Ga0070680_100081500 Ga0070680_1000815001 166
392 3300005338 Ga0068868_100034114 Ga0068868_1000341141 166
393 3300005339 Ga0070660_100207546 Ga0070660_1002075461 166
394 3300005340 Ga0070689_100446774 Ga0070689_1004467741 166
395 3300005340 Ga0070689_101212350 Ga0070689_1012123501 166
396 3300005343 Ga0070687_101264114 Ga0070687_1012641141 166
397 3300005347 Ga0070668_100038776 Ga0070668_1000387762 166
398 3300005347 Ga0070668_100065717 Ga0070668_1000657172 166
399 3300005347 Ga0070668_100081584 Ga0070668_1000815843 166
400 3300005347 Ga0070668_100093078 Ga0070668_1000930782 166
401 3300005353 Ga0070669_100112510 Ga0070669_1001125101 166
402 3300005354 Ga0070675_100166479 Ga0070675_1001664792 166
403 3300005354 Ga0070675_100214135 Ga0070675_1002141352 166
404 3300005354 Ga0070675_100246901 Ga0070675_1002469012 166
405 3300005354 Ga0070675_100524883 Ga0070675_1005248832 166
406 3300005355 Ga0070671_100139781 Ga0070671_1001397812 166
407 3300005355 Ga0070671_100615204 Ga0070671_1006152042 166
408 3300005356 Ga0070674_100461309 Ga0070674_1004613092 166
409 3300005356 Ga0070674_100781989 Ga0070674_1007819892 166
410 3300005364 Ga0070673_100197544 Ga0070673_1001975442 166
411 3300005364 Ga0070673_100284219 Ga0070673_1002842192 166
412 3300005364 Ga0070673_101336580 Ga0070673_1013365801 166
413 3300005365 Ga0070688_100183024 Ga0070688_1001830241 166
414 3300005365 Ga0070688_100574830 Ga0070688_1005748301 166
415 3300005366 Ga0070659_100100796 Ga0070659_1001007962 166
416 3300005367 Ga0070667_100599446 Ga0070667_1005994461 166
417 3300005436 Ga0070713_100289224 Ga0070713_1002892242 166
418 3300005437 Ga0070710_10237258 Ga0070710_102372582 166
419 3300005441 Ga0070700_100150599 Ga0070700_1001505991 166
420 3300005441 Ga0070700_100822968 Ga0070700_1008229681 166
421 3300005455 Ga0070663_100011469 Ga0070663_1000114691 166
422 3300005455 Ga0070663_100022407 Ga0070663_1000224072 166
423 3300005455 Ga0070663_100082416 Ga0070663_1000824162 166
424 3300005455 Ga0070663_100204768 Ga0070663_1002047682 166
425 3300005456 Ga0070678_100011085 Ga0070678_1000110852 166
426 3300005456 Ga0070678_100064850 Ga0070678_1000648503 166
427 3300005456 Ga0070678_100152067 Ga0070678_1001520672 166
428 3300005456 Ga0070678_100159924 Ga0070678_1001599242 166
429 3300005457 Ga0070662_100097724 Ga0070662_1000977243 166
430 3300005458 Ga0070681_10041643 Ga0070681_100416435 166
431 3300005459 Ga0068867_100393149 Ga0068867_1003931492 166
432 3300005459 Ga0068867_100407017 Ga0068867_1004070171 166
433 3300005459 Ga0068867_100603275 Ga0068867_1006032752 166
434 3300005466 Ga0070685_10132615 Ga0070685_101326152 166
435 3300005466 Ga0070685_10296082 Ga0070685_102960821 166
436 3300005467 Ga0070706_101528771 Ga0070706_1015287711 166
437 3300005471 Ga0070698_101814548 Ga0070698_1018145481 166
438 3300005518 Ga0070699_100506767 Ga0070699_1005067671 166
439 3300005530 Ga0070679_100028386 Ga0070679_1000283864 166
440 3300005535 Ga0070684_100159841 Ga0070684_1001598411 166
441 3300005535 Ga0070684_100752393 Ga0070684_1007523931 166
442 3300005539 Ga0068853_100430451 Ga0068853_1004304512 166
443 3300005539 Ga0068853_101055805 Ga0068853_1010558051 166
444 3300005543 Ga0070672_100119640 Ga0070672_1001196402 166
445 3300005543 Ga0070672_100382019 Ga0070672_1003820192 166
446 3300005544 Ga0070686_100181281 Ga0070686_1001812813 166
447 3300005548 Ga0070665_100038779 Ga0070665_1000387794 166
448 3300005548 Ga0070665_100084569 Ga0070665_1000845694 166
449 3300005548 Ga0070665_100143395 Ga0070665_1001433952 166
450 3300005548 Ga0070665_100159117 Ga0070665_1001591175 166
451 3300005548 Ga0070665_100227433 Ga0070665_1002274333 166
452 3300005548 Ga0070665_100487636 Ga0070665_1004876363 166
453 3300005563 Ga0068855_100021984 Ga0068855_1000219842 166
454 3300005563 Ga0068855_100039709 Ga0068855_1000397093 166
455 3300005563 Ga0068855_100111720 Ga0068855_1001117204 166
456 3300005564 Ga0070664_100118017 Ga0070664_1001180173 166
457 3300005577 Ga0068857_100268057 Ga0068857_1002680572 166
458 3300005577 Ga0068857_100493160 Ga0068857_1004931602 166
459 3300005578 Ga0068854_100010964 Ga0068854_1000109643 166
460 3300005578 Ga0068854_100661758 Ga0068854_1006617581 166
461 3300005614 Ga0068856_100000540 Ga0068856_1000005404 166
462 3300005614 Ga0068856_100288133 Ga0068856_1002881332 166
463 3300005614 Ga0068856_100447966 Ga0068856_1004479662 166
464 3300005615 Ga0070702_100617486 Ga0070702_1006174861 166
465 3300005615 Ga0070702_101000616 Ga0070702_1010006161 166
466 3300005616 Ga0068852_100123844 Ga0068852_1001238442 166
467 3300005617 Ga0068859_100200649 Ga0068859_1002006492 166
468 3300005617 Ga0068859_100201023 Ga0068859_1002010232 166
469 3300005618 Ga0068864_100378585 Ga0068864_1003785851 166
470 3300005618 Ga0068864_100396125 Ga0068864_1003961251 166
471 3300005718 Ga0068866_10353099 Ga0068866_103530992 166
472 3300005719 Ga0068861_100194902 Ga0068861_1001949022 166
473 3300005840 Ga0068870_10063270 Ga0068870_100632702 166
474 3300005842 Ga0068858_100049531 Ga0068858_1000495315 166
475 3300005842 Ga0068858_100063701 Ga0068858_1000637014 166
476 3300005842 Ga0068858_100085133 Ga0068858_1000851333 166
477 3300005842 Ga0068858_100249542 Ga0068858_1002495422 166
478 3300005843 Ga0068860_100233797 Ga0068860_1002337972 166
479 3300005843 Ga0068860_100333779 Ga0068860_1003337792 166
480 3300005843 Ga0068860_100528878 Ga0068860_1005288783 166
481 3300005844 Ga0068862_100037181 Ga0068862_1000371815 166
482 3300005844 Ga0068862_100551300 Ga0068862_1005513002 166
483 3300005937 Ga0081455_10003799 Ga0081455_100037999 166
484 3300005937 Ga0081455_10016122 Ga0081455_100161227 166
485 3300005937 Ga0081455_10023378 Ga0081455_100233782 166
486 3300005937 Ga0081455_10024424 Ga0081455_100244247 166
487 3300005981 Ga0081538_10022806 Ga0081538_100228063 166
488 3300005983 Ga0081540_1001162 Ga0081540_100116222 166
489 3300005983 Ga0081540_1005031 Ga0081540_10050315 166
490 3300005983 Ga0081540_1007496 Ga0081540_10074966 166
491 3300005983 Ga0081540_1009260 Ga0081540_10092608 166
492 3300005983 Ga0081540_1012233 Ga0081540_10122336 166
493 3300005983 Ga0081540_1074124 Ga0081540_10741242 166
494 3300005983 Ga0081540_1123230 Ga0081540_11232301 166
495 3300005985 Ga0081539_10000966 Ga0081539_1000096628 166
496 3300005985 Ga0081539_10046027 Ga0081539_100460272 166
497 3300006038 Ga0075365_10007222 Ga0075365_100072226 166
498 3300006038 Ga0075365_10055244 Ga0075365_100552442 166
499 3300006038 Ga0075365_10104789 Ga0075365_101047892 166
500 3300006038 Ga0075365_10200035 Ga0075365_102000352 166
501 3300006042 Ga0075368_10212815 Ga0075368_102128152 166
502 3300006042 Ga0075368_10279892 Ga0075368_102798921 166
503 3300006048 Ga0075363_100016896 Ga0075363_1000168965 166
504 3300006048 Ga0075363_100028560 Ga0075363_1000285602 166
505 3300006048 Ga0075363_100053851 Ga0075363_1000538511 166
506 3300006048 Ga0075363_100277746 Ga0075363_1002777461 166
507 3300006051 Ga0075364_10031529 Ga0075364_100315293 166
508 3300006051 Ga0075364_10305866 Ga0075364_103058662 166
509 3300006051 Ga0075364_10455731 Ga0075364_104557311 166
510 3300006163 Ga0070715_10213412 Ga0070715_102134122 166
511 3300006173 Ga0070716_100330371 Ga0070716_1003303711 166
512 3300006175 Ga0070712_100105562 Ga0070712_1001055621 166
513 3300006177 Ga0075362_10017408 Ga0075362_100174083 166
514 3300006177 Ga0075362_10091355 Ga0075362_100913553 166
515 3300006177 Ga0075362_10187535 Ga0075362_101875352 166
516 3300006178 Ga0075367_10204281 Ga0075367_102042811 166
517 3300006178 Ga0075367_10421047 Ga0075367_104210471 166
518 3300006186 Ga0075369_10016235 Ga0075369_100162352 166
519 3300006186 Ga0075369_10034714 Ga0075369_100347143 166
520 3300006186 Ga0075369_10148024 Ga0075369_101480242 166
521 3300006186 Ga0075369_10157110 Ga0075369_101571102 166
522 3300006195 Ga0075366_10030691 Ga0075366_100306913 166
523 3300006195 Ga0075366_10137217 Ga0075366_101372172 166
524 3300006237 Ga0097621_100094411 Ga0097621_1000944112 166
525 3300006353 Ga0075370_10021423 Ga0075370_100214235 166
526 3300006353 Ga0075370_10131295 Ga0075370_101312952 166
527 3300006353 Ga0075370_10377985 Ga0075370_103779851 166
528 3300006358 Ga0068871_100564787 Ga0068871_1005647872 166
529 3300006358 Ga0068871_100945052 Ga0068871_1009450522 166
530 3300006844 Ga0075428_100125897 Ga0075428_1001258972 166
531 3300006871 Ga0075434_100315212 Ga0075434_1003152122 166
532 3300006880 Ga0075429_100459510 Ga0075429_1004595102 166
533 3300006881 Ga0068865_100129004 Ga0068865_1001290042 166
534 3300006881 Ga0068865_100587428 Ga0068865_1005874281 166
535 3300006881 Ga0068865_100647124 Ga0068865_1006471241 166
536 3300006881 Ga0068865_100807603 Ga0068865_1008076032 166
537 3300006914 Ga0075436_100637026 Ga0075436_1006370261 166
538 3300006931 Ga0097620_100200641 Ga0097620_1002006411 166
539 3300006931 Ga0097620_100201032 Ga0097620_1002010322 166
540 3300006942 Ga0099824_1006119 Ga0099824_100611919 166
541 3300006943 Ga0099822_1014043 Ga0099822_10140439 166
542 3300007788 Ga0099795_10006732 Ga0099795_100067323 166
543 3300007788 Ga0099795_10012369 Ga0099795_100123693 166
544 3300009093 Ga0105240_10113703 Ga0105240_101137031 166
545 3300009098 Ga0105245_10181113 Ga0105245_101811132 166
546 3300009098 Ga0105245_10337206 Ga0105245_103372061 166
547 3300009101 Ga0105247_10028777 Ga0105247_100287771 166
548 3300009101 Ga0105247_10078744 Ga0105247_100787442 166
549 3300009101 Ga0105247_10140941 Ga0105247_101409411 166
550 3300009148 Ga0105243_10539593 Ga0105243_105395931 166
551 3300009148 Ga0105243_10619255 Ga0105243_106192552 166
552 3300009174 Ga0105241_10125496 Ga0105241_101254962 166
553 3300009176 Ga0105242_10039799 Ga0105242_100397993 166
554 3300009177 Ga0105248_10023017 Ga0105248_100230174 166
555 3300009177 Ga0105248_10314212 Ga0105248_103142122 166
556 3300009177 Ga0105248_11020580 Ga0105248_110205802 166
557 3300009545 Ga0105237_10528926 Ga0105237_105289261 166
558 3300009551 Ga0105238_10087183 Ga0105238_100871832 166
559 3300009551 Ga0105238_10213127 Ga0105238_102131272 166
560 3300009553 Ga0105249_10416025 Ga0105249_104160251 166
561 3300009553 Ga0105249_11715565 Ga0105249_117155652 166
562 3300010159 Ga0099796_10219691 Ga0099796_102196911 166
563 3300010375 Ga0105239_10039840 Ga0105239_100398404 166
564 3300010375 Ga0105239_10060392 Ga0105239_100603922 166
565 3300010375 Ga0105239_10073624 Ga0105239_100736243 166
566 3300010375 Ga0105239_10146156 Ga0105239_101461563 166
567 3300010375 Ga0105239_10592338 Ga0105239_105923382 166
568 3300011119 Ga0105246_10004242 Ga0105246_100042425 166
569 3300011119 Ga0105246_10061626 Ga0105246_100616262 166
570 3300011119 Ga0105246_10425285 Ga0105246_104252851 166
571 3300012483 Ga0157337_1019336 Ga0157337_10193361 166
572 3300013104 Ga0157370_10055288 Ga0157370_100552882 166
573 3300013105 Ga0157369_11179679 Ga0157369_111796792 166
574 3300013296 Ga0157374_10110606 Ga0157374_101106063 166
575 3300013297 Ga0157378_10119537 Ga0157378_101195373 166
576 3300013297 Ga0157378_10177987 Ga0157378_101779871 166
577 3300013297 Ga0157378_10344116 Ga0157378_103441162 166
578 3300013297 Ga0157378_11639592 Ga0157378_116395921 166
579 3300013306 Ga0163162_10007574 Ga0163162_100075745 166
580 3300013306 Ga0163162_10315174 Ga0163162_103151742 166
581 3300013306 Ga0163162_11197798 Ga0163162_111977981 166
582 3300013307 Ga0157372_12623184 Ga0157372_126231841 166
583 3300013308 Ga0157375_10247981 Ga0157375_102479812 166
584 3300013308 Ga0157375_10272575 Ga0157375_102725752 166
585 3300013308 Ga0157375_10292148 Ga0157375_102921482 166
586 3300013308 Ga0157375_11010552 Ga0157375_110105521 166
587 3300014325 Ga0163163_10068804 Ga0163163_100688043 166
588 3300014325 Ga0163163_10088341 Ga0163163_100883413 166
589 3300014325 Ga0163163_10237236 Ga0163163_102372362 166
590 3300014325 Ga0163163_10322212 Ga0163163_103222121 166
591 3300014325 Ga0163163_10882382 Ga0163163_108823821 166
592 3300014325 Ga0163163_11046677 Ga0163163_110466771 166
593 3300014326 Ga0157380_10027065 Ga0157380_100270653 166
594 3300014326 Ga0157380_10332147 Ga0157380_103321471 166
595 3300014326 Ga0157380_11081999 Ga0157380_110819991 166
596 3300014326 Ga0157380_11411552 Ga0157380_114115522 166
597 3300014745 Ga0157377_10131013 Ga0157377_101310131 166
598 3300014745 Ga0157377_10735503 Ga0157377_107355031 166
599 3300014745 Ga0157377_10750139 Ga0157377_107501391 166
600 3300014968 Ga0157379_10192840 Ga0157379_101928402 166
601 3300014969 Ga0157376_10110109 Ga0157376_101101091 166
602 3300014969 Ga0157376_10147227 Ga0157376_101472272 166
603 3300015262 Ga0182007_10167031 Ga0182007_101670311 166
604 3300017792 Ga0163161_10573798 Ga0163161_105737982 166
605 3300025261 Ga0209233_1023807 Ga0209233_10238072 166
606 3300025297 Ga0209758_1006028 Ga0209758_10060285 166
607 3300025297 Ga0209758_1070185 Ga0209758_10701852 166
608 3300025315 Ga0207697_10013036 Ga0207697_100130362 166
609 3300025899 Ga0207642_10157253 Ga0207642_101572531 166
610 3300025899 Ga0207642_10409132 Ga0207642_104091321 166
611 3300025900 Ga0207710_10028750 Ga0207710_100287501 166
612 3300025900 Ga0207710_10070899 Ga0207710_100708992 166
613 3300025900 Ga0207710_10108829 Ga0207710_101088292 166
614 3300025900 Ga0207710_10112693 Ga0207710_101126932 166
615 3300025901 Ga0207688_10026527 Ga0207688_100265272 166
616 3300025901 Ga0207688_10046897 Ga0207688_100468973 166
617 3300025901 Ga0207688_10061701 Ga0207688_100617012 166
618 3300025901 Ga0207688_10263506 Ga0207688_102635062 166
619 3300025903 Ga0207680_10393967 Ga0207680_103939672 166
620 3300025904 Ga0207647_10100687 Ga0207647_101006871 166
621 3300025907 Ga0207645_10442535 Ga0207645_104425351 166
622 3300025908 Ga0207643_10186796 Ga0207643_101867962 166
623 3300025909 Ga0207705_10357472 Ga0207705_103574722 166
624 3300025911 Ga0207654_10096908 Ga0207654_100969082 166
625 3300025911 Ga0207654_10129163 Ga0207654_101291632 166
626 3300025912 Ga0207707_10084173 Ga0207707_100841732 166
627 3300025913 Ga0207695_10308117 Ga0207695_103081172 166
628 3300025914 Ga0207671_10163465 Ga0207671_101634652 166
629 3300025914 Ga0207671_11221270 Ga0207671_112212701 166
630 3300025915 Ga0207693_10037840 Ga0207693_100378401 166
631 3300025917 Ga0207660_10258781 Ga0207660_102587811 166
632 3300025919 Ga0207657_10092864 Ga0207657_100928643 166
633 3300025920 Ga0207649_10379231 Ga0207649_103792311 166
634 3300025921 Ga0207652_10097756 Ga0207652_100977562 166
635 3300025923 Ga0207681_10100674 Ga0207681_101006741 166
636 3300025924 Ga0207694_10112473 Ga0207694_101124732 166
637 3300025925 Ga0207650_10328321 Ga0207650_103283212 166
638 3300025925 Ga0207650_10473929 Ga0207650_104739292 166
639 3300025925 Ga0207650_10477105 Ga0207650_104771051 166
640 3300025925 Ga0207650_10777394 Ga0207650_107773941 166
641 3300025926 Ga0207659_10159889 Ga0207659_101598892 166
642 3300025926 Ga0207659_10223616 Ga0207659_102236161 166
643 3300025926 Ga0207659_10324128 Ga0207659_103241281 166
644 3300025926 Ga0207659_10569531 Ga0207659_105695312 166
645 3300025927 Ga0207687_10024543 Ga0207687_100245432 166
646 3300025927 Ga0207687_10871268 Ga0207687_108712681 166
647 3300025931 Ga0207644_10438468 Ga0207644_104384683 166
648 3300025931 Ga0207644_11229092 Ga0207644_112290921 166
649 3300025933 Ga0207706_10088312 Ga0207706_100883123 166
650 3300025935 Ga0207709_10413595 Ga0207709_104135952 166
651 3300025935 Ga0207709_10954767 Ga0207709_109547671 166
652 3300025937 Ga0207669_10300119 Ga0207669_103001192 166
653 3300025938 Ga0207704_10178562 Ga0207704_101785622 166
654 3300025938 Ga0207704_10646143 Ga0207704_106461432 166
655 3300025939 Ga0207665_10066823 Ga0207665_100668231 166
656 3300025939 Ga0207665_10203579 Ga0207665_102035791 166
657 3300025940 Ga0207691_10058603 Ga0207691_100586033 166
658 3300025940 Ga0207691_10313472 Ga0207691_103134721 166
659 3300025941 Ga0207711_10155096 Ga0207711_101550962 166
660 3300025941 Ga0207711_10217312 Ga0207711_102173122 166
661 3300025942 Ga0207689_10196723 Ga0207689_101967232 166
662 3300025945 Ga0207679_10103763 Ga0207679_101037634 166
663 3300025949 Ga0207667_10046583 Ga0207667_100465833 166
664 3300025949 Ga0207667_10391628 Ga0207667_103916281 166
665 3300025949 Ga0207667_10539508 Ga0207667_105395081 166
666 3300025960 Ga0207651_10292405 Ga0207651_102924052 166
667 3300025960 Ga0207651_10514015 Ga0207651_105140152 166
668 3300025972 Ga0207668_10186108 Ga0207668_101861081 166
669 3300025972 Ga0207668_10557764 Ga0207668_105577642 166
670 3300025981 Ga0207640_10011851 Ga0207640_100118513 166
671 3300025981 Ga0207640_10714416 Ga0207640_107144161 166
672 3300026023 Ga0207677_10028438 Ga0207677_100284382 166
673 3300026023 Ga0207677_10117463 Ga0207677_101174632 166
674 3300026035 Ga0207703_10034719 Ga0207703_100347192 166
675 3300026035 Ga0207703_10186095 Ga0207703_101860951 166
676 3300026035 Ga0207703_10409057 Ga0207703_104090572 166
677 3300026035 Ga0207703_10475113 Ga0207703_104751131 166
678 3300026041 Ga0207639_10078976 Ga0207639_100789762 166
679 3300026041 Ga0207639_10599694 Ga0207639_105996942 166
680 3300026041 Ga0207639_11129528 Ga0207639_111295281 166
681 3300026067 Ga0207678_10024550 Ga0207678_100245504 166
682 3300026067 Ga0207678_10093941 Ga0207678_100939413 166
683 3300026067 Ga0207678_10094956 Ga0207678_100949563 166
684 3300026067 Ga0207678_10199547 Ga0207678_101995472 166
685 3300026067 Ga0207678_10289318 Ga0207678_102893182 166
686 3300026078 Ga0207702_10003075 Ga0207702_100030754 166
687 3300026078 Ga0207702_10363622 Ga0207702_103636222 166
688 3300026088 Ga0207641_10380706 Ga0207641_103807062 166
689 3300026088 Ga0207641_10656443 Ga0207641_106564432 166
690 3300026089 Ga0207648_10111099 Ga0207648_101110992 166
691 3300026089 Ga0207648_10529890 Ga0207648_105298901 166
692 3300026095 Ga0207676_10338008 Ga0207676_103380081 166
693 3300026116 Ga0207674_10033510 Ga0207674_100335105 166
694 3300026116 Ga0207674_10400024 Ga0207674_104000241 166
695 3300026118 Ga0207675_100048585 Ga0207675_1000485852 166
696 3300026121 Ga0207683_10019513 Ga0207683_100195138 166
697 3300026121 Ga0207683_10051303 Ga0207683_100513033 166
698 3300026121 Ga0207683_10102080 Ga0207683_101020802 166
699 3300026121 Ga0207683_10198600 Ga0207683_101986002 166
700 3300026121 Ga0207683_10387816 Ga0207683_103878161 166
701 3300026121 Ga0207683_10692265 Ga0207683_106922652 166
702 3300026121 Ga0207683_10911092 Ga0207683_109110921 166
703 3300026142 Ga0207698_10174301 Ga0207698_101743012 166
704 3300027357 Ga0209589_1000021 Ga0209589_100002135 166
705 3300027361 Ga0209489_100028 Ga0209489_10002835 166
706 3300027363 Ga0209700_100037 Ga0209700_10003735 166
707 3300027866 Ga0209813_10090542 Ga0209813_100905421 166
708 3300028379 Ga0268266_10000680 Ga0268266_100006804 166
709 3300028379 Ga0268266_10002169 Ga0268266_100021693 166
710 3300028379 Ga0268266_10024779 Ga0268266_100247798 166
711 3300028379 Ga0268266_10096578 Ga0268266_100965783 166
712 3300028379 Ga0268266_10098886 Ga0268266_100988862 166
713 3300028379 Ga0268266_10133948 Ga0268266_101339482 166
714 3300028379 Ga0268266_10508727 Ga0268266_105087271 166
715 3300028380 Ga0268265_10028819 Ga0268265_100288195 166
716 3300028380 Ga0268265_10498026 Ga0268265_104980261 166
717 3300028380 Ga0268265_10727038 Ga0268265_107270381 166
718 3300028381 Ga0268264_10211583 Ga0268264_102115831 166
719 3300028381 Ga0268264_10360833 Ga0268264_103608332 166
720 3300028381 Ga0268264_11005879 Ga0268264_110058792 166
721 3300028786 Ga0307517_10000175 Ga0307517_1000017526 166
722 3300028794 Ga0307515_10093325 Ga0307515_100933252 166
723 3300028794 Ga0307515_10280782 Ga0307515_102807821 166
724 3300031456 Ga0307513_10057077 Ga0307513_100570774 166
725 3300031456 Ga0307513_10182197 Ga0307513_101821972 166
726 3300031456 Ga0307513_10371673 Ga0307513_103716732 166
727 3300031507 Ga0307509_10084646 Ga0307509_100846462 166
728 3300031548 Ga0307408_100505017 Ga0307408_1005050172 166
729 3300031711 Ga0265314_10003949 Ga0265314_100039492 166
730 3300031730 Ga0307516_10151857 Ga0307516_101518572 166
731 3300031730 Ga0307516_10192455 Ga0307516_101924552 166
732 3300031730 Ga0307516_10610540 Ga0307516_106105401 166
733 3300031731 Ga0307405_10241741 Ga0307405_102417411 166
734 3300031901 Ga0307406_10127422 Ga0307406_101274222 166
735 3300031901 Ga0307406_10150823 Ga0307406_101508231 166
736 3300031911 Ga0307412_10431601 Ga0307412_104316012 166
737 3300031911 Ga0307412_10998363 Ga0307412_109983631 166
738 3300032002 Ga0307416_100267044 Ga0307416_1002670442 166
739 3300032002 Ga0307416_100415049 Ga0307416_1004150492 166
740 3300032002 Ga0307416_102306814 Ga0307416_1023068141 166
741 3300032004 Ga0307414_10434577 Ga0307414_104345771 166
742 3300032005 Ga0307411_10065225 Ga0307411_100652252 166
743 3300032126 Ga0307415_100054255 Ga0307415_1000542553 166
744 3300032126 Ga0307415_100085248 Ga0307415_1000852483 166
745 3300032126 Ga0307415_100321899 Ga0307415_1003218992 166
746 3300033180 Ga0307510_10010287 Ga0307510_100102874 166
747 3300035083 Ga0373926_0132099 Ga0373926_0132099_314_820 166
748 3300035112 Ga0373932_0026257 Ga0373932_0026257_153_653 166
749 3300035112 Ga0373932_0116569 Ga0373932_0116569_141_644 166
750 3300035115 Ga0373941_0142888 Ga0373941_0142888_205_708 166
751 3300035116 Ga0373945_0204677 Ga0373945_0204677_235_741 166
752 3300035172 Ga0373955_0225677 Ga0373955_0225677_169_672 166
753 3300035691 Ga0373931_0003001 Ga0373931_0003001_3894_4397 166
754 3300035695 Ga0373927_0153238 Ga0373927_0153238_187_690 166
755 3300035725 Ga0373947_0213774 Ga0373947_0213774_724_1233 166
756 3300036401 Ga0373937_0428902 Ga0373937_0428902_485_988 166
757 3300037068 Ga0373925_0174161 Ga0373925_0174161_1169_1678 166
758 3300037068 Ga0373925_0328147 Ga0373925_0328147_75_578 166
759 3300037068 Ga0373925_0636194 Ga0373925_0636194_46_555 166
760 3300037471 Ga0395905_0499162 Ga0395905_0499162_127_633 166
761 3300038443 Ga0395901_0380417 Ga0395901_0380417_73_576 166
762 3300041460 Ga0451802_0623261 Ga0451802_0623261_66_572 166
763 3300041486 Ga0451807_1001866 Ga0451807_1001866_92_592 166
764 3300041486 Ga0451807_1667569 Ga0451807_1667569_101_604 166
765 3300041486 Ga0451807_1946340 Ga0451807_1946340_557_1063 166
766 3300041491 Ga0451833_0048398 Ga0451833_0048398_47_550 166
767 3300041492 Ga0451835_1012982 Ga0451835_1012982_164_667 166
768 3300046452 Ga0495617_051254 Ga0495617_051254_745_1251 166
769 3300046455 Ga0495603_0010419 Ga0495603_0010419_2994_3494 166
770 3300046455 Ga0495603_0016067 Ga0495603_0016067_1540_2046 166
771 3300046455 Ga0495603_0056389 Ga0495603_0056389_1552_2058 166
772 3300046455 Ga0495603_0173014 Ga0495603_0173014_17_523 166
773 3300046457 Ga0495590_0336458 Ga0495590_0336458_37_543 166
774 3300046459 Ga0495629_0077987 Ga0495629_0077987_539_1045 166
775 3300046460 Ga0495638_0094374 Ga0495638_0094374_995_1501 166
776 3300046460 Ga0495638_0156987 Ga0495638_0156987_434_940 166
777 3300046462 Ga0495651_0780390 Ga0495651_0780390_26_559 166
778 3300046471 Ga0495650_0099227 Ga0495650_0099227_431_937 166
779 3300046475 Ga0495639_0062306 Ga0495639_0062306_14_514 166
780 3300046492 Ga0495585_0131359 Ga0495585_0131359_149_655 166
781 3300046499 Ga0495594_0129264 Ga0495594_0129264_59_565 166
782 3300046500 Ga0495596_0063536 Ga0495596_0063536_586_1092 166
783 3300046507 Ga0495606_0132216 Ga0495606_0132216_551_1057 166
784 3300046507 Ga0495606_0204613 Ga0495606_0204613_538_1041 166
785 3300046512 Ga0495610_0028391 Ga0495610_0028391_1802_2308 166
786 3300046512 Ga0495610_0159647 Ga0495610_0159647_109_615 166
787 3300046513 Ga0495616_0328317 Ga0495616_0328317_27_530 166
788 3300046515 Ga0495620_0186358 Ga0495620_0186358_116_622 166
789 3300046518 Ga0495631_0090236 Ga0495631_0090236_782_1288 166
790 3300046523 Ga0495644_0069318 Ga0495644_0069318_70_576 166
791 3300046523 Ga0495644_0147410 Ga0495644_0147410_223_729 166
792 3300046524 Ga0495648_0320809 Ga0495648_0320809_55_561 166
793 3300046530 Ga0495654_0165764 Ga0495654_0165764_357_863 166
794 3300046536 Ga0495587_0283480 Ga0495587_0283480_240_830 166
795 3300046538 Ga0495609_0043250 Ga0495609_0043250_277_783 166
796 3300046538 Ga0495609_0050883 Ga0495609_0050883_528_1028 166
797 3300046538 Ga0495609_0161223 Ga0495609_0161223_424_930 166
798 3300046539 Ga0495621_0010649 Ga0495621_0010649_612_1121 166
799 3300046557 Ga0495622_0044765 Ga0495622_0044765_533_1039 166
800 3300046557 Ga0495622_0297899 Ga0495622_0297899_103_603 166
801 3300046615 Ga0495656_0003421 Ga0495656_0003421_151_657 166
802 3300046615 Ga0495656_0028898 Ga0495656_0028898_591_1094 166
803 3300046615 Ga0495656_0030100 Ga0495656_0030100_1092_1598 166
804 3300046616 Ga0495668_0125789 Ga0495668_0125789_216_716 166
805 3300046616 Ga0495668_0166092 Ga0495668_0166092_629_1135 166
806 3300046616 Ga0495668_0208085 Ga0495668_0208085_208_714 166
807 3300046616 Ga0495668_0630773 Ga0495668_0630773_51_557 166
808 3300046660 Ga0495625_0067931 Ga0495625_0067931_493_1026 166
809 3300046660 Ga0495625_0273687 Ga0495625_0273687_530_1030 166
810 3300046660 Ga0495625_0295610 Ga0495625_0295610_41_544 166
811 3300046660 Ga0495625_0373557 Ga0495625_0373557_100_606 166
812 3300046660 Ga0495625_0465578 Ga0495625_0465578_28_534 166
813 3300046664 Ga0495659_0033870 Ga0495659_0033870_829_1335 166
814 3300046674 Ga0495588_0281158 Ga0495588_0281158_317_820 166
815 3300046681 Ga0495647_0402293 Ga0495647_0402293_84_590 166
816 3300046684 Ga0495669_0064842 Ga0495669_0064842_139_645 166
817 3300046684 Ga0495669_0083825 Ga0495669_0083825_264_764 166
818 3300046690 Ga0495624_0123097 Ga0495624_0123097_148_648 166
819 3300046691 Ga0495670_0096732 Ga0495670_0096732_842_1348 166
820 3300046692 Ga0495671_0115441 Ga0495671_0115441_558_1064 166
821 3300046692 Ga0495671_0170410 Ga0495671_0170410_57_563 166
822 3300046694 Ga0495649_0186263 Ga0495649_0186263_110_616 166
823 3300046694 Ga0495649_0394862 Ga0495649_0394862_98_598 166
824 3300046794 Ga0495589_0095626 Ga0495589_0095626_566_1072 166
825 3300046794 Ga0495589_0142352 Ga0495589_0142352_366_866 166
826 3300046794 Ga0495589_0169547 Ga0495589_0169547_322_822 166
827 3300046809 Ga0495600_0143564 Ga0495600_0143564_377_910 166
828 3300047315 Ga0495581_0202275 Ga0495581_0202275_345_854 166
829 3300047317 Ga0495604_0214928 Ga0495604_0214928_247_753 166
830 3300047318 Ga0495636_0030621 Ga0495636_0030621_538_1044 166
831 3300047320 Ga0495672_0339280 Ga0495672_0339280_164_670 166
832 3300047321 Ga0495676_0062458 Ga0495676_0062458_1335_1844 166
833 3300047323 Ga0495683_0047765 Ga0495683_0047765_1624_2130 166
834 3300047323 Ga0495683_0128105 Ga0495683_0128105_128_634 166
835 3300047447 Ga0495685_114679 Ga0495685_114679_261_767 166
836 3300047472 Ga0495686_0490492 Ga0495686_0490492_94_600 166
837 3300048091 Ga0495626_0176548 Ga0495626_0176548_74_580 166
838 3300048903 Ga0496100_0048756 Ga0496100_0048756_2042_2545 166
839 3300048903 Ga0496100_0081491 Ga0496100_0081491_1584_2087 166
840 3300048904 Ga0496101_0008281 Ga0496101_0008281_2119_2622 166
841 3300048904 Ga0496101_0044430 Ga0496101_0044430_1710_2213 166
842 3300048904 Ga0496101_0319134 Ga0496101_0319134_312_818 166
843 3300048905 Ga0496102_0001453 Ga0496102_0001453_3823_4326 166
844 3300048905 Ga0496102_0043946 Ga0496102_0043946_1978_2481 166
845 3300048905 Ga0496102_1324930 Ga0496102_1324930_85_591 166
846 3300048906 Ga0496103_0010530 Ga0496103_0010530_2931_3434 166
847 3300048906 Ga0496103_0056754 Ga0496103_0056754_1778_2281 166
848 3300048906 Ga0496103_0674250 Ga0496103_0674250_12_518 166
849 3300048907 Ga0496104_0027853 Ga0496104_0027853_4373_4876 166
850 3300048907 Ga0496104_0271160 Ga0496104_0271160_772_1275 166
851 3300048907 Ga0496104_0618479 Ga0496104_0618479_44_550 166
852 3300048908 Ga0496105_0005368 Ga0496105_0005368_5075_5578 166
853 3300048908 Ga0496105_0197778 Ga0496105_0197778_871_1374 166
854 3300048908 Ga0496105_0864316 Ga0496105_0864316_25_531 166
855 3300048909 Ga0496106_0003462 Ga0496106_0003462_10002_10505 166
856 3300048909 Ga0496106_0007634 Ga0496106_0007634_4830_5339 166
857 3300048909 Ga0496106_0076324 Ga0496106_0076324_148_651 166
858 3300048909 Ga0496106_0199556 Ga0496106_0199556_364_870 166
859 3300048909 Ga0496106_0478127 Ga0496106_0478127_395_901 166
860 3300048910 Ga0496107_0008406 Ga0496107_0008406_3746_4255 166
861 3300048910 Ga0496107_0019887 Ga0496107_0019887_2453_2956 166
862 3300048910 Ga0496107_0029236 Ga0496107_0029236_2234_2737 166
863 3300048910 Ga0496107_0171756 Ga0496107_0171756_888_1394 166
864 3300048910 Ga0496107_0352387 Ga0496107_0352387_530_1036 166
865 3300048911 Ga0496108_0034768 Ga0496108_0034768_335_838 166
866 3300048911 Ga0496108_0104749 Ga0496108_0104749_180_683 166
867 3300048912 Ga0496109_0090477 Ga0496109_0090477_169_678 166
868 3300048912 Ga0496109_0652160 Ga0496109_0652160_143_646 166
869 3300048913 Ga0496110_0009850 Ga0496110_0009850_2343_2846 166
870 3300048913 Ga0496110_0015996 Ga0496110_0015996_4152_4655 166
871 3300048914 Ga0496111_0024623 Ga0496111_0024623_2177_2680 166
872 3300048914 Ga0496111_0039977 Ga0496111_0039977_2136_2639 166
873 3300048914 Ga0496111_0231979 Ga0496111_0231979_342_845 166
874 3300048915 Ga0496112_0042992 Ga0496112_0042992_2738_3241 166
875 3300048915 Ga0496112_0078349 Ga0496112_0078349_1431_1940 166
876 3300048916 Ga0496113_0023859 Ga0496113_0023859_860_1369 166
877 3300048916 Ga0496113_0032245 Ga0496113_0032245_3149_3652 166
878 3300048916 Ga0496113_0047640 Ga0496113_0047640_196_702 166
879 3300048916 Ga0496113_0174611 Ga0496113_0174611_1000_1503 166
880 3300048916 Ga0496113_0548004 Ga0496113_0548004_14_517 166
881 3300048917 Ga0496114_0022794 Ga0496114_0022794_356_859 166
882 3300048918 Ga0496115_0004695 Ga0496115_0004695_3582_4085 166
883 3300048918 Ga0496115_0027446 Ga0496115_0027446_3093_3596 166
884 3300048920 Ga0496117_0228952 Ga0496117_0228952_273_779 166
885 3300048921 Ga0496118_0216458 Ga0496118_0216458_264_770 166
886 3300048924 Ga0496121_0063692 Ga0496121_0063692_886_1392 166
887 3300048924 Ga0496121_0070730 Ga0496121_0070730_578_1084 166
888 3300048924 Ga0496121_0311718 Ga0496121_0311718_116_622 166
889 3300048927 Ga0496124_0180542 Ga0496124_0180542_297_803 166
890 3300048927 Ga0496124_0305447 Ga0496124_0305447_70_576 166
891 3300048928 Ga0496125_0208382 Ga0496125_0208382_76_582 166
892 3300048928 Ga0496125_0354947 Ga0496125_0354947_357_863 166
893 3300048929 Ga0496126_0011555 Ga0496126_0011555_238_741 166
894 3300048929 Ga0496126_0014534 Ga0496126_0014534_5563_6069 166
895 3300048929 Ga0496126_0062393 Ga0496126_0062393_606_1112 166
896 3300048929 Ga0496126_0145240 Ga0496126_0145240_526_1167 166
897 3300048929 Ga0496126_0283596 Ga0496126_0283596_612_1118 166
898 3300048929 Ga0496126_0480060 Ga0496126_0480060_49_555 166
899 3300049578 Ga0501042_0346240 Ga0501042_0346240_546_1052 166
900 3300049583 Ga0501067_0035210 Ga0501067_0035210_306_806 166
901 3300049583 Ga0501067_0044688 Ga0501067_0044688_1923_2429 166
902 3300049584 Ga0501068_0273486 Ga0501068_0273486_292_798 166
903 3300049585 Ga0501069_0203031 Ga0501069_0203031_487_993 166
904 3300049587 Ga0501071_0187713 Ga0501071_0187713_578_1084 166
905 3300049591 Ga0501075_0611963 Ga0501075_0611963_295_801 166
906 3300049592 Ga0501076_0098020 Ga0501076_0098020_630_1130 166
907 3300050489 nmdc:mga03683_19812_c1 nmdc:mga03683_19812_c1_130_636 166
908 3300050489 nmdc:mga03683_279409_c1 nmdc:mga03683_279409_c1_251_757 166
909 3300050489 nmdc:mga03683_402934_c1 nmdc:mga03683_402934_c1_78_581 166
910 3300050490 nmdc:mga03n38_164796_c1 nmdc:mga03n38_164796_c1_574_1080 166
911 3300050490 nmdc:mga03n38_287851_c1 nmdc:mga03n38_287851_c1_297_803 166
912 3300050490 nmdc:mga03n38_298337_c1 nmdc:mga03n38_298337_c1_36_542 166
913 3300050491 nmdc:mga00v17_211293_c1 nmdc:mga00v17_211293_c1_399_905 166
914 3300050491 nmdc:mga00v17_87918_c1 nmdc:mga00v17_87918_c1_1345_1851 166
915 3300050492 nmdc:mga0yw44_103713_c1 nmdc:mga0yw44_103713_c1_622_1128 166
916 3300050492 nmdc:mga0yw44_189590_c1 nmdc:mga0yw44_189590_c1_840_1346 166
917 3300050492 nmdc:mga0yw44_265923_c1 nmdc:mga0yw44_265923_c1_297_803 166
918 3300050492 nmdc:mga0yw44_30731_c1 nmdc:mga0yw44_30731_c1_196_702 166
919 3300050492 nmdc:mga0yw44_3728_c1 nmdc:mga0yw44_3728_c1_5088_5594 166
920 3300050493 nmdc:mga0k408_11114_c1 nmdc:mga0k408_11114_c1_1072_1578 166
921 3300050493 nmdc:mga0k408_332175_c1 nmdc:mga0k408_332175_c1_378_884 166
922 3300050493 nmdc:mga0k408_46281_c1 nmdc:mga0k408_46281_c1_756_1262 166
923 3300050494 nmdc:mga06z11_31889_c1 nmdc:mga06z11_31889_c1_762_1268 166
924 3300050494 nmdc:mga06z11_386642_c1 nmdc:mga06z11_386642_c1_185_691 166
925 3300050494 nmdc:mga06z11_494596_c1 nmdc:mga06z11_494596_c1_77_583 166
926 3300050495 nmdc:mga04h51_414475_c1 nmdc:mga04h51_414475_c1_24_530 166
927 3300050495 nmdc:mga04h51_97303_c1 nmdc:mga04h51_97303_c1_252_758 166
928 3300050496 nmdc:mga07m45_148798_c1 nmdc:mga07m45_148798_c1_784_1290 166
929 3300050496 nmdc:mga07m45_43287_c1 nmdc:mga07m45_43287_c1_1482_1988 166
930 3300050496 nmdc:mga07m45_9877_c1 nmdc:mga07m45_9877_c1_4142_4648 166
931 3300050507 nmdc:mga05p37_573050_c1 nmdc:mga05p37_573050_c1_268_774 166
932 3300050508 nmdc:mga09592_688562_c1 nmdc:mga09592_688562_c1_318_824 166
933 3300050511 nmdc:mga08y16_170224_c1 nmdc:mga08y16_170224_c1_49_555 166
934 3300050512 nmdc:mga0n895_187543_c1 nmdc:mga0n895_187543_c1_850_1350 166
935 3300050513 nmdc:mga0rr50_512824_c1 nmdc:mga0rr50_512824_c1_503_1009 166
936 3300050513 nmdc:mga0rr50_669647_c1 nmdc:mga0rr50_669647_c1_227_727 166
937 3300050515 nmdc:mga0a205_229797_c1 nmdc:mga0a205_229797_c1_583_1089 166
938 3300050516 nmdc:mga0sz30_37500_c1 nmdc:mga0sz30_37500_c1_227_733 166
939 3300053086 Ga0500578_0453093 Ga0500578_0453093_47_553 166
940 3300053090 Ga0500646_0110726 Ga0500646_0110726_26_532 166
941 3300053093 Ga0500651_0084520 Ga0500651_0084520_735_1241 166
942 3300053096 Ga0500641_0006112 Ga0500641_0006112_989_1495 166
943 3300053108 Ga0500562_083418 Ga0500562_083418_299_805 166
944 3300053114 Ga0500582_160514 Ga0500582_160514_207_713 166
945 3300053119 Ga0500595_000506 Ga0500595_000506_819_1328 166
946 3300053119 Ga0500595_000631 Ga0500595_000631_10631_11137 166
947 3300053133 Ga0500655_090724 Ga0500655_090724_84_590 166
948 3300053134 Ga0500658_0072400 Ga0500658_0072400_237_743 166
949 3300053137 Ga0500561_0044808 Ga0500561_0044808_208_714 166
950 3300053142 Ga0500577_0189174 Ga0500577_0189174_321_827 166
951 3300053147 Ga0500589_055504 Ga0500589_055504_478_984 166
952 3300053158 Ga0500627_0155115 Ga0500627_0155115_191_697 166
953 3300053162 Ga0500638_002747 Ga0500638_002747_1479_1988 166
954 3300053162 Ga0500638_070154 Ga0500638_070154_414_917 166
955 3300053178 Ga0500637_0000350 Ga0500637_0000350_3911_4420 166
956 3300053178 Ga0500637_0128472 Ga0500637_0128472_96_602 166
957 3300053727 Ga0500611_108289 Ga0500611_108289_86_592 166
958 3300053730 Ga0500645_022804 Ga0500645_022804_317_823 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05099

TerB

Tellurite resistance protein TerB

65

182

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zx1-assembly1.cif.gz_A crystal structure of ent domain from t. brucei 0.6784 98 160
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.5596 22 147
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.5434 22 147
5zx1-assembly1.cif.gz_A crystal structure of ent domain from t. brucei 0.519 98 160
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.5122 4 156
ID Description Score Start End Superfamily
af_Q9M2M2_56_121_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.84 98 147 1.10.1240.40
af_I1JUF7_325_389_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7981 90 151 1.10.1240.40
af_Q9M2Q2_35_103_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7674 101 160 1.10.3680.10
af_I1JUF7_325_389_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7017 90 151 1.10.1240.40
af_A0A0P0W487_245_310_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7008 80 150 1.10.1240.40
ID Description Score Start End GO Terms
AF-Q2S7K9-F1-model_v4 Uncharacterized protein conserved in bacteria 0.8194 1 150
AF-X5MEQ8-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.811 1 152
AF-Q2S7K9-F1-model_v4 Uncharacterized protein conserved in bacteria 0.8095 1 150
AF-X5MEQ8-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.8016 1 152
AF-A0A6B1GQA6-F1-model_v4 TerB family tellurite resistance protein 0.7878 2 154

Feature Viewer

pLDDT pTM Quality
80.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map