F486808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 958 | 425 | 1916 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0095280|Ga0501034_0095280_556_1548 |
| Length | 330 |
| Sequence | MRDPYEVLGVSKSASEADIKSAYRGLAKKLHPDANKHDPKAASRFAELNAAYEIVGDDEKRKAFDRGEIDAEGKPRFRGFEGYGAQPGGGFNRGDAQFETFSFGPDGFQRRGRASGGGGFEDLLRGMFGGAARGPRGGYGGTFEAEDFGPPPTGQDLHASLTITLPEAAKGTKARVTLPTGKSVEVKIPAGLASGQQIRLKGQGWPAAGGGKAGDALITVNVTPHPVFKPDGADLRLDLPITLYEAVLGGKVRVPTLDGAVELAIPAGTSSGRTFRLRGKGLKKDGSKSSTGDLLATVRIVLPEHTDDALTDLMKTWRDSKPYDPRGDIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 413 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 417 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 418 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 420 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 424 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 425 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0.31 |
| Rhizoplane | 8.66 |
| Rhizosphere | 87.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0095280 | 3300049571 | Bacteria | 2973 |
| 2 | 2214656053 | 2209111006 | Bacteria | 4786 |
| 3 | ARcpr5oldR_c000226 | 3300000041 | Bacteria | 9278 |
| 4 | ARSoilYngRDRAFT_c00122 | 3300000042 | Bacteria | 13299 |
| 5 | ARcpr5yngRDRAFT_c000316 | 3300000043 | Bacteria | 6756 |
| 6 | ARSoilOldRDRAFT_c000054 | 3300000044 | Bacteria | 23692 |
| 7 | ARCol0yngRDRAFT_1000054 | 3300000652 | Bacteria | 20195 |
| 8 | JGI24032J14994_100197 | 3300001430 | Bacteria | 3099 |
| 9 | JGI24746J21847_1004760 | 3300001977 | Bacteria | 2132 |
| 10 | JGI24747J21853_1000617 | 3300001978 | Bacteria | 2321 |
| 11 | JGI24740J21852_10019512 | 3300001979 | Bacteria | 2387 |
| 12 | JGI24739J22299_10001041 | 3300001989 | Bacteria | 10288 |
| 13 | JGI24737J22298_10000776 | 3300001990 | Bacteria | 11303 |
| 14 | JGI24737J22298_10000959 | 3300001990 | Bacteria | 10242 |
| 15 | JGI24750J21931_1000558 | 3300002070 | Bacteria | 5702 |
| 16 | JGI24738J21930_10000571 | 3300002075 | Bacteria | 10549 |
| 17 | JGI24749J21850_1000591 | 3300002076 | Bacteria | 5287 |
| 18 | JGI24035J26624_1000164 | 3300002126 | Bacteria | 6046 |
| 19 | JGI24034J26672_10000323 | 3300002239 | Bacteria | 6166 |
| 20 | JGI24742J22300_10000080 | 3300002244 | Bacteria | 13750 |
| 21 | JGI25406J46586_10000018 | 3300003203 | Bacteria | 88860 |
| 22 | JGI25404J52841_10006788 | 3300003659 | Bacteria | 2403 |
| 23 | Ga0065716_1001726 | 3300005277 | Bacteria | 3775 |
| 24 | Ga0065712_10009732 | 3300005290 | Bacteria | 2250 |
| 25 | Ga0065712_10069678 | 3300005290 | Bacteria | 6896 |
| 26 | Ga0065715_10001633 | 3300005293 | Bacteria | 8375 |
| 27 | Ga0070658_10008040 | 3300005327 | Bacteria | 8479 |
| 28 | Ga0070658_10034116 | 3300005327 | Bacteria | 4094 |
| 29 | Ga0070683_100000289 | 3300005329 | Bacteria | 34698 |
| 30 | Ga0070683_100064495 | 3300005329 | Bacteria | 3410 |
| 31 | Ga0070690_100006047 | 3300005330 | Bacteria | 6846 |
| 32 | Ga0070690_100010825 | 3300005330 | Bacteria | 5320 |
| 33 | Ga0070670_100027675 | 3300005331 | Bacteria | 4877 |
| 34 | Ga0070670_100108118 | 3300005331 | Bacteria | 2396 |
| 35 | Ga0070677_10000043 | 3300005333 | Bacteria | 39363 |
| 36 | Ga0068869_100002554 | 3300005334 | Bacteria | 10982 |
| 37 | Ga0070666_10013513 | 3300005335 | Bacteria | 5182 |
| 38 | Ga0070680_100008016 | 3300005336 | Bacteria | 8065 |
| 39 | Ga0070680_100016633 | 3300005336 | Bacteria | 5790 |
| 40 | Ga0070680_100035810 | 3300005336 | Bacteria | 4008 |
| 41 | Ga0070680_100050316 | 3300005336 | Bacteria | 3399 |
| 42 | Ga0070680_100170530 | 3300005336 | Bacteria | 1831 |
| 43 | Ga0070682_100000528 | 3300005337 | Bacteria | 23870 |
| 44 | Ga0070682_100040250 | 3300005337 | Bacteria | 2875 |
| 45 | Ga0070682_100088047 | 3300005337 | Bacteria | 2026 |
| 46 | Ga0068868_100000408 | 3300005338 | Bacteria | 29034 |
| 47 | Ga0068868_100040736 | 3300005338 | Bacteria | 3616 |
| 48 | Ga0070660_100011422 | 3300005339 | Bacteria | 6308 |
| 49 | Ga0070660_100037116 | 3300005339 | Bacteria | 3693 |
| 50 | Ga0070689_100000819 | 3300005340 | Bacteria | 19235 |
| 51 | Ga0070689_100008559 | 3300005340 | Bacteria | 7212 |
| 52 | Ga0070689_100068676 | 3300005340 | Bacteria | 2764 |
| 53 | Ga0070691_10009402 | 3300005341 | Bacteria | 4461 |
| 54 | Ga0070687_100000950 | 3300005343 | Bacteria | 9837 |
| 55 | Ga0070661_100000314 | 3300005344 | Bacteria | 39090 |
| 56 | Ga0070661_100008178 | 3300005344 | Bacteria | 7217 |
| 57 | Ga0070692_10000310 | 3300005345 | Bacteria | 13896 |
| 58 | Ga0070692_10037572 | 3300005345 | Bacteria | 2462 |
| 59 | Ga0070668_100000857 | 3300005347 | Bacteria | 21127 |
| 60 | Ga0070669_100005664 | 3300005353 | Bacteria | 9015 |
| 61 | Ga0070669_100047495 | 3300005353 | Bacteria | 3132 |
| 62 | Ga0070675_100004259 | 3300005354 | Bacteria | 10893 |
| 63 | Ga0070675_100031348 | 3300005354 | Bacteria | 4298 |
| 64 | Ga0070671_100000598 | 3300005355 | Bacteria | 25820 |
| 65 | Ga0070671_100031256 | 3300005355 | Bacteria | 4397 |
| 66 | Ga0070671_100223422 | 3300005355 | Bacteria | 1598 |
| 67 | Ga0070674_100010763 | 3300005356 | Bacteria | 5545 |
| 68 | Ga0070674_100404834 | 3300005356 | Bacteria | 1116 |
| 69 | Ga0070673_100000289 | 3300005364 | Bacteria | 26187 |
| 70 | Ga0070673_100244183 | 3300005364 | Bacteria | 1562 |
| 71 | Ga0070688_100000189 | 3300005365 | Bacteria | 32631 |
| 72 | Ga0070688_100005181 | 3300005365 | Bacteria | 6843 |
| 73 | Ga0070688_100041426 | 3300005365 | Bacteria | 2827 |
| 74 | Ga0070659_100075797 | 3300005366 | Bacteria | 2681 |
| 75 | Ga0070667_100000436 | 3300005367 | Bacteria | 43897 |
| 76 | Ga0070667_100016498 | 3300005367 | Bacteria | 6113 |
| 77 | Ga0070667_100164712 | 3300005367 | Bacteria | 1955 |
| 78 | Ga0070703_10002551 | 3300005406 | Bacteria | 5247 |
| 79 | Ga0070709_10000652 | 3300005434 | Bacteria | 19741 |
| 80 | Ga0070709_10001788 | 3300005434 | Bacteria | 11676 |
| 81 | Ga0070709_10026083 | 3300005434 | Bacteria | 3459 |
| 82 | Ga0070709_10029506 | 3300005434 | Bacteria | 3282 |
| 83 | Ga0070714_100025604 | 3300005435 | Bacteria | 4870 |
| 84 | Ga0070714_100026305 | 3300005435 | Bacteria | 4808 |
| 85 | Ga0070714_100027072 | 3300005435 | Bacteria | 4744 |
| 86 | Ga0070714_100037701 | 3300005435 | Bacteria | 4063 |
| 87 | Ga0070714_100070473 | 3300005435 | Bacteria | 3022 |
| 88 | Ga0070714_100093437 | 3300005435 | Bacteria | 2638 |
| 89 | Ga0070714_100501986 | 3300005435 | Bacteria | 1157 |
| 90 | Ga0070713_100001448 | 3300005436 | Bacteria | 15190 |
| 91 | Ga0070713_100020933 | 3300005436 | Bacteria | 5022 |
| 92 | Ga0070713_100024488 | 3300005436 | Bacteria | 4702 |
| 93 | Ga0070713_100120238 | 3300005436 | Bacteria | 2302 |
| 94 | Ga0070710_10001787 | 3300005437 | Bacteria | 10169 |
| 95 | Ga0070710_10035536 | 3300005437 | Bacteria | 2717 |
| 96 | Ga0070710_10105489 | 3300005437 | Bacteria | 1685 |
| 97 | Ga0070701_10000106 | 3300005438 | Bacteria | 23737 |
| 98 | Ga0070701_10009951 | 3300005438 | Bacteria | 4187 |
| 99 | Ga0070701_10071269 | 3300005438 | Bacteria | 1858 |
| 100 | Ga0070711_100001638 | 3300005439 | Bacteria | 12376 |
| 101 | Ga0070711_100023208 | 3300005439 | Bacteria | 4031 |
| 102 | Ga0070711_100071211 | 3300005439 | Bacteria | 2449 |
| 103 | Ga0070711_100079140 | 3300005439 | Bacteria | 2337 |
| 104 | Ga0070705_100000781 | 3300005440 | Bacteria | 17954 |
| 105 | Ga0070705_100061455 | 3300005440 | Bacteria | 2233 |
| 106 | Ga0070700_100001610 | 3300005441 | Bacteria | 11254 |
| 107 | Ga0070694_100003956 | 3300005444 | Bacteria | 8867 |
| 108 | Ga0070694_100005440 | 3300005444 | Bacteria | 7710 |
| 109 | Ga0070663_100000297 | 3300005455 | Bacteria | 25442 |
| 110 | Ga0070663_100050692 | 3300005455 | Bacteria | 2954 |
| 111 | Ga0070663_100199561 | 3300005455 | Bacteria | 1560 |
| 112 | Ga0070678_100001470 | 3300005456 | Bacteria | 12559 |
| 113 | Ga0070678_100011789 | 3300005456 | Bacteria | 5407 |
| 114 | Ga0070662_100035544 | 3300005457 | Bacteria | 3520 |
| 115 | Ga0070662_100065036 | 3300005457 | Bacteria | 2672 |
| 116 | Ga0070662_100172258 | 3300005457 | Bacteria | 1700 |
| 117 | Ga0070681_10000645 | 3300005458 | Bacteria | 28768 |
| 118 | Ga0070681_10022181 | 3300005458 | Bacteria | 6373 |
| 119 | Ga0070681_10042512 | 3300005458 | Bacteria | 4553 |
| 120 | Ga0070681_10109584 | 3300005458 | Bacteria | 2701 |
| 121 | Ga0068867_100017453 | 3300005459 | Bacteria | 5098 |
| 122 | Ga0070685_10034634 | 3300005466 | Bacteria | 2844 |
| 123 | Ga0070685_10215413 | 3300005466 | Bacteria | 1255 |
| 124 | Ga0070679_100060424 | 3300005530 | Bacteria | 3777 |
| 125 | Ga0070679_100115293 | 3300005530 | Bacteria | 2672 |
| 126 | Ga0070679_100185671 | 3300005530 | Bacteria | 2050 |
| 127 | Ga0070679_100230727 | 3300005530 | Bacteria | 1810 |
| 128 | Ga0070679_100510947 | 3300005530 | Bacteria | 1145 |
| 129 | Ga0070684_100006705 | 3300005535 | Bacteria | 8926 |
| 130 | Ga0070684_100015951 | 3300005535 | Bacteria | 6134 |
| 131 | Ga0070684_100043054 | 3300005535 | Bacteria | 3898 |
| 132 | Ga0068853_100007059 | 3300005539 | Bacteria | 8981 |
| 133 | Ga0068853_100224896 | 3300005539 | Bacteria | 1715 |
| 134 | Ga0070672_100000106 | 3300005543 | Bacteria | 41858 |
| 135 | Ga0070672_100126117 | 3300005543 | Bacteria | 2100 |
| 136 | Ga0070686_100000615 | 3300005544 | Bacteria | 20904 |
| 137 | Ga0070686_100015365 | 3300005544 | Bacteria | 4433 |
| 138 | Ga0070695_100001248 | 3300005545 | Bacteria | 13985 |
| 139 | Ga0070695_100017930 | 3300005545 | Bacteria | 4295 |
| 140 | Ga0070695_100029515 | 3300005545 | Bacteria | 3408 |
| 141 | Ga0070695_100145569 | 3300005545 | Bacteria | 1648 |
| 142 | Ga0070696_100008593 | 3300005546 | Bacteria | 6832 |
| 143 | Ga0070696_100031040 | 3300005546 | Bacteria | 3660 |
| 144 | Ga0070696_100059408 | 3300005546 | Bacteria | 2672 |
| 145 | Ga0070696_100071909 | 3300005546 | Bacteria | 2435 |
| 146 | Ga0070693_100071161 | 3300005547 | Bacteria | 2048 |
| 147 | Ga0070693_100123149 | 3300005547 | Bacteria | 1611 |
| 148 | Ga0070704_100004997 | 3300005549 | Bacteria | 7705 |
| 149 | Ga0070704_100018272 | 3300005549 | Bacteria | 4479 |
| 150 | Ga0068855_100053416 | 3300005563 | Bacteria | 4753 |
| 151 | Ga0068855_100155675 | 3300005563 | Bacteria | 2596 |
| 152 | Ga0070664_100017797 | 3300005564 | Bacteria | 5837 |
| 153 | Ga0070664_100465762 | 3300005564 | Bacteria | 1162 |
| 154 | Ga0068857_100000047 | 3300005577 | Bacteria | 67784 |
| 155 | Ga0068854_100000502 | 3300005578 | Bacteria | 23837 |
| 156 | Ga0068854_100059417 | 3300005578 | Bacteria | 2763 |
| 157 | Ga0068856_100001905 | 3300005614 | Bacteria | 21761 |
| 158 | Ga0068856_100361373 | 3300005614 | Bacteria | 1470 |
| 159 | Ga0070702_100004825 | 3300005615 | Bacteria | 6199 |
| 160 | Ga0070702_100031385 | 3300005615 | Bacteria | 2906 |
| 161 | Ga0068852_100011300 | 3300005616 | Bacteria | 6716 |
| 162 | Ga0068859_100005879 | 3300005617 | Bacteria | 12451 |
| 163 | Ga0068859_100024931 | 3300005617 | Bacteria | 6003 |
| 164 | Ga0068859_100202501 | 3300005617 | Bacteria | 2070 |
| 165 | Ga0068864_100000931 | 3300005618 | Bacteria | 24535 |
| 166 | Ga0068864_100116167 | 3300005618 | Bacteria | 2387 |
| 167 | Ga0068866_10000077 | 3300005718 | Bacteria | 39340 |
| 168 | Ga0068866_10014674 | 3300005718 | Bacteria | 3465 |
| 169 | Ga0068861_100011038 | 3300005719 | Bacteria | 6278 |
| 170 | Ga0068870_10001017 | 3300005840 | Bacteria | 11098 |
| 171 | Ga0068863_100000543 | 3300005841 | Bacteria | 38366 |
| 172 | Ga0068863_100036826 | 3300005841 | Bacteria | 4659 |
| 173 | Ga0068858_100002073 | 3300005842 | Bacteria | 20401 |
| 174 | Ga0068858_100028716 | 3300005842 | Bacteria | 5166 |
| 175 | Ga0068858_100040985 | 3300005842 | Bacteria | 4295 |
| 176 | Ga0068858_100258516 | 3300005842 | Bacteria | 1655 |
| 177 | Ga0068860_100005115 | 3300005843 | Bacteria | 13336 |
| 178 | Ga0068860_100034229 | 3300005843 | Bacteria | 4871 |
| 179 | Ga0068862_100000879 | 3300005844 | Bacteria | 29265 |
| 180 | Ga0068862_100013544 | 3300005844 | Bacteria | 6756 |
| 181 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 182 | Ga0081455_10000596 | 3300005937 | Bacteria | 46863 |
| 183 | Ga0081455_10009848 | 3300005937 | Bacteria | 9788 |
| 184 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 185 | Ga0081540_1001222 | 3300005983 | Bacteria | 22443 |
| 186 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 187 | Ga0070717_10000287 | 3300006028 | Bacteria | 34051 |
| 188 | Ga0070717_10136105 | 3300006028 | Bacteria | 2116 |
| 189 | Ga0075368_10067462 | 3300006042 | Bacteria | 1440 |
| 190 | Ga0075364_10203629 | 3300006051 | Bacteria | 1342 |
| 191 | Ga0075432_10000660 | 3300006058 | Bacteria | 10552 |
| 192 | Ga0070715_10000989 | 3300006163 | Bacteria | 7957 |
| 193 | Ga0070716_100026935 | 3300006173 | Bacteria | 3082 |
| 194 | Ga0070716_100043704 | 3300006173 | Bacteria | 2507 |
| 195 | Ga0070712_100031048 | 3300006175 | Bacteria | 3596 |
| 196 | Ga0070712_100083487 | 3300006175 | Bacteria | 2320 |
| 197 | Ga0070712_100086846 | 3300006175 | Bacteria | 2281 |
| 198 | Ga0070712_100174265 | 3300006175 | Bacteria | 1671 |
| 199 | Ga0075362_10001028 | 3300006177 | Bacteria | 8594 |
| 200 | Ga0075367_10026404 | 3300006178 | Bacteria | 3294 |
| 201 | Ga0075367_10131271 | 3300006178 | Bacteria | 1548 |
| 202 | Ga0097621_100000416 | 3300006237 | Bacteria | 29698 |
| 203 | Ga0097621_100007350 | 3300006237 | Bacteria | 7877 |
| 204 | Ga0097621_100201324 | 3300006237 | Bacteria | 1729 |
| 205 | Ga0075370_10139642 | 3300006353 | Bacteria | 1416 |
| 206 | Ga0068871_100000249 | 3300006358 | Bacteria | 37516 |
| 207 | Ga0068871_100004813 | 3300006358 | Bacteria | 9439 |
| 208 | Ga0075428_100047718 | 3300006844 | Bacteria | 4702 |
| 209 | Ga0075430_100002807 | 3300006846 | Bacteria | 14570 |
| 210 | Ga0075431_100013028 | 3300006847 | Bacteria | 8398 |
| 211 | Ga0075433_10001150 | 3300006852 | Bacteria | 19214 |
| 212 | Ga0075433_10151919 | 3300006852 | Bacteria | 2060 |
| 213 | Ga0075434_100003092 | 3300006871 | Bacteria | 14816 |
| 214 | Ga0075434_100003158 | 3300006871 | Bacteria | 14688 |
| 215 | Ga0075434_100055769 | 3300006871 | Bacteria | 3926 |
| 216 | Ga0075434_100067393 | 3300006871 | Bacteria | 3565 |
| 217 | Ga0075429_100001089 | 3300006880 | Bacteria | 21839 |
| 218 | Ga0068865_100000248 | 3300006881 | Bacteria | 30110 |
| 219 | Ga0068865_100065099 | 3300006881 | Bacteria | 2567 |
| 220 | Ga0075436_100015431 | 3300006914 | Bacteria | 5230 |
| 221 | Ga0075436_100069651 | 3300006914 | Bacteria | 2431 |
| 222 | Ga0097620_100005879 | 3300006931 | Bacteria | 12451 |
| 223 | Ga0097620_100024931 | 3300006931 | Bacteria | 6003 |
| 224 | Ga0097620_100202511 | 3300006931 | Bacteria | 2070 |
| 225 | Ga0075435_100040427 | 3300007076 | Bacteria | 3723 |
| 226 | Ga0075435_100211730 | 3300007076 | Bacteria | 1645 |
| 227 | Ga0075435_100258996 | 3300007076 | Unclassified | 1482 |
| 228 | Ga0099795_10004304 | 3300007788 | Bacteria | 3656 |
| 229 | Ga0105251_10019615 | 3300009011 | Bacteria | 3567 |
| 230 | Ga0105251_10028839 | 3300009011 | Bacteria | 2801 |
| 231 | Ga0105240_10034168 | 3300009093 | Bacteria | 6562 |
| 232 | Ga0105240_10150755 | 3300009093 | Bacteria | 2769 |
| 233 | Ga0105240_10234711 | 3300009093 | Bacteria | 2129 |
| 234 | Ga0111539_10002489 | 3300009094 | Bacteria | 24423 |
| 235 | Ga0111539_10002685 | 3300009094 | Bacteria | 23545 |
| 236 | Ga0111539_10013785 | 3300009094 | Bacteria | 10099 |
| 237 | Ga0105245_10016985 | 3300009098 | Bacteria | 6352 |
| 238 | Ga0105245_10619033 | 3300009098 | Bacteria | 1111 |
| 239 | Ga0105247_10000908 | 3300009101 | Bacteria | 22289 |
| 240 | Ga0114129_10035354 | 3300009147 | Bacteria | 7058 |
| 241 | Ga0114129_10094866 | 3300009147 | Bacteria | 4132 |
| 242 | Ga0105243_10001705 | 3300009148 | Bacteria | 18936 |
| 243 | Ga0105243_10022992 | 3300009148 | Bacteria | 4741 |
| 244 | Ga0105241_10002306 | 3300009174 | Bacteria | 14330 |
| 245 | Ga0105241_10085108 | 3300009174 | Bacteria | 2484 |
| 246 | Ga0105242_10001376 | 3300009176 | Bacteria | 19167 |
| 247 | Ga0105242_10052448 | 3300009176 | Bacteria | 3328 |
| 248 | Ga0105242_10232853 | 3300009176 | Bacteria | 1652 |
| 249 | Ga0105248_10016671 | 3300009177 | Bacteria | 8087 |
| 250 | Ga0105248_10248698 | 3300009177 | Bacteria | 2001 |
| 251 | Ga0105237_10002245 | 3300009545 | Bacteria | 24070 |
| 252 | Ga0105237_10041271 | 3300009545 | Bacteria | 4654 |
| 253 | Ga0105237_10089865 | 3300009545 | Bacteria | 3061 |
| 254 | Ga0105238_10094377 | 3300009551 | Bacteria | 2979 |
| 255 | Ga0105249_10000476 | 3300009553 | Bacteria | 37263 |
| 256 | Ga0105249_10032161 | 3300009553 | Bacteria | 4745 |
| 257 | Ga0105249_10136831 | 3300009553 | Bacteria | 2345 |
| 258 | Ga0105249_10398243 | 3300009553 | Bacteria | 1406 |
| 259 | Ga0099796_10000894 | 3300010159 | Bacteria | 5532 |
| 260 | Ga0105239_10015033 | 3300010375 | Bacteria | 8581 |
| 261 | Ga0105239_10179657 | 3300010375 | Bacteria | 2368 |
| 262 | Ga0105239_10389036 | 3300010375 | Bacteria | 1577 |
| 263 | Ga0105246_10000057 | 3300011119 | Bacteria | 44951 |
| 264 | Ga0157338_1000271 | 3300012515 | Bacteria | 2787 |
| 265 | Ga0157371_10013856 | 3300013102 | Bacteria | 6108 |
| 266 | Ga0157371_10141930 | 3300013102 | Bacteria | 1711 |
| 267 | Ga0157369_10438364 | 3300013105 | Bacteria | 1353 |
| 268 | Ga0157374_10032430 | 3300013296 | Bacteria | 4756 |
| 269 | Ga0157374_10040397 | 3300013296 | Bacteria | 4296 |
| 270 | Ga0157378_10146161 | 3300013297 | Bacteria | 2199 |
| 271 | Ga0163162_10001937 | 3300013306 | Bacteria | 19439 |
| 272 | Ga0163162_10075749 | 3300013306 | Bacteria | 3425 |
| 273 | Ga0157375_10001755 | 3300013308 | Bacteria | 18608 |
| 274 | Ga0157375_10054765 | 3300013308 | Bacteria | 3930 |
| 275 | Ga0157375_10069926 | 3300013308 | Bacteria | 3518 |
| 276 | Ga0157375_10551290 | 3300013308 | Bacteria | 1314 |
| 277 | Ga0163163_10001266 | 3300014325 | Bacteria | 21327 |
| 278 | Ga0163163_10002439 | 3300014325 | Bacteria | 15729 |
| 279 | Ga0163163_10003757 | 3300014325 | Bacteria | 12927 |
| 280 | Ga0163163_10101927 | 3300014325 | Bacteria | 2893 |
| 281 | Ga0157380_10002615 | 3300014326 | Bacteria | 12181 |
| 282 | Ga0182008_10079253 | 3300014497 | Bacteria | 1616 |
| 283 | Ga0157377_10002633 | 3300014745 | Bacteria | 7965 |
| 284 | Ga0157377_10019882 | 3300014745 | Bacteria | 3512 |
| 285 | Ga0157379_10000293 | 3300014968 | Bacteria | 39625 |
| 286 | Ga0157379_10004953 | 3300014968 | Bacteria | 11423 |
| 287 | Ga0157379_10062321 | 3300014968 | Bacteria | 3336 |
| 288 | Ga0157379_10084734 | 3300014968 | Bacteria | 2840 |
| 289 | Ga0157379_10140761 | 3300014968 | Bacteria | 2175 |
| 290 | Ga0157376_10000531 | 3300014969 | Bacteria | 24495 |
| 291 | Ga0157376_10349106 | 3300014969 | Bacteria | 1415 |
| 292 | Ga0163161_10000209 | 3300017792 | Bacteria | 53534 |
| 293 | Ga0206353_11779653 | 3300020082 | Bacteria | 1594 |
| 294 | Ga0213873_10014165 | 3300021358 | Bacteria | 1763 |
| 295 | Ga0213876_10008652 | 3300021384 | Bacteria | 5507 |
| 296 | Ga0207666_1000353 | 3300025271 | Bacteria | 6302 |
| 297 | Ga0207697_10000044 | 3300025315 | Bacteria | 48337 |
| 298 | Ga0207697_10011939 | 3300025315 | Bacteria | 3658 |
| 299 | Ga0207653_10011921 | 3300025885 | Bacteria | 2711 |
| 300 | Ga0207682_10000260 | 3300025893 | Bacteria | 23782 |
| 301 | Ga0207692_10001125 | 3300025898 | Bacteria | 9843 |
| 302 | Ga0207692_10001993 | 3300025898 | Bacteria | 7798 |
| 303 | Ga0207692_10020685 | 3300025898 | Bacteria | 2998 |
| 304 | Ga0207692_10081832 | 3300025898 | Bacteria | 1729 |
| 305 | Ga0207642_10000807 | 3300025899 | Bacteria | 9746 |
| 306 | Ga0207642_10175617 | 3300025899 | Bacteria | 1163 |
| 307 | Ga0207710_10003110 | 3300025900 | Bacteria | 7435 |
| 308 | Ga0207710_10009956 | 3300025900 | Bacteria | 3997 |
| 309 | Ga0207688_10012079 | 3300025901 | Bacteria | 4698 |
| 310 | Ga0207647_10004419 | 3300025904 | Bacteria | 10421 |
| 311 | Ga0207647_10006899 | 3300025904 | Bacteria | 8230 |
| 312 | Ga0207699_10000253 | 3300025906 | Bacteria | 29543 |
| 313 | Ga0207699_10006701 | 3300025906 | Bacteria | 5590 |
| 314 | Ga0207645_10000344 | 3300025907 | Bacteria | 38826 |
| 315 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 316 | Ga0207705_10012927 | 3300025909 | Bacteria | 6023 |
| 317 | Ga0207705_10258921 | 3300025909 | Bacteria | 1328 |
| 318 | Ga0207654_10036113 | 3300025911 | Bacteria | 2759 |
| 319 | Ga0207707_10018209 | 3300025912 | Bacteria | 6122 |
| 320 | Ga0207707_10036720 | 3300025912 | Bacteria | 4283 |
| 321 | Ga0207707_10116020 | 3300025912 | Bacteria | 2340 |
| 322 | Ga0207695_10077441 | 3300025913 | Bacteria | 3377 |
| 323 | Ga0207671_10022324 | 3300025914 | Bacteria | 4786 |
| 324 | Ga0207693_10000861 | 3300025915 | Bacteria | 27070 |
| 325 | Ga0207693_10002835 | 3300025915 | Bacteria | 15018 |
| 326 | Ga0207693_10024218 | 3300025915 | Bacteria | 4820 |
| 327 | Ga0207693_10056378 | 3300025915 | Bacteria | 3081 |
| 328 | Ga0207693_10108204 | 3300025915 | Bacteria | 2181 |
| 329 | Ga0207693_10170006 | 3300025915 | Bacteria | 1717 |
| 330 | Ga0207693_10191176 | 3300025915 | Bacteria | 1611 |
| 331 | Ga0207693_10208285 | 3300025915 | Bacteria | 1537 |
| 332 | Ga0207663_10014464 | 3300025916 | Bacteria | 4320 |
| 333 | Ga0207663_10033471 | 3300025916 | Bacteria | 3062 |
| 334 | Ga0207663_10083699 | 3300025916 | Bacteria | 2096 |
| 335 | Ga0207660_10000992 | 3300025917 | Bacteria | 18816 |
| 336 | Ga0207662_10000216 | 3300025918 | Bacteria | 26834 |
| 337 | Ga0207662_10004775 | 3300025918 | Bacteria | 7163 |
| 338 | Ga0207662_10158640 | 3300025918 | Bacteria | 1444 |
| 339 | Ga0207657_10000358 | 3300025919 | Bacteria | 48238 |
| 340 | Ga0207657_10012419 | 3300025919 | Bacteria | 8416 |
| 341 | Ga0207657_10036149 | 3300025919 | Bacteria | 4423 |
| 342 | Ga0207657_10223741 | 3300025919 | Bacteria | 1507 |
| 343 | Ga0207649_10000545 | 3300025920 | Bacteria | 26032 |
| 344 | Ga0207652_10012964 | 3300025921 | Bacteria | 6745 |
| 345 | Ga0207652_10016404 | 3300025921 | Bacteria | 6048 |
| 346 | Ga0207652_10234747 | 3300025921 | Bacteria | 1653 |
| 347 | Ga0207681_10000684 | 3300025923 | Bacteria | 22260 |
| 348 | Ga0207681_10173205 | 3300025923 | Bacteria | 1637 |
| 349 | Ga0207694_10083458 | 3300025924 | Bacteria | 2512 |
| 350 | Ga0207694_10280239 | 3300025924 | Bacteria | 1369 |
| 351 | Ga0207650_10016372 | 3300025925 | Bacteria | 5183 |
| 352 | Ga0207650_10133430 | 3300025925 | Bacteria | 1945 |
| 353 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 354 | Ga0207659_10008259 | 3300025926 | Bacteria | 6453 |
| 355 | Ga0207687_10000149 | 3300025927 | Bacteria | 46713 |
| 356 | Ga0207687_10025507 | 3300025927 | Bacteria | 3955 |
| 357 | Ga0207700_10011168 | 3300025928 | Bacteria | 5716 |
| 358 | Ga0207700_10018517 | 3300025928 | Bacteria | 4682 |
| 359 | Ga0207700_10093579 | 3300025928 | Bacteria | 2379 |
| 360 | Ga0207700_10097830 | 3300025928 | Bacteria | 2333 |
| 361 | Ga0207700_10165286 | 3300025928 | Bacteria | 1841 |
| 362 | Ga0207664_10005618 | 3300025929 | Bacteria | 8581 |
| 363 | Ga0207664_10015064 | 3300025929 | Bacteria | 5602 |
| 364 | Ga0207664_10029498 | 3300025929 | Bacteria | 4179 |
| 365 | Ga0207664_10067530 | 3300025929 | Bacteria | 2870 |
| 366 | Ga0207644_10007018 | 3300025931 | Bacteria | 7334 |
| 367 | Ga0207644_10088757 | 3300025931 | Bacteria | 2300 |
| 368 | Ga0207690_10000203 | 3300025932 | Bacteria | 46451 |
| 369 | Ga0207690_10034350 | 3300025932 | Bacteria | 3267 |
| 370 | Ga0207690_10307345 | 3300025932 | Bacteria | 1243 |
| 371 | Ga0207706_10002188 | 3300025933 | Bacteria | 19056 |
| 372 | Ga0207706_10008175 | 3300025933 | Bacteria | 9651 |
| 373 | Ga0207706_10023762 | 3300025933 | Bacteria | 5500 |
| 374 | Ga0207686_10001306 | 3300025934 | Bacteria | 14268 |
| 375 | Ga0207686_10004009 | 3300025934 | Bacteria | 7903 |
| 376 | Ga0207709_10000852 | 3300025935 | Bacteria | 23321 |
| 377 | Ga0207670_10005646 | 3300025936 | Bacteria | 6883 |
| 378 | Ga0207669_10000357 | 3300025937 | Bacteria | 20792 |
| 379 | Ga0207669_10108343 | 3300025937 | Bacteria | 1855 |
| 380 | Ga0207704_10002400 | 3300025938 | Bacteria | 8418 |
| 381 | Ga0207704_10070427 | 3300025938 | Bacteria | 2214 |
| 382 | Ga0207665_10000259 | 3300025939 | Bacteria | 36733 |
| 383 | Ga0207665_10011108 | 3300025939 | Bacteria | 5907 |
| 384 | Ga0207665_10019210 | 3300025939 | Bacteria | 4490 |
| 385 | Ga0207665_10213324 | 3300025939 | Bacteria | 1411 |
| 386 | Ga0207691_10000256 | 3300025940 | Bacteria | 52748 |
| 387 | Ga0207691_10328719 | 3300025940 | Bacteria | 1310 |
| 388 | Ga0207711_10011944 | 3300025941 | Bacteria | 7218 |
| 389 | Ga0207711_10020618 | 3300025941 | Bacteria | 5500 |
| 390 | Ga0207689_10000565 | 3300025942 | Bacteria | 35394 |
| 391 | Ga0207689_10028355 | 3300025942 | Bacteria | 4684 |
| 392 | Ga0207661_10000104 | 3300025944 | Bacteria | 53977 |
| 393 | Ga0207679_10000196 | 3300025945 | Bacteria | 48433 |
| 394 | Ga0207679_10052994 | 3300025945 | Bacteria | 2978 |
| 395 | Ga0207679_10392934 | 3300025945 | Bacteria | 1218 |
| 396 | Ga0207667_10032029 | 3300025949 | Bacteria | 5668 |
| 397 | Ga0207667_10219249 | 3300025949 | Bacteria | 1949 |
| 398 | Ga0207667_10337495 | 3300025949 | Bacteria | 1538 |
| 399 | Ga0207651_10001138 | 3300025960 | Bacteria | 11864 |
| 400 | Ga0207712_10000967 | 3300025961 | Bacteria | 20676 |
| 401 | Ga0207712_10027564 | 3300025961 | Bacteria | 3794 |
| 402 | Ga0207712_10117974 | 3300025961 | Bacteria | 2002 |
| 403 | Ga0207668_10000251 | 3300025972 | Bacteria | 35861 |
| 404 | Ga0207668_10103480 | 3300025972 | Bacteria | 2120 |
| 405 | Ga0207640_10000157 | 3300025981 | Bacteria | 49126 |
| 406 | Ga0207640_10099634 | 3300025981 | Bacteria | 2034 |
| 407 | Ga0207658_10010507 | 3300025986 | Bacteria | 6288 |
| 408 | Ga0207658_10031355 | 3300025986 | Bacteria | 3774 |
| 409 | Ga0207658_10086998 | 3300025986 | Bacteria | 2412 |
| 410 | Ga0207658_10119225 | 3300025986 | Bacteria | 2100 |
| 411 | Ga0207677_10000609 | 3300026023 | Bacteria | 22003 |
| 412 | Ga0207703_10007245 | 3300026035 | Bacteria | 8820 |
| 413 | Ga0207703_10044502 | 3300026035 | Bacteria | 3568 |
| 414 | Ga0207639_10002440 | 3300026041 | Bacteria | 12492 |
| 415 | Ga0207639_10113773 | 3300026041 | Bacteria | 2210 |
| 416 | Ga0207639_10171693 | 3300026041 | Bacteria | 1837 |
| 417 | Ga0207678_10001125 | 3300026067 | Bacteria | 24491 |
| 418 | Ga0207678_10055203 | 3300026067 | Bacteria | 3422 |
| 419 | Ga0207708_10000365 | 3300026075 | Bacteria | 35380 |
| 420 | Ga0207708_10015747 | 3300026075 | Bacteria | 5673 |
| 421 | Ga0207702_10003955 | 3300026078 | Bacteria | 13300 |
| 422 | Ga0207702_10163742 | 3300026078 | Bacteria | 2033 |
| 423 | Ga0207702_10193556 | 3300026078 | Bacteria | 1881 |
| 424 | Ga0207702_10238400 | 3300026078 | Bacteria | 1703 |
| 425 | Ga0207702_10281855 | 3300026078 | Bacteria | 1571 |
| 426 | Ga0207641_10002938 | 3300026088 | Bacteria | 15413 |
| 427 | Ga0207648_10000341 | 3300026089 | Bacteria | 51269 |
| 428 | Ga0207648_10023831 | 3300026089 | Bacteria | 5474 |
| 429 | Ga0207648_10154534 | 3300026089 | Bacteria | 2025 |
| 430 | Ga0207676_10004494 | 3300026095 | Bacteria | 9861 |
| 431 | Ga0207676_10012794 | 3300026095 | Bacteria | 6021 |
| 432 | Ga0207676_10450453 | 3300026095 | Bacteria | 1213 |
| 433 | Ga0207674_10001078 | 3300026116 | Bacteria | 35464 |
| 434 | Ga0207675_100003271 | 3300026118 | Bacteria | 15865 |
| 435 | Ga0207675_100072959 | 3300026118 | Bacteria | 3210 |
| 436 | Ga0207675_100160135 | 3300026118 | Bacteria | 2146 |
| 437 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 438 | Ga0209995_1019384 | 3300027471 | Bacteria | 1123 |
| 439 | Ga0209966_1001700 | 3300027695 | Bacteria | 3741 |
| 440 | Ga0209966_1002101 | 3300027695 | Bacteria | 3327 |
| 441 | Ga0209998_10000862 | 3300027717 | Bacteria | 7798 |
| 442 | Ga0209998_10001803 | 3300027717 | Bacteria | 5069 |
| 443 | Ga0209998_10043599 | 3300027717 | Bacteria | 1024 |
| 444 | Ga0209974_10002661 | 3300027876 | Bacteria | 6469 |
| 445 | Ga0209974_10067284 | 3300027876 | Bacteria | 1218 |
| 446 | Ga0207428_10000165 | 3300027907 | Bacteria | 91701 |
| 447 | Ga0207428_10000446 | 3300027907 | Bacteria | 50240 |
| 448 | Ga0207428_10001251 | 3300027907 | Bacteria | 27203 |
| 449 | Ga0207428_10301325 | 3300027907 | Bacteria | 1186 |
| 450 | Ga0268266_10016010 | 3300028379 | Bacteria | 6413 |
| 451 | Ga0268265_10001687 | 3300028380 | Bacteria | 18006 |
| 452 | Ga0268265_10036385 | 3300028380 | Bacteria | 3605 |
| 453 | Ga0268264_10002029 | 3300028381 | Bacteria | 18124 |
| 454 | Ga0268264_10018354 | 3300028381 | Bacteria | 5720 |
| 455 | Ga0265337_1014277 | 3300028556 | Bacteria | 2636 |
| 456 | Ga0265326_10055246 | 3300028558 | Bacteria | 1123 |
| 457 | Ga0265338_10035840 | 3300028800 | Bacteria | 4758 |
| 458 | Ga0265338_10045038 | 3300028800 | Bacteria | 4063 |
| 459 | Ga0265330_10009899 | 3300031235 | Bacteria | 4512 |
| 460 | Ga0265328_10016980 | 3300031239 | Bacteria | 2824 |
| 461 | Ga0265328_10053514 | 3300031239 | Bacteria | 1481 |
| 462 | Ga0265325_10000026 | 3300031241 | Bacteria | 109937 |
| 463 | Ga0265325_10015162 | 3300031241 | Bacteria | 4340 |
| 464 | Ga0265325_10021617 | 3300031241 | Bacteria | 3531 |
| 465 | Ga0265325_10036642 | 3300031241 | Bacteria | 2597 |
| 466 | Ga0265340_10023909 | 3300031247 | Bacteria | 3109 |
| 467 | Ga0265339_10000047 | 3300031249 | Bacteria | 110601 |
| 468 | Ga0265331_10001610 | 3300031250 | Bacteria | 16482 |
| 469 | Ga0265331_10018492 | 3300031250 | Bacteria | 3613 |
| 470 | Ga0265327_10033231 | 3300031251 | Bacteria | 2877 |
| 471 | Ga0265316_10171986 | 3300031344 | Bacteria | 1616 |
| 472 | Ga0265316_10182372 | 3300031344 | Bacteria | 1562 |
| 473 | Ga0265313_10000069 | 3300031595 | Bacteria | 100065 |
| 474 | Ga0265313_10000794 | 3300031595 | Bacteria | 31959 |
| 475 | Ga0265313_10013073 | 3300031595 | Bacteria | 5013 |
| 476 | Ga0265313_10020093 | 3300031595 | Bacteria | 3695 |
| 477 | Ga0265313_10024594 | 3300031595 | Bacteria | 3213 |
| 478 | Ga0265313_10053103 | 3300031595 | Bacteria | 1930 |
| 479 | Ga0265313_10069204 | 3300031595 | Bacteria | 1629 |
| 480 | Ga0265313_10093900 | 3300031595 | Bacteria | 1342 |
| 481 | Ga0316579_10087297 | 3300031691 | Bacteria | 1488 |
| 482 | Ga0265314_10005328 | 3300031711 | Bacteria | 11638 |
| 483 | Ga0265314_10022387 | 3300031711 | Bacteria | 4840 |
| 484 | Ga0265342_10000502 | 3300031712 | Bacteria | 41908 |
| 485 | Ga0307413_10268530 | 3300031824 | Bacteria | 1276 |
| 486 | Ga0307406_10049692 | 3300031901 | Bacteria | 2655 |
| 487 | Ga0307409_100061827 | 3300031995 | Bacteria | 2928 |
| 488 | Ga0307415_100103966 | 3300032126 | Bacteria | 2091 |
| 489 | Ga0316593_10089675 | 3300032168 | Bacteria | 1082 |
| 490 | Ga0307510_10005901 | 3300033180 | Bacteria | 14608 |
| 491 | Ga0373930_0002826 | 3300034816 | Bacteria | 2719 |
| 492 | Ga0373948_0000248 | 3300034817 | Bacteria | 6472 |
| 493 | Ga0373950_0022322 | 3300034818 | Bacteria | 1125 |
| 494 | Ga0373958_0000204 | 3300034819 | Bacteria | 6946 |
| 495 | Ga0373958_0001259 | 3300034819 | Bacteria | 3386 |
| 496 | Ga0373958_0003604 | 3300034819 | Bacteria | 2244 |
| 497 | Ga0373959_0004004 | 3300034820 | Bacteria | 2360 |
| 498 | Ga0373959_0004649 | 3300034820 | Bacteria | 2222 |
| 499 | Ga0373938_0000103 | 3300034957 | Bacteria | 11575 |
| 500 | Ga0373938_0001026 | 3300034957 | Bacteria | 4492 |
| 501 | Ga0373928_0001804 | 3300035084 | Bacteria | 4170 |
| 502 | Ga0373928_0002065 | 3300035084 | Bacteria | 3912 |
| 503 | Ga0373929_0002152 | 3300035085 | Bacteria | 3656 |
| 504 | Ga0373929_0009691 | 3300035085 | Bacteria | 1790 |
| 505 | Ga0373934_0031646 | 3300035086 | Bacteria | 2072 |
| 506 | Ga0373944_0002070 | 3300035089 | Bacteria | 5089 |
| 507 | Ga0373949_0002185 | 3300035090 | Bacteria | 5118 |
| 508 | Ga0373949_0009483 | 3300035090 | Bacteria | 2132 |
| 509 | Ga0373951_0001067 | 3300035091 | Bacteria | 7345 |
| 510 | Ga0373951_0001578 | 3300035091 | Bacteria | 5976 |
| 511 | Ga0373951_0004467 | 3300035091 | Bacteria | 3321 |
| 512 | Ga0373952_0002272 | 3300035092 | Bacteria | 3458 |
| 513 | Ga0373952_0004667 | 3300035092 | Bacteria | 2491 |
| 514 | Ga0373952_0007374 | 3300035092 | Bacteria | 2060 |
| 515 | Ga0373932_0000763 | 3300035112 | Bacteria | 9537 |
| 516 | Ga0373932_0002253 | 3300035112 | Bacteria | 4938 |
| 517 | Ga0373932_0034093 | 3300035112 | Bacteria | 1433 |
| 518 | Ga0373936_0002079 | 3300035113 | Bacteria | 7426 |
| 519 | Ga0373939_0000538 | 3300035114 | Bacteria | 9510 |
| 520 | Ga0373939_0001474 | 3300035114 | Bacteria | 5703 |
| 521 | Ga0373939_0004190 | 3300035114 | Bacteria | 3400 |
| 522 | Ga0373939_0006376 | 3300035114 | Bacteria | 2840 |
| 523 | Ga0373939_0011217 | 3300035114 | Bacteria | 2257 |
| 524 | Ga0373941_0003546 | 3300035115 | Bacteria | 3544 |
| 525 | Ga0373945_0004056 | 3300035116 | Bacteria | 4634 |
| 526 | Ga0373945_0027667 | 3300035116 | Bacteria | 1982 |
| 527 | Ga0373953_0004398 | 3300035117 | Bacteria | 4490 |
| 528 | Ga0373954_0003827 | 3300035118 | Bacteria | 6434 |
| 529 | Ga0373954_0004751 | 3300035118 | Bacteria | 5857 |
| 530 | Ga0373954_0016066 | 3300035118 | Bacteria | 3349 |
| 531 | Ga0373956_0007108 | 3300035119 | Bacteria | 4504 |
| 532 | Ga0373956_0039789 | 3300035119 | Bacteria | 2085 |
| 533 | Ga0373956_0072658 | 3300035119 | Bacteria | 1571 |
| 534 | Ga0373957_0002588 | 3300035120 | Bacteria | 5190 |
| 535 | Ga0373957_0040020 | 3300035120 | Bacteria | 1761 |
| 536 | Ga0373960_0000016 | 3300035121 | Bacteria | 21415 |
| 537 | Ga0373943_0010246 | 3300035170 | Bacteria | 4204 |
| 538 | Ga0373943_0019971 | 3300035170 | Bacteria | 3085 |
| 539 | Ga0373943_0030538 | 3300035170 | Bacteria | 2551 |
| 540 | Ga0373943_0031519 | 3300035170 | Bacteria | 2515 |
| 541 | Ga0373946_0000794 | 3300035171 | Bacteria | 10763 |
| 542 | Ga0373946_0040304 | 3300035171 | Bacteria | 1910 |
| 543 | Ga0373955_0001006 | 3300035172 | Bacteria | 11984 |
| 544 | Ga0373955_0001974 | 3300035172 | Bacteria | 8836 |
| 545 | Ga0373955_0003538 | 3300035172 | Bacteria | 6874 |
| 546 | Ga0373955_0015930 | 3300035172 | Bacteria | 3690 |
| 547 | Ga0373955_0024053 | 3300035172 | Bacteria | 3110 |
| 548 | Ga0373942_0001481 | 3300035207 | Bacteria | 6042 |
| 549 | Ga0373942_0004423 | 3300035207 | Bacteria | 3263 |
| 550 | Ga0373961_0003830 | 3300035241 | Bacteria | 3676 |
| 551 | Ga0373961_0003885 | 3300035241 | Bacteria | 3646 |
| 552 | Ga0373961_0005277 | 3300035241 | Bacteria | 3108 |
| 553 | Ga0373962_0000149 | 3300035242 | Bacteria | 14459 |
| 554 | Ga0373962_0000620 | 3300035242 | Bacteria | 8028 |
| 555 | Ga0373962_0001044 | 3300035242 | Bacteria | 6427 |
| 556 | Ga0373924_0001761 | 3300035410 | Bacteria | 7148 |
| 557 | Ga0373931_0002359 | 3300035691 | Bacteria | 8345 |
| 558 | Ga0373931_0004026 | 3300035691 | Bacteria | 6658 |
| 559 | Ga0373931_0012885 | 3300035691 | Bacteria | 4061 |
| 560 | Ga0373931_0035211 | 3300035691 | Bacteria | 2601 |
| 561 | Ga0373935_0003725 | 3300035692 | Bacteria | 8896 |
| 562 | Ga0373935_0074363 | 3300035692 | Bacteria | 2196 |
| 563 | Ga0373927_0014192 | 3300035695 | Bacteria | 5282 |
| 564 | Ga0373927_0019295 | 3300035695 | Bacteria | 4472 |
| 565 | Ga0373927_0022483 | 3300035695 | Bacteria | 4131 |
| 566 | Ga0373933_0003044 | 3300035724 | Bacteria | 9355 |
| 567 | Ga0373933_0007407 | 3300035724 | Bacteria | 5985 |
| 568 | Ga0373933_0014720 | 3300035724 | Bacteria | 4353 |
| 569 | Ga0373947_0048824 | 3300035725 | Bacteria | 2540 |
| 570 | Ga0373947_0058914 | 3300035725 | Bacteria | 2327 |
| 571 | Ga0373937_0001830 | 3300036401 | Bacteria | 17860 |
| 572 | Ga0373937_0003591 | 3300036401 | Bacteria | 13079 |
| 573 | Ga0373937_0003746 | 3300036401 | Bacteria | 12849 |
| 574 | Ga0373937_0018802 | 3300036401 | Bacteria | 6176 |
| 575 | Ga0373937_0026471 | 3300036401 | Bacteria | 5242 |
| 576 | Ga0373925_0004912 | 3300037068 | Bacteria | 10054 |
| 577 | Ga0395899_0055599 | 3300037312 | Bacteria | 2927 |
| 578 | Ga0395900_0001539 | 3300037418 | Bacteria | 27389 |
| 579 | Ga0395900_0014500 | 3300037418 | Bacteria | 8041 |
| 580 | Ga0395900_0065578 | 3300037418 | Bacteria | 3731 |
| 581 | Ga0395898_0018398 | 3300037466 | Bacteria | 7124 |
| 582 | Ga0395898_0053996 | 3300037466 | Bacteria | 3922 |
| 583 | Ga0395901_0019085 | 3300038443 | Bacteria | 7011 |
| 584 | Ga0436365_0276616 | 3300039437 | Bacteria | 4975 |
| 585 | Ga0436365_0340427 | 3300039437 | Bacteria | 11316 |
| 586 | Ga0436365_1108063 | 3300039437 | Bacteria | 1634 |
| 587 | Ga0436365_1744975 | 3300039437 | Bacteria | 17913 |
| 588 | Ga0436365_1793855 | 3300039437 | Bacteria | 1997 |
| 589 | Ga0436360_0620291 | 3300039438 | Unclassified | 1164 |
| 590 | Ga0436363_0159755 | 3300039450 | Bacteria | 5310 |
| 591 | Ga0436363_0547396 | 3300039450 | Bacteria | 1403 |
| 592 | Ga0439448_0030523 | 3300042005 | Bacteria | 1710 |
| 593 | Ga0466963_0040811 | 3300044694 | Bacteria | 3042 |
| 594 | Ga0466963_0048614 | 3300044694 | Bacteria | 2803 |
| 595 | Ga0453684_0030893 | 3300044712 | Bacteria | 7552 |
| 596 | Ga0466971_0084811 | 3300044719 | Bacteria | 1447 |
| 597 | Ga0466957_0264414 | 3300044842 | Bacteria | 1147 |
| 598 | Ga0451576_0016162 | 3300045051 | Bacteria | 8246 |
| 599 | Ga0466958_0175418 | 3300045836 | Bacteria | 1359 |
| 600 | Ga0466967_0007437 | 3300045976 | Bacteria | 7900 |
| 601 | Ga0466967_0447170 | 3300045976 | Bacteria | 1263 |
| 602 | Ga0495617_049441 | 3300046452 | Bacteria | 1399 |
| 603 | Ga0495592_0002638 | 3300046454 | Bacteria | 12675 |
| 604 | Ga0495592_0010694 | 3300046454 | Bacteria | 6919 |
| 605 | Ga0495592_0254498 | 3300046454 | Bacteria | 1159 |
| 606 | Ga0495603_0015087 | 3300046455 | Bacteria | 4673 |
| 607 | Ga0495629_0000908 | 3300046459 | Bacteria | 23774 |
| 608 | Ga0495629_0008943 | 3300046459 | Bacteria | 7357 |
| 609 | Ga0495629_0028960 | 3300046459 | Bacteria | 3930 |
| 610 | Ga0495629_0065245 | 3300046459 | Bacteria | 2542 |
| 611 | Ga0495629_0072282 | 3300046459 | Bacteria | 2407 |
| 612 | Ga0495629_0091414 | 3300046459 | Bacteria | 2124 |
| 613 | Ga0495641_0013745 | 3300046461 | Bacteria | 4424 |
| 614 | Ga0495641_0068989 | 3300046461 | Bacteria | 1589 |
| 615 | Ga0495651_0010375 | 3300046462 | Bacteria | 7157 |
| 616 | Ga0495651_0015811 | 3300046462 | Bacteria | 5842 |
| 617 | Ga0495651_0031843 | 3300046462 | Bacteria | 4111 |
| 618 | Ga0495651_0035348 | 3300046462 | Bacteria | 3891 |
| 619 | Ga0495651_0042107 | 3300046462 | Bacteria | 3546 |
| 620 | Ga0495653_0161929 | 3300046463 | Bacteria | 1552 |
| 621 | Ga0495580_0038175 | 3300046472 | Bacteria | 3441 |
| 622 | Ga0495582_0013116 | 3300046473 | Bacteria | 4562 |
| 623 | Ga0495662_0002314 | 3300046476 | Bacteria | 9607 |
| 624 | Ga0495664_0019528 | 3300046477 | Bacteria | 3897 |
| 625 | Ga0495664_0031623 | 3300046477 | Bacteria | 3103 |
| 626 | Ga0495664_0056004 | 3300046477 | Bacteria | 2345 |
| 627 | Ga0495585_0004760 | 3300046492 | Bacteria | 8737 |
| 628 | Ga0495607_0016632 | 3300046501 | Bacteria | 4744 |
| 629 | Ga0495606_0002132 | 3300046507 | Bacteria | 23896 |
| 630 | Ga0495608_0010351 | 3300046511 | Bacteria | 6508 |
| 631 | Ga0495608_0013583 | 3300046511 | Bacteria | 5648 |
| 632 | Ga0495608_0029442 | 3300046511 | Bacteria | 3723 |
| 633 | Ga0495618_0019969 | 3300046514 | Bacteria | 4123 |
| 634 | Ga0495618_0086748 | 3300046514 | Bacteria | 2001 |
| 635 | Ga0495628_0000115 | 3300046516 | Bacteria | 65159 |
| 636 | Ga0495628_0048362 | 3300046516 | Bacteria | 3371 |
| 637 | Ga0495628_0075930 | 3300046516 | Bacteria | 2616 |
| 638 | Ga0495628_0343576 | 3300046516 | Bacteria | 1098 |
| 639 | Ga0495630_0103854 | 3300046517 | Bacteria | 2150 |
| 640 | Ga0495637_0052229 | 3300046520 | Unclassified | 1707 |
| 641 | Ga0495644_0000983 | 3300046523 | Bacteria | 11834 |
| 642 | Ga0495666_0012543 | 3300046526 | Bacteria | 4225 |
| 643 | Ga0495652_0001117 | 3300046529 | Bacteria | 30393 |
| 644 | Ga0495652_0007929 | 3300046529 | Bacteria | 9747 |
| 645 | Ga0495652_0013930 | 3300046529 | Bacteria | 7229 |
| 646 | Ga0495652_0027254 | 3300046529 | Bacteria | 5036 |
| 647 | Ga0495665_0010075 | 3300046531 | Bacteria | 5121 |
| 648 | Ga0495640_0035855 | 3300046533 | Bacteria | 3509 |
| 649 | Ga0495640_0062405 | 3300046533 | Bacteria | 2527 |
| 650 | Ga0495640_0110846 | 3300046533 | Unclassified | 1793 |
| 651 | Ga0495586_0048068 | 3300046535 | Bacteria | 2304 |
| 652 | Ga0495587_0006245 | 3300046536 | Bacteria | 7779 |
| 653 | Ga0495587_0019798 | 3300046536 | Bacteria | 4160 |
| 654 | Ga0495598_0020568 | 3300046537 | Unclassified | 1744 |
| 655 | Ga0495609_0140321 | 3300046538 | Bacteria | 1031 |
| 656 | Ga0495645_0010751 | 3300046543 | Bacteria | 6431 |
| 657 | Ga0495645_0018002 | 3300046543 | Bacteria | 5069 |
| 658 | Ga0495645_0113080 | 3300046543 | Bacteria | 1919 |
| 659 | Ga0495622_0003333 | 3300046557 | Bacteria | 7587 |
| 660 | Ga0495622_0071727 | 3300046557 | Bacteria | 1598 |
| 661 | Ga0495633_0008234 | 3300046558 | Bacteria | 5898 |
| 662 | Ga0495667_0000674 | 3300046559 | Bacteria | 21859 |
| 663 | Ga0495667_0003600 | 3300046559 | Bacteria | 10422 |
| 664 | Ga0495667_0017680 | 3300046559 | Bacteria | 4816 |
| 665 | Ga0495667_0018730 | 3300046559 | Bacteria | 4674 |
| 666 | Ga0495667_0026205 | 3300046559 | Bacteria | 3927 |
| 667 | Ga0495656_0000789 | 3300046615 | Bacteria | 10214 |
| 668 | Ga0495634_0038239 | 3300046642 | Bacteria | 3272 |
| 669 | Ga0495634_0080129 | 3300046642 | Bacteria | 2137 |
| 670 | Ga0495634_0099766 | 3300046642 | Bacteria | 1877 |
| 671 | Ga0495625_0116833 | 3300046660 | Bacteria | 1819 |
| 672 | Ga0495635_0002598 | 3300046663 | Bacteria | 12359 |
| 673 | Ga0495635_0009000 | 3300046663 | Bacteria | 6965 |
| 674 | Ga0495635_0025046 | 3300046663 | Bacteria | 4157 |
| 675 | Ga0495635_0111734 | 3300046663 | Bacteria | 1866 |
| 676 | Ga0495659_0005270 | 3300046664 | Bacteria | 4068 |
| 677 | Ga0495588_0020105 | 3300046674 | Bacteria | 3276 |
| 678 | Ga0495588_0198236 | 3300046674 | Bacteria | 1060 |
| 679 | Ga0495657_0011216 | 3300046675 | Bacteria | 6713 |
| 680 | Ga0495657_0014159 | 3300046675 | Bacteria | 5860 |
| 681 | Ga0495599_0007091 | 3300046678 | Bacteria | 6786 |
| 682 | Ga0495599_0031443 | 3300046678 | Bacteria | 3332 |
| 683 | Ga0495623_0002539 | 3300046679 | Bacteria | 12066 |
| 684 | Ga0495623_0021243 | 3300046679 | Bacteria | 4193 |
| 685 | Ga0495646_0002845 | 3300046680 | Bacteria | 10710 |
| 686 | Ga0495646_0020414 | 3300046680 | Bacteria | 4191 |
| 687 | Ga0495646_0043834 | 3300046680 | Bacteria | 2737 |
| 688 | Ga0495646_0118237 | 3300046680 | Bacteria | 1502 |
| 689 | Ga0495647_0006115 | 3300046681 | Bacteria | 3969 |
| 690 | Ga0495647_0008529 | 3300046681 | Plasmid | 3447 |
| 691 | Ga0495658_0000673 | 3300046683 | Bacteria | 18551 |
| 692 | Ga0495613_0058540 | 3300046689 | Bacteria | 2827 |
| 693 | Ga0495613_0168647 | 3300046689 | Bacteria | 1554 |
| 694 | Ga0495624_0004039 | 3300046690 | Bacteria | 10793 |
| 695 | Ga0495624_0137077 | 3300046690 | Bacteria | 1500 |
| 696 | Ga0495670_0000479 | 3300046691 | Bacteria | 18937 |
| 697 | Ga0495671_0036634 | 3300046692 | Bacteria | 2484 |
| 698 | Ga0495600_0000876 | 3300046809 | Bacteria | 16075 |
| 699 | Ga0495600_0055592 | 3300046809 | Bacteria | 2585 |
| 700 | Ga0495600_0077847 | 3300046809 | Bacteria | 2166 |
| 701 | Ga0495600_0151915 | 3300046809 | Bacteria | 1499 |
| 702 | Ga0495581_0006390 | 3300047315 | Bacteria | 6837 |
| 703 | Ga0495604_0000619 | 3300047317 | Bacteria | 30531 |
| 704 | Ga0495604_0001990 | 3300047317 | Bacteria | 16501 |
| 705 | Ga0495604_0009299 | 3300047317 | Bacteria | 7781 |
| 706 | Ga0495674_0005221 | 3300047319 | Bacteria | 12468 |
| 707 | Ga0495674_0069477 | 3300047319 | Bacteria | 3045 |
| 708 | Ga0495672_0119466 | 3300047320 | Bacteria | 1403 |
| 709 | Ga0495676_0022034 | 3300047321 | Bacteria | 5552 |
| 710 | Ga0495676_0206799 | 3300047321 | Unclassified | 1360 |
| 711 | Ga0495680_0002310 | 3300047322 | Bacteria | 19589 |
| 712 | Ga0495680_0002967 | 3300047322 | Bacteria | 16971 |
| 713 | Ga0495680_0019825 | 3300047322 | Bacteria | 5670 |
| 714 | Ga0495680_0026626 | 3300047322 | Bacteria | 4763 |
| 715 | Ga0495675_0029011 | 3300047444 | Bacteria | 3527 |
| 716 | Ga0495675_0075594 | 3300047444 | Bacteria | 2123 |
| 717 | Ga0495684_0003464 | 3300047471 | Bacteria | 12344 |
| 718 | Ga0495684_0071240 | 3300047471 | Bacteria | 2641 |
| 719 | Ga0495684_0129934 | 3300047471 | Bacteria | 1893 |
| 720 | Ga0495593_0003537 | 3300047673 | Bacteria | 9347 |
| 721 | Ga0495593_0053418 | 3300047673 | Bacteria | 2133 |
| 722 | Ga0495602_0003665 | 3300048088 | Bacteria | 15920 |
| 723 | Ga0495602_0030986 | 3300048088 | Bacteria | 5063 |
| 724 | Ga0495602_0078472 | 3300048088 | Bacteria | 2789 |
| 725 | Ga0495602_0098047 | 3300048088 | Bacteria | 2413 |
| 726 | Ga0496100_0004411 | 3300048903 | Bacteria | 7456 |
| 727 | Ga0496100_0006203 | 3300048903 | Bacteria | 6501 |
| 728 | Ga0496100_0064055 | 3300048903 | Bacteria | 2431 |
| 729 | Ga0496100_0198714 | 3300048903 | Bacteria | 1460 |
| 730 | Ga0496100_0249691 | 3300048903 | Bacteria | 1312 |
| 731 | Ga0496101_0000464 | 3300048904 | Bacteria | 25674 |
| 732 | Ga0496101_0009586 | 3300048904 | Bacteria | 6368 |
| 733 | Ga0496101_0108048 | 3300048904 | Bacteria | 2091 |
| 734 | Ga0496101_0341825 | 3300048904 | Bacteria | 1175 |
| 735 | Ga0496102_0001120 | 3300048905 | Bacteria | 24582 |
| 736 | Ga0496102_0032062 | 3300048905 | Bacteria | 4720 |
| 737 | Ga0496102_0120448 | 3300048905 | Bacteria | 2450 |
| 738 | Ga0496102_0221629 | 3300048905 | Bacteria | 1783 |
| 739 | Ga0496102_0483063 | 3300048905 | Bacteria | 1160 |
| 740 | Ga0496103_0000611 | 3300048906 | Bacteria | 27883 |
| 741 | Ga0496103_0071919 | 3300048906 | Bacteria | 2165 |
| 742 | Ga0496104_0000279 | 3300048907 | Bacteria | 45192 |
| 743 | Ga0496104_0000299 | 3300048907 | Bacteria | 43965 |
| 744 | Ga0496104_0004500 | 3300048907 | Bacteria | 12143 |
| 745 | Ga0496104_0014336 | 3300048907 | Bacteria | 7158 |
| 746 | Ga0496104_0022589 | 3300048907 | Bacteria | 5777 |
| 747 | Ga0496104_0060191 | 3300048907 | Bacteria | 3597 |
| 748 | Ga0496104_0105923 | 3300048907 | Bacteria | 2694 |
| 749 | Ga0496104_0125360 | 3300048907 | Bacteria | 2466 |
| 750 | Ga0496104_0239644 | 3300048907 | Bacteria | 1726 |
| 751 | Ga0496104_0264810 | 3300048907 | Bacteria | 1631 |
| 752 | Ga0496104_0385638 | 3300048907 | Bacteria | 1313 |
| 753 | Ga0496104_0571857 | 3300048907 | Bacteria | 1040 |
| 754 | Ga0496105_0000157 | 3300048908 | Bacteria | 45010 |
| 755 | Ga0496105_0001270 | 3300048908 | Bacteria | 17643 |
| 756 | Ga0496105_0052802 | 3300048908 | Bacteria | 3357 |
| 757 | Ga0496105_0053668 | 3300048908 | Bacteria | 3329 |
| 758 | Ga0496105_0114051 | 3300048908 | Bacteria | 2229 |
| 759 | Ga0496106_0000541 | 3300048909 | Bacteria | 26824 |
| 760 | Ga0496106_0041084 | 3300048909 | Bacteria | 3465 |
| 761 | Ga0496106_0057223 | 3300048909 | Bacteria | 2948 |
| 762 | Ga0496106_0147036 | 3300048909 | Bacteria | 1857 |
| 763 | Ga0496107_0001684 | 3300048910 | Bacteria | 13835 |
| 764 | Ga0496107_0003483 | 3300048910 | Bacteria | 10525 |
| 765 | Ga0496107_0018855 | 3300048910 | Bacteria | 4863 |
| 766 | Ga0496107_0041412 | 3300048910 | Bacteria | 3306 |
| 767 | Ga0496108_0000660 | 3300048911 | Bacteria | 26581 |
| 768 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 769 | Ga0496108_0003134 | 3300048911 | Bacteria | 13290 |
| 770 | Ga0496108_0020932 | 3300048911 | Bacteria | 5378 |
| 771 | Ga0496108_0061584 | 3300048911 | Bacteria | 3158 |
| 772 | Ga0496108_0187188 | 3300048911 | Bacteria | 1793 |
| 773 | Ga0496108_0213856 | 3300048911 | Bacteria | 1674 |
| 774 | Ga0496109_0000696 | 3300048912 | Bacteria | 27921 |
| 775 | Ga0496109_0000977 | 3300048912 | Bacteria | 23646 |
| 776 | Ga0496109_0001413 | 3300048912 | Bacteria | 19914 |
| 777 | Ga0496109_0002804 | 3300048912 | Bacteria | 14591 |
| 778 | Ga0496109_0012519 | 3300048912 | Bacteria | 7324 |
| 779 | Ga0496110_0049690 | 3300048913 | Bacteria | 3680 |
| 780 | Ga0496110_0051664 | 3300048913 | Bacteria | 3612 |
| 781 | Ga0496110_0059567 | 3300048913 | Bacteria | 3366 |
| 782 | Ga0496110_0100573 | 3300048913 | Bacteria | 2591 |
| 783 | Ga0496110_0232299 | 3300048913 | Bacteria | 1677 |
| 784 | Ga0496111_0039261 | 3300048914 | Bacteria | 3393 |
| 785 | Ga0496112_0000045 | 3300048915 | Bacteria | 85873 |
| 786 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 787 | Ga0496112_0003700 | 3300048915 | Bacteria | 12756 |
| 788 | Ga0496112_0004414 | 3300048915 | Bacteria | 11908 |
| 789 | Ga0496112_0011347 | 3300048915 | Bacteria | 8133 |
| 790 | Ga0496112_0015545 | 3300048915 | Bacteria | 7108 |
| 791 | Ga0496112_0015661 | 3300048915 | Bacteria | 7081 |
| 792 | Ga0496112_0110069 | 3300048915 | Bacteria | 2725 |
| 793 | Ga0496113_0000962 | 3300048916 | Bacteria | 15335 |
| 794 | Ga0496113_0001231 | 3300048916 | Bacteria | 14077 |
| 795 | Ga0496113_0119226 | 3300048916 | Bacteria | 2061 |
| 796 | Ga0496113_0144907 | 3300048916 | Bacteria | 1870 |
| 797 | Ga0496113_0351464 | 3300048916 | Bacteria | 1182 |
| 798 | Ga0496114_0011491 | 3300048917 | Bacteria | 7076 |
| 799 | Ga0496114_0014713 | 3300048917 | Bacteria | 6287 |
| 800 | Ga0496114_0070041 | 3300048917 | Bacteria | 2945 |
| 801 | Ga0496114_0286118 | 3300048917 | Bacteria | 1454 |
| 802 | Ga0496115_0012499 | 3300048918 | Bacteria | 6391 |
| 803 | Ga0496115_0016751 | 3300048918 | Bacteria | 5585 |
| 804 | Ga0496115_0066908 | 3300048918 | Bacteria | 2904 |
| 805 | Ga0496115_0099117 | 3300048918 | Bacteria | 2387 |
| 806 | Ga0496115_0110381 | 3300048918 | Bacteria | 2259 |
| 807 | Ga0496115_0171451 | 3300048918 | Bacteria | 1794 |
| 808 | Ga0496115_0322032 | 3300048918 | Bacteria | 1264 |
| 809 | Ga0496119_0004297 | 3300048922 | Bacteria | 14250 |
| 810 | Ga0496126_0008548 | 3300048929 | Bacteria | 11032 |
| 811 | Ga0496126_0063075 | 3300048929 | Bacteria | 3323 |
| 812 | Ga0496126_0133298 | 3300048929 | Bacteria | 2145 |
| 813 | Ga0496126_0238760 | 3300048929 | Bacteria | 1519 |
| 814 | Ga0496126_0254895 | 3300048929 | Bacteria | 1461 |
| 815 | Ga0501032_0013787 | 3300049569 | Bacteria | 5735 |
| 816 | Ga0501032_0026425 | 3300049569 | Bacteria | 3992 |
| 817 | Ga0501033_0026459 | 3300049570 | Bacteria | 4366 |
| 818 | Ga0501033_0035781 | 3300049570 | Bacteria | 3722 |
| 819 | Ga0501033_0094162 | 3300049570 | Bacteria | 2190 |
| 820 | Ga0501033_0293446 | 3300049570 | Bacteria | 1146 |
| 821 | Ga0501034_0000229 | 3300049571 | Bacteria | 105030 |
| 822 | Ga0501034_0013020 | 3300049571 | Bacteria | 8573 |
| 823 | Ga0501034_0023890 | 3300049571 | Bacteria | 6221 |
| 824 | Ga0501034_0078705 | 3300049571 | Bacteria | 3300 |
| 825 | Ga0501034_0212294 | 3300049571 | Bacteria | 1890 |
| 826 | Ga0501036_0001657 | 3300049572 | Bacteria | 17249 |
| 827 | Ga0501036_0019768 | 3300049572 | Bacteria | 5654 |
| 828 | Ga0501036_0110671 | 3300049572 | Bacteria | 2321 |
| 829 | Ga0501037_0005935 | 3300049573 | Bacteria | 8917 |
| 830 | Ga0501037_0018906 | 3300049573 | Bacteria | 5078 |
| 831 | Ga0501038_0013215 | 3300049574 | Bacteria | 7529 |
| 832 | Ga0501038_0172084 | 3300049574 | Bacteria | 1752 |
| 833 | Ga0501039_0009233 | 3300049575 | Bacteria | 7515 |
| 834 | Ga0501039_0194570 | 3300049575 | Bacteria | 1594 |
| 835 | Ga0501039_0208799 | 3300049575 | Bacteria | 1535 |
| 836 | Ga0501043_0002225 | 3300049579 | Bacteria | 16540 |
| 837 | Ga0501043_0007079 | 3300049579 | Bacteria | 8927 |
| 838 | Ga0501043_0011946 | 3300049579 | Bacteria | 6794 |
| 839 | Ga0501043_0114917 | 3300049579 | Bacteria | 2112 |
| 840 | Ga0501043_0277942 | 3300049579 | Bacteria | 1284 |
| 841 | Ga0501046_0023812 | 3300049580 | Bacteria | 5031 |
| 842 | Ga0501047_0000314 | 3300049581 | Bacteria | 55906 |
| 843 | Ga0501047_0087590 | 3300049581 | Bacteria | 2991 |
| 844 | Ga0501047_0132116 | 3300049581 | Bacteria | 2376 |
| 845 | Ga0501047_0168876 | 3300049581 | Bacteria | 2057 |
| 846 | Ga0501048_0002000 | 3300049582 | Bacteria | 15488 |
| 847 | Ga0501068_0006446 | 3300049584 | Bacteria | 6470 |
| 848 | Ga0501069_0083206 | 3300049585 | Bacteria | 1804 |
| 849 | Ga0501069_0089368 | 3300049585 | Bacteria | 1741 |
| 850 | Ga0501070_0006779 | 3300049586 | Bacteria | 9746 |
| 851 | Ga0501070_0007677 | 3300049586 | Bacteria | 9150 |
| 852 | Ga0501070_0008242 | 3300049586 | Bacteria | 8811 |
| 853 | Ga0501070_0052152 | 3300049586 | Bacteria | 3395 |
| 854 | Ga0501070_0062216 | 3300049586 | Bacteria | 3092 |
| 855 | Ga0501070_0066421 | 3300049586 | Bacteria | 2987 |
| 856 | Ga0501071_0067741 | 3300049587 | Bacteria | 2597 |
| 857 | Ga0501072_0004407 | 3300049588 | Bacteria | 10689 |
| 858 | Ga0501072_0096288 | 3300049588 | Bacteria | 2352 |
| 859 | Ga0501072_0217227 | 3300049588 | Bacteria | 1524 |
| 860 | Ga0501073_0007118 | 3300049589 | Bacteria | 8331 |
| 861 | Ga0501073_0049770 | 3300049589 | Bacteria | 2937 |
| 862 | Ga0501073_0226226 | 3300049589 | Bacteria | 1292 |
| 863 | Ga0501074_0034191 | 3300049590 | Bacteria | 3685 |
| 864 | Ga0501076_0087471 | 3300049592 | Bacteria | 2505 |
| 865 | Ga0501076_0239841 | 3300049592 | Bacteria | 1483 |
| 866 | Ga0501079_0079963 | 3300049741 | Bacteria | 2527 |
| 867 | Ga0501080_0005419 | 3300049742 | Bacteria | 11382 |
| 868 | Ga0501080_0126161 | 3300049742 | Bacteria | 2370 |
| 869 | Ga0501083_0001743 | 3300049744 | Bacteria | 14830 |
| 870 | Ga0501083_0046344 | 3300049744 | Bacteria | 2940 |
| 871 | Ga0501083_0129738 | 3300049744 | Bacteria | 1652 |
| 872 | Ga0501035_0000896 | 3300049822 | Bacteria | 31485 |
| 873 | Ga0501035_0016102 | 3300049822 | Bacteria | 6899 |
| 874 | Ga0501035_0030449 | 3300049822 | Bacteria | 4919 |
| 875 | Ga0501035_0119923 | 3300049822 | Bacteria | 2300 |
| 876 | Ga0501035_0262985 | 3300049822 | Bacteria | 1462 |
| 877 | Ga0501035_0319828 | 3300049822 | Bacteria | 1304 |
| 878 | Ga0501035_0409611 | 3300049822 | Bacteria | 1127 |
| 879 | Ga0501044_0026016 | 3300049823 | Bacteria | 6198 |
| 880 | Ga0501044_0028840 | 3300049823 | Bacteria | 5854 |
| 881 | Ga0501044_0040259 | 3300049823 | Bacteria | 4870 |
| 882 | Ga0501044_0068356 | 3300049823 | Bacteria | 3619 |
| 883 | Ga0501044_0109276 | 3300049823 | Bacteria | 2774 |
| 884 | Ga0501044_0167511 | 3300049823 | Bacteria | 2170 |
| 885 | Ga0501044_0197844 | 3300049823 | Bacteria | 1969 |
| 886 | Ga0501044_0250109 | 3300049823 | Bacteria | 1714 |
| 887 | Ga0501044_0291460 | 3300049823 | Bacteria | 1563 |
| 888 | nmdc:mga0yw44_47683_c1 | 3300050492 | Bacteria | 2580 |
| 889 | nmdc:mga06z11_60782_c1 | 3300050494 | Bacteria | 1968 |
| 890 | nmdc:mga07m45_136399_c1 | 3300050496 | Bacteria | 1420 |
| 891 | nmdc:mga07m45_17418_c1 | 3300050496 | Bacteria | 3859 |
| 892 | nmdc:mga05p37_133863_c1 | 3300050507 | Bacteria | 3041 |
| 893 | nmdc:mga05p37_2697_c1 | 3300050507 | Bacteria | 19225 |
| 894 | nmdc:mga09592_12303_c1 | 3300050508 | Bacteria | 6968 |
| 895 | nmdc:mga0qj67_693_c1 | 3300050509 | Bacteria | 22941 |
| 896 | nmdc:mga06r32_1056_c1 | 3300050510 | Bacteria | 24895 |
| 897 | nmdc:mga08y16_119630_c1 | 3300050511 | Bacteria | 2741 |
| 898 | nmdc:mga08y16_82727_c1 | 3300050511 | Bacteria | 3347 |
| 899 | nmdc:mga0n895_159790_c1 | 3300050512 | Bacteria | 2285 |
| 900 | nmdc:mga0n895_1654_c1 | 3300050512 | Bacteria | 16850 |
| 901 | nmdc:mga0n895_206722_c1 | 3300050512 | Bacteria | 1994 |
| 902 | nmdc:mga0n895_32994_c1 | 3300050512 | Bacteria | 4973 |
| 903 | nmdc:mga0rr50_1013_c1 | 3300050513 | Bacteria | 15240 |
| 904 | nmdc:mga0rr50_143061_c1 | 3300050513 | Bacteria | 1926 |
| 905 | nmdc:mga0rr50_161499_c1 | 3300050513 | Bacteria | 1819 |
| 906 | nmdc:mga0rr50_228131_c1 | 3300050513 | Unclassified | 1540 |
| 907 | nmdc:mga08x19_96260_c1 | 3300050514 | Bacteria | 1959 |
| 908 | nmdc:mga0a205_284340_c1 | 3300050515 | Bacteria | 1529 |
| 909 | nmdc:mga0a205_467_c1 | 3300050515 | Bacteria | 29468 |
| 910 | nmdc:mga0a205_6139_c1 | 3300050515 | Bacteria | 10841 |
| 911 | Ga0495601_0000701 | 3300053077 | Bacteria | 17998 |
| 912 | Ga0495601_0001682 | 3300053077 | Bacteria | 12202 |
| 913 | Ga0495601_0003818 | 3300053077 | Bacteria | 8668 |
| 914 | Ga0495601_0009237 | 3300053077 | Bacteria | 5828 |
| 915 | Ga0495601_0024093 | 3300053077 | Bacteria | 3745 |
| 916 | Ga0495601_0033370 | 3300053077 | Bacteria | 3207 |
| 917 | Ga0495601_0050468 | 3300053077 | Bacteria | 2624 |
| 918 | Ga0495612_0000478 | 3300053078 | Bacteria | 16063 |
| 919 | Ga0495612_0001410 | 3300053078 | Bacteria | 9882 |
| 920 | Ga0495612_0005755 | 3300053078 | Bacteria | 5119 |
| 921 | Ga0495612_0012899 | 3300053078 | Bacteria | 3366 |
| 922 | Ga0495612_0034083 | 3300053078 | Bacteria | 2061 |
| 923 | Ga0495595_0000277 | 3300053084 | Bacteria | 20328 |
| 924 | Ga0495595_0007089 | 3300053084 | Bacteria | 4579 |
| 925 | Ga0495595_0010272 | 3300053084 | Bacteria | 3889 |
| 926 | Ga0495595_0015012 | 3300053084 | Bacteria | 3296 |
| 927 | Ga0495595_0015922 | 3300053084 | Bacteria | 3210 |
| 928 | Ga0495595_0015962 | 3300053084 | Bacteria | 3207 |
| 929 | Ga0495595_0141297 | 3300053084 | Bacteria | 1181 |
| 930 | Ga0495619_0000159 | 3300053085 | Bacteria | 49689 |
| 931 | Ga0495619_0000300 | 3300053085 | Bacteria | 34873 |
| 932 | Ga0495619_0000628 | 3300053085 | Bacteria | 23297 |
| 933 | Ga0495619_0004640 | 3300053085 | Bacteria | 8756 |
| 934 | Ga0495619_0010923 | 3300053085 | Bacteria | 5715 |
| 935 | Ga0495619_0035693 | 3300053085 | Bacteria | 3234 |
| 936 | Ga0495619_0061653 | 3300053085 | Bacteria | 2495 |
| 937 | Ga0495619_0135342 | 3300053085 | Bacteria | 1695 |
| 938 | Ga0500643_003796 | 3300053087 | Bacteria | 7063 |
| 939 | Ga0500644_0000375 | 3300053088 | Bacteria | 21830 |
| 940 | Ga0500646_0048753 | 3300053090 | Bacteria | 1215 |
| 941 | Ga0500566_0013664 | 3300053094 | Bacteria | 4774 |
| 942 | Ga0500641_0016700 | 3300053096 | Bacteria | 2735 |
| 943 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 944 | Ga0500655_016549 | 3300053133 | Bacteria | 1359 |
| 945 | Ga0500589_094636 | 3300053147 | Bacteria | 1308 |
| 946 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 947 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 948 | Ga0500637_0093139 | 3300053178 | Bacteria | 1746 |
| 949 | Ga0500645_000252 | 3300053730 | Bacteria | 39375 |
| 950 | Ga0500645_011250 | 3300053730 | Bacteria | 2928 |
| 951 | Ga0501084_0260661 | 3300054114 | Bacteria | 1463 |
| 952 | Ga0501082_0015464 | 3300060353 | Bacteria | 6568 |
| 953 | Ga0501082_0026664 | 3300060353 | Bacteria | 4981 |
| 954 | Ga0501082_0172306 | 3300060353 | Bacteria | 1881 |
| 955 | Ga0501082_0250979 | 3300060353 | Bacteria | 1540 |
| 956 | 2935771213 | 2935769743 | Bacteria | 7878163 |
| 957 | 8016555369 | 8016548790 | Bacteria | 8155074 |
| 958 | 8016571852 | 8016566248 | Bacteria | 8158151 |
| 959 | Ga0501034_0095280 | |||
| 960 | 2214656053 | |||
| 961 | ARcpr5oldR_c000226 | |||
| 962 | ARSoilYngRDRAFT_c00122 | |||
| 963 | ARcpr5yngRDRAFT_c000316 | |||
| 964 | ARSoilOldRDRAFT_c000054 | |||
| 965 | ARCol0yngRDRAFT_1000054 | |||
| 966 | JGI24032J14994_100197 | |||
| 967 | JGI24746J21847_1004760 | |||
| 968 | JGI24747J21853_1000617 | |||
| 969 | JGI24740J21852_10019512 | |||
| 970 | JGI24739J22299_10001041 | |||
| 971 | JGI24737J22298_10000776 | |||
| 972 | JGI24737J22298_10000959 | |||
| 973 | JGI24750J21931_1000558 | |||
| 974 | JGI24738J21930_10000571 | |||
| 975 | JGI24749J21850_1000591 | |||
| 976 | JGI24035J26624_1000164 | |||
| 977 | JGI24034J26672_10000323 | |||
| 978 | JGI24742J22300_10000080 | |||
| 979 | JGI25406J46586_10000018 | |||
| 980 | JGI25404J52841_10006788 | |||
| 981 | Ga0065716_1001726 | |||
| 982 | Ga0065712_10009732 | |||
| 983 | Ga0065712_10069678 | |||
| 984 | Ga0065715_10001633 | |||
| 985 | Ga0070658_10008040 | |||
| 986 | Ga0070658_10034116 | |||
| 987 | Ga0070683_100000289 | |||
| 988 | Ga0070683_100064495 | |||
| 989 | Ga0070690_100006047 | |||
| 990 | Ga0070690_100010825 | |||
| 991 | Ga0070670_100027675 | |||
| 992 | Ga0070670_100108118 | |||
| 993 | Ga0070677_10000043 | |||
| 994 | Ga0068869_100002554 | |||
| 995 | Ga0070666_10013513 | |||
| 996 | Ga0070680_100008016 | |||
| 997 | Ga0070680_100016633 | |||
| 998 | Ga0070680_100035810 | |||
| 999 | Ga0070680_100050316 | |||
| 1000 | Ga0070680_100170530 | |||
| 1001 | Ga0070682_100000528 | |||
| 1002 | Ga0070682_100040250 | |||
| 1003 | Ga0070682_100088047 | |||
| 1004 | Ga0068868_100000408 | |||
| 1005 | Ga0068868_100040736 | |||
| 1006 | Ga0070660_100011422 | |||
| 1007 | Ga0070660_100037116 | |||
| 1008 | Ga0070689_100000819 | |||
| 1009 | Ga0070689_100008559 | |||
| 1010 | Ga0070689_100068676 | |||
| 1011 | Ga0070691_10009402 | |||
| 1012 | Ga0070687_100000950 | |||
| 1013 | Ga0070661_100000314 | |||
| 1014 | Ga0070661_100008178 | |||
| 1015 | Ga0070692_10000310 | |||
| 1016 | Ga0070692_10037572 | |||
| 1017 | Ga0070668_100000857 | |||
| 1018 | Ga0070669_100005664 | |||
| 1019 | Ga0070669_100047495 | |||
| 1020 | Ga0070675_100004259 | |||
| 1021 | Ga0070675_100031348 | |||
| 1022 | Ga0070671_100000598 | |||
| 1023 | Ga0070671_100031256 | |||
| 1024 | Ga0070671_100223422 | |||
| 1025 | Ga0070674_100010763 | |||
| 1026 | Ga0070674_100404834 | |||
| 1027 | Ga0070673_100000289 | |||
| 1028 | Ga0070673_100244183 | |||
| 1029 | Ga0070688_100000189 | |||
| 1030 | Ga0070688_100005181 | |||
| 1031 | Ga0070688_100041426 | |||
| 1032 | Ga0070659_100075797 | |||
| 1033 | Ga0070667_100000436 | |||
| 1034 | Ga0070667_100016498 | |||
| 1035 | Ga0070667_100164712 | |||
| 1036 | Ga0070703_10002551 | |||
| 1037 | Ga0070709_10000652 | |||
| 1038 | Ga0070709_10001788 | |||
| 1039 | Ga0070709_10026083 | |||
| 1040 | Ga0070709_10029506 | |||
| 1041 | Ga0070714_100025604 | |||
| 1042 | Ga0070714_100026305 | |||
| 1043 | Ga0070714_100027072 | |||
| 1044 | Ga0070714_100037701 | |||
| 1045 | Ga0070714_100070473 | |||
| 1046 | Ga0070714_100093437 | |||
| 1047 | Ga0070714_100501986 | |||
| 1048 | Ga0070713_100001448 | |||
| 1049 | Ga0070713_100020933 | |||
| 1050 | Ga0070713_100024488 | |||
| 1051 | Ga0070713_100120238 | |||
| 1052 | Ga0070710_10001787 | |||
| 1053 | Ga0070710_10035536 | |||
| 1054 | Ga0070710_10105489 | |||
| 1055 | Ga0070701_10000106 | |||
| 1056 | Ga0070701_10009951 | |||
| 1057 | Ga0070701_10071269 | |||
| 1058 | Ga0070711_100001638 | |||
| 1059 | Ga0070711_100023208 | |||
| 1060 | Ga0070711_100071211 | |||
| 1061 | Ga0070711_100079140 | |||
| 1062 | Ga0070705_100000781 | |||
| 1063 | Ga0070705_100061455 | |||
| 1064 | Ga0070700_100001610 | |||
| 1065 | Ga0070694_100003956 | |||
| 1066 | Ga0070694_100005440 | |||
| 1067 | Ga0070663_100000297 | |||
| 1068 | Ga0070663_100050692 | |||
| 1069 | Ga0070663_100199561 | |||
| 1070 | Ga0070678_100001470 | |||
| 1071 | Ga0070678_100011789 | |||
| 1072 | Ga0070662_100035544 | |||
| 1073 | Ga0070662_100065036 | |||
| 1074 | Ga0070662_100172258 | |||
| 1075 | Ga0070681_10000645 | |||
| 1076 | Ga0070681_10022181 | |||
| 1077 | Ga0070681_10042512 | |||
| 1078 | Ga0070681_10109584 | |||
| 1079 | Ga0068867_100017453 | |||
| 1080 | Ga0070685_10034634 | |||
| 1081 | Ga0070685_10215413 | |||
| 1082 | Ga0070679_100060424 | |||
| 1083 | Ga0070679_100115293 | |||
| 1084 | Ga0070679_100185671 | |||
| 1085 | Ga0070679_100230727 | |||
| 1086 | Ga0070679_100510947 | |||
| 1087 | Ga0070684_100006705 | |||
| 1088 | Ga0070684_100015951 | |||
| 1089 | Ga0070684_100043054 | |||
| 1090 | Ga0068853_100007059 | |||
| 1091 | Ga0068853_100224896 | |||
| 1092 | Ga0070672_100000106 | |||
| 1093 | Ga0070672_100126117 | |||
| 1094 | Ga0070686_100000615 | |||
| 1095 | Ga0070686_100015365 | |||
| 1096 | Ga0070695_100001248 | |||
| 1097 | Ga0070695_100017930 | |||
| 1098 | Ga0070695_100029515 | |||
| 1099 | Ga0070695_100145569 | |||
| 1100 | Ga0070696_100008593 | |||
| 1101 | Ga0070696_100031040 | |||
| 1102 | Ga0070696_100059408 | |||
| 1103 | Ga0070696_100071909 | |||
| 1104 | Ga0070693_100071161 | |||
| 1105 | Ga0070693_100123149 | |||
| 1106 | Ga0070704_100004997 | |||
| 1107 | Ga0070704_100018272 | |||
| 1108 | Ga0068855_100053416 | |||
| 1109 | Ga0068855_100155675 | |||
| 1110 | Ga0070664_100017797 | |||
| 1111 | Ga0070664_100465762 | |||
| 1112 | Ga0068857_100000047 | |||
| 1113 | Ga0068854_100000502 | |||
| 1114 | Ga0068854_100059417 | |||
| 1115 | Ga0068856_100001905 | |||
| 1116 | Ga0068856_100361373 | |||
| 1117 | Ga0070702_100004825 | |||
| 1118 | Ga0070702_100031385 | |||
| 1119 | Ga0068852_100011300 | |||
| 1120 | Ga0068859_100005879 | |||
| 1121 | Ga0068859_100024931 | |||
| 1122 | Ga0068859_100202501 | |||
| 1123 | Ga0068864_100000931 | |||
| 1124 | Ga0068864_100116167 | |||
| 1125 | Ga0068866_10000077 | |||
| 1126 | Ga0068866_10014674 | |||
| 1127 | Ga0068861_100011038 | |||
| 1128 | Ga0068870_10001017 | |||
| 1129 | Ga0068863_100000543 | |||
| 1130 | Ga0068863_100036826 | |||
| 1131 | Ga0068858_100002073 | |||
| 1132 | Ga0068858_100028716 | |||
| 1133 | Ga0068858_100040985 | |||
| 1134 | Ga0068858_100258516 | |||
| 1135 | Ga0068860_100005115 | |||
| 1136 | Ga0068860_100034229 | |||
| 1137 | Ga0068862_100000879 | |||
| 1138 | Ga0068862_100013544 | |||
| 1139 | Ga0081455_10000007 | |||
| 1140 | Ga0081455_10000596 | |||
| 1141 | Ga0081455_10009848 | |||
| 1142 | Ga0081540_1000007 | |||
| 1143 | Ga0081540_1001222 | |||
| 1144 | Ga0081539_10000003 | |||
| 1145 | Ga0070717_10000287 | |||
| 1146 | Ga0070717_10136105 | |||
| 1147 | Ga0075368_10067462 | |||
| 1148 | Ga0075364_10203629 | |||
| 1149 | Ga0075432_10000660 | |||
| 1150 | Ga0070715_10000989 | |||
| 1151 | Ga0070716_100026935 | |||
| 1152 | Ga0070716_100043704 | |||
| 1153 | Ga0070712_100031048 | |||
| 1154 | Ga0070712_100083487 | |||
| 1155 | Ga0070712_100086846 | |||
| 1156 | Ga0070712_100174265 | |||
| 1157 | Ga0075362_10001028 | |||
| 1158 | Ga0075367_10026404 | |||
| 1159 | Ga0075367_10131271 | |||
| 1160 | Ga0097621_100000416 | |||
| 1161 | Ga0097621_100007350 | |||
| 1162 | Ga0097621_100201324 | |||
| 1163 | Ga0075370_10139642 | |||
| 1164 | Ga0068871_100000249 | |||
| 1165 | Ga0068871_100004813 | |||
| 1166 | Ga0075428_100047718 | |||
| 1167 | Ga0075430_100002807 | |||
| 1168 | Ga0075431_100013028 | |||
| 1169 | Ga0075433_10001150 | |||
| 1170 | Ga0075433_10151919 | |||
| 1171 | Ga0075434_100003092 | |||
| 1172 | Ga0075434_100003158 | |||
| 1173 | Ga0075434_100055769 | |||
| 1174 | Ga0075434_100067393 | |||
| 1175 | Ga0075429_100001089 | |||
| 1176 | Ga0068865_100000248 | |||
| 1177 | Ga0068865_100065099 | |||
| 1178 | Ga0075436_100015431 | |||
| 1179 | Ga0075436_100069651 | |||
| 1180 | Ga0097620_100005879 | |||
| 1181 | Ga0097620_100024931 | |||
| 1182 | Ga0097620_100202511 | |||
| 1183 | Ga0075435_100040427 | |||
| 1184 | Ga0075435_100211730 | |||
| 1185 | Ga0075435_100258996 | |||
| 1186 | Ga0099795_10004304 | |||
| 1187 | Ga0105251_10019615 | |||
| 1188 | Ga0105251_10028839 | |||
| 1189 | Ga0105240_10034168 | |||
| 1190 | Ga0105240_10150755 | |||
| 1191 | Ga0105240_10234711 | |||
| 1192 | Ga0111539_10002489 | |||
| 1193 | Ga0111539_10002685 | |||
| 1194 | Ga0111539_10013785 | |||
| 1195 | Ga0105245_10016985 | |||
| 1196 | Ga0105245_10619033 | |||
| 1197 | Ga0105247_10000908 | |||
| 1198 | Ga0114129_10035354 | |||
| 1199 | Ga0114129_10094866 | |||
| 1200 | Ga0105243_10001705 | |||
| 1201 | Ga0105243_10022992 | |||
| 1202 | Ga0105241_10002306 | |||
| 1203 | Ga0105241_10085108 | |||
| 1204 | Ga0105242_10001376 | |||
| 1205 | Ga0105242_10052448 | |||
| 1206 | Ga0105242_10232853 | |||
| 1207 | Ga0105248_10016671 | |||
| 1208 | Ga0105248_10248698 | |||
| 1209 | Ga0105237_10002245 | |||
| 1210 | Ga0105237_10041271 | |||
| 1211 | Ga0105237_10089865 | |||
| 1212 | Ga0105238_10094377 | |||
| 1213 | Ga0105249_10000476 | |||
| 1214 | Ga0105249_10032161 | |||
| 1215 | Ga0105249_10136831 | |||
| 1216 | Ga0105249_10398243 | |||
| 1217 | Ga0099796_10000894 | |||
| 1218 | Ga0105239_10015033 | |||
| 1219 | Ga0105239_10179657 | |||
| 1220 | Ga0105239_10389036 | |||
| 1221 | Ga0105246_10000057 | |||
| 1222 | Ga0157338_1000271 | |||
| 1223 | Ga0157371_10013856 | |||
| 1224 | Ga0157371_10141930 | |||
| 1225 | Ga0157369_10438364 | |||
| 1226 | Ga0157374_10032430 | |||
| 1227 | Ga0157374_10040397 | |||
| 1228 | Ga0157378_10146161 | |||
| 1229 | Ga0163162_10001937 | |||
| 1230 | Ga0163162_10075749 | |||
| 1231 | Ga0157375_10001755 | |||
| 1232 | Ga0157375_10054765 | |||
| 1233 | Ga0157375_10069926 | |||
| 1234 | Ga0157375_10551290 | |||
| 1235 | Ga0163163_10001266 | |||
| 1236 | Ga0163163_10002439 | |||
| 1237 | Ga0163163_10003757 | |||
| 1238 | Ga0163163_10101927 | |||
| 1239 | Ga0157380_10002615 | |||
| 1240 | Ga0182008_10079253 | |||
| 1241 | Ga0157377_10002633 | |||
| 1242 | Ga0157377_10019882 | |||
| 1243 | Ga0157379_10000293 | |||
| 1244 | Ga0157379_10004953 | |||
| 1245 | Ga0157379_10062321 | |||
| 1246 | Ga0157379_10084734 | |||
| 1247 | Ga0157379_10140761 | |||
| 1248 | Ga0157376_10000531 | |||
| 1249 | Ga0157376_10349106 | |||
| 1250 | Ga0163161_10000209 | |||
| 1251 | Ga0206353_11779653 | |||
| 1252 | Ga0213873_10014165 | |||
| 1253 | Ga0213876_10008652 | |||
| 1254 | Ga0207666_1000353 | |||
| 1255 | Ga0207697_10000044 | |||
| 1256 | Ga0207697_10011939 | |||
| 1257 | Ga0207653_10011921 | |||
| 1258 | Ga0207682_10000260 | |||
| 1259 | Ga0207692_10001125 | |||
| 1260 | Ga0207692_10001993 | |||
| 1261 | Ga0207692_10020685 | |||
| 1262 | Ga0207692_10081832 | |||
| 1263 | Ga0207642_10000807 | |||
| 1264 | Ga0207642_10175617 | |||
| 1265 | Ga0207710_10003110 | |||
| 1266 | Ga0207710_10009956 | |||
| 1267 | Ga0207688_10012079 | |||
| 1268 | Ga0207647_10004419 | |||
| 1269 | Ga0207647_10006899 | |||
| 1270 | Ga0207699_10000253 | |||
| 1271 | Ga0207699_10006701 | |||
| 1272 | Ga0207645_10000344 | |||
| 1273 | Ga0207643_10000012 | |||
| 1274 | Ga0207705_10012927 | |||
| 1275 | Ga0207705_10258921 | |||
| 1276 | Ga0207654_10036113 | |||
| 1277 | Ga0207707_10018209 | |||
| 1278 | Ga0207707_10036720 | |||
| 1279 | Ga0207707_10116020 | |||
| 1280 | Ga0207695_10077441 | |||
| 1281 | Ga0207671_10022324 | |||
| 1282 | Ga0207693_10000861 | |||
| 1283 | Ga0207693_10002835 | |||
| 1284 | Ga0207693_10024218 | |||
| 1285 | Ga0207693_10056378 | |||
| 1286 | Ga0207693_10108204 | |||
| 1287 | Ga0207693_10170006 | |||
| 1288 | Ga0207693_10191176 | |||
| 1289 | Ga0207693_10208285 | |||
| 1290 | Ga0207663_10014464 | |||
| 1291 | Ga0207663_10033471 | |||
| 1292 | Ga0207663_10083699 | |||
| 1293 | Ga0207660_10000992 | |||
| 1294 | Ga0207662_10000216 | |||
| 1295 | Ga0207662_10004775 | |||
| 1296 | Ga0207662_10158640 | |||
| 1297 | Ga0207657_10000358 | |||
| 1298 | Ga0207657_10012419 | |||
| 1299 | Ga0207657_10036149 | |||
| 1300 | Ga0207657_10223741 | |||
| 1301 | Ga0207649_10000545 | |||
| 1302 | Ga0207652_10012964 | |||
| 1303 | Ga0207652_10016404 | |||
| 1304 | Ga0207652_10234747 | |||
| 1305 | Ga0207681_10000684 | |||
| 1306 | Ga0207681_10173205 | |||
| 1307 | Ga0207694_10083458 | |||
| 1308 | Ga0207694_10280239 | |||
| 1309 | Ga0207650_10016372 | |||
| 1310 | Ga0207650_10133430 | |||
| 1311 | Ga0207659_10000023 | |||
| 1312 | Ga0207659_10008259 | |||
| 1313 | Ga0207687_10000149 | |||
| 1314 | Ga0207687_10025507 | |||
| 1315 | Ga0207700_10011168 | |||
| 1316 | Ga0207700_10018517 | |||
| 1317 | Ga0207700_10093579 | |||
| 1318 | Ga0207700_10097830 | |||
| 1319 | Ga0207700_10165286 | |||
| 1320 | Ga0207664_10005618 | |||
| 1321 | Ga0207664_10015064 | |||
| 1322 | Ga0207664_10029498 | |||
| 1323 | Ga0207664_10067530 | |||
| 1324 | Ga0207644_10007018 | |||
| 1325 | Ga0207644_10088757 | |||
| 1326 | Ga0207690_10000203 | |||
| 1327 | Ga0207690_10034350 | |||
| 1328 | Ga0207690_10307345 | |||
| 1329 | Ga0207706_10002188 | |||
| 1330 | Ga0207706_10008175 | |||
| 1331 | Ga0207706_10023762 | |||
| 1332 | Ga0207686_10001306 | |||
| 1333 | Ga0207686_10004009 | |||
| 1334 | Ga0207709_10000852 | |||
| 1335 | Ga0207670_10005646 | |||
| 1336 | Ga0207669_10000357 | |||
| 1337 | Ga0207669_10108343 | |||
| 1338 | Ga0207704_10002400 | |||
| 1339 | Ga0207704_10070427 | |||
| 1340 | Ga0207665_10000259 | |||
| 1341 | Ga0207665_10011108 | |||
| 1342 | Ga0207665_10019210 | |||
| 1343 | Ga0207665_10213324 | |||
| 1344 | Ga0207691_10000256 | |||
| 1345 | Ga0207691_10328719 | |||
| 1346 | Ga0207711_10011944 | |||
| 1347 | Ga0207711_10020618 | |||
| 1348 | Ga0207689_10000565 | |||
| 1349 | Ga0207689_10028355 | |||
| 1350 | Ga0207661_10000104 | |||
| 1351 | Ga0207679_10000196 | |||
| 1352 | Ga0207679_10052994 | |||
| 1353 | Ga0207679_10392934 | |||
| 1354 | Ga0207667_10032029 | |||
| 1355 | Ga0207667_10219249 | |||
| 1356 | Ga0207667_10337495 | |||
| 1357 | Ga0207651_10001138 | |||
| 1358 | Ga0207712_10000967 | |||
| 1359 | Ga0207712_10027564 | |||
| 1360 | Ga0207712_10117974 | |||
| 1361 | Ga0207668_10000251 | |||
| 1362 | Ga0207668_10103480 | |||
| 1363 | Ga0207640_10000157 | |||
| 1364 | Ga0207640_10099634 | |||
| 1365 | Ga0207658_10010507 | |||
| 1366 | Ga0207658_10031355 | |||
| 1367 | Ga0207658_10086998 | |||
| 1368 | Ga0207658_10119225 | |||
| 1369 | Ga0207677_10000609 | |||
| 1370 | Ga0207703_10007245 | |||
| 1371 | Ga0207703_10044502 | |||
| 1372 | Ga0207639_10002440 | |||
| 1373 | Ga0207639_10113773 | |||
| 1374 | Ga0207639_10171693 | |||
| 1375 | Ga0207678_10001125 | |||
| 1376 | Ga0207678_10055203 | |||
| 1377 | Ga0207708_10000365 | |||
| 1378 | Ga0207708_10015747 | |||
| 1379 | Ga0207702_10003955 | |||
| 1380 | Ga0207702_10163742 | |||
| 1381 | Ga0207702_10193556 | |||
| 1382 | Ga0207702_10238400 | |||
| 1383 | Ga0207702_10281855 | |||
| 1384 | Ga0207641_10002938 | |||
| 1385 | Ga0207648_10000341 | |||
| 1386 | Ga0207648_10023831 | |||
| 1387 | Ga0207648_10154534 | |||
| 1388 | Ga0207676_10004494 | |||
| 1389 | Ga0207676_10012794 | |||
| 1390 | Ga0207676_10450453 | |||
| 1391 | Ga0207674_10001078 | |||
| 1392 | Ga0207675_100003271 | |||
| 1393 | Ga0207675_100072959 | |||
| 1394 | Ga0207675_100160135 | |||
| 1395 | Ga0207683_10000006 | |||
| 1396 | Ga0209995_1019384 | |||
| 1397 | Ga0209966_1001700 | |||
| 1398 | Ga0209966_1002101 | |||
| 1399 | Ga0209998_10000862 | |||
| 1400 | Ga0209998_10001803 | |||
| 1401 | Ga0209998_10043599 | |||
| 1402 | Ga0209974_10002661 | |||
| 1403 | Ga0209974_10067284 | |||
| 1404 | Ga0207428_10000165 | |||
| 1405 | Ga0207428_10000446 | |||
| 1406 | Ga0207428_10001251 | |||
| 1407 | Ga0207428_10301325 | |||
| 1408 | Ga0268266_10016010 | |||
| 1409 | Ga0268265_10001687 | |||
| 1410 | Ga0268265_10036385 | |||
| 1411 | Ga0268264_10002029 | |||
| 1412 | Ga0268264_10018354 | |||
| 1413 | Ga0265337_1014277 | |||
| 1414 | Ga0265326_10055246 | |||
| 1415 | Ga0265338_10035840 | |||
| 1416 | Ga0265338_10045038 | |||
| 1417 | Ga0265330_10009899 | |||
| 1418 | Ga0265328_10016980 | |||
| 1419 | Ga0265328_10053514 | |||
| 1420 | Ga0265325_10000026 | |||
| 1421 | Ga0265325_10015162 | |||
| 1422 | Ga0265325_10021617 | |||
| 1423 | Ga0265325_10036642 | |||
| 1424 | Ga0265340_10023909 | |||
| 1425 | Ga0265339_10000047 | |||
| 1426 | Ga0265331_10001610 | |||
| 1427 | Ga0265331_10018492 | |||
| 1428 | Ga0265327_10033231 | |||
| 1429 | Ga0265316_10171986 | |||
| 1430 | Ga0265316_10182372 | |||
| 1431 | Ga0265313_10000069 | |||
| 1432 | Ga0265313_10000794 | |||
| 1433 | Ga0265313_10013073 | |||
| 1434 | Ga0265313_10020093 | |||
| 1435 | Ga0265313_10024594 | |||
| 1436 | Ga0265313_10053103 | |||
| 1437 | Ga0265313_10069204 | |||
| 1438 | Ga0265313_10093900 | |||
| 1439 | Ga0316579_10087297 | |||
| 1440 | Ga0265314_10005328 | |||
| 1441 | Ga0265314_10022387 | |||
| 1442 | Ga0265342_10000502 | |||
| 1443 | Ga0307413_10268530 | |||
| 1444 | Ga0307406_10049692 | |||
| 1445 | Ga0307409_100061827 | |||
| 1446 | Ga0307415_100103966 | |||
| 1447 | Ga0316593_10089675 | |||
| 1448 | Ga0307510_10005901 | |||
| 1449 | Ga0373930_0002826 | |||
| 1450 | Ga0373948_0000248 | |||
| 1451 | Ga0373950_0022322 | |||
| 1452 | Ga0373958_0000204 | |||
| 1453 | Ga0373958_0001259 | |||
| 1454 | Ga0373958_0003604 | |||
| 1455 | Ga0373959_0004004 | |||
| 1456 | Ga0373959_0004649 | |||
| 1457 | Ga0373938_0000103 | |||
| 1458 | Ga0373938_0001026 | |||
| 1459 | Ga0373928_0001804 | |||
| 1460 | Ga0373928_0002065 | |||
| 1461 | Ga0373929_0002152 | |||
| 1462 | Ga0373929_0009691 | |||
| 1463 | Ga0373934_0031646 | |||
| 1464 | Ga0373944_0002070 | |||
| 1465 | Ga0373949_0002185 | |||
| 1466 | Ga0373949_0009483 | |||
| 1467 | Ga0373951_0001067 | |||
| 1468 | Ga0373951_0001578 | |||
| 1469 | Ga0373951_0004467 | |||
| 1470 | Ga0373952_0002272 | |||
| 1471 | Ga0373952_0004667 | |||
| 1472 | Ga0373952_0007374 | |||
| 1473 | Ga0373932_0000763 | |||
| 1474 | Ga0373932_0002253 | |||
| 1475 | Ga0373932_0034093 | |||
| 1476 | Ga0373936_0002079 | |||
| 1477 | Ga0373939_0000538 | |||
| 1478 | Ga0373939_0001474 | |||
| 1479 | Ga0373939_0004190 | |||
| 1480 | Ga0373939_0006376 | |||
| 1481 | Ga0373939_0011217 | |||
| 1482 | Ga0373941_0003546 | |||
| 1483 | Ga0373945_0004056 | |||
| 1484 | Ga0373945_0027667 | |||
| 1485 | Ga0373953_0004398 | |||
| 1486 | Ga0373954_0003827 | |||
| 1487 | Ga0373954_0004751 | |||
| 1488 | Ga0373954_0016066 | |||
| 1489 | Ga0373956_0007108 | |||
| 1490 | Ga0373956_0039789 | |||
| 1491 | Ga0373956_0072658 | |||
| 1492 | Ga0373957_0002588 | |||
| 1493 | Ga0373957_0040020 | |||
| 1494 | Ga0373960_0000016 | |||
| 1495 | Ga0373943_0010246 | |||
| 1496 | Ga0373943_0019971 | |||
| 1497 | Ga0373943_0030538 | |||
| 1498 | Ga0373943_0031519 | |||
| 1499 | Ga0373946_0000794 | |||
| 1500 | Ga0373946_0040304 | |||
| 1501 | Ga0373955_0001006 | |||
| 1502 | Ga0373955_0001974 | |||
| 1503 | Ga0373955_0003538 | |||
| 1504 | Ga0373955_0015930 | |||
| 1505 | Ga0373955_0024053 | |||
| 1506 | Ga0373942_0001481 | |||
| 1507 | Ga0373942_0004423 | |||
| 1508 | Ga0373961_0003830 | |||
| 1509 | Ga0373961_0003885 | |||
| 1510 | Ga0373961_0005277 | |||
| 1511 | Ga0373962_0000149 | |||
| 1512 | Ga0373962_0000620 | |||
| 1513 | Ga0373962_0001044 | |||
| 1514 | Ga0373924_0001761 | |||
| 1515 | Ga0373931_0002359 | |||
| 1516 | Ga0373931_0004026 | |||
| 1517 | Ga0373931_0012885 | |||
| 1518 | Ga0373931_0035211 | |||
| 1519 | Ga0373935_0003725 | |||
| 1520 | Ga0373935_0074363 | |||
| 1521 | Ga0373927_0014192 | |||
| 1522 | Ga0373927_0019295 | |||
| 1523 | Ga0373927_0022483 | |||
| 1524 | Ga0373933_0003044 | |||
| 1525 | Ga0373933_0007407 | |||
| 1526 | Ga0373933_0014720 | |||
| 1527 | Ga0373947_0048824 | |||
| 1528 | Ga0373947_0058914 | |||
| 1529 | Ga0373937_0001830 | |||
| 1530 | Ga0373937_0003591 | |||
| 1531 | Ga0373937_0003746 | |||
| 1532 | Ga0373937_0018802 | |||
| 1533 | Ga0373937_0026471 | |||
| 1534 | Ga0373925_0004912 | |||
| 1535 | Ga0395899_0055599 | |||
| 1536 | Ga0395900_0001539 | |||
| 1537 | Ga0395900_0014500 | |||
| 1538 | Ga0395900_0065578 | |||
| 1539 | Ga0395898_0018398 | |||
| 1540 | Ga0395898_0053996 | |||
| 1541 | Ga0395901_0019085 | |||
| 1542 | Ga0436365_0276616 | |||
| 1543 | Ga0436365_0340427 | |||
| 1544 | Ga0436365_1108063 | |||
| 1545 | Ga0436365_1744975 | |||
| 1546 | Ga0436365_1793855 | |||
| 1547 | Ga0436360_0620291 | |||
| 1548 | Ga0436363_0159755 | |||
| 1549 | Ga0436363_0547396 | |||
| 1550 | Ga0439448_0030523 | |||
| 1551 | Ga0466963_0040811 | |||
| 1552 | Ga0466963_0048614 | |||
| 1553 | Ga0453684_0030893 | |||
| 1554 | Ga0466971_0084811 | |||
| 1555 | Ga0466957_0264414 | |||
| 1556 | Ga0451576_0016162 | |||
| 1557 | Ga0466958_0175418 | |||
| 1558 | Ga0466967_0007437 | |||
| 1559 | Ga0466967_0447170 | |||
| 1560 | Ga0495617_049441 | |||
| 1561 | Ga0495592_0002638 | |||
| 1562 | Ga0495592_0010694 | |||
| 1563 | Ga0495592_0254498 | |||
| 1564 | Ga0495603_0015087 | |||
| 1565 | Ga0495629_0000908 | |||
| 1566 | Ga0495629_0008943 | |||
| 1567 | Ga0495629_0028960 | |||
| 1568 | Ga0495629_0065245 | |||
| 1569 | Ga0495629_0072282 | |||
| 1570 | Ga0495629_0091414 | |||
| 1571 | Ga0495641_0013745 | |||
| 1572 | Ga0495641_0068989 | |||
| 1573 | Ga0495651_0010375 | |||
| 1574 | Ga0495651_0015811 | |||
| 1575 | Ga0495651_0031843 | |||
| 1576 | Ga0495651_0035348 | |||
| 1577 | Ga0495651_0042107 | |||
| 1578 | Ga0495653_0161929 | |||
| 1579 | Ga0495580_0038175 | |||
| 1580 | Ga0495582_0013116 | |||
| 1581 | Ga0495662_0002314 | |||
| 1582 | Ga0495664_0019528 | |||
| 1583 | Ga0495664_0031623 | |||
| 1584 | Ga0495664_0056004 | |||
| 1585 | Ga0495585_0004760 | |||
| 1586 | Ga0495607_0016632 | |||
| 1587 | Ga0495606_0002132 | |||
| 1588 | Ga0495608_0010351 | |||
| 1589 | Ga0495608_0013583 | |||
| 1590 | Ga0495608_0029442 | |||
| 1591 | Ga0495618_0019969 | |||
| 1592 | Ga0495618_0086748 | |||
| 1593 | Ga0495628_0000115 | |||
| 1594 | Ga0495628_0048362 | |||
| 1595 | Ga0495628_0075930 | |||
| 1596 | Ga0495628_0343576 | |||
| 1597 | Ga0495630_0103854 | |||
| 1598 | Ga0495637_0052229 | |||
| 1599 | Ga0495644_0000983 | |||
| 1600 | Ga0495666_0012543 | |||
| 1601 | Ga0495652_0001117 | |||
| 1602 | Ga0495652_0007929 | |||
| 1603 | Ga0495652_0013930 | |||
| 1604 | Ga0495652_0027254 | |||
| 1605 | Ga0495665_0010075 | |||
| 1606 | Ga0495640_0035855 | |||
| 1607 | Ga0495640_0062405 | |||
| 1608 | Ga0495640_0110846 | |||
| 1609 | Ga0495586_0048068 | |||
| 1610 | Ga0495587_0006245 | |||
| 1611 | Ga0495587_0019798 | |||
| 1612 | Ga0495598_0020568 | |||
| 1613 | Ga0495609_0140321 | |||
| 1614 | Ga0495645_0010751 | |||
| 1615 | Ga0495645_0018002 | |||
| 1616 | Ga0495645_0113080 | |||
| 1617 | Ga0495622_0003333 | |||
| 1618 | Ga0495622_0071727 | |||
| 1619 | Ga0495633_0008234 | |||
| 1620 | Ga0495667_0000674 | |||
| 1621 | Ga0495667_0003600 | |||
| 1622 | Ga0495667_0017680 | |||
| 1623 | Ga0495667_0018730 | |||
| 1624 | Ga0495667_0026205 | |||
| 1625 | Ga0495656_0000789 | |||
| 1626 | Ga0495634_0038239 | |||
| 1627 | Ga0495634_0080129 | |||
| 1628 | Ga0495634_0099766 | |||
| 1629 | Ga0495625_0116833 | |||
| 1630 | Ga0495635_0002598 | |||
| 1631 | Ga0495635_0009000 | |||
| 1632 | Ga0495635_0025046 | |||
| 1633 | Ga0495635_0111734 | |||
| 1634 | Ga0495659_0005270 | |||
| 1635 | Ga0495588_0020105 | |||
| 1636 | Ga0495588_0198236 | |||
| 1637 | Ga0495657_0011216 | |||
| 1638 | Ga0495657_0014159 | |||
| 1639 | Ga0495599_0007091 | |||
| 1640 | Ga0495599_0031443 | |||
| 1641 | Ga0495623_0002539 | |||
| 1642 | Ga0495623_0021243 | |||
| 1643 | Ga0495646_0002845 | |||
| 1644 | Ga0495646_0020414 | |||
| 1645 | Ga0495646_0043834 | |||
| 1646 | Ga0495646_0118237 | |||
| 1647 | Ga0495647_0006115 | |||
| 1648 | Ga0495647_0008529 | |||
| 1649 | Ga0495658_0000673 | |||
| 1650 | Ga0495613_0058540 | |||
| 1651 | Ga0495613_0168647 | |||
| 1652 | Ga0495624_0004039 | |||
| 1653 | Ga0495624_0137077 | |||
| 1654 | Ga0495670_0000479 | |||
| 1655 | Ga0495671_0036634 | |||
| 1656 | Ga0495600_0000876 | |||
| 1657 | Ga0495600_0055592 | |||
| 1658 | Ga0495600_0077847 | |||
| 1659 | Ga0495600_0151915 | |||
| 1660 | Ga0495581_0006390 | |||
| 1661 | Ga0495604_0000619 | |||
| 1662 | Ga0495604_0001990 | |||
| 1663 | Ga0495604_0009299 | |||
| 1664 | Ga0495674_0005221 | |||
| 1665 | Ga0495674_0069477 | |||
| 1666 | Ga0495672_0119466 | |||
| 1667 | Ga0495676_0022034 | |||
| 1668 | Ga0495676_0206799 | |||
| 1669 | Ga0495680_0002310 | |||
| 1670 | Ga0495680_0002967 | |||
| 1671 | Ga0495680_0019825 | |||
| 1672 | Ga0495680_0026626 | |||
| 1673 | Ga0495675_0029011 | |||
| 1674 | Ga0495675_0075594 | |||
| 1675 | Ga0495684_0003464 | |||
| 1676 | Ga0495684_0071240 | |||
| 1677 | Ga0495684_0129934 | |||
| 1678 | Ga0495593_0003537 | |||
| 1679 | Ga0495593_0053418 | |||
| 1680 | Ga0495602_0003665 | |||
| 1681 | Ga0495602_0030986 | |||
| 1682 | Ga0495602_0078472 | |||
| 1683 | Ga0495602_0098047 | |||
| 1684 | Ga0496100_0004411 | |||
| 1685 | Ga0496100_0006203 | |||
| 1686 | Ga0496100_0064055 | |||
| 1687 | Ga0496100_0198714 | |||
| 1688 | Ga0496100_0249691 | |||
| 1689 | Ga0496101_0000464 | |||
| 1690 | Ga0496101_0009586 | |||
| 1691 | Ga0496101_0108048 | |||
| 1692 | Ga0496101_0341825 | |||
| 1693 | Ga0496102_0001120 | |||
| 1694 | Ga0496102_0032062 | |||
| 1695 | Ga0496102_0120448 | |||
| 1696 | Ga0496102_0221629 | |||
| 1697 | Ga0496102_0483063 | |||
| 1698 | Ga0496103_0000611 | |||
| 1699 | Ga0496103_0071919 | |||
| 1700 | Ga0496104_0000279 | |||
| 1701 | Ga0496104_0000299 | |||
| 1702 | Ga0496104_0004500 | |||
| 1703 | Ga0496104_0014336 | |||
| 1704 | Ga0496104_0022589 | |||
| 1705 | Ga0496104_0060191 | |||
| 1706 | Ga0496104_0105923 | |||
| 1707 | Ga0496104_0125360 | |||
| 1708 | Ga0496104_0239644 | |||
| 1709 | Ga0496104_0264810 | |||
| 1710 | Ga0496104_0385638 | |||
| 1711 | Ga0496104_0571857 | |||
| 1712 | Ga0496105_0000157 | |||
| 1713 | Ga0496105_0001270 | |||
| 1714 | Ga0496105_0052802 | |||
| 1715 | Ga0496105_0053668 | |||
| 1716 | Ga0496105_0114051 | |||
| 1717 | Ga0496106_0000541 | |||
| 1718 | Ga0496106_0041084 | |||
| 1719 | Ga0496106_0057223 | |||
| 1720 | Ga0496106_0147036 | |||
| 1721 | Ga0496107_0001684 | |||
| 1722 | Ga0496107_0003483 | |||
| 1723 | Ga0496107_0018855 | |||
| 1724 | Ga0496107_0041412 | |||
| 1725 | Ga0496108_0000660 | |||
| 1726 | Ga0496108_0000938 | |||
| 1727 | Ga0496108_0003134 | |||
| 1728 | Ga0496108_0020932 | |||
| 1729 | Ga0496108_0061584 | |||
| 1730 | Ga0496108_0187188 | |||
| 1731 | Ga0496108_0213856 | |||
| 1732 | Ga0496109_0000696 | |||
| 1733 | Ga0496109_0000977 | |||
| 1734 | Ga0496109_0001413 | |||
| 1735 | Ga0496109_0002804 | |||
| 1736 | Ga0496109_0012519 | |||
| 1737 | Ga0496110_0049690 | |||
| 1738 | Ga0496110_0051664 | |||
| 1739 | Ga0496110_0059567 | |||
| 1740 | Ga0496110_0100573 | |||
| 1741 | Ga0496110_0232299 | |||
| 1742 | Ga0496111_0039261 | |||
| 1743 | Ga0496112_0000045 | |||
| 1744 | Ga0496112_0000590 | |||
| 1745 | Ga0496112_0003700 | |||
| 1746 | Ga0496112_0004414 | |||
| 1747 | Ga0496112_0011347 | |||
| 1748 | Ga0496112_0015545 | |||
| 1749 | Ga0496112_0015661 | |||
| 1750 | Ga0496112_0110069 | |||
| 1751 | Ga0496113_0000962 | |||
| 1752 | Ga0496113_0001231 | |||
| 1753 | Ga0496113_0119226 | |||
| 1754 | Ga0496113_0144907 | |||
| 1755 | Ga0496113_0351464 | |||
| 1756 | Ga0496114_0011491 | |||
| 1757 | Ga0496114_0014713 | |||
| 1758 | Ga0496114_0070041 | |||
| 1759 | Ga0496114_0286118 | |||
| 1760 | Ga0496115_0012499 | |||
| 1761 | Ga0496115_0016751 | |||
| 1762 | Ga0496115_0066908 | |||
| 1763 | Ga0496115_0099117 | |||
| 1764 | Ga0496115_0110381 | |||
| 1765 | Ga0496115_0171451 | |||
| 1766 | Ga0496115_0322032 | |||
| 1767 | Ga0496119_0004297 | |||
| 1768 | Ga0496126_0008548 | |||
| 1769 | Ga0496126_0063075 | |||
| 1770 | Ga0496126_0133298 | |||
| 1771 | Ga0496126_0238760 | |||
| 1772 | Ga0496126_0254895 | |||
| 1773 | Ga0501032_0013787 | |||
| 1774 | Ga0501032_0026425 | |||
| 1775 | Ga0501033_0026459 | |||
| 1776 | Ga0501033_0035781 | |||
| 1777 | Ga0501033_0094162 | |||
| 1778 | Ga0501033_0293446 | |||
| 1779 | Ga0501034_0000229 | |||
| 1780 | Ga0501034_0013020 | |||
| 1781 | Ga0501034_0023890 | |||
| 1782 | Ga0501034_0078705 | |||
| 1783 | Ga0501034_0212294 | |||
| 1784 | Ga0501036_0001657 | |||
| 1785 | Ga0501036_0019768 | |||
| 1786 | Ga0501036_0110671 | |||
| 1787 | Ga0501037_0005935 | |||
| 1788 | Ga0501037_0018906 | |||
| 1789 | Ga0501038_0013215 | |||
| 1790 | Ga0501038_0172084 | |||
| 1791 | Ga0501039_0009233 | |||
| 1792 | Ga0501039_0194570 | |||
| 1793 | Ga0501039_0208799 | |||
| 1794 | Ga0501043_0002225 | |||
| 1795 | Ga0501043_0007079 | |||
| 1796 | Ga0501043_0011946 | |||
| 1797 | Ga0501043_0114917 | |||
| 1798 | Ga0501043_0277942 | |||
| 1799 | Ga0501046_0023812 | |||
| 1800 | Ga0501047_0000314 | |||
| 1801 | Ga0501047_0087590 | |||
| 1802 | Ga0501047_0132116 | |||
| 1803 | Ga0501047_0168876 | |||
| 1804 | Ga0501048_0002000 | |||
| 1805 | Ga0501068_0006446 | |||
| 1806 | Ga0501069_0083206 | |||
| 1807 | Ga0501069_0089368 | |||
| 1808 | Ga0501070_0006779 | |||
| 1809 | Ga0501070_0007677 | |||
| 1810 | Ga0501070_0008242 | |||
| 1811 | Ga0501070_0052152 | |||
| 1812 | Ga0501070_0062216 | |||
| 1813 | Ga0501070_0066421 | |||
| 1814 | Ga0501071_0067741 | |||
| 1815 | Ga0501072_0004407 | |||
| 1816 | Ga0501072_0096288 | |||
| 1817 | Ga0501072_0217227 | |||
| 1818 | Ga0501073_0007118 | |||
| 1819 | Ga0501073_0049770 | |||
| 1820 | Ga0501073_0226226 | |||
| 1821 | Ga0501074_0034191 | |||
| 1822 | Ga0501076_0087471 | |||
| 1823 | Ga0501076_0239841 | |||
| 1824 | Ga0501079_0079963 | |||
| 1825 | Ga0501080_0005419 | |||
| 1826 | Ga0501080_0126161 | |||
| 1827 | Ga0501083_0001743 | |||
| 1828 | Ga0501083_0046344 | |||
| 1829 | Ga0501083_0129738 | |||
| 1830 | Ga0501035_0000896 | |||
| 1831 | Ga0501035_0016102 | |||
| 1832 | Ga0501035_0030449 | |||
| 1833 | Ga0501035_0119923 | |||
| 1834 | Ga0501035_0262985 | |||
| 1835 | Ga0501035_0319828 | |||
| 1836 | Ga0501035_0409611 | |||
| 1837 | Ga0501044_0026016 | |||
| 1838 | Ga0501044_0028840 | |||
| 1839 | Ga0501044_0040259 | |||
| 1840 | Ga0501044_0068356 | |||
| 1841 | Ga0501044_0109276 | |||
| 1842 | Ga0501044_0167511 | |||
| 1843 | Ga0501044_0197844 | |||
| 1844 | Ga0501044_0250109 | |||
| 1845 | Ga0501044_0291460 | |||
| 1846 | nmdc:mga0yw44_47683_c1 | |||
| 1847 | nmdc:mga06z11_60782_c1 | |||
| 1848 | nmdc:mga07m45_136399_c1 | |||
| 1849 | nmdc:mga07m45_17418_c1 | |||
| 1850 | nmdc:mga05p37_133863_c1 | |||
| 1851 | nmdc:mga05p37_2697_c1 | |||
| 1852 | nmdc:mga09592_12303_c1 | |||
| 1853 | nmdc:mga0qj67_693_c1 | |||
| 1854 | nmdc:mga06r32_1056_c1 | |||
| 1855 | nmdc:mga08y16_119630_c1 | |||
| 1856 | nmdc:mga08y16_82727_c1 | |||
| 1857 | nmdc:mga0n895_159790_c1 | |||
| 1858 | nmdc:mga0n895_1654_c1 | |||
| 1859 | nmdc:mga0n895_206722_c1 | |||
| 1860 | nmdc:mga0n895_32994_c1 | |||
| 1861 | nmdc:mga0rr50_1013_c1 | |||
| 1862 | nmdc:mga0rr50_143061_c1 | |||
| 1863 | nmdc:mga0rr50_161499_c1 | |||
| 1864 | nmdc:mga0rr50_228131_c1 | |||
| 1865 | nmdc:mga08x19_96260_c1 | |||
| 1866 | nmdc:mga0a205_284340_c1 | |||
| 1867 | nmdc:mga0a205_467_c1 | |||
| 1868 | nmdc:mga0a205_6139_c1 | |||
| 1869 | Ga0495601_0000701 | |||
| 1870 | Ga0495601_0001682 | |||
| 1871 | Ga0495601_0003818 | |||
| 1872 | Ga0495601_0009237 | |||
| 1873 | Ga0495601_0024093 | |||
| 1874 | Ga0495601_0033370 | |||
| 1875 | Ga0495601_0050468 | |||
| 1876 | Ga0495612_0000478 | |||
| 1877 | Ga0495612_0001410 | |||
| 1878 | Ga0495612_0005755 | |||
| 1879 | Ga0495612_0012899 | |||
| 1880 | Ga0495612_0034083 | |||
| 1881 | Ga0495595_0000277 | |||
| 1882 | Ga0495595_0007089 | |||
| 1883 | Ga0495595_0010272 | |||
| 1884 | Ga0495595_0015012 | |||
| 1885 | Ga0495595_0015922 | |||
| 1886 | Ga0495595_0015962 | |||
| 1887 | Ga0495595_0141297 | |||
| 1888 | Ga0495619_0000159 | |||
| 1889 | Ga0495619_0000300 | |||
| 1890 | Ga0495619_0000628 | |||
| 1891 | Ga0495619_0004640 | |||
| 1892 | Ga0495619_0010923 | |||
| 1893 | Ga0495619_0035693 | |||
| 1894 | Ga0495619_0061653 | |||
| 1895 | Ga0495619_0135342 | |||
| 1896 | Ga0500643_003796 | |||
| 1897 | Ga0500644_0000375 | |||
| 1898 | Ga0500646_0048753 | |||
| 1899 | Ga0500566_0013664 | |||
| 1900 | Ga0500641_0016700 | |||
| 1901 | Ga0500595_000002 | |||
| 1902 | Ga0500655_016549 | |||
| 1903 | Ga0500589_094636 | |||
| 1904 | Ga0500616_0000002 | |||
| 1905 | Ga0500616_0000048 | |||
| 1906 | Ga0500637_0093139 | |||
| 1907 | Ga0500645_000252 | |||
| 1908 | Ga0500645_011250 | |||
| 1909 | Ga0501084_0260661 | |||
| 1910 | Ga0501082_0015464 | |||
| 1911 | Ga0501082_0026664 | |||
| 1912 | Ga0501082_0172306 | |||
| 1913 | Ga0501082_0250979 | |||
| 1914 | 2935771213 | |||
| 1915 | 8016555369 | |||
| 1916 | 8016571852 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j7z-assembly6.cif.gz_F | thermus thermophilus dnaj j- and g/f-domains | 0.9706 | 3 | 65 |
| 8fe2-assembly2.cif.gz_B | structure of j-pkac chimera complexed with aplithianine a | 0.9451 | 3 | 67 |
| 2ctr-assembly1.cif.gz_A | solution structure of j-domain from human dnaj subfamily b menber 9 | 0.9412 | 1 | 66 |
| 7jtk-assembly1.cif.gz_y | radial spoke 1 isolated from chlamydomonas reinhardtii | 0.9344 | 3 | 66 |
| 8glv-assembly1.cif.gz_KA | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.9269 | 3 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36659_200_276_2.60.260.20 | Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain | 0.9805 | 181 | 257 | 2.60.260.20 |
| af_Q921R4_436_526_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9789 | 4 | 67 | 1.10.287.110 |
| af_I1NG96_25_126_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9764 | 3 | 67 | 1.10.287.110 |
| af_K7N008_53_137_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9763 | 3 | 67 | 1.10.287.110 |
| af_Q8CHS2_271_339_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.976 | 4 | 57 | 1.10.287.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M1CD84-F1-model_v4 | DnaJ | 0.9683 | 140 | 257 |
GO:0006457
GO:0031072 GO:0046872 GO:0051082 |
| AF-A0A2E1Z000-F1-model_v4 | deleted | 0.9586 | 1 | 76 |
|
| AF-A0A3M0XWA6-F1-model_v4 | J domain-containing protein | 0.9583 | 154 | 283 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |
| AF-A0A4Y9J712-F1-model_v4 | deleted | 0.9544 | 144 | 263 |
|
| AF-A0A6V8NMM0-F1-model_v4 | Molecular chaperone DnaJ | 0.9469 | 162 | 253 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |