F486829
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 959 | 414 | 934 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_46200_c1|nmdc:mga0rr50_46200_c1_513_1703 |
| Length | 396 |
| Sequence | LNQASIQIKIGAATAGTHPVPLAGSSGRAGLERPVDPERALRQHRWRLFGPHAMKPSTTEPGRISEYRDVDAVTFREEIVSRYRPAVLRGLVAQWPAVQRARTSIQAIGQYLSAFDKGGAVDVMMMPPHVHGRLFYSDDMRGFNFSRSKASIGEVSDKLLRYAKFEGRPSLAVQSALIADCLPGFASENRLAILDESVQPRIWLGNVVTTPAHFDESNNVACVVSGTRRFTLFPPEQIANLYIGPLGHAPTGTPISLVSLANPDFERFPRFRDALASALVAELEPGDAIYIPTLWWHHVQSLAKYNILVNYWWKGQVDAERVSDSALNCLLHCLLTLKDLPAEQRQVWRTLFDYYIFSANPRSVEHIPEQVRGVLGEISPELAKQVKAFLVTQLQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 8 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 9 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 12 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 13 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 14 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 15 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 16 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 17 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 18 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 19 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 20 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 21 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 22 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 218 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 248 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 249 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 253 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 398 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 399 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 410 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 411 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 412 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 413 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 414 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 10.01 |
| Nodule | 0.31 |
| Rhizoplane | 3.02 |
| Rhizosphere | 78.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10001060 | 3300001990 | Bacteria | 9709 |
| 2 | JGI24735J21928_10001233 | 3300002067 | Bacteria | 9087 |
| 3 | JGI25165J46597_1001272 | 3300003214 | Bacteria | 14759 |
| 4 | JGI25153J46596_10023669 | 3300003215 | Bacteria | 2233 |
| 5 | rootH2_10023272 | 3300003320 | Bacteria | 8740 |
| 6 | rootH2_10155199 | 3300003320 | Bacteria | 3317 |
| 7 | rootH2_10180229 | 3300003320 | Bacteria | 1733 |
| 8 | rootL2_10002566 | 3300003322 | Bacteria | 5393 |
| 9 | rootL2_10220746 | 3300003322 | Bacteria | 1519 |
| 10 | rootH1_10021415 | 3300003323 | Bacteria | 26101 |
| 11 | rootH1_10039841 | 3300003316 | Bacteria | 6678 |
| 12 | rootH1_10039841 | 3300003323 | Bacteria | 86560 |
| 13 | Ga0055539_1000638 | 3300003752 | Bacteria | 9365 |
| 14 | Ga0055535_1000387 | 3300003761 | Bacteria | 41727 |
| 15 | Ga0055529_1000195 | 3300003763 | Bacteria | 82315 |
| 16 | Ga0055526_1001611 | 3300003771 | Bacteria | 15841 |
| 17 | Ga0055537_1000244 | 3300003773 | Bacteria | 39860 |
| 18 | Ga0055524_1000010 | 3300003775 | Bacteria | 282893 |
| 19 | Ga0055524_1005546 | 3300003775 | Bacteria | 5610 |
| 20 | Ga0055536_1001570 | 3300003781 | Bacteria | 13668 |
| 21 | Ga0055536_1003467 | 3300003781 | Bacteria | 8454 |
| 22 | Ga0055536_1003484 | 3300003781 | Bacteria | 8436 |
| 23 | Ga0055534_1000030 | 3300003784 | Bacteria | 121396 |
| 24 | Ga0055534_1000219 | 3300003784 | Bacteria | 42036 |
| 25 | Ga0055528_1000340 | 3300003790 | Bacteria | 38910 |
| 26 | Ga0055528_1008032 | 3300003790 | Bacteria | 4582 |
| 27 | Ga0055530_10000056 | 3300003791 | Bacteria | 100874 |
| 28 | Ga0055530_10000168 | 3300003791 | Bacteria | 59457 |
| 29 | Ga0055530_10000664 | 3300003791 | Bacteria | 29365 |
| 30 | Ga0055530_10002027 | 3300003791 | Bacteria | 13694 |
| 31 | Ga0055531_10004512 | 3300003794 | Bacteria | 8454 |
| 32 | Ga0055531_10008426 | 3300003794 | Bacteria | 5439 |
| 33 | Ga0065165_1002523 | 3300005262 | Bacteria | 15241 |
| 34 | Ga0065165_1034780 | 3300005262 | Bacteria | 1554 |
| 35 | Ga0065165_1049412 | 3300005262 | Bacteria | 1203 |
| 36 | Ga0065712_10111141 | 3300005290 | Bacteria | 1823 |
| 37 | Ga0065707_10081991 | 3300005295 | Bacteria | 25855 |
| 38 | Ga0070658_10000199 | 3300005327 | Bacteria | 52822 |
| 39 | Ga0070658_10008396 | 3300005327 | Bacteria | 8302 |
| 40 | Ga0070658_10040607 | 3300005327 | Bacteria | 3754 |
| 41 | Ga0070658_10076225 | 3300005327 | Bacteria | 2750 |
| 42 | Ga0070676_10005363 | 3300005328 | Bacteria | 6829 |
| 43 | Ga0070683_100034599 | 3300005329 | Bacteria | 4616 |
| 44 | Ga0070683_100071615 | 3300005329 | Bacteria | 3234 |
| 45 | Ga0070690_100027170 | 3300005330 | Bacteria | 3536 |
| 46 | Ga0070690_100051971 | 3300005330 | Bacteria | 2618 |
| 47 | Ga0070677_10041023 | 3300005333 | Bacteria | 1825 |
| 48 | Ga0068869_100131228 | 3300005334 | Bacteria | 1926 |
| 49 | Ga0070666_10108357 | 3300005335 | Bacteria | 1919 |
| 50 | Ga0070680_100026810 | 3300005336 | Bacteria | 4609 |
| 51 | Ga0070680_100114992 | 3300005336 | Bacteria | 2241 |
| 52 | Ga0068868_100017884 | 3300005338 | Bacteria | 5288 |
| 53 | Ga0070660_100000665 | 3300005339 | Bacteria | 22740 |
| 54 | Ga0070660_100015100 | 3300005339 | Bacteria | 5573 |
| 55 | Ga0070689_100050000 | 3300005340 | Bacteria | 3229 |
| 56 | Ga0070691_10056239 | 3300005341 | Bacteria | 1885 |
| 57 | Ga0070661_100002145 | 3300005344 | Bacteria | 13596 |
| 58 | Ga0070661_100005541 | 3300005344 | Bacteria | 8702 |
| 59 | Ga0070692_10058791 | 3300005345 | Bacteria | 2020 |
| 60 | Ga0070675_100166202 | 3300005354 | Bacteria | 1900 |
| 61 | Ga0070671_100028749 | 3300005355 | Bacteria | 4581 |
| 62 | Ga0070674_100094663 | 3300005356 | Bacteria | 2164 |
| 63 | Ga0070673_100000094 | 3300005364 | Bacteria | 39584 |
| 64 | Ga0070673_100043679 | 3300005364 | Bacteria | 3465 |
| 65 | Ga0070659_100004192 | 3300005366 | Bacteria | 10287 |
| 66 | Ga0070659_100009487 | 3300005366 | Bacteria | 7151 |
| 67 | Ga0070659_100010651 | 3300005366 | Bacteria | 6771 |
| 68 | Ga0070659_100241568 | 3300005366 | Bacteria | 1495 |
| 69 | Ga0070709_10186491 | 3300005434 | Bacteria | 1460 |
| 70 | Ga0070714_100016222 | 3300005435 | Bacteria | 6008 |
| 71 | Ga0070714_100018544 | 3300005435 | Bacteria | 5655 |
| 72 | Ga0070714_100144956 | 3300005435 | Bacteria | 2135 |
| 73 | Ga0070714_100237003 | 3300005435 | Bacteria | 1683 |
| 74 | Ga0070713_100038870 | 3300005436 | Bacteria | 3859 |
| 75 | Ga0070711_100099275 | 3300005439 | Unclassified | 2115 |
| 76 | Ga0070663_100002094 | 3300005455 | Bacteria | 11164 |
| 77 | Ga0070663_100013961 | 3300005455 | Bacteria | 5142 |
| 78 | Ga0070662_100132406 | 3300005457 | Bacteria | 1924 |
| 79 | Ga0070662_100145301 | 3300005457 | Bacteria | 1842 |
| 80 | Ga0070681_10002376 | 3300005458 | Bacteria | 17189 |
| 81 | Ga0070681_10054150 | 3300005458 | Bacteria | 3997 |
| 82 | Ga0070681_10102190 | 3300005458 | Bacteria | 2812 |
| 83 | Ga0068867_100000202 | 3300005459 | Bacteria | 39594 |
| 84 | Ga0068867_100069424 | 3300005459 | Bacteria | 2632 |
| 85 | Ga0070706_100028276 | 3300005467 | Bacteria | 5162 |
| 86 | Ga0070706_100101529 | 3300005467 | Bacteria | 2673 |
| 87 | Ga0070707_100051345 | 3300005468 | Bacteria | 3954 |
| 88 | Ga0070699_100033798 | 3300005518 | Bacteria | 4419 |
| 89 | Ga0070699_100039597 | 3300005518 | Bacteria | 4080 |
| 90 | Ga0070699_100309784 | 3300005518 | Bacteria | 1417 |
| 91 | Ga0070679_100080023 | 3300005530 | Bacteria | 3257 |
| 92 | Ga0070679_100095255 | 3300005530 | Bacteria | 2965 |
| 93 | Ga0070679_100180840 | 3300005530 | Bacteria | 2081 |
| 94 | Ga0070679_100263932 | 3300005530 | Bacteria | 1677 |
| 95 | Ga0070679_100291015 | 3300005530 | Bacteria | 1585 |
| 96 | Ga0070697_100054002 | 3300005536 | Bacteria | 3265 |
| 97 | Ga0070697_100072202 | 3300005536 | Bacteria | 2832 |
| 98 | Ga0070697_100102787 | 3300005536 | Bacteria | 2375 |
| 99 | Ga0068853_100028920 | 3300005539 | Bacteria | 4666 |
| 100 | Ga0068853_100035161 | 3300005539 | Bacteria | 4255 |
| 101 | Ga0068853_100064349 | 3300005539 | Bacteria | 3180 |
| 102 | Ga0068853_100106756 | 3300005539 | Bacteria | 2482 |
| 103 | Ga0070693_100001654 | 3300005547 | Bacteria | 10088 |
| 104 | Ga0070693_100001802 | 3300005547 | Bacteria | 9762 |
| 105 | Ga0070693_100092020 | 3300005547 | Bacteria | 1830 |
| 106 | Ga0070665_100000894 | 3300005548 | Bacteria | 38327 |
| 107 | Ga0070665_100002017 | 3300005548 | Bacteria | 22832 |
| 108 | Ga0070665_100022797 | 3300005548 | Bacteria | 6303 |
| 109 | Ga0070665_100049336 | 3300005548 | Bacteria | 4224 |
| 110 | Ga0070665_100101390 | 3300005548 | Bacteria | 2882 |
| 111 | Ga0070665_100104534 | 3300005548 | Bacteria | 2834 |
| 112 | Ga0068855_100001261 | 3300005563 | Bacteria | 31420 |
| 113 | Ga0068855_100033668 | 3300005563 | Bacteria | 6113 |
| 114 | Ga0068855_100082538 | 3300005563 | Bacteria | 3725 |
| 115 | Ga0068855_100116518 | 3300005563 | Bacteria | 3062 |
| 116 | Ga0068855_100151776 | 3300005563 | Bacteria | 2634 |
| 117 | Ga0068855_100160973 | 3300005563 | Bacteria | 2548 |
| 118 | Ga0070664_100006965 | 3300005564 | Bacteria | 9112 |
| 119 | Ga0070664_100098331 | 3300005564 | Bacteria | 2542 |
| 120 | Ga0070664_100104731 | 3300005564 | Bacteria | 2463 |
| 121 | Ga0070664_100256447 | 3300005564 | Bacteria | 1573 |
| 122 | Ga0068857_100002632 | 3300005577 | Bacteria | 14734 |
| 123 | Ga0068857_100277425 | 3300005577 | Unclassified | 1541 |
| 124 | Ga0068854_100002955 | 3300005578 | Bacteria | 10546 |
| 125 | Ga0068854_100014084 | 3300005578 | Bacteria | 5264 |
| 126 | Ga0068854_100086291 | 3300005578 | Bacteria | 2326 |
| 127 | Ga0068854_100232270 | 3300005578 | Bacteria | 1464 |
| 128 | Ga0068854_100321989 | 3300005578 | Bacteria | 1257 |
| 129 | Ga0068856_100008073 | 3300005614 | Bacteria | 10275 |
| 130 | Ga0068856_100088973 | 3300005614 | Bacteria | 3070 |
| 131 | Ga0068852_100008465 | 3300005616 | Bacteria | 7583 |
| 132 | Ga0068852_100036281 | 3300005616 | Bacteria | 4124 |
| 133 | Ga0068852_100046405 | 3300005616 | Bacteria | 3702 |
| 134 | Ga0068852_100159710 | 3300005616 | Bacteria | 2104 |
| 135 | Ga0068859_100184334 | 3300005617 | Bacteria | 2171 |
| 136 | Ga0068859_100344749 | 3300005617 | Bacteria | 1584 |
| 137 | Ga0068864_100081378 | 3300005618 | Bacteria | 2839 |
| 138 | Ga0068866_10005953 | 3300005718 | Bacteria | 5071 |
| 139 | Ga0068861_100008866 | 3300005719 | Bacteria | 6933 |
| 140 | Ga0068861_100242951 | 3300005719 | Bacteria | 1532 |
| 141 | Ga0068851_10157580 | 3300005834 | Bacteria | 1245 |
| 142 | Ga0068863_100282113 | 3300005841 | Bacteria | 1609 |
| 143 | Ga0068858_100085691 | 3300005842 | Bacteria | 2931 |
| 144 | Ga0068860_100042046 | 3300005843 | Bacteria | 4367 |
| 145 | Ga0068860_100168308 | 3300005843 | Bacteria | 2116 |
| 146 | Ga0068862_100010147 | 3300005844 | Bacteria | 7771 |
| 147 | Ga0081539_10011361 | 3300005985 | Bacteria | 7051 |
| 148 | Ga0075365_10081619 | 3300006038 | Bacteria | 2191 |
| 149 | Ga0070716_100073564 | 3300006173 | Bacteria | 2016 |
| 150 | Ga0070712_100042678 | 3300006175 | Bacteria | 3119 |
| 151 | Ga0070712_100144827 | 3300006175 | Bacteria | 1817 |
| 152 | Ga0075369_10004557 | 3300006186 | Bacteria | 5132 |
| 153 | Ga0075366_10138617 | 3300006195 | Bacteria | 1470 |
| 154 | Ga0097621_100076899 | 3300006237 | Bacteria | 2769 |
| 155 | Ga0097621_100206386 | 3300006237 | Bacteria | 1707 |
| 156 | Ga0075370_10001687 | 3300006353 | Bacteria | 9794 |
| 157 | Ga0068871_100054443 | 3300006358 | Bacteria | 3246 |
| 158 | Ga0068871_100071864 | 3300006358 | Bacteria | 2847 |
| 159 | Ga0068871_100121153 | 3300006358 | Bacteria | 2209 |
| 160 | Ga0075428_100031973 | 3300006844 | Bacteria | 5813 |
| 161 | Ga0075430_100006166 | 3300006846 | Bacteria | 10104 |
| 162 | Ga0075431_100021591 | 3300006847 | Bacteria | 6585 |
| 163 | Ga0075431_100034546 | 3300006847 | Bacteria | 5209 |
| 164 | Ga0075433_10008489 | 3300006852 | Bacteria | 8198 |
| 165 | Ga0075433_10170230 | 3300006852 | Bacteria | 1938 |
| 166 | Ga0075434_100001830 | 3300006871 | Bacteria | 18355 |
| 167 | Ga0075434_100145771 | 3300006871 | Bacteria | 2388 |
| 168 | Ga0075429_100059872 | 3300006880 | Bacteria | 3318 |
| 169 | Ga0068865_100000123 | 3300006881 | Bacteria | 39584 |
| 170 | Ga0068865_100238121 | 3300006881 | Bacteria | 1431 |
| 171 | Ga0097620_100184339 | 3300006931 | Bacteria | 2171 |
| 172 | Ga0097620_100344768 | 3300006931 | Bacteria | 1584 |
| 173 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 174 | Ga0099826_10080508 | 3300006948 | Bacteria | 2030 |
| 175 | Ga0075435_100290690 | 3300007076 | Bacteria | 1396 |
| 176 | Ga0105251_10005338 | 3300009011 | Bacteria | 8439 |
| 177 | Ga0105244_10003017 | 3300009036 | Bacteria | 12355 |
| 178 | Ga0105240_10001162 | 3300009093 | Bacteria | 46146 |
| 179 | Ga0105240_10001872 | 3300009093 | Bacteria | 34979 |
| 180 | Ga0105240_10003430 | 3300009093 | Bacteria | 24640 |
| 181 | Ga0105240_10015370 | 3300009093 | Bacteria | 10409 |
| 182 | Ga0105240_10019223 | 3300009093 | Bacteria | 9132 |
| 183 | Ga0105240_10026360 | 3300009093 | Bacteria | 7625 |
| 184 | Ga0105240_10040184 | 3300009093 | Bacteria | 5987 |
| 185 | Ga0105240_10058942 | 3300009093 | Bacteria | 4792 |
| 186 | Ga0105240_10090706 | 3300009093 | Bacteria | 3735 |
| 187 | Ga0105240_10097332 | 3300009093 | Bacteria | 3586 |
| 188 | Ga0105240_10203674 | 3300009093 | Bacteria | 2317 |
| 189 | Ga0105240_10249255 | 3300009093 | Bacteria | 2055 |
| 190 | Ga0105240_10319213 | 3300009093 | Bacteria | 1771 |
| 191 | Ga0111539_10014312 | 3300009094 | Bacteria | 9906 |
| 192 | Ga0111539_10559751 | 3300009094 | Bacteria | 1332 |
| 193 | Ga0105245_10037993 | 3300009098 | Bacteria | 4282 |
| 194 | Ga0105245_10114724 | 3300009098 | Bacteria | 2509 |
| 195 | Ga0105247_10066340 | 3300009101 | Bacteria | 2247 |
| 196 | Ga0114129_10061810 | 3300009147 | Bacteria | 5234 |
| 197 | Ga0105243_10000794 | 3300009148 | Bacteria | 30172 |
| 198 | Ga0105243_10229752 | 3300009148 | Bacteria | 1645 |
| 199 | Ga0105241_10033744 | 3300009174 | Bacteria | 3843 |
| 200 | Ga0105241_10154297 | 3300009174 | Bacteria | 1881 |
| 201 | Ga0105241_10246310 | 3300009174 | Bacteria | 1513 |
| 202 | Ga0105242_10000655 | 3300009176 | Bacteria | 27107 |
| 203 | Ga0105242_10027366 | 3300009176 | Bacteria | 4526 |
| 204 | Ga0105242_10332237 | 3300009176 | Bacteria | 1398 |
| 205 | Ga0105242_10443690 | 3300009176 | Bacteria | 1222 |
| 206 | Ga0105242_10510731 | 3300009176 | Bacteria | 1145 |
| 207 | Ga0105248_10041522 | 3300009177 | Bacteria | 5157 |
| 208 | Ga0105248_10090599 | 3300009177 | Bacteria | 3443 |
| 209 | Ga0105248_10100561 | 3300009177 | Bacteria | 3258 |
| 210 | Ga0105237_10017953 | 3300009545 | Bacteria | 7330 |
| 211 | Ga0105237_10024588 | 3300009545 | Bacteria | 6159 |
| 212 | Ga0105237_10033576 | 3300009545 | Bacteria | 5199 |
| 213 | Ga0105237_10149784 | 3300009545 | Bacteria | 2329 |
| 214 | Ga0105237_10153172 | 3300009545 | Unclassified | 2302 |
| 215 | Ga0105237_10407828 | 3300009545 | Bacteria | 1364 |
| 216 | Ga0105237_10453498 | 3300009545 | Bacteria | 1288 |
| 217 | Ga0105238_10006972 | 3300009551 | Bacteria | 11290 |
| 218 | Ga0105238_10041811 | 3300009551 | Bacteria | 4642 |
| 219 | Ga0105238_10129475 | 3300009551 | Unclassified | 2502 |
| 220 | Ga0105238_10148434 | 3300009551 | Bacteria | 2321 |
| 221 | Ga0105249_10034746 | 3300009553 | Bacteria | 4568 |
| 222 | Ga0105249_10088876 | 3300009553 | Bacteria | 2886 |
| 223 | Ga0105249_10103516 | 3300009553 | Bacteria | 2681 |
| 224 | Ga0105239_10009730 | 3300010375 | Bacteria | 10807 |
| 225 | Ga0105239_10046917 | 3300010375 | Bacteria | 4733 |
| 226 | Ga0105239_10080514 | 3300010375 | Bacteria | 3583 |
| 227 | Ga0105239_10173252 | 3300010375 | Bacteria | 2413 |
| 228 | Ga0105239_10202440 | 3300010375 | Bacteria | 2224 |
| 229 | Ga0105246_10015636 | 3300011119 | Bacteria | 4794 |
| 230 | Ga0105246_10215684 | 3300011119 | Bacteria | 1501 |
| 231 | Ga0157373_10134857 | 3300013100 | Bacteria | 1736 |
| 232 | Ga0157370_10001541 | 3300013104 | Bacteria | 28510 |
| 233 | Ga0157370_10005410 | 3300013104 | Bacteria | 14325 |
| 234 | Ga0157370_10013426 | 3300013104 | Bacteria | 8438 |
| 235 | Ga0157370_10121627 | 3300013104 | Bacteria | 2437 |
| 236 | Ga0157370_10485222 | 3300013104 | Bacteria | 1135 |
| 237 | Ga0157369_10083491 | 3300013105 | Bacteria | 3416 |
| 238 | Ga0157369_10185303 | 3300013105 | Bacteria | 2189 |
| 239 | Ga0157369_10300382 | 3300013105 | Bacteria | 1670 |
| 240 | Ga0157369_10378038 | 3300013105 | Bacteria | 1470 |
| 241 | Ga0157369_10448340 | 3300013105 | Bacteria | 1336 |
| 242 | Ga0157369_10468512 | 3300013105 | Bacteria | 1304 |
| 243 | Ga0157374_10009427 | 3300013296 | Bacteria | 8380 |
| 244 | Ga0157374_10047556 | 3300013296 | Bacteria | 3978 |
| 245 | Ga0157374_10207730 | 3300013296 | Bacteria | 1919 |
| 246 | Ga0157374_10212371 | 3300013296 | Unclassified | 1897 |
| 247 | Ga0157378_10096164 | 3300013297 | Bacteria | 2699 |
| 248 | Ga0157378_10219689 | 3300013297 | Bacteria | 1806 |
| 249 | Ga0157378_10295180 | 3300013297 | Bacteria | 1567 |
| 250 | Ga0157372_10021717 | 3300013307 | Bacteria | 6938 |
| 251 | Ga0157372_10142697 | 3300013307 | Bacteria | 2761 |
| 252 | Ga0157372_10250363 | 3300013307 | Bacteria | 2056 |
| 253 | Ga0157372_10498548 | 3300013307 | Bacteria | 1420 |
| 254 | Ga0163163_10254585 | 3300014325 | Bacteria | 1806 |
| 255 | Ga0157380_10000779 | 3300014326 | Bacteria | 19967 |
| 256 | Ga0182008_10000013 | 3300014497 | Bacteria | 286492 |
| 257 | Ga0182008_10029729 | 3300014497 | Bacteria | 2758 |
| 258 | Ga0157376_10000220 | 3300014969 | Bacteria | 39580 |
| 259 | Ga0157376_10111488 | 3300014969 | Bacteria | 2409 |
| 260 | Ga0182006_1076790 | 3300015261 | Bacteria | 1226 |
| 261 | Ga0182007_10000004 | 3300015262 | Bacteria | 485875 |
| 262 | Ga0182005_1001569 | 3300015265 | Bacteria | 9028 |
| 263 | Ga0163161_10007435 | 3300017792 | Bacteria | 7569 |
| 264 | Ga0163161_10035183 | 3300017792 | Bacteria | 3584 |
| 265 | Ga0163161_10038272 | 3300017792 | Bacteria | 3440 |
| 266 | Ga0213876_10000178 | 3300021384 | Bacteria | 65721 |
| 267 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 268 | Ga0207427_103171 | 3300025231 | Bacteria | 3660 |
| 269 | Ga0209258_100291 | 3300025242 | Bacteria | 82373 |
| 270 | Ga0209258_100872 | 3300025242 | Bacteria | 15897 |
| 271 | Ga0207425_1018172 | 3300025245 | Bacteria | 1529 |
| 272 | Ga0209026_1001218 | 3300025250 | Bacteria | 11877 |
| 273 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 274 | Ga0209148_1000394 | 3300025254 | Bacteria | 51565 |
| 275 | Ga0209148_1002813 | 3300025254 | Bacteria | 5408 |
| 276 | Ga0209148_1002879 | 3300025254 | Bacteria | 5276 |
| 277 | Ga0209759_1002075 | 3300025256 | Bacteria | 9373 |
| 278 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 279 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 280 | Ga0209565_1000179 | 3300025263 | Bacteria | 79300 |
| 281 | Ga0209455_1000208 | 3300025272 | Bacteria | 83420 |
| 282 | Ga0209455_1000610 | 3300025272 | Bacteria | 22718 |
| 283 | Ga0209673_1000237 | 3300025273 | Bacteria | 106342 |
| 284 | Ga0209673_1001240 | 3300025273 | Bacteria | 26584 |
| 285 | Ga0209675_1000107 | 3300025291 | Bacteria | 119593 |
| 286 | Ga0209675_1002110 | 3300025291 | Bacteria | 10537 |
| 287 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 288 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 289 | Ga0209676_1000354 | 3300025292 | Bacteria | 86753 |
| 290 | Ga0209676_1002027 | 3300025292 | Bacteria | 15881 |
| 291 | Ga0209676_1010724 | 3300025292 | Bacteria | 3776 |
| 292 | Ga0209025_1007736 | 3300025294 | Bacteria | 7922 |
| 293 | Ga0209564_1000422 | 3300025295 | Bacteria | 74531 |
| 294 | Ga0209564_1013712 | 3300025295 | Bacteria | 3419 |
| 295 | Ga0209758_1002900 | 3300025297 | Bacteria | 16557 |
| 296 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 297 | Ga0209050_1000069 | 3300025298 | Bacteria | 297615 |
| 298 | Ga0209050_1000649 | 3300025298 | Bacteria | 53856 |
| 299 | Ga0209050_1025682 | 3300025298 | Bacteria | 1994 |
| 300 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 301 | Ga0209256_1000965 | 3300025299 | Bacteria | 34676 |
| 302 | Ga0209256_1006508 | 3300025299 | Bacteria | 6143 |
| 303 | Ga0209256_1018485 | 3300025299 | Bacteria | 2261 |
| 304 | Ga0209051_1001126 | 3300025303 | Bacteria | 24440 |
| 305 | Ga0209051_1002524 | 3300025303 | Bacteria | 12967 |
| 306 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 307 | Ga0209257_1000194 | 3300025304 | Bacteria | 150624 |
| 308 | Ga0209257_1005408 | 3300025304 | Bacteria | 8983 |
| 309 | Ga0209257_1007938 | 3300025304 | Bacteria | 6224 |
| 310 | Ga0207655_1001866 | 3300025728 | Bacteria | 18158 |
| 311 | Ga0207713_1039236 | 3300025735 | Bacteria | 1999 |
| 312 | Ga0207680_10142096 | 3300025903 | Bacteria | 1592 |
| 313 | Ga0207699_10108858 | 3300025906 | Bacteria | 1772 |
| 314 | Ga0207645_10018197 | 3300025907 | Bacteria | 4628 |
| 315 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 316 | Ga0207705_10000354 | 3300025909 | Bacteria | 41477 |
| 317 | Ga0207705_10001638 | 3300025909 | Bacteria | 17774 |
| 318 | Ga0207684_10024343 | 3300025910 | Bacteria | 5163 |
| 319 | Ga0207684_10068684 | 3300025910 | Bacteria | 3011 |
| 320 | Ga0207684_10305149 | 3300025910 | Bacteria | 1372 |
| 321 | Ga0207654_10017619 | 3300025911 | Bacteria | 3738 |
| 322 | Ga0207654_10056875 | 3300025911 | Bacteria | 2271 |
| 323 | Ga0207707_10002777 | 3300025912 | Bacteria | 15616 |
| 324 | Ga0207707_10059893 | 3300025912 | Bacteria | 3313 |
| 325 | Ga0207707_10126652 | 3300025912 | Bacteria | 2234 |
| 326 | Ga0207707_10161757 | 3300025912 | Unclassified | 1957 |
| 327 | Ga0207695_10003912 | 3300025913 | Bacteria | 20607 |
| 328 | Ga0207695_10005836 | 3300025913 | Bacteria | 16191 |
| 329 | Ga0207695_10008285 | 3300025913 | Bacteria | 13036 |
| 330 | Ga0207695_10022428 | 3300025913 | Bacteria | 7165 |
| 331 | Ga0207695_10040862 | 3300025913 | Bacteria | 4967 |
| 332 | Ga0207695_10067718 | 3300025913 | Bacteria | 3661 |
| 333 | Ga0207695_10070174 | 3300025913 | Bacteria | 3583 |
| 334 | Ga0207695_10076080 | 3300025913 | Bacteria | 3414 |
| 335 | Ga0207695_10081284 | 3300025913 | Bacteria | 3279 |
| 336 | Ga0207671_10020155 | 3300025914 | Bacteria | 5081 |
| 337 | Ga0207671_10126783 | 3300025914 | Bacteria | 1956 |
| 338 | Ga0207671_10336798 | 3300025914 | Bacteria | 1195 |
| 339 | Ga0207693_10004578 | 3300025915 | Bacteria | 11670 |
| 340 | Ga0207660_10001881 | 3300025917 | Bacteria | 13992 |
| 341 | Ga0207660_10137755 | 3300025917 | Bacteria | 1864 |
| 342 | Ga0207660_10315043 | 3300025917 | Bacteria | 1248 |
| 343 | Ga0207660_10366691 | 3300025917 | Bacteria | 1156 |
| 344 | Ga0207657_10001150 | 3300025919 | Bacteria | 28145 |
| 345 | Ga0207657_10004105 | 3300025919 | Bacteria | 15466 |
| 346 | Ga0207657_10015382 | 3300025919 | Bacteria | 7413 |
| 347 | Ga0207649_10003619 | 3300025920 | Bacteria | 8439 |
| 348 | Ga0207652_10002553 | 3300025921 | Bacteria | 15275 |
| 349 | Ga0207652_10018371 | 3300025921 | Bacteria | 5733 |
| 350 | Ga0207652_10140729 | 3300025921 | Bacteria | 2157 |
| 351 | Ga0207652_10308289 | 3300025921 | Bacteria | 1429 |
| 352 | Ga0207652_10315304 | 3300025921 | Bacteria | 1412 |
| 353 | Ga0207646_10001282 | 3300025922 | Bacteria | 31406 |
| 354 | Ga0207694_10020923 | 3300025924 | Bacteria | 4953 |
| 355 | Ga0207694_10023181 | 3300025924 | Bacteria | 4713 |
| 356 | Ga0207694_10042419 | 3300025924 | Bacteria | 3509 |
| 357 | Ga0207659_10326802 | 3300025926 | Bacteria | 1267 |
| 358 | Ga0207700_10057740 | 3300025928 | Bacteria | 2928 |
| 359 | Ga0207664_10000197 | 3300025929 | Bacteria | 45209 |
| 360 | Ga0207664_10354770 | 3300025929 | Bacteria | 1298 |
| 361 | Ga0207690_10001754 | 3300025932 | Bacteria | 13317 |
| 362 | Ga0207706_10038186 | 3300025933 | Bacteria | 4260 |
| 363 | Ga0207706_10076169 | 3300025933 | Bacteria | 2951 |
| 364 | Ga0207686_10001104 | 3300025934 | Bacteria | 15710 |
| 365 | Ga0207686_10030398 | 3300025934 | Bacteria | 3197 |
| 366 | Ga0207686_10038374 | 3300025934 | Bacteria | 2898 |
| 367 | Ga0207709_10000254 | 3300025935 | Bacteria | 63973 |
| 368 | Ga0207709_10130726 | 3300025935 | Bacteria | 1711 |
| 369 | Ga0207670_10026013 | 3300025936 | Bacteria | 3683 |
| 370 | Ga0207704_10000133 | 3300025938 | Bacteria | 40529 |
| 371 | Ga0207665_10050752 | 3300025939 | Bacteria | 2790 |
| 372 | Ga0207711_10147227 | 3300025941 | Bacteria | 2122 |
| 373 | Ga0207689_10001230 | 3300025942 | Bacteria | 24641 |
| 374 | Ga0207689_10089926 | 3300025942 | Bacteria | 2522 |
| 375 | Ga0207661_10056936 | 3300025944 | Unclassified | 3141 |
| 376 | Ga0207679_10009072 | 3300025945 | Bacteria | 6354 |
| 377 | Ga0207679_10160279 | 3300025945 | Bacteria | 1841 |
| 378 | Ga0207679_10247463 | 3300025945 | Bacteria | 1514 |
| 379 | Ga0207667_10000116 | 3300025949 | Bacteria | 128218 |
| 380 | Ga0207667_10005682 | 3300025949 | Bacteria | 15205 |
| 381 | Ga0207667_10006471 | 3300025949 | Bacteria | 14174 |
| 382 | Ga0207667_10019038 | 3300025949 | Bacteria | 7674 |
| 383 | Ga0207667_10076365 | 3300025949 | Bacteria | 3476 |
| 384 | Ga0207667_10139213 | 3300025949 | Bacteria | 2499 |
| 385 | Ga0207667_10152042 | 3300025949 | Bacteria | 2382 |
| 386 | Ga0207667_10162201 | 3300025949 | Bacteria | 2299 |
| 387 | Ga0207651_10000012 | 3300025960 | Bacteria | 189928 |
| 388 | Ga0207651_10092619 | 3300025960 | Bacteria | 2217 |
| 389 | Ga0207640_10000021 | 3300025981 | Bacteria | 168138 |
| 390 | Ga0207658_10156895 | 3300025986 | Bacteria | 1861 |
| 391 | Ga0207703_10014632 | 3300026035 | Bacteria | 6120 |
| 392 | Ga0207639_10005643 | 3300026041 | Bacteria | 8469 |
| 393 | Ga0207639_10024259 | 3300026041 | Bacteria | 4387 |
| 394 | Ga0207639_10137112 | 3300026041 | Bacteria | 2034 |
| 395 | Ga0207639_10260801 | 3300026041 | Unclassified | 1516 |
| 396 | Ga0207678_10005690 | 3300026067 | Bacteria | 11131 |
| 397 | Ga0207702_10005695 | 3300026078 | Bacteria | 10866 |
| 398 | Ga0207702_10030558 | 3300026078 | Bacteria | 4488 |
| 399 | Ga0207702_10086540 | 3300026078 | Bacteria | 2733 |
| 400 | Ga0207641_10272584 | 3300026088 | Bacteria | 1588 |
| 401 | Ga0207648_10000628 | 3300026089 | Bacteria | 39541 |
| 402 | Ga0207648_10197105 | 3300026089 | Bacteria | 1786 |
| 403 | Ga0207674_10002241 | 3300026116 | Bacteria | 24492 |
| 404 | Ga0207674_10004133 | 3300026116 | Bacteria | 17557 |
| 405 | Ga0207674_10326551 | 3300026116 | Bacteria | 1484 |
| 406 | Ga0207674_10358479 | 3300026116 | Bacteria | 1410 |
| 407 | Ga0207698_10000754 | 3300026142 | Bacteria | 18785 |
| 408 | Ga0207698_10053238 | 3300026142 | Bacteria | 3105 |
| 409 | Ga0207698_10061744 | 3300026142 | Bacteria | 2922 |
| 410 | Ga0207698_10275707 | 3300026142 | Bacteria | 1553 |
| 411 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 412 | Ga0209974_10039278 | 3300027876 | Bacteria | 1574 |
| 413 | Ga0207428_10010044 | 3300027907 | Bacteria | 8472 |
| 414 | Ga0265354_1000560 | 3300028016 | Bacteria | 6357 |
| 415 | Ga0268266_10001496 | 3300028379 | Bacteria | 27627 |
| 416 | Ga0268266_10004360 | 3300028379 | Bacteria | 13596 |
| 417 | Ga0268266_10014895 | 3300028379 | Bacteria | 6677 |
| 418 | Ga0268266_10147209 | 3300028379 | Bacteria | 2119 |
| 419 | Ga0268265_10025414 | 3300028380 | Bacteria | 4203 |
| 420 | Ga0268265_10037847 | 3300028380 | Bacteria | 3543 |
| 421 | Ga0268264_10158773 | 3300028381 | Bacteria | 2035 |
| 422 | Ga0265336_10000032 | 3300028666 | Bacteria | 167925 |
| 423 | Ga0307515_10014980 | 3300028794 | Bacteria | 14323 |
| 424 | Ga0307515_10041594 | 3300028794 | Bacteria | 7218 |
| 425 | Ga0316176_1102927 | 3300030732 | Bacteria | 4315 |
| 426 | Ga0265770_1000540 | 3300030878 | Bacteria | 5255 |
| 427 | Ga0307513_10051744 | 3300031456 | Bacteria | 4428 |
| 428 | Ga0307513_10159844 | 3300031456 | Bacteria | 2147 |
| 429 | Ga0307513_10186899 | 3300031456 | Bacteria | 1928 |
| 430 | Ga0307408_100004051 | 3300031548 | Bacteria | 9994 |
| 431 | Ga0316578_10030767 | 3300031728 | Bacteria | 3054 |
| 432 | Ga0307516_10000068 | 3300031730 | Bacteria | 111515 |
| 433 | Ga0307516_10001773 | 3300031730 | Bacteria | 29682 |
| 434 | Ga0307516_10037833 | 3300031730 | Bacteria | 4820 |
| 435 | Ga0307405_10002816 | 3300031731 | Bacteria | 7810 |
| 436 | Ga0307410_10028523 | 3300031852 | Bacteria | 3542 |
| 437 | Ga0307407_10021778 | 3300031903 | Bacteria | 3313 |
| 438 | Ga0307409_100034119 | 3300031995 | Bacteria | 3712 |
| 439 | Ga0307416_100000858 | 3300032002 | Bacteria | 15992 |
| 440 | Ga0307416_100096328 | 3300032002 | Bacteria | 2559 |
| 441 | Ga0307414_10250336 | 3300032004 | Bacteria | 1472 |
| 442 | Ga0307411_10078898 | 3300032005 | Unclassified | 2259 |
| 443 | Ga0307510_10126663 | 3300033180 | Bacteria | 2241 |
| 444 | Ga0307510_10172201 | 3300033180 | Unclassified | 1742 |
| 445 | Ga0373945_0024321 | 3300035116 | Bacteria | 2098 |
| 446 | Ga0373956_0063969 | 3300035119 | Bacteria | 1670 |
| 447 | Ga0373943_0019772 | 3300035170 | Bacteria | 3100 |
| 448 | Ga0373955_0163715 | 3300035172 | Bacteria | 1314 |
| 449 | Ga0316574_0052152 | 3300035398 | Bacteria | 2550 |
| 450 | Ga0373924_0012506 | 3300035410 | Bacteria | 3173 |
| 451 | Ga0373935_0187458 | 3300035692 | Bacteria | 1423 |
| 452 | Ga0373947_0020569 | 3300035725 | Bacteria | 3811 |
| 453 | Ga0373937_0066429 | 3300036401 | Bacteria | 3321 |
| 454 | Ga0373937_0273019 | 3300036401 | Unclassified | 1596 |
| 455 | Ga0373925_0009878 | 3300037068 | Bacteria | 6934 |
| 456 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 457 | Ga0395899_0000256 | 3300037312 | Bacteria | 70194 |
| 458 | Ga0395899_0001762 | 3300037312 | Bacteria | 17985 |
| 459 | Ga0395899_0002562 | 3300037312 | Bacteria | 14702 |
| 460 | Ga0395899_0002656 | 3300037312 | Bacteria | 14408 |
| 461 | Ga0395900_0000065 | 3300037418 | Bacteria | 196327 |
| 462 | Ga0395900_0000312 | 3300037418 | Bacteria | 72126 |
| 463 | Ga0395900_0011019 | 3300037418 | Bacteria | 9241 |
| 464 | Ga0395900_0022389 | 3300037418 | Bacteria | 6463 |
| 465 | Ga0395900_0033276 | 3300037418 | Bacteria | 5306 |
| 466 | Ga0395900_0033672 | 3300037418 | Bacteria | 5273 |
| 467 | Ga0395900_0054706 | 3300037418 | Bacteria | 4109 |
| 468 | Ga0395900_0074018 | 3300037418 | Bacteria | 3502 |
| 469 | Ga0395900_0140297 | 3300037418 | Bacteria | 2475 |
| 470 | Ga0395900_0218988 | 3300037418 | Bacteria | 1920 |
| 471 | Ga0395900_0221076 | 3300037418 | Bacteria | 1909 |
| 472 | Ga0395900_0245407 | 3300037418 | Bacteria | 1794 |
| 473 | Ga0395900_0401062 | 3300037418 | Bacteria | 1335 |
| 474 | Ga0395898_0001598 | 3300037466 | Bacteria | 30916 |
| 475 | Ga0395898_0017081 | 3300037466 | Bacteria | 7411 |
| 476 | Ga0395898_0084646 | 3300037466 | Bacteria | 3056 |
| 477 | Ga0395898_0097702 | 3300037466 | Bacteria | 2820 |
| 478 | Ga0395898_0109304 | 3300037466 | Unclassified | 2651 |
| 479 | Ga0395898_0183190 | 3300037466 | Bacteria | 2001 |
| 480 | Ga0395898_0210535 | 3300037466 | Bacteria | 1854 |
| 481 | Ga0395898_0292994 | 3300037466 | Bacteria | 1552 |
| 482 | Ga0395898_0340430 | 3300037466 | Bacteria | 1430 |
| 483 | Ga0395905_0005086 | 3300037471 | Bacteria | 13535 |
| 484 | Ga0395905_0007563 | 3300037471 | Bacteria | 10794 |
| 485 | Ga0395905_0020325 | 3300037471 | Bacteria | 6289 |
| 486 | Ga0395905_0359087 | 3300037471 | Bacteria | 1349 |
| 487 | Ga0395901_0000094 | 3300038443 | Bacteria | 120153 |
| 488 | Ga0395901_0000442 | 3300038443 | Bacteria | 48366 |
| 489 | Ga0395901_0002606 | 3300038443 | Bacteria | 18256 |
| 490 | Ga0395901_0191624 | 3300038443 | Bacteria | 2144 |
| 491 | Ga0395901_0385690 | 3300038443 | Bacteria | 1441 |
| 492 | Ga0436365_1679154 | 3300039437 | Bacteria | 73730 |
| 493 | Ga0439436_0012373 | 3300041404 | Bacteria | 2591 |
| 494 | Ga0439453_0021431 | 3300041408 | Bacteria | 1165 |
| 495 | Ga0451793_0304280 | 3300041452 | Bacteria | 6526 |
| 496 | Ga0451806_137214 | 3300041462 | Bacteria | 4593 |
| 497 | Ga0451807_0283309 | 3300041486 | Bacteria | 1710 |
| 498 | Ga0439443_001810 | 3300042003 | Bacteria | 2452 |
| 499 | Ga0439432_029018 | 3300042006 | Bacteria | 1800 |
| 500 | Ga0439449_0000144 | 3300042007 | Bacteria | 24266 |
| 501 | Ga0439452_025717 | 3300042010 | Bacteria | 1492 |
| 502 | Ga0450920_017547 | 3300042122 | Bacteria | 1369 |
| 503 | Ga0439446_0012684 | 3300042156 | Bacteria | 2303 |
| 504 | Ga0439458_0005546 | 3300042157 | Bacteria | 2835 |
| 505 | Ga0439434_0003947 | 3300042435 | Bacteria | 4332 |
| 506 | Ga0466969_0006199 | 3300044656 | Bacteria | 6364 |
| 507 | Ga0466969_0124756 | 3300044656 | Bacteria | 1197 |
| 508 | Ga0466972_0001066 | 3300044658 | Bacteria | 13166 |
| 509 | Ga0466965_0001602 | 3300044683 | Bacteria | 9240 |
| 510 | Ga0466965_0015567 | 3300044683 | Bacteria | 3613 |
| 511 | Ga0466965_0023267 | 3300044683 | Bacteria | 2991 |
| 512 | Ga0466965_0036778 | 3300044683 | Bacteria | 2402 |
| 513 | Ga0466966_0002495 | 3300044684 | Bacteria | 12058 |
| 514 | Ga0466966_0003676 | 3300044684 | Bacteria | 10126 |
| 515 | Ga0466966_0003847 | 3300044684 | Bacteria | 9910 |
| 516 | Ga0466966_0007297 | 3300044684 | Bacteria | 7325 |
| 517 | Ga0466966_0046280 | 3300044684 | Bacteria | 2778 |
| 518 | Ga0466966_0070296 | 3300044684 | Unclassified | 2195 |
| 519 | Ga0466961_0013406 | 3300044693 | Bacteria | 5248 |
| 520 | Ga0466961_0022464 | 3300044693 | Bacteria | 4058 |
| 521 | Ga0466961_0025235 | 3300044693 | Bacteria | 3823 |
| 522 | Ga0466961_0047971 | 3300044693 | Bacteria | 2729 |
| 523 | Ga0466961_0166085 | 3300044693 | Bacteria | 1374 |
| 524 | Ga0466963_0051797 | 3300044694 | Bacteria | 2722 |
| 525 | Ga0466964_0002334 | 3300044706 | Bacteria | 6732 |
| 526 | Ga0466964_0032730 | 3300044706 | Bacteria | 2067 |
| 527 | Ga0466971_0001227 | 3300044719 | Bacteria | 10649 |
| 528 | Ga0466971_0001502 | 3300044719 | Bacteria | 9838 |
| 529 | Ga0466971_0030426 | 3300044719 | Bacteria | 2415 |
| 530 | Ga0466971_0080081 | 3300044719 | Bacteria | 1489 |
| 531 | Ga0466968_0072509 | 3300044735 | Bacteria | 1501 |
| 532 | Ga0466970_0009285 | 3300044765 | Bacteria | 4966 |
| 533 | Ga0466970_0037762 | 3300044765 | Bacteria | 2561 |
| 534 | Ga0466970_0093960 | 3300044765 | Bacteria | 1629 |
| 535 | Ga0466957_0000006 | 3300044842 | Bacteria | 85752 |
| 536 | Ga0466957_0009575 | 3300044842 | Bacteria | 5533 |
| 537 | Ga0466957_0028197 | 3300044842 | Bacteria | 3341 |
| 538 | Ga0466957_0030950 | 3300044842 | Bacteria | 3196 |
| 539 | Ga0466957_0070162 | 3300044842 | Bacteria | 2165 |
| 540 | Ga0466957_0206970 | 3300044842 | Bacteria | 1291 |
| 541 | Ga0466959_0003211 | 3300045049 | Bacteria | 10630 |
| 542 | Ga0466959_0048063 | 3300045049 | Bacteria | 3136 |
| 543 | Ga0466959_0088267 | 3300045049 | Bacteria | 2229 |
| 544 | Ga0451576_0016609 | 3300045051 | Bacteria | 8119 |
| 545 | Ga0466958_0001145 | 3300045836 | Bacteria | 12283 |
| 546 | Ga0466958_0024145 | 3300045836 | Bacteria | 3576 |
| 547 | Ga0466958_0033486 | 3300045836 | Bacteria | 3061 |
| 548 | Ga0466967_0007712 | 3300045976 | Bacteria | 7801 |
| 549 | Ga0466967_0015652 | 3300045976 | Bacteria | 5953 |
| 550 | Ga0466967_0036968 | 3300045976 | Bacteria | 4174 |
| 551 | Ga0466967_0037992 | 3300045976 | Bacteria | 4126 |
| 552 | Ga0466967_0065033 | 3300045976 | Bacteria | 3245 |
| 553 | Ga0466967_0360652 | 3300045976 | Bacteria | 1408 |
| 554 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 555 | Ga0495627_000026 | 3300046453 | Bacteria | 238494 |
| 556 | Ga0495592_0108804 | 3300046454 | Bacteria | 1964 |
| 557 | Ga0495603_0047497 | 3300046455 | Bacteria | 2556 |
| 558 | Ga0495590_0000042 | 3300046457 | Bacteria | 120663 |
| 559 | Ga0495590_0000451 | 3300046457 | Bacteria | 20284 |
| 560 | Ga0495590_0003216 | 3300046457 | Bacteria | 6677 |
| 561 | Ga0495590_0036144 | 3300046457 | Bacteria | 1723 |
| 562 | Ga0495590_0048088 | 3300046457 | Bacteria | 1487 |
| 563 | Ga0495591_000068 | 3300046458 | Bacteria | 117653 |
| 564 | Ga0495638_0000604 | 3300046460 | Bacteria | 40235 |
| 565 | Ga0495638_0000660 | 3300046460 | Bacteria | 37623 |
| 566 | Ga0495638_0001264 | 3300046460 | Bacteria | 23634 |
| 567 | Ga0495638_0002210 | 3300046460 | Bacteria | 16219 |
| 568 | Ga0495638_0004597 | 3300046460 | Bacteria | 10447 |
| 569 | Ga0495638_0133534 | 3300046460 | Bacteria | 1456 |
| 570 | Ga0495651_0191254 | 3300046462 | Bacteria | 1440 |
| 571 | Ga0495653_0037136 | 3300046463 | Bacteria | 3831 |
| 572 | Ga0495653_0048195 | 3300046463 | Bacteria | 3290 |
| 573 | Ga0495653_0107859 | 3300046463 | Bacteria | 2006 |
| 574 | Ga0495650_0022270 | 3300046471 | Bacteria | 3043 |
| 575 | Ga0495650_0034354 | 3300046471 | Bacteria | 2246 |
| 576 | Ga0495650_0040080 | 3300046471 | Bacteria | 2015 |
| 577 | Ga0495650_0068094 | 3300046471 | Bacteria | 1405 |
| 578 | Ga0495582_0075282 | 3300046473 | Bacteria | 1869 |
| 579 | Ga0495605_0000004 | 3300046474 | Bacteria | 395282 |
| 580 | Ga0495605_0000084 | 3300046474 | Bacteria | 124941 |
| 581 | Ga0495605_0000647 | 3300046474 | Bacteria | 26637 |
| 582 | Ga0495605_0001330 | 3300046474 | Bacteria | 16349 |
| 583 | Ga0495605_0014213 | 3300046474 | Bacteria | 4366 |
| 584 | Ga0495605_0019389 | 3300046474 | Bacteria | 3632 |
| 585 | Ga0495605_0048460 | 3300046474 | Bacteria | 2080 |
| 586 | Ga0495584_0000041 | 3300046491 | Bacteria | 91074 |
| 587 | Ga0495584_0000093 | 3300046491 | Bacteria | 61798 |
| 588 | Ga0495584_0017090 | 3300046491 | Bacteria | 3698 |
| 589 | Ga0495585_0002675 | 3300046492 | Bacteria | 12486 |
| 590 | Ga0495585_0068780 | 3300046492 | Bacteria | 1933 |
| 591 | Ga0495585_0127093 | 3300046492 | Bacteria | 1344 |
| 592 | Ga0495594_0071870 | 3300046499 | Bacteria | 1924 |
| 593 | Ga0495596_0000238 | 3300046500 | Bacteria | 37279 |
| 594 | Ga0495596_0002734 | 3300046500 | Bacteria | 9268 |
| 595 | Ga0495596_0006693 | 3300046500 | Bacteria | 5276 |
| 596 | Ga0495596_0011687 | 3300046500 | Bacteria | 3775 |
| 597 | Ga0495607_0000995 | 3300046501 | Bacteria | 26171 |
| 598 | Ga0495607_0001794 | 3300046501 | Bacteria | 18325 |
| 599 | Ga0495607_0002272 | 3300046501 | Bacteria | 15823 |
| 600 | Ga0495607_0002667 | 3300046501 | Bacteria | 14276 |
| 601 | Ga0495607_0008853 | 3300046501 | Bacteria | 6854 |
| 602 | Ga0495583_0000170 | 3300046506 | Bacteria | 111003 |
| 603 | Ga0495583_0000182 | 3300046506 | Bacteria | 107009 |
| 604 | Ga0495583_0004765 | 3300046506 | Bacteria | 9525 |
| 605 | Ga0495583_0006233 | 3300046506 | Bacteria | 7849 |
| 606 | Ga0495583_0011541 | 3300046506 | Bacteria | 5065 |
| 607 | Ga0495583_0038261 | 3300046506 | Bacteria | 2267 |
| 608 | Ga0495583_0054440 | 3300046506 | Bacteria | 1811 |
| 609 | Ga0495606_0014422 | 3300046507 | Bacteria | 6169 |
| 610 | Ga0495606_0026503 | 3300046507 | Bacteria | 4131 |
| 611 | Ga0495606_0031373 | 3300046507 | Bacteria | 3696 |
| 612 | Ga0495606_0086650 | 3300046507 | Bacteria | 1935 |
| 613 | Ga0495608_0248269 | 3300046511 | Bacteria | 1110 |
| 614 | Ga0495610_0000712 | 3300046512 | Bacteria | 31727 |
| 615 | Ga0495610_0002794 | 3300046512 | Bacteria | 14280 |
| 616 | Ga0495610_0005868 | 3300046512 | Bacteria | 8619 |
| 617 | Ga0495616_0000709 | 3300046513 | Bacteria | 24711 |
| 618 | Ga0495616_0003907 | 3300046513 | Bacteria | 9491 |
| 619 | Ga0495616_0011719 | 3300046513 | Bacteria | 5011 |
| 620 | Ga0495616_0015645 | 3300046513 | Bacteria | 4215 |
| 621 | Ga0495616_0016074 | 3300046513 | Bacteria | 4147 |
| 622 | Ga0495616_0019225 | 3300046513 | Bacteria | 3731 |
| 623 | Ga0495616_0035359 | 3300046513 | Bacteria | 2586 |
| 624 | Ga0495616_0053801 | 3300046513 | Bacteria | 1999 |
| 625 | Ga0495630_0029392 | 3300046517 | Bacteria | 4087 |
| 626 | Ga0495631_0002607 | 3300046518 | Bacteria | 10080 |
| 627 | Ga0495631_0003414 | 3300046518 | Bacteria | 8695 |
| 628 | Ga0495631_0006009 | 3300046518 | Bacteria | 6313 |
| 629 | Ga0495631_0011820 | 3300046518 | Bacteria | 4281 |
| 630 | Ga0495631_0032523 | 3300046518 | Bacteria | 2351 |
| 631 | Ga0495631_0032916 | 3300046518 | Bacteria | 2332 |
| 632 | Ga0495631_0032917 | 3300046518 | Bacteria | 2332 |
| 633 | Ga0495632_0000024 | 3300046519 | Bacteria | 179517 |
| 634 | Ga0495632_0000028 | 3300046519 | Bacteria | 171089 |
| 635 | Ga0495632_0000043 | 3300046519 | Bacteria | 143694 |
| 636 | Ga0495632_0006837 | 3300046519 | Bacteria | 7276 |
| 637 | Ga0495632_0030354 | 3300046519 | Bacteria | 2806 |
| 638 | Ga0495632_0063798 | 3300046519 | Bacteria | 1783 |
| 639 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 640 | Ga0495637_0007144 | 3300046520 | Bacteria | 5560 |
| 641 | Ga0495637_0007639 | 3300046520 | Bacteria | 5349 |
| 642 | Ga0495637_0088223 | 3300046520 | Bacteria | 1227 |
| 643 | Ga0495643_0006873 | 3300046522 | Bacteria | 7413 |
| 644 | Ga0495643_0198176 | 3300046522 | Bacteria | 965 |
| 645 | Ga0495644_0000801 | 3300046523 | Bacteria | 12974 |
| 646 | Ga0495644_0007211 | 3300046523 | Bacteria | 4296 |
| 647 | Ga0495644_0018712 | 3300046523 | Bacteria | 2643 |
| 648 | Ga0495644_0043394 | 3300046523 | Bacteria | 1692 |
| 649 | Ga0495648_0000221 | 3300046524 | Bacteria | 65359 |
| 650 | Ga0495648_0001910 | 3300046524 | Bacteria | 19895 |
| 651 | Ga0495648_0012173 | 3300046524 | Bacteria | 6433 |
| 652 | Ga0495648_0015052 | 3300046524 | Bacteria | 5633 |
| 653 | Ga0495663_0000785 | 3300046525 | Bacteria | 10848 |
| 654 | Ga0495642_0000001 | 3300046528 | Bacteria | 389656 |
| 655 | Ga0495642_0000041 | 3300046528 | Bacteria | 76279 |
| 656 | Ga0495642_0000295 | 3300046528 | Bacteria | 28032 |
| 657 | Ga0495642_0004347 | 3300046528 | Bacteria | 5501 |
| 658 | Ga0495642_0118581 | 3300046528 | Bacteria | 1135 |
| 659 | Ga0495642_0123538 | 3300046528 | Bacteria | 1111 |
| 660 | Ga0495642_0130266 | 3300046528 | Bacteria | 1082 |
| 661 | Ga0495652_0190946 | 3300046529 | Bacteria | 1563 |
| 662 | Ga0495652_0274500 | 3300046529 | Bacteria | 1237 |
| 663 | Ga0495654_0000692 | 3300046530 | Bacteria | 26426 |
| 664 | Ga0495654_0005801 | 3300046530 | Bacteria | 7114 |
| 665 | Ga0495654_0009776 | 3300046530 | Bacteria | 5244 |
| 666 | Ga0495654_0029926 | 3300046530 | Bacteria | 2774 |
| 667 | Ga0495587_0025462 | 3300046536 | Bacteria | 3615 |
| 668 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 669 | Ga0495609_0003932 | 3300046538 | Bacteria | 8325 |
| 670 | Ga0495609_0025869 | 3300046538 | Bacteria | 2688 |
| 671 | Ga0495597_0000030 | 3300046542 | Bacteria | 134736 |
| 672 | Ga0495597_0000501 | 3300046542 | Bacteria | 32664 |
| 673 | Ga0495597_0002785 | 3300046542 | Bacteria | 10751 |
| 674 | Ga0495597_0092485 | 3300046542 | Bacteria | 1282 |
| 675 | Ga0495645_0001013 | 3300046543 | Bacteria | 19106 |
| 676 | Ga0495645_0177605 | 3300046543 | Bacteria | 1461 |
| 677 | Ga0495645_0245018 | 3300046543 | Bacteria | 1194 |
| 678 | Ga0495633_0005044 | 3300046558 | Bacteria | 8231 |
| 679 | Ga0495633_0008714 | 3300046558 | Bacteria | 5687 |
| 680 | Ga0495667_0119331 | 3300046559 | Bacteria | 1703 |
| 681 | Ga0495667_0215329 | 3300046559 | Bacteria | 1227 |
| 682 | Ga0495656_0009162 | 3300046615 | Bacteria | 3556 |
| 683 | Ga0495656_0037015 | 3300046615 | Bacteria | 2013 |
| 684 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 685 | Ga0495668_0000273 | 3300046616 | Bacteria | 72362 |
| 686 | Ga0495668_0000381 | 3300046616 | Bacteria | 58825 |
| 687 | Ga0495668_0000445 | 3300046616 | Bacteria | 52843 |
| 688 | Ga0495668_0008975 | 3300046616 | Bacteria | 6174 |
| 689 | Ga0495668_0020930 | 3300046616 | Bacteria | 3757 |
| 690 | Ga0495668_0071989 | 3300046616 | Bacteria | 1899 |
| 691 | Ga0495668_0127239 | 3300046616 | Bacteria | 1394 |
| 692 | Ga0495611_0000547 | 3300046648 | Bacteria | 22026 |
| 693 | Ga0495611_0001632 | 3300046648 | Bacteria | 10889 |
| 694 | Ga0495625_0000064 | 3300046660 | Bacteria | 174730 |
| 695 | Ga0495625_0002507 | 3300046660 | Bacteria | 19776 |
| 696 | Ga0495625_0003961 | 3300046660 | Bacteria | 14221 |
| 697 | Ga0495625_0004661 | 3300046660 | Bacteria | 12873 |
| 698 | Ga0495625_0005864 | 3300046660 | Bacteria | 11075 |
| 699 | Ga0495625_0013679 | 3300046660 | Bacteria | 6508 |
| 700 | Ga0495625_0054903 | 3300046660 | Bacteria | 2843 |
| 701 | Ga0495625_0103307 | 3300046660 | Bacteria | 1954 |
| 702 | Ga0495625_0184376 | 3300046660 | Bacteria | 1386 |
| 703 | Ga0495625_0200569 | 3300046660 | Unclassified | 1317 |
| 704 | Ga0495625_0223552 | 3300046660 | Bacteria | 1232 |
| 705 | Ga0495661_0000089 | 3300046665 | Bacteria | 110930 |
| 706 | Ga0495661_0001275 | 3300046665 | Bacteria | 21615 |
| 707 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 708 | Ga0495588_0020140 | 3300046674 | Bacteria | 3274 |
| 709 | Ga0495588_0057725 | 3300046674 | Bacteria | 2005 |
| 710 | Ga0495599_0012626 | 3300046678 | Bacteria | 5208 |
| 711 | Ga0495623_0006111 | 3300046679 | Bacteria | 7833 |
| 712 | Ga0495623_0088549 | 3300046679 | Bacteria | 1905 |
| 713 | Ga0495658_0285462 | 3300046683 | Bacteria | 1042 |
| 714 | Ga0495669_0000055 | 3300046684 | Bacteria | 78120 |
| 715 | Ga0495669_0009316 | 3300046684 | Bacteria | 4137 |
| 716 | Ga0495669_0035976 | 3300046684 | Bacteria | 2187 |
| 717 | Ga0495669_0056904 | 3300046684 | Bacteria | 1763 |
| 718 | Ga0495670_0000024 | 3300046691 | Bacteria | 91893 |
| 719 | Ga0495670_0007012 | 3300046691 | Bacteria | 5548 |
| 720 | Ga0495670_0019879 | 3300046691 | Bacteria | 3309 |
| 721 | Ga0495670_0048652 | 3300046691 | Bacteria | 2121 |
| 722 | Ga0495671_0000167 | 3300046692 | Bacteria | 57939 |
| 723 | Ga0495671_0000964 | 3300046692 | Bacteria | 20153 |
| 724 | Ga0495671_0003542 | 3300046692 | Bacteria | 9542 |
| 725 | Ga0495671_0037522 | 3300046692 | Bacteria | 2450 |
| 726 | Ga0495649_0000029 | 3300046694 | Bacteria | 162379 |
| 727 | Ga0495649_0060179 | 3300046694 | Bacteria | 2044 |
| 728 | Ga0495649_0067967 | 3300046694 | Bacteria | 1912 |
| 729 | Ga0495649_0074957 | 3300046694 | Bacteria | 1812 |
| 730 | Ga0495649_0090965 | 3300046694 | Bacteria | 1626 |
| 731 | Ga0495649_0091566 | 3300046694 | Bacteria | 1620 |
| 732 | Ga0495589_0000015 | 3300046794 | Bacteria | 224112 |
| 733 | Ga0495589_0000273 | 3300046794 | Bacteria | 42118 |
| 734 | Ga0495589_0000962 | 3300046794 | Bacteria | 17596 |
| 735 | Ga0495589_0010186 | 3300046794 | Bacteria | 4884 |
| 736 | Ga0495589_0021898 | 3300046794 | Bacteria | 3265 |
| 737 | Ga0495589_0022083 | 3300046794 | Bacteria | 3250 |
| 738 | Ga0495589_0071881 | 3300046794 | Bacteria | 1690 |
| 739 | Ga0495600_0063153 | 3300046809 | Bacteria | 2420 |
| 740 | Ga0495660_0000123 | 3300046810 | Bacteria | 84616 |
| 741 | Ga0495660_0004490 | 3300046810 | Bacteria | 8439 |
| 742 | Ga0495660_0004629 | 3300046810 | Bacteria | 8296 |
| 743 | Ga0495660_0004866 | 3300046810 | Bacteria | 8086 |
| 744 | Ga0495660_0006883 | 3300046810 | Bacteria | 6695 |
| 745 | Ga0495660_0028027 | 3300046810 | Bacteria | 3184 |
| 746 | Ga0495660_0061945 | 3300046810 | Bacteria | 2006 |
| 747 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 748 | Ga0495672_0000065 | 3300047320 | Bacteria | 193941 |
| 749 | Ga0495672_0000192 | 3300047320 | Bacteria | 87986 |
| 750 | Ga0495672_0011820 | 3300047320 | Bacteria | 6132 |
| 751 | Ga0495672_0015956 | 3300047320 | Bacteria | 5084 |
| 752 | Ga0495680_0099721 | 3300047322 | Bacteria | 2165 |
| 753 | Ga0495680_0256077 | 3300047322 | Bacteria | 1239 |
| 754 | Ga0495683_0000012 | 3300047323 | Bacteria | 205754 |
| 755 | Ga0495683_0018891 | 3300047323 | Bacteria | 3558 |
| 756 | Ga0495683_0096411 | 3300047323 | Bacteria | 1427 |
| 757 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 758 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 759 | Ga0495687_000067 | 3300047443 | Bacteria | 161372 |
| 760 | Ga0495687_000295 | 3300047443 | Bacteria | 65636 |
| 761 | Ga0495687_000691 | 3300047443 | Bacteria | 38250 |
| 762 | Ga0495687_009020 | 3300047443 | Bacteria | 5629 |
| 763 | Ga0495675_0084199 | 3300047444 | Bacteria | 2001 |
| 764 | Ga0495675_0143083 | 3300047444 | Bacteria | 1481 |
| 765 | Ga0495675_0203995 | 3300047444 | Bacteria | 1202 |
| 766 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 767 | Ga0495677_0001541 | 3300047445 | Bacteria | 9278 |
| 768 | Ga0495677_0002563 | 3300047445 | Bacteria | 7114 |
| 769 | Ga0495677_0006156 | 3300047445 | Bacteria | 4536 |
| 770 | Ga0495679_001202 | 3300047446 | Bacteria | 15376 |
| 771 | Ga0495679_018192 | 3300047446 | Bacteria | 2499 |
| 772 | Ga0495685_003676 | 3300047447 | Bacteria | 4903 |
| 773 | Ga0495681_0010866 | 3300047470 | Bacteria | 5477 |
| 774 | Ga0495681_0022082 | 3300047470 | Bacteria | 3413 |
| 775 | Ga0495684_0095976 | 3300047471 | Bacteria | 2244 |
| 776 | Ga0495686_0000015 | 3300047472 | Bacteria | 471703 |
| 777 | Ga0495686_0000190 | 3300047472 | Bacteria | 115114 |
| 778 | Ga0495686_0001315 | 3300047472 | Bacteria | 27861 |
| 779 | Ga0495686_0005278 | 3300047472 | Bacteria | 10255 |
| 780 | Ga0495686_0006246 | 3300047472 | Bacteria | 9174 |
| 781 | Ga0495686_0047006 | 3300047472 | Bacteria | 2726 |
| 782 | Ga0495686_0075680 | 3300047472 | Bacteria | 2064 |
| 783 | Ga0495686_0113247 | 3300047472 | Bacteria | 1624 |
| 784 | Ga0495686_0179706 | 3300047472 | Bacteria | 1226 |
| 785 | Ga0495686_0181944 | 3300047472 | Bacteria | 1217 |
| 786 | Ga0495602_0011369 | 3300048088 | Bacteria | 9207 |
| 787 | Ga0495626_0000020 | 3300048091 | Bacteria | 222537 |
| 788 | Ga0495626_0000089 | 3300048091 | Bacteria | 119565 |
| 789 | Ga0495626_0000200 | 3300048091 | Bacteria | 72580 |
| 790 | Ga0495626_0010985 | 3300048091 | Bacteria | 4805 |
| 791 | Ga0495626_0012037 | 3300048091 | Bacteria | 4552 |
| 792 | Ga0495626_0016945 | 3300048091 | Bacteria | 3691 |
| 793 | Ga0495626_0020349 | 3300048091 | Bacteria | 3308 |
| 794 | Ga0495626_0043483 | 3300048091 | Bacteria | 2106 |
| 795 | Ga0496100_0013476 | 3300048903 | Bacteria | 4717 |
| 796 | Ga0496102_0000033 | 3300048905 | Bacteria | 213952 |
| 797 | Ga0496102_0155105 | 3300048905 | Bacteria | 2153 |
| 798 | Ga0496102_0287028 | 3300048905 | Bacteria | 1551 |
| 799 | Ga0496103_0140655 | 3300048906 | Bacteria | 1543 |
| 800 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 801 | Ga0496104_0003936 | 3300048907 | Bacteria | 12849 |
| 802 | Ga0496105_0000016 | 3300048908 | Bacteria | 212909 |
| 803 | Ga0496105_0199239 | 3300048908 | Bacteria | 1634 |
| 804 | Ga0496106_0002387 | 3300048909 | Bacteria | 13993 |
| 805 | Ga0496106_0124162 | 3300048909 | Bacteria | 2020 |
| 806 | Ga0496106_0275900 | 3300048909 | Bacteria | 1346 |
| 807 | Ga0496106_0492369 | 3300048909 | Bacteria | 985 |
| 808 | Ga0496107_0032190 | 3300048910 | Bacteria | 3747 |
| 809 | Ga0496108_0079946 | 3300048911 | Bacteria | 2768 |
| 810 | Ga0496109_0191569 | 3300048912 | Bacteria | 1922 |
| 811 | Ga0496109_0245069 | 3300048912 | Bacteria | 1687 |
| 812 | Ga0496110_0022464 | 3300048913 | Bacteria | 5357 |
| 813 | Ga0496110_0206371 | 3300048913 | Bacteria | 1786 |
| 814 | Ga0496112_0215924 | 3300048915 | Bacteria | 1874 |
| 815 | Ga0496113_0039244 | 3300048916 | Bacteria | 3484 |
| 816 | Ga0496113_0191476 | 3300048916 | Bacteria | 1623 |
| 817 | Ga0496114_0003632 | 3300048917 | Bacteria | 11866 |
| 818 | Ga0496114_0271751 | 3300048917 | Bacteria | 1494 |
| 819 | Ga0496115_0334092 | 3300048918 | Bacteria | 1238 |
| 820 | Ga0496116_0000757 | 3300048919 | Bacteria | 41050 |
| 821 | Ga0496116_0028644 | 3300048919 | Bacteria | 4030 |
| 822 | Ga0496117_0000065 | 3300048920 | Bacteria | 254215 |
| 823 | Ga0496117_0000575 | 3300048920 | Bacteria | 60272 |
| 824 | Ga0496117_0060828 | 3300048920 | Bacteria | 2600 |
| 825 | Ga0496118_0000033 | 3300048921 | Bacteria | 326357 |
| 826 | Ga0496118_0000382 | 3300048921 | Bacteria | 74559 |
| 827 | Ga0496118_0000557 | 3300048921 | Bacteria | 61344 |
| 828 | Ga0496118_0036397 | 3300048921 | Bacteria | 3980 |
| 829 | Ga0496119_0009436 | 3300048922 | Bacteria | 8376 |
| 830 | Ga0496120_0027380 | 3300048923 | Bacteria | 3507 |
| 831 | Ga0496120_0119949 | 3300048923 | Bacteria | 1361 |
| 832 | Ga0496121_0002039 | 3300048924 | Bacteria | 31980 |
| 833 | Ga0496121_0046256 | 3300048924 | Bacteria | 3727 |
| 834 | Ga0496122_0001066 | 3300048925 | Bacteria | 47710 |
| 835 | Ga0496122_0001384 | 3300048925 | Bacteria | 39329 |
| 836 | Ga0496122_0004104 | 3300048925 | Bacteria | 18449 |
| 837 | Ga0496122_0033396 | 3300048925 | Bacteria | 4233 |
| 838 | Ga0496123_0000419 | 3300048926 | Bacteria | 77130 |
| 839 | Ga0496123_0005245 | 3300048926 | Bacteria | 13162 |
| 840 | Ga0496123_0008591 | 3300048926 | Bacteria | 9354 |
| 841 | Ga0496123_0014468 | 3300048926 | Bacteria | 6537 |
| 842 | Ga0496123_0017267 | 3300048926 | Bacteria | 5816 |
| 843 | Ga0496124_0000569 | 3300048927 | Bacteria | 62485 |
| 844 | Ga0496124_0003340 | 3300048927 | Bacteria | 19750 |
| 845 | Ga0496124_0006729 | 3300048927 | Bacteria | 12432 |
| 846 | Ga0496124_0008940 | 3300048927 | Bacteria | 10378 |
| 847 | Ga0496124_0009726 | 3300048927 | Bacteria | 9842 |
| 848 | Ga0496124_0016760 | 3300048927 | Bacteria | 6948 |
| 849 | Ga0496124_0024820 | 3300048927 | Bacteria | 5442 |
| 850 | Ga0496124_0037080 | 3300048927 | Bacteria | 4244 |
| 851 | Ga0496124_0061645 | 3300048927 | Bacteria | 3143 |
| 852 | Ga0496124_0076307 | 3300048927 | Bacteria | 2767 |
| 853 | Ga0496124_0089965 | 3300048927 | Bacteria | 2505 |
| 854 | Ga0496124_0197905 | 3300048927 | Bacteria | 1531 |
| 855 | Ga0496124_0245160 | 3300048927 | Bacteria | 1329 |
| 856 | Ga0496125_0004414 | 3300048928 | Bacteria | 16254 |
| 857 | Ga0496125_0012558 | 3300048928 | Bacteria | 8395 |
| 858 | Ga0496125_0038358 | 3300048928 | Bacteria | 4148 |
| 859 | Ga0496126_0003368 | 3300048929 | Bacteria | 20267 |
| 860 | Ga0496126_0016900 | 3300048929 | Bacteria | 7280 |
| 861 | Ga0496126_0079388 | 3300048929 | Bacteria | 2905 |
| 862 | Ga0496126_0321628 | 3300048929 | Bacteria | 1271 |
| 863 | Ga0495678_000015 | 3300049459 | Bacteria | 309544 |
| 864 | Ga0495678_000178 | 3300049459 | Bacteria | 73165 |
| 865 | Ga0495678_003372 | 3300049459 | Bacteria | 9942 |
| 866 | Ga0495678_006425 | 3300049459 | Bacteria | 6253 |
| 867 | Ga0495678_016551 | 3300049459 | Bacteria | 3367 |
| 868 | Ga0495682_0000248 | 3300049460 | Bacteria | 42769 |
| 869 | Ga0495682_0006111 | 3300049460 | Bacteria | 4910 |
| 870 | Ga0501031_0107988 | 3300049568 | Bacteria | 1817 |
| 871 | Ga0501032_0019857 | 3300049569 | Bacteria | 4691 |
| 872 | Ga0501032_0368075 | 3300049569 | Bacteria | 925 |
| 873 | Ga0501034_0106416 | 3300049571 | Bacteria | 2798 |
| 874 | Ga0501034_0393371 | 3300049571 | Bacteria | 1310 |
| 875 | Ga0501037_0088170 | 3300049573 | Bacteria | 2245 |
| 876 | Ga0501038_0175998 | 3300049574 | Bacteria | 1729 |
| 877 | Ga0501038_0254452 | 3300049574 | Bacteria | 1390 |
| 878 | Ga0501039_0018765 | 3300049575 | Bacteria | 5308 |
| 879 | Ga0501043_0257407 | 3300049579 | Bacteria | 1343 |
| 880 | Ga0501046_0008689 | 3300049580 | Bacteria | 8829 |
| 881 | Ga0501046_0080098 | 3300049580 | Bacteria | 2524 |
| 882 | Ga0501046_0114398 | 3300049580 | Bacteria | 2058 |
| 883 | Ga0501046_0188502 | 3300049580 | Bacteria | 1539 |
| 884 | Ga0501047_0006271 | 3300049581 | Bacteria | 11177 |
| 885 | Ga0501047_0294483 | 3300049581 | Bacteria | 1466 |
| 886 | Ga0501047_0319198 | 3300049581 | Bacteria | 1393 |
| 887 | Ga0501069_0031520 | 3300049585 | Bacteria | 2916 |
| 888 | Ga0501035_0001876 | 3300049822 | Bacteria | 21173 |
| 889 | Ga0501035_0026768 | 3300049822 | Bacteria | 5274 |
| 890 | Ga0501035_0207431 | 3300049822 | Bacteria | 1678 |
| 891 | Ga0501044_0021716 | 3300049823 | Bacteria | 6843 |
| 892 | Ga0501044_0293691 | 3300049823 | Bacteria | 1556 |
| 893 | nmdc:mga0yw44_3099_c1 | 3300050492 | Bacteria | 7287 |
| 894 | nmdc:mga0k408_195565_c1 | 3300050493 | Bacteria | 1207 |
| 895 | nmdc:mga07m45_278_c2 | 3300050496 | Bacteria | 17340 |
| 896 | nmdc:mga05p37_154864_c1 | 3300050507 | Bacteria | 2801 |
| 897 | nmdc:mga0qj67_9414_c1 | 3300050509 | Bacteria | 7268 |
| 898 | nmdc:mga06r32_67633_c1 | 3300050510 | Bacteria | 3450 |
| 899 | nmdc:mga08y16_130970_c1 | 3300050511 | Bacteria | 2608 |
| 900 | nmdc:mga08y16_428604_c1 | 3300050511 | Bacteria | 1351 |
| 901 | nmdc:mga0n895_3166_c1 | 3300050512 | Bacteria | 13149 |
| 902 | nmdc:mga0n895_32315_c1 | 3300050512 | Bacteria | 5022 |
| 903 | nmdc:mga0rr50_277413_c1 | 3300050513 | Bacteria | 1398 |
| 904 | nmdc:mga0rr50_46200_c1 | 3300050513 | Bacteria | 3205 |
| 905 | nmdc:mga0a205_33903_c1 | 3300050515 | Bacteria | 4896 |
| 906 | nmdc:mga0a205_5464_c1 | 3300050515 | Bacteria | 11447 |
| 907 | nmdc:mga0sz30_7450_c1 | 3300050516 | Bacteria | 3022 |
| 908 | Ga0495601_0123986 | 3300053077 | Bacteria | 1680 |
| 909 | Ga0500578_0000082 | 3300053086 | Bacteria | 105580 |
| 910 | Ga0500643_000546 | 3300053087 | Bacteria | 26277 |
| 911 | Ga0500644_0128314 | 3300053088 | Bacteria | 996 |
| 912 | Ga0500583_0002256 | 3300053092 | Bacteria | 5744 |
| 913 | Ga0500651_0146350 | 3300053093 | Bacteria | 1421 |
| 914 | Ga0500554_006504 | 3300053102 | Bacteria | 2625 |
| 915 | Ga0500594_0000209 | 3300053118 | Bacteria | 14427 |
| 916 | Ga0500595_001147 | 3300053119 | Bacteria | 14712 |
| 917 | Ga0500608_000348 | 3300053122 | Bacteria | 17856 |
| 918 | Ga0500626_005836 | 3300053128 | Bacteria | 4848 |
| 919 | Ga0500658_0005963 | 3300053134 | Bacteria | 4531 |
| 920 | Ga0500559_0004275 | 3300053136 | Bacteria | 6835 |
| 921 | Ga0500559_0009071 | 3300053136 | Bacteria | 4323 |
| 922 | Ga0500559_0009670 | 3300053136 | Bacteria | 4164 |
| 923 | Ga0500559_0112836 | 3300053136 | Bacteria | 1260 |
| 924 | Ga0500604_0006147 | 3300053151 | Bacteria | 3172 |
| 925 | Ga0500616_0007463 | 3300053153 | Bacteria | 6941 |
| 926 | Ga0500622_0001253 | 3300053156 | Bacteria | 20749 |
| 927 | Ga0500622_0022344 | 3300053156 | Bacteria | 3354 |
| 928 | Ga0500622_0026816 | 3300053156 | Bacteria | 3038 |
| 929 | Ga0500622_0041519 | 3300053156 | Bacteria | 2394 |
| 930 | Ga0500627_0045944 | 3300053158 | Bacteria | 1892 |
| 931 | Ga0466962_0002261 | 3300061719 | Bacteria | 9125 |
| 932 | Ga0466962_0002967 | 3300061719 | Bacteria | 8093 |
| 933 | Ga0466962_0019410 | 3300061719 | Bacteria | 3266 |
| 934 | Ga0466962_0032872 | 3300061719 | Bacteria | 2482 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10000199 | Ga0070658_1000019929 | 261 |
| 2 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002706 | 261 |
| 3 | 3300045976 | Ga0466967_0036968 | Ga0466967_0036968_3319_4155 | 269 |
| 4 | iso_pu_bacteria | 2643221577 | 2643895563 | 283 |
| 5 | iso_pu_bacteria | 2643221685 | 2644477745 | 283 |
| 6 | 3300009176 | Ga0105242_10443690 | Ga0105242_104436902 | 287 |
| 7 | 3300049569 | Ga0501032_0368075 | Ga0501032_0368075_23_886 | 287 |
| 8 | 3300046694 | Ga0495649_0060179 | Ga0495649_0060179_1135_2031 | 291 |
| 9 | 3300048922 | Ga0496119_0009436 | Ga0496119_0009436_6286_7182 | 291 |
| 10 | 3300048923 | Ga0496120_0027380 | Ga0496120_0027380_1036_1932 | 291 |
| 11 | 3300048924 | Ga0496121_0046256 | Ga0496121_0046256_1487_2383 | 291 |
| 12 | 3300048928 | Ga0496125_0012558 | Ga0496125_0012558_6464_7360 | 291 |
| 13 | 3300048929 | Ga0496126_0016900 | Ga0496126_0016900_5424_6320 | 291 |
| 14 | 3300005339 | Ga0070660_100000665 | Ga0070660_1000006656 | 294 |
| 15 | 3300005366 | Ga0070659_100004192 | Ga0070659_1000041927 | 294 |
| 16 | 3300025919 | Ga0207657_10001150 | Ga0207657_100011506 | 294 |
| 17 | 3300025932 | Ga0207690_10001754 | Ga0207690_100017548 | 294 |
| 18 | 3300046522 | Ga0495643_0198176 | Ga0495643_0198176_29_922 | 297 |
| 19 | 3300046683 | Ga0495658_0285462 | Ga0495658_0285462_107_1021 | 297 |
| 20 | 3300053088 | Ga0500644_0128314 | Ga0500644_0128314_19_918 | 297 |
| 21 | 3300042010 | Ga0439452_025717 | Ga0439452_025717_10_906 | 298 |
| 22 | 3300049571 | Ga0501034_0393371 | Ga0501034_0393371_12_908 | 298 |
| 23 | 3300025913 | Ga0207695_10022428 | Ga0207695_100224284 | 301 |
| 24 | 3300025914 | Ga0207671_10020155 | Ga0207671_100201553 | 301 |
| 25 | 3300009094 | Ga0111539_10014312 | Ga0111539_100143129 | 303 |
| 26 | 3300031731 | Ga0307405_10002816 | Ga0307405_100028162 | 303 |
| 27 | 3300031852 | Ga0307410_10028523 | Ga0307410_100285234 | 303 |
| 28 | 3300031903 | Ga0307407_10021778 | Ga0307407_100217784 | 303 |
| 29 | 3300031995 | Ga0307409_100034119 | Ga0307409_1000341193 | 303 |
| 30 | 3300032002 | Ga0307416_100000858 | Ga0307416_1000008588 | 303 |
| 31 | 3300041408 | Ga0439453_0021431 | Ga0439453_0021431_102_1037 | 303 |
| 32 | 3300042003 | Ga0439443_001810 | Ga0439443_001810_829_1764 | 303 |
| 33 | 3300042122 | Ga0450920_017547 | Ga0450920_017547_98_1033 | 303 |
| 34 | 3300042156 | Ga0439446_0012684 | Ga0439446_0012684_1156_2091 | 303 |
| 35 | 3300042435 | Ga0439434_0003947 | Ga0439434_0003947_2975_3910 | 303 |
| 36 | 3300046691 | Ga0495670_0000024 | Ga0495670_0000024_29224_30177 | 303 |
| 37 | 3300025914 | Ga0207671_10336798 | Ga0207671_103367982 | 311 |
| 38 | 3300044684 | Ga0466966_0070296 | Ga0466966_0070296_618_1676 | 311 |
| 39 | 3300046692 | Ga0495671_0037522 | Ga0495671_0037522_41_1021 | 311 |
| 40 | 3300031456 | Ga0307513_10186899 | Ga0307513_101868992 | 314 |
| 41 | 3300046506 | Ga0495583_0006233 | Ga0495583_0006233_698_1675 | 314 |
| 42 | 3300046528 | Ga0495642_0130266 | Ga0495642_0130266_128_1072 | 314 |
| 43 | 3300046616 | Ga0495668_0020930 | Ga0495668_0020930_560_1537 | 314 |
| 44 | 3300046660 | Ga0495625_0004661 | Ga0495625_0004661_5856_6833 | 314 |
| 45 | 3300053136 | Ga0500559_0112836 | Ga0500559_0112836_80_1057 | 314 |
| 46 | 3300021384 | Ga0213876_10000178 | Ga0213876_100001784 | 315 |
| 47 | 3300039437 | Ga0436365_1679154 | Ga0436365_1679154_13878_14900 | 315 |
| 48 | 3300048927 | Ga0496124_0016760 | Ga0496124_0016760_5388_6335 | 315 |
| 49 | 3300031548 | Ga0307408_100004051 | Ga0307408_1000040517 | 316 |
| 50 | 3300048909 | Ga0496106_0492369 | Ga0496106_0492369_15_974 | 319 |
| 51 | 3300005329 | Ga0070683_100034599 | Ga0070683_1000345993 | 320 |
| 52 | 3300005336 | Ga0070680_100114992 | Ga0070680_1001149922 | 320 |
| 53 | 3300005436 | Ga0070713_100038870 | Ga0070713_1000388702 | 320 |
| 54 | 3300005530 | Ga0070679_100095255 | Ga0070679_1000952552 | 320 |
| 55 | 3300005577 | Ga0068857_100277425 | Ga0068857_1002774252 | 320 |
| 56 | 3300025912 | Ga0207707_10161757 | Ga0207707_101617572 | 320 |
| 57 | 3300025917 | Ga0207660_10137755 | Ga0207660_101377552 | 320 |
| 58 | 3300025944 | Ga0207661_10056936 | Ga0207661_100569362 | 320 |
| 59 | 3300053119 | Ga0500595_001147 | Ga0500595_001147_3304_4281 | 320 |
| 60 | 3300037418 | Ga0395900_0033672 | Ga0395900_0033672_1346_2383 | 322 |
| 61 | 3300037471 | Ga0395905_0007563 | Ga0395905_0007563_7016_8053 | 322 |
| 62 | 3300053093 | Ga0500651_0146350 | Ga0500651_0146350_204_1211 | 322 |
| 63 | 3300003781 | Ga0055536_1001570 | Ga0055536_10015705 | 323 |
| 64 | 3300003791 | Ga0055530_10002027 | Ga0055530_100020275 | 323 |
| 65 | 3300009147 | Ga0114129_10061810 | Ga0114129_100618104 | 323 |
| 66 | 3300025292 | Ga0209676_1000253 | Ga0209676_100025312 | 323 |
| 67 | 3300025298 | Ga0209050_1000649 | Ga0209050_100064917 | 323 |
| 68 | 3300025303 | Ga0209051_1002524 | Ga0209051_100252413 | 323 |
| 69 | 3300025304 | Ga0209257_1007938 | Ga0209257_10079385 | 323 |
| 70 | 3300050507 | nmdc:mga05p37_154864_c1 | nmdc:mga05p37_154864_c1_572_1594 | 323 |
| 71 | 3300053087 | Ga0500643_000546 | Ga0500643_000546_6816_7826 | 323 |
| 72 | 3300005548 | Ga0070665_100101390 | Ga0070665_1001013902 | 324 |
| 73 | 3300037418 | Ga0395900_0218988 | Ga0395900_0218988_18_1046 | 324 |
| 74 | 3300037466 | Ga0395898_0017081 | Ga0395898_0017081_3231_4259 | 324 |
| 75 | 3300005439 | Ga0070711_100099275 | Ga0070711_1000992752 | 325 |
| 76 | 3300005548 | Ga0070665_100049336 | Ga0070665_1000493363 | 325 |
| 77 | 3300033180 | Ga0307510_10126663 | Ga0307510_101266632 | 325 |
| 78 | 3300035119 | Ga0373956_0063969 | Ga0373956_0063969_157_1155 | 325 |
| 79 | 3300046660 | Ga0495625_0005864 | Ga0495625_0005864_1318_2337 | 325 |
| 80 | 3300048903 | Ga0496100_0013476 | Ga0496100_0013476_210_1208 | 325 |
| 81 | 3300048907 | Ga0496104_0003936 | Ga0496104_0003936_4287_5285 | 325 |
| 82 | 3300048908 | Ga0496105_0199239 | Ga0496105_0199239_395_1393 | 325 |
| 83 | 3300048917 | Ga0496114_0003632 | Ga0496114_0003632_4445_5443 | 325 |
| 84 | 3300053077 | Ga0495601_0123986 | Ga0495601_0123986_448_1446 | 325 |
| 85 | 3300003320 | rootH2_10155199 | rootH2_101551992 | 326 |
| 86 | 3300005548 | Ga0070665_100022797 | Ga0070665_1000227973 | 326 |
| 87 | 3300005617 | Ga0068859_100344749 | Ga0068859_1003447492 | 326 |
| 88 | 3300006931 | Ga0097620_100344768 | Ga0097620_1003447682 | 326 |
| 89 | 3300025913 | Ga0207695_10067718 | Ga0207695_100677182 | 326 |
| 90 | 3300028016 | Ga0265354_1000560 | Ga0265354_10005604 | 326 |
| 91 | 3300028379 | Ga0268266_10014895 | Ga0268266_100148954 | 326 |
| 92 | 3300028379 | Ga0268266_10147209 | Ga0268266_101472092 | 326 |
| 93 | 3300030878 | Ga0265770_1000540 | Ga0265770_10005404 | 326 |
| 94 | 3300044656 | Ga0466969_0124756 | Ga0466969_0124756_18_1043 | 326 |
| 95 | 3300044693 | Ga0466961_0166085 | Ga0466961_0166085_230_1255 | 326 |
| 96 | 3300046471 | Ga0495650_0034354 | Ga0495650_0034354_688_1689 | 326 |
| 97 | iso_pu_bacteria | 2582581279 | 2585147602 | 326 |
| 98 | 3300005548 | Ga0070665_100000894 | Ga0070665_10000089410 | 327 |
| 99 | 3300009093 | Ga0105240_10097332 | Ga0105240_100973321 | 327 |
| 100 | 3300010375 | Ga0105239_10009730 | Ga0105239_100097304 | 327 |
| 101 | 3300013297 | Ga0157378_10219689 | Ga0157378_102196892 | 327 |
| 102 | 3300025913 | Ga0207695_10070174 | Ga0207695_100701741 | 327 |
| 103 | 3300028379 | Ga0268266_10001496 | Ga0268266_100014963 | 327 |
| 104 | 3300028380 | Ga0268265_10025414 | Ga0268265_100254143 | 327 |
| 105 | 3300045976 | Ga0466967_0065033 | Ga0466967_0065033_1625_2629 | 327 |
| 106 | 3300046500 | Ga0495596_0002734 | Ga0495596_0002734_5478_6509 | 327 |
| 107 | 3300046518 | Ga0495631_0011820 | Ga0495631_0011820_1848_2879 | 327 |
| 108 | 3300046694 | Ga0495649_0074957 | Ga0495649_0074957_666_1667 | 327 |
| 109 | 3300047445 | Ga0495677_0002563 | Ga0495677_0002563_4511_5542 | 327 |
| 110 | 3300048929 | Ga0496126_0003368 | Ga0496126_0003368_896_1903 | 327 |
| 111 | 3300005290 | Ga0065712_10111141 | Ga0065712_101111411 | 328 |
| 112 | 3300005295 | Ga0065707_10081991 | Ga0065707_1008199115 | 328 |
| 113 | 3300005330 | Ga0070690_100027170 | Ga0070690_1000271703 | 328 |
| 114 | 3300005340 | Ga0070689_100050000 | Ga0070689_1000500004 | 328 |
| 115 | 3300005354 | Ga0070675_100166202 | Ga0070675_1001662022 | 328 |
| 116 | 3300005459 | Ga0068867_100069424 | Ga0068867_1000694242 | 328 |
| 117 | 3300005547 | Ga0070693_100001654 | Ga0070693_1000016549 | 328 |
| 118 | 3300005719 | Ga0068861_100008866 | Ga0068861_1000088663 | 328 |
| 119 | 3300005842 | Ga0068858_100085691 | Ga0068858_1000856913 | 328 |
| 120 | 3300006237 | Ga0097621_100076899 | Ga0097621_1000768992 | 328 |
| 121 | 3300006237 | Ga0097621_100206386 | Ga0097621_1002063863 | 328 |
| 122 | 3300006358 | Ga0068871_100054443 | Ga0068871_1000544433 | 328 |
| 123 | 3300006358 | Ga0068871_100121153 | Ga0068871_1001211532 | 328 |
| 124 | 3300009093 | Ga0105240_10001162 | Ga0105240_100011623 | 328 |
| 125 | 3300009093 | Ga0105240_10319213 | Ga0105240_103192132 | 328 |
| 126 | 3300009098 | Ga0105245_10114724 | Ga0105245_101147243 | 328 |
| 127 | 3300009176 | Ga0105242_10027366 | Ga0105242_100273663 | 328 |
| 128 | 3300009176 | Ga0105242_10332237 | Ga0105242_103322371 | 328 |
| 129 | 3300009177 | Ga0105248_10041522 | Ga0105248_100415225 | 328 |
| 130 | 3300009177 | Ga0105248_10100561 | Ga0105248_101005613 | 328 |
| 131 | 3300009545 | Ga0105237_10017953 | Ga0105237_100179533 | 328 |
| 132 | 3300009545 | Ga0105237_10407828 | Ga0105237_104078281 | 328 |
| 133 | 3300009553 | Ga0105249_10088876 | Ga0105249_100888762 | 328 |
| 134 | 3300010375 | Ga0105239_10202440 | Ga0105239_102024402 | 328 |
| 135 | 3300013296 | Ga0157374_10047556 | Ga0157374_100475562 | 328 |
| 136 | 3300013296 | Ga0157374_10212371 | Ga0157374_102123712 | 328 |
| 137 | 3300013297 | Ga0157378_10096164 | Ga0157378_100961643 | 328 |
| 138 | 3300013297 | Ga0157378_10295180 | Ga0157378_102951802 | 328 |
| 139 | 3300013307 | Ga0157372_10250363 | Ga0157372_102503632 | 328 |
| 140 | 3300014326 | Ga0157380_10000779 | Ga0157380_1000077916 | 328 |
| 141 | 3300014969 | Ga0157376_10111488 | Ga0157376_101114883 | 328 |
| 142 | 3300025934 | Ga0207686_10030398 | Ga0207686_100303983 | 328 |
| 143 | 3300025936 | Ga0207670_10026013 | Ga0207670_100260134 | 328 |
| 144 | 3300025941 | Ga0207711_10147227 | Ga0207711_101472272 | 328 |
| 145 | 3300025949 | Ga0207667_10005682 | Ga0207667_100056826 | 328 |
| 146 | 3300026035 | Ga0207703_10014632 | Ga0207703_100146323 | 328 |
| 147 | 3300026089 | Ga0207648_10197105 | Ga0207648_101971052 | 328 |
| 148 | 3300028666 | Ga0265336_10000032 | Ga0265336_10000032114 | 328 |
| 149 | 3300031730 | Ga0307516_10037833 | Ga0307516_100378332 | 328 |
| 150 | 3300035172 | Ga0373955_0163715 | Ga0373955_0163715_60_1067 | 328 |
| 151 | 3300035692 | Ga0373935_0187458 | Ga0373935_0187458_151_1158 | 328 |
| 152 | 3300036401 | Ga0373937_0066429 | Ga0373937_0066429_1784_2791 | 328 |
| 153 | 3300044683 | Ga0466965_0015567 | Ga0466965_0015567_1480_2466 | 328 |
| 154 | 3300046454 | Ga0495592_0108804 | Ga0495592_0108804_688_1695 | 328 |
| 155 | 3300046460 | Ga0495638_0001264 | Ga0495638_0001264_11335_12357 | 328 |
| 156 | 3300046462 | Ga0495651_0191254 | Ga0495651_0191254_366_1373 | 328 |
| 157 | 3300046511 | Ga0495608_0248269 | Ga0495608_0248269_62_1069 | 328 |
| 158 | 3300046529 | Ga0495652_0190946 | Ga0495652_0190946_367_1374 | 328 |
| 159 | 3300046543 | Ga0495645_0001013 | Ga0495645_0001013_17716_18723 | 328 |
| 160 | 3300046559 | Ga0495667_0119331 | Ga0495667_0119331_155_1162 | 328 |
| 161 | 3300046660 | Ga0495625_0002507 | Ga0495625_0002507_53_1075 | 328 |
| 162 | 3300046660 | Ga0495625_0013679 | Ga0495625_0013679_636_1637 | 328 |
| 163 | 3300046678 | Ga0495599_0012626 | Ga0495599_0012626_3417_4424 | 328 |
| 164 | 3300046679 | Ga0495623_0088549 | Ga0495623_0088549_20_1027 | 328 |
| 165 | 3300046809 | Ga0495600_0063153 | Ga0495600_0063153_822_1829 | 328 |
| 166 | 3300047322 | Ga0495680_0256077 | Ga0495680_0256077_188_1195 | 328 |
| 167 | 3300047444 | Ga0495675_0143083 | Ga0495675_0143083_101_1108 | 328 |
| 168 | 3300047471 | Ga0495684_0095976 | Ga0495684_0095976_682_1689 | 328 |
| 169 | 3300053102 | Ga0500554_006504 | Ga0500554_006504_849_1856 | 328 |
| 170 | iso_pu_bacteria | 2599185354 | 2600201619 | 328 |
| 171 | iso_pu_bacteria | 2751185897 | 2753763294 | 328 |
| 172 | iso_pu_bacteria | 2857504554 | 2857506101 | 328 |
| 173 | 3300005458 | Ga0070681_10054150 | Ga0070681_100541504 | 329 |
| 174 | 3300005578 | Ga0068854_100321989 | Ga0068854_1003219892 | 329 |
| 175 | 3300005843 | Ga0068860_100168308 | Ga0068860_1001683082 | 329 |
| 176 | 3300025912 | Ga0207707_10059893 | Ga0207707_100598934 | 329 |
| 177 | 3300025986 | Ga0207658_10156895 | Ga0207658_101568952 | 329 |
| 178 | 3300028381 | Ga0268264_10158773 | Ga0268264_101587732 | 329 |
| 179 | 3300028794 | Ga0307515_10041594 | Ga0307515_100415944 | 329 |
| 180 | 3300031730 | Ga0307516_10000068 | Ga0307516_1000006891 | 329 |
| 181 | 3300044684 | Ga0466966_0003676 | Ga0466966_0003676_7646_8722 | 329 |
| 182 | 3300044765 | Ga0466970_0009285 | Ga0466970_0009285_896_1972 | 329 |
| 183 | 3300046471 | Ga0495650_0040080 | Ga0495650_0040080_253_1260 | 329 |
| 184 | 3300046518 | Ga0495631_0003414 | Ga0495631_0003414_405_1412 | 329 |
| 185 | 3300047472 | Ga0495686_0001315 | Ga0495686_0001315_972_1979 | 329 |
| 186 | 3300048905 | Ga0496102_0287028 | Ga0496102_0287028_18_1007 | 329 |
| 187 | 3300049459 | Ga0495678_006425 | Ga0495678_006425_4736_5743 | 329 |
| 188 | 3300050493 | nmdc:mga0k408_195565_c1 | nmdc:mga0k408_195565_c1_14_1027 | 329 |
| 189 | 3300053118 | Ga0500594_0000209 | Ga0500594_0000209_3754_4761 | 329 |
| 190 | 3300053156 | Ga0500622_0001253 | Ga0500622_0001253_9516_10523 | 329 |
| 191 | 3300061719 | Ga0466962_0002261 | Ga0466962_0002261_4914_5990 | 329 |
| 192 | iso_pu_bacteria | 2852649853 | 2852650722 | 329 |
| 193 | iso_pu_bacteria | 2939589442 | 2939591635 | 329 |
| 194 | 3300005335 | Ga0070666_10108357 | Ga0070666_101083572 | 330 |
| 195 | 3300005338 | Ga0068868_100017884 | Ga0068868_1000178842 | 330 |
| 196 | 3300005355 | Ga0070671_100028749 | Ga0070671_1000287493 | 330 |
| 197 | 3300005364 | Ga0070673_100043679 | Ga0070673_1000436793 | 330 |
| 198 | 3300005563 | Ga0068855_100001261 | Ga0068855_10000126119 | 330 |
| 199 | 3300005578 | Ga0068854_100086291 | Ga0068854_1000862911 | 330 |
| 200 | 3300005618 | Ga0068864_100081378 | Ga0068864_1000813782 | 330 |
| 201 | 3300005843 | Ga0068860_100042046 | Ga0068860_1000420462 | 330 |
| 202 | 3300009101 | Ga0105247_10066340 | Ga0105247_100663402 | 330 |
| 203 | 3300013104 | Ga0157370_10485222 | Ga0157370_104852221 | 330 |
| 204 | 3300013105 | Ga0157369_10083491 | Ga0157369_100834913 | 330 |
| 205 | 3300025903 | Ga0207680_10142096 | Ga0207680_101420962 | 330 |
| 206 | 3300025933 | Ga0207706_10076169 | Ga0207706_100761692 | 330 |
| 207 | 3300025949 | Ga0207667_10000116 | Ga0207667_10000116110 | 330 |
| 208 | 3300025960 | Ga0207651_10092619 | Ga0207651_100926192 | 330 |
| 209 | 3300026088 | Ga0207641_10272584 | Ga0207641_102725842 | 330 |
| 210 | 3300031456 | Ga0307513_10159844 | Ga0307513_101598442 | 330 |
| 211 | 3300036401 | Ga0373937_0273019 | Ga0373937_0273019_476_1507 | 330 |
| 212 | 3300046455 | Ga0495603_0047497 | Ga0495603_0047497_912_1919 | 330 |
| 213 | 3300046460 | Ga0495638_0000660 | Ga0495638_0000660_2548_3552 | 330 |
| 214 | 3300046474 | Ga0495605_0048460 | Ga0495605_0048460_389_1396 | 330 |
| 215 | 3300046512 | Ga0495610_0002794 | Ga0495610_0002794_6229_7233 | 330 |
| 216 | 3300046513 | Ga0495616_0000709 | Ga0495616_0000709_22950_23957 | 330 |
| 217 | 3300046518 | Ga0495631_0006009 | Ga0495631_0006009_2870_3877 | 330 |
| 218 | 3300046519 | Ga0495632_0000024 | Ga0495632_0000024_25230_26237 | 330 |
| 219 | 3300046528 | Ga0495642_0000041 | Ga0495642_0000041_74588_75595 | 330 |
| 220 | 3300046528 | Ga0495642_0118581 | Ga0495642_0118581_26_1048 | 330 |
| 221 | 3300046529 | Ga0495652_0274500 | Ga0495652_0274500_91_1098 | 330 |
| 222 | 3300046530 | Ga0495654_0029926 | Ga0495654_0029926_281_1288 | 330 |
| 223 | 3300046543 | Ga0495645_0177605 | Ga0495645_0177605_334_1341 | 330 |
| 224 | 3300046665 | Ga0495661_0001275 | Ga0495661_0001275_16683_17690 | 330 |
| 225 | 3300046674 | Ga0495588_0057725 | Ga0495588_0057725_170_1177 | 330 |
| 226 | 3300046684 | Ga0495669_0000055 | Ga0495669_0000055_10033_11040 | 330 |
| 227 | 3300046692 | Ga0495671_0000167 | Ga0495671_0000167_42687_43694 | 330 |
| 228 | 3300049460 | Ga0495682_0006111 | Ga0495682_0006111_1664_2671 | 330 |
| 229 | 3300053086 | Ga0500578_0000082 | Ga0500578_0000082_68045_69049 | 330 |
| 230 | 3300053156 | Ga0500622_0041519 | Ga0500622_0041519_896_1891 | 330 |
| 231 | iso_pu_bacteria | 2643221663 | 2644354469 | 330 |
| 232 | 3300002067 | JGI24735J21928_10001233 | JGI24735J21928_100012333 | 331 |
| 233 | 3300003215 | JGI25153J46596_10023669 | JGI25153J46596_100236692 | 331 |
| 234 | 3300003320 | rootH2_10180229 | rootH2_101802291 | 331 |
| 235 | 3300003775 | Ga0055524_1005546 | Ga0055524_10055461 | 331 |
| 236 | 3300003790 | Ga0055528_1008032 | Ga0055528_10080322 | 331 |
| 237 | 3300005262 | Ga0065165_1049412 | Ga0065165_10494121 | 331 |
| 238 | 3300005339 | Ga0070660_100015100 | Ga0070660_1000151002 | 331 |
| 239 | 3300005435 | Ga0070714_100237003 | Ga0070714_1002370032 | 331 |
| 240 | 3300005457 | Ga0070662_100132406 | Ga0070662_1001324063 | 331 |
| 241 | 3300005458 | Ga0070681_10002376 | Ga0070681_100023767 | 331 |
| 242 | 3300005530 | Ga0070679_100080023 | Ga0070679_1000800232 | 331 |
| 243 | 3300005530 | Ga0070679_100263932 | Ga0070679_1002639322 | 331 |
| 244 | 3300005530 | Ga0070679_100291015 | Ga0070679_1002910152 | 331 |
| 245 | 3300005539 | Ga0068853_100064349 | Ga0068853_1000643492 | 331 |
| 246 | 3300005548 | Ga0070665_100002017 | Ga0070665_10000201719 | 331 |
| 247 | 3300005563 | Ga0068855_100082538 | Ga0068855_1000825382 | 331 |
| 248 | 3300005563 | Ga0068855_100116518 | Ga0068855_1001165183 | 331 |
| 249 | 3300005563 | Ga0068855_100151776 | Ga0068855_1001517762 | 331 |
| 250 | 3300005564 | Ga0070664_100098331 | Ga0070664_1000983312 | 331 |
| 251 | 3300005616 | Ga0068852_100046405 | Ga0068852_1000464053 | 331 |
| 252 | 3300005844 | Ga0068862_100010147 | Ga0068862_1000101472 | 331 |
| 253 | 3300009093 | Ga0105240_10001872 | Ga0105240_100018729 | 331 |
| 254 | 3300009093 | Ga0105240_10003430 | Ga0105240_1000343012 | 331 |
| 255 | 3300009093 | Ga0105240_10019223 | Ga0105240_100192232 | 331 |
| 256 | 3300009093 | Ga0105240_10026360 | Ga0105240_100263602 | 331 |
| 257 | 3300009093 | Ga0105240_10090706 | Ga0105240_100907064 | 331 |
| 258 | 3300009093 | Ga0105240_10249255 | Ga0105240_102492552 | 331 |
| 259 | 3300009174 | Ga0105241_10154297 | Ga0105241_101542973 | 331 |
| 260 | 3300009545 | Ga0105237_10153172 | Ga0105237_101531722 | 331 |
| 261 | 3300009545 | Ga0105237_10453498 | Ga0105237_104534982 | 331 |
| 262 | 3300009551 | Ga0105238_10006972 | Ga0105238_100069723 | 331 |
| 263 | 3300009551 | Ga0105238_10129475 | Ga0105238_101294751 | 331 |
| 264 | 3300009553 | Ga0105249_10034746 | Ga0105249_100347463 | 331 |
| 265 | 3300013104 | Ga0157370_10001541 | Ga0157370_100015418 | 331 |
| 266 | 3300013104 | Ga0157370_10005410 | Ga0157370_100054101 | 331 |
| 267 | 3300013105 | Ga0157369_10300382 | Ga0157369_103003822 | 331 |
| 268 | 3300013105 | Ga0157369_10448340 | Ga0157369_104483401 | 331 |
| 269 | 3300013307 | Ga0157372_10142697 | Ga0157372_101426971 | 331 |
| 270 | 3300013307 | Ga0157372_10498548 | Ga0157372_104985482 | 331 |
| 271 | 3300025254 | Ga0209148_1002879 | Ga0209148_10028793 | 331 |
| 272 | 3300025263 | Ga0209565_1000179 | Ga0209565_100017916 | 331 |
| 273 | 3300025272 | Ga0209455_1000610 | Ga0209455_10006106 | 331 |
| 274 | 3300025273 | Ga0209673_1001240 | Ga0209673_10012409 | 331 |
| 275 | 3300025291 | Ga0209675_1002110 | Ga0209675_10021108 | 331 |
| 276 | 3300025295 | Ga0209564_1013712 | Ga0209564_10137123 | 331 |
| 277 | 3300025297 | Ga0209758_1002900 | Ga0209758_100290012 | 331 |
| 278 | 3300025299 | Ga0209256_1018485 | Ga0209256_10184852 | 331 |
| 279 | 3300025912 | Ga0207707_10002777 | Ga0207707_100027772 | 331 |
| 280 | 3300025913 | Ga0207695_10003912 | Ga0207695_100039124 | 331 |
| 281 | 3300025913 | Ga0207695_10008285 | Ga0207695_1000828512 | 331 |
| 282 | 3300025913 | Ga0207695_10081284 | Ga0207695_100812841 | 331 |
| 283 | 3300025917 | Ga0207660_10001881 | Ga0207660_100018813 | 331 |
| 284 | 3300025919 | Ga0207657_10004105 | Ga0207657_100041053 | 331 |
| 285 | 3300025921 | Ga0207652_10002553 | Ga0207652_100025532 | 331 |
| 286 | 3300025921 | Ga0207652_10018371 | Ga0207652_100183712 | 331 |
| 287 | 3300025921 | Ga0207652_10315304 | Ga0207652_103153042 | 331 |
| 288 | 3300025924 | Ga0207694_10023181 | Ga0207694_100231813 | 331 |
| 289 | 3300025924 | Ga0207694_10042419 | Ga0207694_100424192 | 331 |
| 290 | 3300025945 | Ga0207679_10247463 | Ga0207679_102474632 | 331 |
| 291 | 3300025949 | Ga0207667_10019038 | Ga0207667_100190385 | 331 |
| 292 | 3300025949 | Ga0207667_10076365 | Ga0207667_100763652 | 331 |
| 293 | 3300025949 | Ga0207667_10139213 | Ga0207667_101392132 | 331 |
| 294 | 3300026041 | Ga0207639_10137112 | Ga0207639_101371122 | 331 |
| 295 | 3300026041 | Ga0207639_10260801 | Ga0207639_102608012 | 331 |
| 296 | 3300026116 | Ga0207674_10326551 | Ga0207674_103265511 | 331 |
| 297 | 3300026142 | Ga0207698_10053238 | Ga0207698_100532383 | 331 |
| 298 | 3300027876 | Ga0209974_10039278 | Ga0209974_100392782 | 331 |
| 299 | 3300028379 | Ga0268266_10004360 | Ga0268266_100043609 | 331 |
| 300 | 3300028380 | Ga0268265_10037847 | Ga0268265_100378472 | 331 |
| 301 | 3300032005 | Ga0307411_10078898 | Ga0307411_100788983 | 331 |
| 302 | 3300033180 | Ga0307510_10172201 | Ga0307510_101722012 | 331 |
| 303 | 3300037418 | Ga0395900_0221076 | Ga0395900_0221076_438_1475 | 331 |
| 304 | 3300037466 | Ga0395898_0097702 | Ga0395898_0097702_456_1484 | 331 |
| 305 | 3300037466 | Ga0395898_0109304 | Ga0395898_0109304_1600_2628 | 331 |
| 306 | 3300046460 | Ga0495638_0004597 | Ga0495638_0004597_4292_5329 | 331 |
| 307 | 3300046491 | Ga0495584_0017090 | Ga0495584_0017090_2088_3098 | 331 |
| 308 | 3300046492 | Ga0495585_0068780 | Ga0495585_0068780_296_1306 | 331 |
| 309 | 3300046501 | Ga0495607_0008853 | Ga0495607_0008853_2133_3143 | 331 |
| 310 | 3300046506 | Ga0495583_0000182 | Ga0495583_0000182_21235_22245 | 331 |
| 311 | 3300046506 | Ga0495583_0011541 | Ga0495583_0011541_1936_2946 | 331 |
| 312 | 3300046506 | Ga0495583_0038261 | Ga0495583_0038261_489_1499 | 331 |
| 313 | 3300046512 | Ga0495610_0005868 | Ga0495610_0005868_6120_7145 | 331 |
| 314 | 3300046520 | Ga0495637_0007144 | Ga0495637_0007144_924_1934 | 331 |
| 315 | 3300046520 | Ga0495637_0007639 | Ga0495637_0007639_1774_2817 | 331 |
| 316 | 3300046523 | Ga0495644_0007211 | Ga0495644_0007211_688_1698 | 331 |
| 317 | 3300046524 | Ga0495648_0012173 | Ga0495648_0012173_1532_2566 | 331 |
| 318 | 3300046528 | Ga0495642_0004347 | Ga0495642_0004347_1015_2025 | 331 |
| 319 | 3300046660 | Ga0495625_0000064 | Ga0495625_0000064_103106_104143 | 331 |
| 320 | 3300046660 | Ga0495625_0184376 | Ga0495625_0184376_213_1223 | 331 |
| 321 | 3300046660 | Ga0495625_0200569 | Ga0495625_0200569_232_1251 | 331 |
| 322 | 3300046691 | Ga0495670_0007012 | Ga0495670_0007012_820_1830 | 331 |
| 323 | 3300046692 | Ga0495671_0003542 | Ga0495671_0003542_2389_3399 | 331 |
| 324 | 3300046810 | Ga0495660_0006883 | Ga0495660_0006883_5458_6468 | 331 |
| 325 | 3300046810 | Ga0495660_0061945 | Ga0495660_0061945_701_1711 | 331 |
| 326 | 3300047323 | Ga0495683_0018891 | Ga0495683_0018891_1015_2025 | 331 |
| 327 | 3300047443 | Ga0495687_000691 | Ga0495687_000691_34118_35128 | 331 |
| 328 | 3300047446 | Ga0495679_018192 | Ga0495679_018192_297_1307 | 331 |
| 329 | 3300047472 | Ga0495686_0047006 | Ga0495686_0047006_1210_2235 | 331 |
| 330 | 3300047472 | Ga0495686_0075680 | Ga0495686_0075680_176_1219 | 331 |
| 331 | 3300047472 | Ga0495686_0113247 | Ga0495686_0113247_283_1296 | 331 |
| 332 | 3300047472 | Ga0495686_0181944 | Ga0495686_0181944_117_1154 | 331 |
| 333 | 3300048091 | Ga0495626_0000020 | Ga0495626_0000020_76400_77413 | 331 |
| 334 | 3300048091 | Ga0495626_0010985 | Ga0495626_0010985_1731_2741 | 331 |
| 335 | 3300048905 | Ga0496102_0000033 | Ga0496102_0000033_119162_120175 | 331 |
| 336 | 3300048918 | Ga0496115_0334092 | Ga0496115_0334092_115_1122 | 331 |
| 337 | 3300048921 | Ga0496118_0036397 | Ga0496118_0036397_354_1391 | 331 |
| 338 | 3300048923 | Ga0496120_0119949 | Ga0496120_0119949_311_1348 | 331 |
| 339 | 3300049459 | Ga0495678_016551 | Ga0495678_016551_52_1062 | 331 |
| 340 | 3300053134 | Ga0500658_0005963 | Ga0500658_0005963_1523_2560 | 331 |
| 341 | 3300053136 | Ga0500559_0009071 | Ga0500559_0009071_911_1945 | 331 |
| 342 | iso_pu_bacteria | 2643221684 | 2644474071 | 331 |
| 343 | iso_pu_bacteria | 8047673197 | 8047679707 | 331 |
| 344 | 3300003214 | JGI25165J46597_1001272 | JGI25165J46597_100127214 | 332 |
| 345 | 3300005327 | Ga0070658_10008396 | Ga0070658_100083961 | 332 |
| 346 | 3300005327 | Ga0070658_10076225 | Ga0070658_100762253 | 332 |
| 347 | 3300005328 | Ga0070676_10005363 | Ga0070676_100053635 | 332 |
| 348 | 3300005329 | Ga0070683_100071615 | Ga0070683_1000716154 | 332 |
| 349 | 3300005336 | Ga0070680_100026810 | Ga0070680_1000268105 | 332 |
| 350 | 3300005341 | Ga0070691_10056239 | Ga0070691_100562392 | 332 |
| 351 | 3300005344 | Ga0070661_100002145 | Ga0070661_1000021454 | 332 |
| 352 | 3300005345 | Ga0070692_10058791 | Ga0070692_100587912 | 332 |
| 353 | 3300005364 | Ga0070673_100000094 | Ga0070673_10000009412 | 332 |
| 354 | 3300005366 | Ga0070659_100010651 | Ga0070659_1000106513 | 332 |
| 355 | 3300005366 | Ga0070659_100241568 | Ga0070659_1002415682 | 332 |
| 356 | 3300005434 | Ga0070709_10186491 | Ga0070709_101864912 | 332 |
| 357 | 3300005435 | Ga0070714_100016222 | Ga0070714_1000162224 | 332 |
| 358 | 3300005435 | Ga0070714_100018544 | Ga0070714_1000185444 | 332 |
| 359 | 3300005435 | Ga0070714_100144956 | Ga0070714_1001449562 | 332 |
| 360 | 3300005455 | Ga0070663_100002094 | Ga0070663_10000209411 | 332 |
| 361 | 3300005455 | Ga0070663_100013961 | Ga0070663_1000139615 | 332 |
| 362 | 3300005457 | Ga0070662_100145301 | Ga0070662_1001453011 | 332 |
| 363 | 3300005458 | Ga0070681_10102190 | Ga0070681_101021903 | 332 |
| 364 | 3300005459 | Ga0068867_100000202 | Ga0068867_10000020212 | 332 |
| 365 | 3300005467 | Ga0070706_100101529 | Ga0070706_1001015292 | 332 |
| 366 | 3300005468 | Ga0070707_100051345 | Ga0070707_1000513452 | 332 |
| 367 | 3300005518 | Ga0070699_100033798 | Ga0070699_1000337983 | 332 |
| 368 | 3300005518 | Ga0070699_100039597 | Ga0070699_1000395972 | 332 |
| 369 | 3300005518 | Ga0070699_100309784 | Ga0070699_1003097842 | 332 |
| 370 | 3300005530 | Ga0070679_100180840 | Ga0070679_1001808403 | 332 |
| 371 | 3300005536 | Ga0070697_100072202 | Ga0070697_1000722022 | 332 |
| 372 | 3300005536 | Ga0070697_100102787 | Ga0070697_1001027873 | 332 |
| 373 | 3300005539 | Ga0068853_100028920 | Ga0068853_1000289203 | 332 |
| 374 | 3300005539 | Ga0068853_100106756 | Ga0068853_1001067563 | 332 |
| 375 | 3300005547 | Ga0070693_100092020 | Ga0070693_1000920201 | 332 |
| 376 | 3300005563 | Ga0068855_100033668 | Ga0068855_1000336682 | 332 |
| 377 | 3300005563 | Ga0068855_100160973 | Ga0068855_1001609732 | 332 |
| 378 | 3300005564 | Ga0070664_100006965 | Ga0070664_1000069657 | 332 |
| 379 | 3300005564 | Ga0070664_100256447 | Ga0070664_1002564472 | 332 |
| 380 | 3300005577 | Ga0068857_100002632 | Ga0068857_10000263212 | 332 |
| 381 | 3300005578 | Ga0068854_100002955 | Ga0068854_1000029556 | 332 |
| 382 | 3300005578 | Ga0068854_100232270 | Ga0068854_1002322701 | 332 |
| 383 | 3300005614 | Ga0068856_100008073 | Ga0068856_1000080731 | 332 |
| 384 | 3300005614 | Ga0068856_100088973 | Ga0068856_1000889732 | 332 |
| 385 | 3300005616 | Ga0068852_100008465 | Ga0068852_1000084652 | 332 |
| 386 | 3300005616 | Ga0068852_100036281 | Ga0068852_1000362812 | 332 |
| 387 | 3300005616 | Ga0068852_100159710 | Ga0068852_1001597102 | 332 |
| 388 | 3300005718 | Ga0068866_10005953 | Ga0068866_100059532 | 332 |
| 389 | 3300005834 | Ga0068851_10157580 | Ga0068851_101575801 | 332 |
| 390 | 3300006173 | Ga0070716_100073564 | Ga0070716_1000735642 | 332 |
| 391 | 3300006175 | Ga0070712_100042678 | Ga0070712_1000426781 | 332 |
| 392 | 3300006175 | Ga0070712_100144827 | Ga0070712_1001448272 | 332 |
| 393 | 3300006186 | Ga0075369_10004557 | Ga0075369_100045572 | 332 |
| 394 | 3300006852 | Ga0075433_10170230 | Ga0075433_101702301 | 332 |
| 395 | 3300006871 | Ga0075434_100145771 | Ga0075434_1001457712 | 332 |
| 396 | 3300006881 | Ga0068865_100000123 | Ga0068865_10000012312 | 332 |
| 397 | 3300006881 | Ga0068865_100238121 | Ga0068865_1002381212 | 332 |
| 398 | 3300007076 | Ga0075435_100290690 | Ga0075435_1002906902 | 332 |
| 399 | 3300009093 | Ga0105240_10058942 | Ga0105240_100589425 | 332 |
| 400 | 3300009093 | Ga0105240_10203674 | Ga0105240_102036743 | 332 |
| 401 | 3300009098 | Ga0105245_10037993 | Ga0105245_100379933 | 332 |
| 402 | 3300009148 | Ga0105243_10000794 | Ga0105243_1000079425 | 332 |
| 403 | 3300009176 | Ga0105242_10000655 | Ga0105242_1000065512 | 332 |
| 404 | 3300009177 | Ga0105248_10090599 | Ga0105248_100905991 | 332 |
| 405 | 3300009545 | Ga0105237_10024588 | Ga0105237_100245884 | 332 |
| 406 | 3300009545 | Ga0105237_10033576 | Ga0105237_100335765 | 332 |
| 407 | 3300009545 | Ga0105237_10149784 | Ga0105237_101497842 | 332 |
| 408 | 3300009551 | Ga0105238_10041811 | Ga0105238_100418113 | 332 |
| 409 | 3300009551 | Ga0105238_10148434 | Ga0105238_101484342 | 332 |
| 410 | 3300009553 | Ga0105249_10103516 | Ga0105249_101035162 | 332 |
| 411 | 3300010375 | Ga0105239_10046917 | Ga0105239_100469172 | 332 |
| 412 | 3300010375 | Ga0105239_10080514 | Ga0105239_100805145 | 332 |
| 413 | 3300010375 | Ga0105239_10173252 | Ga0105239_101732523 | 332 |
| 414 | 3300011119 | Ga0105246_10215684 | Ga0105246_102156841 | 332 |
| 415 | 3300013100 | Ga0157373_10134857 | Ga0157373_101348572 | 332 |
| 416 | 3300013104 | Ga0157370_10121627 | Ga0157370_101216273 | 332 |
| 417 | 3300013105 | Ga0157369_10185303 | Ga0157369_101853033 | 332 |
| 418 | 3300013105 | Ga0157369_10378038 | Ga0157369_103780381 | 332 |
| 419 | 3300013105 | Ga0157369_10468512 | Ga0157369_104685122 | 332 |
| 420 | 3300013296 | Ga0157374_10009427 | Ga0157374_100094275 | 332 |
| 421 | 3300013296 | Ga0157374_10207730 | Ga0157374_102077301 | 332 |
| 422 | 3300013307 | Ga0157372_10021717 | Ga0157372_100217174 | 332 |
| 423 | 3300014969 | Ga0157376_10000220 | Ga0157376_1000022012 | 332 |
| 424 | 3300025231 | Ga0207427_103171 | Ga0207427_1031711 | 332 |
| 425 | 3300025250 | Ga0209026_1001218 | Ga0209026_10012181 | 332 |
| 426 | 3300025254 | Ga0209148_1000059 | Ga0209148_100005911 | 332 |
| 427 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003498 | 332 |
| 428 | 3300025292 | Ga0209676_1002027 | Ga0209676_10020273 | 332 |
| 429 | 3300025906 | Ga0207699_10108858 | Ga0207699_101088582 | 332 |
| 430 | 3300025907 | Ga0207645_10018197 | Ga0207645_100181973 | 332 |
| 431 | 3300025909 | Ga0207705_10000354 | Ga0207705_1000035436 | 332 |
| 432 | 3300025910 | Ga0207684_10068684 | Ga0207684_100686844 | 332 |
| 433 | 3300025912 | Ga0207707_10126652 | Ga0207707_101266523 | 332 |
| 434 | 3300025913 | Ga0207695_10040862 | Ga0207695_100408623 | 332 |
| 435 | 3300025914 | Ga0207671_10126783 | Ga0207671_101267832 | 332 |
| 436 | 3300025915 | Ga0207693_10004578 | Ga0207693_100045785 | 332 |
| 437 | 3300025917 | Ga0207660_10315043 | Ga0207660_103150431 | 332 |
| 438 | 3300025917 | Ga0207660_10366691 | Ga0207660_103666911 | 332 |
| 439 | 3300025921 | Ga0207652_10140729 | Ga0207652_101407292 | 332 |
| 440 | 3300025921 | Ga0207652_10308289 | Ga0207652_103082892 | 332 |
| 441 | 3300025922 | Ga0207646_10001282 | Ga0207646_100012823 | 332 |
| 442 | 3300025924 | Ga0207694_10020923 | Ga0207694_100209233 | 332 |
| 443 | 3300025926 | Ga0207659_10326802 | Ga0207659_103268022 | 332 |
| 444 | 3300025928 | Ga0207700_10057740 | Ga0207700_100577402 | 332 |
| 445 | 3300025929 | Ga0207664_10000197 | Ga0207664_100001973 | 332 |
| 446 | 3300025929 | Ga0207664_10354770 | Ga0207664_103547702 | 332 |
| 447 | 3300025933 | Ga0207706_10038186 | Ga0207706_100381865 | 332 |
| 448 | 3300025934 | Ga0207686_10001104 | Ga0207686_100011044 | 332 |
| 449 | 3300025935 | Ga0207709_10000254 | Ga0207709_1000025447 | 332 |
| 450 | 3300025938 | Ga0207704_10000133 | Ga0207704_1000013325 | 332 |
| 451 | 3300025939 | Ga0207665_10050752 | Ga0207665_100507521 | 332 |
| 452 | 3300025942 | Ga0207689_10001230 | Ga0207689_1000123012 | 332 |
| 453 | 3300025945 | Ga0207679_10009072 | Ga0207679_100090723 | 332 |
| 454 | 3300025949 | Ga0207667_10162201 | Ga0207667_101622013 | 332 |
| 455 | 3300025960 | Ga0207651_10000012 | Ga0207651_10000012145 | 332 |
| 456 | 3300025981 | Ga0207640_10000021 | Ga0207640_100000219 | 332 |
| 457 | 3300026041 | Ga0207639_10005643 | Ga0207639_100056433 | 332 |
| 458 | 3300026067 | Ga0207678_10005690 | Ga0207678_1000569011 | 332 |
| 459 | 3300026078 | Ga0207702_10005695 | Ga0207702_100056958 | 332 |
| 460 | 3300026078 | Ga0207702_10030558 | Ga0207702_100305583 | 332 |
| 461 | 3300026078 | Ga0207702_10086540 | Ga0207702_100865402 | 332 |
| 462 | 3300026089 | Ga0207648_10000628 | Ga0207648_1000062812 | 332 |
| 463 | 3300026116 | Ga0207674_10002241 | Ga0207674_1000224115 | 332 |
| 464 | 3300026116 | Ga0207674_10004133 | Ga0207674_100041337 | 332 |
| 465 | 3300026116 | Ga0207674_10358479 | Ga0207674_103584792 | 332 |
| 466 | 3300026142 | Ga0207698_10000754 | Ga0207698_1000075412 | 332 |
| 467 | 3300026142 | Ga0207698_10061744 | Ga0207698_100617442 | 332 |
| 468 | 3300035116 | Ga0373945_0024321 | Ga0373945_0024321_870_1892 | 332 |
| 469 | 3300035170 | Ga0373943_0019772 | Ga0373943_0019772_1756_2847 | 332 |
| 470 | 3300035410 | Ga0373924_0012506 | Ga0373924_0012506_1981_3072 | 332 |
| 471 | 3300035725 | Ga0373947_0020569 | Ga0373947_0020569_1909_2931 | 332 |
| 472 | 3300037068 | Ga0373925_0009878 | Ga0373925_0009878_5108_6130 | 332 |
| 473 | 3300037312 | Ga0395899_0002562 | Ga0395899_0002562_13386_14426 | 332 |
| 474 | 3300037418 | Ga0395900_0140297 | Ga0395900_0140297_186_1226 | 332 |
| 475 | 3300038443 | Ga0395901_0191624 | Ga0395901_0191624_846_1886 | 332 |
| 476 | 3300044684 | Ga0466966_0007297 | Ga0466966_0007297_2913_3920 | 332 |
| 477 | 3300044693 | Ga0466961_0013406 | Ga0466961_0013406_1285_2283 | 332 |
| 478 | 3300044693 | Ga0466961_0025235 | Ga0466961_0025235_305_1345 | 332 |
| 479 | 3300044719 | Ga0466971_0001502 | Ga0466971_0001502_6688_7728 | 332 |
| 480 | 3300044719 | Ga0466971_0030426 | Ga0466971_0030426_886_1884 | 332 |
| 481 | 3300044765 | Ga0466970_0037762 | Ga0466970_0037762_633_1631 | 332 |
| 482 | 3300044842 | Ga0466957_0028197 | Ga0466957_0028197_532_1530 | 332 |
| 483 | 3300045049 | Ga0466959_0003211 | Ga0466959_0003211_2087_3085 | 332 |
| 484 | 3300045976 | Ga0466967_0015652 | Ga0466967_0015652_3260_4300 | 332 |
| 485 | 3300046457 | Ga0495590_0003216 | Ga0495590_0003216_1088_2116 | 332 |
| 486 | 3300046457 | Ga0495590_0048088 | Ga0495590_0048088_196_1203 | 332 |
| 487 | 3300046463 | Ga0495653_0048195 | Ga0495653_0048195_208_1215 | 332 |
| 488 | 3300046473 | Ga0495582_0075282 | Ga0495582_0075282_734_1741 | 332 |
| 489 | 3300046507 | Ga0495606_0031373 | Ga0495606_0031373_1668_2675 | 332 |
| 490 | 3300046513 | Ga0495616_0053801 | Ga0495616_0053801_139_1137 | 332 |
| 491 | 3300046517 | Ga0495630_0029392 | Ga0495630_0029392_1905_2912 | 332 |
| 492 | 3300046519 | Ga0495632_0030354 | Ga0495632_0030354_848_1876 | 332 |
| 493 | 3300046542 | Ga0495597_0002785 | Ga0495597_0002785_6467_7474 | 332 |
| 494 | 3300046543 | Ga0495645_0245018 | Ga0495645_0245018_92_1099 | 332 |
| 495 | 3300046559 | Ga0495667_0215329 | Ga0495667_0215329_188_1195 | 332 |
| 496 | 3300046615 | Ga0495656_0037015 | Ga0495656_0037015_252_1259 | 332 |
| 497 | 3300046616 | Ga0495668_0000040 | Ga0495668_0000040_8617_9633 | 332 |
| 498 | 3300046674 | Ga0495588_0020140 | Ga0495588_0020140_1774_2781 | 332 |
| 499 | 3300046679 | Ga0495623_0006111 | Ga0495623_0006111_4720_5727 | 332 |
| 500 | 3300046794 | Ga0495589_0021898 | Ga0495589_0021898_2080_3087 | 332 |
| 501 | 3300047322 | Ga0495680_0099721 | Ga0495680_0099721_244_1251 | 332 |
| 502 | 3300047444 | Ga0495675_0203995 | Ga0495675_0203995_116_1123 | 332 |
| 503 | 3300048091 | Ga0495626_0012037 | Ga0495626_0012037_1407_2414 | 332 |
| 504 | 3300048905 | Ga0496102_0155105 | Ga0496102_0155105_222_1262 | 332 |
| 505 | 3300048906 | Ga0496103_0140655 | Ga0496103_0140655_12_1034 | 332 |
| 506 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_222241_223266 | 332 |
| 507 | 3300048908 | Ga0496105_0000016 | Ga0496105_0000016_128215_129240 | 332 |
| 508 | 3300048909 | Ga0496106_0124162 | Ga0496106_0124162_41_1063 | 332 |
| 509 | 3300048911 | Ga0496108_0079946 | Ga0496108_0079946_1345_2391 | 332 |
| 510 | 3300048912 | Ga0496109_0245069 | Ga0496109_0245069_592_1614 | 332 |
| 511 | 3300048913 | Ga0496110_0022464 | Ga0496110_0022464_4074_5120 | 332 |
| 512 | 3300048915 | Ga0496112_0215924 | Ga0496112_0215924_632_1654 | 332 |
| 513 | 3300048927 | Ga0496124_0037080 | Ga0496124_0037080_2730_3767 | 332 |
| 514 | 3300048927 | Ga0496124_0245160 | Ga0496124_0245160_108_1115 | 332 |
| 515 | 3300050512 | nmdc:mga0n895_32315_c1 | nmdc:mga0n895_32315_c1_374_1396 | 332 |
| 516 | 3300050513 | nmdc:mga0rr50_277413_c1 | nmdc:mga0rr50_277413_c1_242_1264 | 332 |
| 517 | 3300050513 | nmdc:mga0rr50_46200_c1 | nmdc:mga0rr50_46200_c1_513_1703 | 332 |
| 518 | 3300050515 | nmdc:mga0a205_33903_c1 | nmdc:mga0a205_33903_c1_683_1873 | 332 |
| 519 | 3300050516 | nmdc:mga0sz30_7450_c1 | nmdc:mga0sz30_7450_c1_542_1579 | 332 |
| 520 | 3300053122 | Ga0500608_000348 | Ga0500608_000348_12659_13687 | 332 |
| 521 | 3300053136 | Ga0500559_0004275 | Ga0500559_0004275_1359_2387 | 332 |
| 522 | 3300053156 | Ga0500622_0026816 | Ga0500622_0026816_463_1491 | 332 |
| 523 | 3300061719 | Ga0466962_0019410 | Ga0466962_0019410_856_1854 | 332 |
| 524 | 3300061719 | Ga0466962_0032872 | Ga0466962_0032872_1288_2328 | 332 |
| 525 | iso_pu_bacteria | 2738541276 | 2738715644 | 332 |
| 526 | iso_pu_bacteria | 2818991457 | 2819662083 | 332 |
| 527 | 3300003320 | rootH2_10023272 | rootH2_100232724 | 333 |
| 528 | 3300003322 | rootL2_10002566 | rootL2_100025665 | 333 |
| 529 | 3300003322 | rootL2_10220746 | rootL2_102207462 | 333 |
| 530 | 3300003752 | Ga0055539_1000638 | Ga0055539_10006384 | 333 |
| 531 | 3300003761 | Ga0055535_1000387 | Ga0055535_10003875 | 333 |
| 532 | 3300003763 | Ga0055529_1000195 | Ga0055529_100019567 | 333 |
| 533 | 3300003771 | Ga0055526_1001611 | Ga0055526_10016117 | 333 |
| 534 | 3300003773 | Ga0055537_1000244 | Ga0055537_100024410 | 333 |
| 535 | 3300003784 | Ga0055534_1000030 | Ga0055534_10000305 | 333 |
| 536 | 3300003784 | Ga0055534_1000219 | Ga0055534_100021918 | 333 |
| 537 | 3300003790 | Ga0055528_1000340 | Ga0055528_100034027 | 333 |
| 538 | 3300003791 | Ga0055530_10000664 | Ga0055530_1000066427 | 333 |
| 539 | 3300005262 | Ga0065165_1002523 | Ga0065165_10025235 | 333 |
| 540 | 3300005327 | Ga0070658_10040607 | Ga0070658_100406073 | 333 |
| 541 | 3300005330 | Ga0070690_100051971 | Ga0070690_1000519712 | 333 |
| 542 | 3300005334 | Ga0068869_100131228 | Ga0068869_1001312282 | 333 |
| 543 | 3300005344 | Ga0070661_100005541 | Ga0070661_1000055414 | 333 |
| 544 | 3300005366 | Ga0070659_100009487 | Ga0070659_1000094873 | 333 |
| 545 | 3300005467 | Ga0070706_100028276 | Ga0070706_1000282764 | 333 |
| 546 | 3300005536 | Ga0070697_100054002 | Ga0070697_1000540022 | 333 |
| 547 | 3300005539 | Ga0068853_100035161 | Ga0068853_1000351614 | 333 |
| 548 | 3300005564 | Ga0070664_100104731 | Ga0070664_1001047312 | 333 |
| 549 | 3300005578 | Ga0068854_100014084 | Ga0068854_1000140843 | 333 |
| 550 | 3300005719 | Ga0068861_100242951 | Ga0068861_1002429512 | 333 |
| 551 | 3300006195 | Ga0075366_10138617 | Ga0075366_101386171 | 333 |
| 552 | 3300006353 | Ga0075370_10001687 | Ga0075370_100016874 | 333 |
| 553 | 3300006844 | Ga0075428_100031973 | Ga0075428_1000319734 | 333 |
| 554 | 3300006846 | Ga0075430_100006166 | Ga0075430_1000061665 | 333 |
| 555 | 3300006847 | Ga0075431_100021591 | Ga0075431_1000215914 | 333 |
| 556 | 3300006847 | Ga0075431_100034546 | Ga0075431_1000345464 | 333 |
| 557 | 3300006852 | Ga0075433_10008489 | Ga0075433_100084892 | 333 |
| 558 | 3300006871 | Ga0075434_100001830 | Ga0075434_10000183011 | 333 |
| 559 | 3300006880 | Ga0075429_100059872 | Ga0075429_1000598723 | 333 |
| 560 | 3300009093 | Ga0105240_10015370 | Ga0105240_100153702 | 333 |
| 561 | 3300009093 | Ga0105240_10040184 | Ga0105240_100401845 | 333 |
| 562 | 3300009094 | Ga0111539_10559751 | Ga0111539_105597511 | 333 |
| 563 | 3300009148 | Ga0105243_10229752 | Ga0105243_102297522 | 333 |
| 564 | 3300009174 | Ga0105241_10033744 | Ga0105241_100337442 | 333 |
| 565 | 3300009176 | Ga0105242_10510731 | Ga0105242_105107312 | 333 |
| 566 | 3300011119 | Ga0105246_10015636 | Ga0105246_100156363 | 333 |
| 567 | 3300015262 | Ga0182007_10000004 | Ga0182007_10000004303 | 333 |
| 568 | 3300017792 | Ga0163161_10007435 | Ga0163161_100074352 | 333 |
| 569 | 3300017792 | Ga0163161_10038272 | Ga0163161_100382722 | 333 |
| 570 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031445 | 333 |
| 571 | 3300025242 | Ga0209258_100291 | Ga0209258_10029168 | 333 |
| 572 | 3300025242 | Ga0209258_100872 | Ga0209258_1008727 | 333 |
| 573 | 3300025254 | Ga0209148_1000394 | Ga0209148_100039432 | 333 |
| 574 | 3300025254 | Ga0209148_1002813 | Ga0209148_10028132 | 333 |
| 575 | 3300025256 | Ga0209759_1002075 | Ga0209759_10020753 | 333 |
| 576 | 3300025263 | Ga0209565_1000024 | Ga0209565_1000024114 | 333 |
| 577 | 3300025272 | Ga0209455_1000208 | Ga0209455_10002085 | 333 |
| 578 | 3300025273 | Ga0209673_1000237 | Ga0209673_100023731 | 333 |
| 579 | 3300025291 | Ga0209675_1000107 | Ga0209675_10001076 | 333 |
| 580 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011315 | 333 |
| 581 | 3300025295 | Ga0209564_1000422 | Ga0209564_100042211 | 333 |
| 582 | 3300025298 | Ga0209050_1000032 | Ga0209050_1000032194 | 333 |
| 583 | 3300025303 | Ga0209051_1001126 | Ga0209051_100112610 | 333 |
| 584 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014374 | 333 |
| 585 | 3300025909 | Ga0207705_10001638 | Ga0207705_100016383 | 333 |
| 586 | 3300025910 | Ga0207684_10024343 | Ga0207684_100243432 | 333 |
| 587 | 3300025910 | Ga0207684_10305149 | Ga0207684_103051491 | 333 |
| 588 | 3300025911 | Ga0207654_10017619 | Ga0207654_100176192 | 333 |
| 589 | 3300025913 | Ga0207695_10005836 | Ga0207695_100058362 | 333 |
| 590 | 3300025913 | Ga0207695_10076080 | Ga0207695_100760803 | 333 |
| 591 | 3300025919 | Ga0207657_10015382 | Ga0207657_100153825 | 333 |
| 592 | 3300025920 | Ga0207649_10003619 | Ga0207649_100036195 | 333 |
| 593 | 3300025934 | Ga0207686_10038374 | Ga0207686_100383743 | 333 |
| 594 | 3300025935 | Ga0207709_10130726 | Ga0207709_101307262 | 333 |
| 595 | 3300025942 | Ga0207689_10089926 | Ga0207689_100899262 | 333 |
| 596 | 3300025945 | Ga0207679_10160279 | Ga0207679_101602792 | 333 |
| 597 | 3300025949 | Ga0207667_10006471 | Ga0207667_1000647112 | 333 |
| 598 | 3300025949 | Ga0207667_10152042 | Ga0207667_101520422 | 333 |
| 599 | 3300026041 | Ga0207639_10024259 | Ga0207639_100242592 | 333 |
| 600 | 3300026142 | Ga0207698_10275707 | Ga0207698_102757071 | 333 |
| 601 | 3300027907 | Ga0207428_10010044 | Ga0207428_100100447 | 333 |
| 602 | 3300030732 | Ga0316176_1102927 | Ga0316176_11029273 | 333 |
| 603 | 3300031728 | Ga0316578_10030767 | Ga0316578_100307672 | 333 |
| 604 | 3300031730 | Ga0307516_10001773 | Ga0307516_1000177331 | 333 |
| 605 | 3300032004 | Ga0307414_10250336 | Ga0307414_102503362 | 333 |
| 606 | 3300037312 | Ga0395899_0000256 | Ga0395899_0000256_30105_31115 | 333 |
| 607 | 3300037312 | Ga0395899_0001762 | Ga0395899_0001762_541_1551 | 333 |
| 608 | 3300037312 | Ga0395899_0002656 | Ga0395899_0002656_3305_4315 | 333 |
| 609 | 3300037418 | Ga0395900_0000065 | Ga0395900_0000065_18539_19549 | 333 |
| 610 | 3300037418 | Ga0395900_0000312 | Ga0395900_0000312_22619_23629 | 333 |
| 611 | 3300037418 | Ga0395900_0011019 | Ga0395900_0011019_6029_7039 | 333 |
| 612 | 3300037418 | Ga0395900_0022389 | Ga0395900_0022389_4874_5884 | 333 |
| 613 | 3300037418 | Ga0395900_0033276 | Ga0395900_0033276_3987_4997 | 333 |
| 614 | 3300037418 | Ga0395900_0054706 | Ga0395900_0054706_994_2004 | 333 |
| 615 | 3300037418 | Ga0395900_0074018 | Ga0395900_0074018_214_1224 | 333 |
| 616 | 3300037418 | Ga0395900_0245407 | Ga0395900_0245407_205_1215 | 333 |
| 617 | 3300037418 | Ga0395900_0401062 | Ga0395900_0401062_16_1026 | 333 |
| 618 | 3300037466 | Ga0395898_0001598 | Ga0395898_0001598_909_1919 | 333 |
| 619 | 3300037466 | Ga0395898_0084646 | Ga0395898_0084646_1779_2789 | 333 |
| 620 | 3300037466 | Ga0395898_0183190 | Ga0395898_0183190_880_1890 | 333 |
| 621 | 3300037466 | Ga0395898_0210535 | Ga0395898_0210535_307_1317 | 333 |
| 622 | 3300037466 | Ga0395898_0292994 | Ga0395898_0292994_394_1404 | 333 |
| 623 | 3300037466 | Ga0395898_0340430 | Ga0395898_0340430_376_1386 | 333 |
| 624 | 3300037471 | Ga0395905_0005086 | Ga0395905_0005086_873_1883 | 333 |
| 625 | 3300037471 | Ga0395905_0020325 | Ga0395905_0020325_1083_2093 | 333 |
| 626 | 3300037471 | Ga0395905_0359087 | Ga0395905_0359087_199_1209 | 333 |
| 627 | 3300038443 | Ga0395901_0000094 | Ga0395901_0000094_91804_92814 | 333 |
| 628 | 3300038443 | Ga0395901_0000442 | Ga0395901_0000442_18147_19157 | 333 |
| 629 | 3300038443 | Ga0395901_0002606 | Ga0395901_0002606_16700_17710 | 333 |
| 630 | 3300038443 | Ga0395901_0385690 | Ga0395901_0385690_172_1182 | 333 |
| 631 | 3300041452 | Ga0451793_0304280 | Ga0451793_0304280_2401_3402 | 333 |
| 632 | 3300041462 | Ga0451806_137214 | Ga0451806_137214_3578_4579 | 333 |
| 633 | 3300042157 | Ga0439458_0005546 | Ga0439458_0005546_1226_2236 | 333 |
| 634 | 3300044656 | Ga0466969_0006199 | Ga0466969_0006199_2787_3830 | 333 |
| 635 | 3300044683 | Ga0466965_0023267 | Ga0466965_0023267_1789_2832 | 333 |
| 636 | 3300044683 | Ga0466965_0036778 | Ga0466965_0036778_96_1106 | 333 |
| 637 | 3300044684 | Ga0466966_0002495 | Ga0466966_0002495_4286_5329 | 333 |
| 638 | 3300044684 | Ga0466966_0003847 | Ga0466966_0003847_5765_6766 | 333 |
| 639 | 3300044684 | Ga0466966_0046280 | Ga0466966_0046280_1395_2405 | 333 |
| 640 | 3300044693 | Ga0466961_0022464 | Ga0466961_0022464_982_1992 | 333 |
| 641 | 3300044693 | Ga0466961_0047971 | Ga0466961_0047971_375_1418 | 333 |
| 642 | 3300044694 | Ga0466963_0051797 | Ga0466963_0051797_58_1101 | 333 |
| 643 | 3300044706 | Ga0466964_0032730 | Ga0466964_0032730_814_1857 | 333 |
| 644 | 3300044719 | Ga0466971_0001227 | Ga0466971_0001227_1312_2355 | 333 |
| 645 | 3300044719 | Ga0466971_0080081 | Ga0466971_0080081_300_1310 | 333 |
| 646 | 3300044735 | Ga0466968_0072509 | Ga0466968_0072509_172_1182 | 333 |
| 647 | 3300044765 | Ga0466970_0093960 | Ga0466970_0093960_287_1297 | 333 |
| 648 | 3300044842 | Ga0466957_0000006 | Ga0466957_0000006_19235_20245 | 333 |
| 649 | 3300044842 | Ga0466957_0030950 | Ga0466957_0030950_109_1152 | 333 |
| 650 | 3300045049 | Ga0466959_0048063 | Ga0466959_0048063_1727_2770 | 333 |
| 651 | 3300045049 | Ga0466959_0088267 | Ga0466959_0088267_885_1895 | 333 |
| 652 | 3300045836 | Ga0466958_0001145 | Ga0466958_0001145_5505_6506 | 333 |
| 653 | 3300045836 | Ga0466958_0024145 | Ga0466958_0024145_246_1256 | 333 |
| 654 | 3300045836 | Ga0466958_0033486 | Ga0466958_0033486_1618_2661 | 333 |
| 655 | 3300045976 | Ga0466967_0007712 | Ga0466967_0007712_1926_2936 | 333 |
| 656 | 3300045976 | Ga0466967_0037992 | Ga0466967_0037992_2870_3913 | 333 |
| 657 | 3300046452 | Ga0495617_000001 | Ga0495617_000001_350801_351820 | 333 |
| 658 | 3300046453 | Ga0495627_000026 | Ga0495627_000026_137988_139007 | 333 |
| 659 | 3300046457 | Ga0495590_0000042 | Ga0495590_0000042_93388_94398 | 333 |
| 660 | 3300046457 | Ga0495590_0036144 | Ga0495590_0036144_252_1262 | 333 |
| 661 | 3300046458 | Ga0495591_000068 | Ga0495591_000068_22449_23459 | 333 |
| 662 | 3300046460 | Ga0495638_0133534 | Ga0495638_0133534_157_1167 | 333 |
| 663 | 3300046471 | Ga0495650_0022270 | Ga0495650_0022270_297_1298 | 333 |
| 664 | 3300046474 | Ga0495605_0000004 | Ga0495605_0000004_673_1692 | 333 |
| 665 | 3300046474 | Ga0495605_0000084 | Ga0495605_0000084_40853_41863 | 333 |
| 666 | 3300046474 | Ga0495605_0014213 | Ga0495605_0014213_858_1868 | 333 |
| 667 | 3300046474 | Ga0495605_0019389 | Ga0495605_0019389_405_1415 | 333 |
| 668 | 3300046491 | Ga0495584_0000041 | Ga0495584_0000041_3279_4289 | 333 |
| 669 | 3300046491 | Ga0495584_0000093 | Ga0495584_0000093_22028_23038 | 333 |
| 670 | 3300046492 | Ga0495585_0002675 | Ga0495585_0002675_8580_9590 | 333 |
| 671 | 3300046500 | Ga0495596_0006693 | Ga0495596_0006693_2502_3512 | 333 |
| 672 | 3300046501 | Ga0495607_0001794 | Ga0495607_0001794_1295_2305 | 333 |
| 673 | 3300046501 | Ga0495607_0002272 | Ga0495607_0002272_3121_4131 | 333 |
| 674 | 3300046501 | Ga0495607_0002667 | Ga0495607_0002667_4547_5566 | 333 |
| 675 | 3300046506 | Ga0495583_0000170 | Ga0495583_0000170_30186_31196 | 333 |
| 676 | 3300046506 | Ga0495583_0004765 | Ga0495583_0004765_4983_5993 | 333 |
| 677 | 3300046506 | Ga0495583_0054440 | Ga0495583_0054440_780_1790 | 333 |
| 678 | 3300046507 | Ga0495606_0014422 | Ga0495606_0014422_4919_5929 | 333 |
| 679 | 3300046507 | Ga0495606_0086650 | Ga0495606_0086650_699_1709 | 333 |
| 680 | 3300046512 | Ga0495610_0000712 | Ga0495610_0000712_18210_19220 | 333 |
| 681 | 3300046513 | Ga0495616_0011719 | Ga0495616_0011719_1425_2435 | 333 |
| 682 | 3300046513 | Ga0495616_0035359 | Ga0495616_0035359_523_1533 | 333 |
| 683 | 3300046518 | Ga0495631_0032916 | Ga0495631_0032916_273_1283 | 333 |
| 684 | 3300046518 | Ga0495631_0032917 | Ga0495631_0032917_273_1283 | 333 |
| 685 | 3300046519 | Ga0495632_0000028 | Ga0495632_0000028_80827_81837 | 333 |
| 686 | 3300046519 | Ga0495632_0006837 | Ga0495632_0006837_436_1446 | 333 |
| 687 | 3300046519 | Ga0495632_0063798 | Ga0495632_0063798_73_1083 | 333 |
| 688 | 3300046520 | Ga0495637_0000002 | Ga0495637_0000002_180398_181408 | 333 |
| 689 | 3300046522 | Ga0495643_0006873 | Ga0495643_0006873_1480_2490 | 333 |
| 690 | 3300046523 | Ga0495644_0000801 | Ga0495644_0000801_1295_2305 | 333 |
| 691 | 3300046523 | Ga0495644_0018712 | Ga0495644_0018712_926_1936 | 333 |
| 692 | 3300046524 | Ga0495648_0000221 | Ga0495648_0000221_2960_3979 | 333 |
| 693 | 3300046528 | Ga0495642_0000001 | Ga0495642_0000001_91589_92608 | 333 |
| 694 | 3300046528 | Ga0495642_0000295 | Ga0495642_0000295_23715_24722 | 333 |
| 695 | 3300046530 | Ga0495654_0005801 | Ga0495654_0005801_673_1692 | 333 |
| 696 | 3300046530 | Ga0495654_0009776 | Ga0495654_0009776_2686_3696 | 333 |
| 697 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_891352_892362 | 333 |
| 698 | 3300046538 | Ga0495609_0003932 | Ga0495609_0003932_2196_3206 | 333 |
| 699 | 3300046538 | Ga0495609_0025869 | Ga0495609_0025869_441_1460 | 333 |
| 700 | 3300046542 | Ga0495597_0000501 | Ga0495597_0000501_14286_15296 | 333 |
| 701 | 3300046542 | Ga0495597_0092485 | Ga0495597_0092485_125_1135 | 333 |
| 702 | 3300046558 | Ga0495633_0005044 | Ga0495633_0005044_5039_6049 | 333 |
| 703 | 3300046615 | Ga0495656_0009162 | Ga0495656_0009162_2413_3423 | 333 |
| 704 | 3300046616 | Ga0495668_0000273 | Ga0495668_0000273_67904_68923 | 333 |
| 705 | 3300046616 | Ga0495668_0000445 | Ga0495668_0000445_32528_33538 | 333 |
| 706 | 3300046616 | Ga0495668_0008975 | Ga0495668_0008975_2678_3688 | 333 |
| 707 | 3300046648 | Ga0495611_0000547 | Ga0495611_0000547_17739_18749 | 333 |
| 708 | 3300046648 | Ga0495611_0001632 | Ga0495611_0001632_2193_3203 | 333 |
| 709 | 3300046660 | Ga0495625_0003961 | Ga0495625_0003961_5054_6076 | 333 |
| 710 | 3300046665 | Ga0495661_0000089 | Ga0495661_0000089_35823_36833 | 333 |
| 711 | 3300046684 | Ga0495669_0009316 | Ga0495669_0009316_2030_3040 | 333 |
| 712 | 3300046684 | Ga0495669_0056904 | Ga0495669_0056904_732_1751 | 333 |
| 713 | 3300046694 | Ga0495649_0000029 | Ga0495649_0000029_67653_68663 | 333 |
| 714 | 3300046694 | Ga0495649_0067967 | Ga0495649_0067967_126_1136 | 333 |
| 715 | 3300046794 | Ga0495589_0000015 | Ga0495589_0000015_148916_149926 | 333 |
| 716 | 3300046794 | Ga0495589_0000273 | Ga0495589_0000273_15959_16978 | 333 |
| 717 | 3300046794 | Ga0495589_0000962 | Ga0495589_0000962_12570_13580 | 333 |
| 718 | 3300046794 | Ga0495589_0010186 | Ga0495589_0010186_329_1339 | 333 |
| 719 | 3300046794 | Ga0495589_0022083 | Ga0495589_0022083_803_1813 | 333 |
| 720 | 3300046810 | Ga0495660_0000123 | Ga0495660_0000123_56322_57332 | 333 |
| 721 | 3300046810 | Ga0495660_0004490 | Ga0495660_0004490_5831_6841 | 333 |
| 722 | 3300046810 | Ga0495660_0028027 | Ga0495660_0028027_1857_2876 | 333 |
| 723 | 3300047320 | Ga0495672_0000065 | Ga0495672_0000065_96007_97017 | 333 |
| 724 | 3300047320 | Ga0495672_0000192 | Ga0495672_0000192_82691_83701 | 333 |
| 725 | 3300047320 | Ga0495672_0011820 | Ga0495672_0011820_3575_4585 | 333 |
| 726 | 3300047320 | Ga0495672_0015956 | Ga0495672_0015956_1578_2588 | 333 |
| 727 | 3300047323 | Ga0495683_0000012 | Ga0495683_0000012_66303_67313 | 333 |
| 728 | 3300047323 | Ga0495683_0096411 | Ga0495683_0096411_222_1232 | 333 |
| 729 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_608439_609449 | 333 |
| 730 | 3300047443 | Ga0495687_000007 | Ga0495687_000007_253356_254366 | 333 |
| 731 | 3300047443 | Ga0495687_000295 | Ga0495687_000295_8305_9315 | 333 |
| 732 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_549705_550715 | 333 |
| 733 | 3300047445 | Ga0495677_0001541 | Ga0495677_0001541_1827_2837 | 333 |
| 734 | 3300047445 | Ga0495677_0006156 | Ga0495677_0006156_243_1253 | 333 |
| 735 | 3300047470 | Ga0495681_0022082 | Ga0495681_0022082_2172_3182 | 333 |
| 736 | 3300047472 | Ga0495686_0000015 | Ga0495686_0000015_242651_243661 | 333 |
| 737 | 3300047472 | Ga0495686_0000190 | Ga0495686_0000190_36009_37019 | 333 |
| 738 | 3300047472 | Ga0495686_0005278 | Ga0495686_0005278_8519_9538 | 333 |
| 739 | 3300047472 | Ga0495686_0179706 | Ga0495686_0179706_201_1211 | 333 |
| 740 | 3300048091 | Ga0495626_0000089 | Ga0495626_0000089_103678_104688 | 333 |
| 741 | 3300048091 | Ga0495626_0000200 | Ga0495626_0000200_67129_68139 | 333 |
| 742 | 3300048091 | Ga0495626_0016945 | Ga0495626_0016945_1794_2804 | 333 |
| 743 | 3300048091 | Ga0495626_0020349 | Ga0495626_0020349_1940_2950 | 333 |
| 744 | 3300048091 | Ga0495626_0043483 | Ga0495626_0043483_748_1758 | 333 |
| 745 | 3300048909 | Ga0496106_0002387 | Ga0496106_0002387_3870_4880 | 333 |
| 746 | 3300048909 | Ga0496106_0275900 | Ga0496106_0275900_254_1264 | 333 |
| 747 | 3300048910 | Ga0496107_0032190 | Ga0496107_0032190_1385_2395 | 333 |
| 748 | 3300048912 | Ga0496109_0191569 | Ga0496109_0191569_899_1909 | 333 |
| 749 | 3300048916 | Ga0496113_0039244 | Ga0496113_0039244_993_2003 | 333 |
| 750 | 3300048917 | Ga0496114_0271751 | Ga0496114_0271751_335_1336 | 333 |
| 751 | 3300048925 | Ga0496122_0004104 | Ga0496122_0004104_2333_3343 | 333 |
| 752 | 3300048925 | Ga0496122_0033396 | Ga0496122_0033396_3047_4054 | 333 |
| 753 | 3300048926 | Ga0496123_0005245 | Ga0496123_0005245_3170_4177 | 333 |
| 754 | 3300048926 | Ga0496123_0017267 | Ga0496123_0017267_2383_3393 | 333 |
| 755 | 3300048927 | Ga0496124_0006729 | Ga0496124_0006729_2152_3162 | 333 |
| 756 | 3300048927 | Ga0496124_0061645 | Ga0496124_0061645_98_1108 | 333 |
| 757 | 3300048927 | Ga0496124_0197905 | Ga0496124_0197905_212_1219 | 333 |
| 758 | 3300048928 | Ga0496125_0038358 | Ga0496125_0038358_1918_2928 | 333 |
| 759 | 3300049459 | Ga0495678_000015 | Ga0495678_000015_92059_93069 | 333 |
| 760 | 3300049822 | Ga0501035_0001876 | Ga0501035_0001876_2392_3402 | 333 |
| 761 | 3300050496 | nmdc:mga07m45_278_c2 | nmdc:mga07m45_278_c2_9089_10099 | 333 |
| 762 | 3300050509 | nmdc:mga0qj67_9414_c1 | nmdc:mga0qj67_9414_c1_5920_6954 | 333 |
| 763 | 3300050510 | nmdc:mga06r32_67633_c1 | nmdc:mga06r32_67633_c1_1371_2405 | 333 |
| 764 | 3300050511 | nmdc:mga08y16_130970_c1 | nmdc:mga08y16_130970_c1_1158_2186 | 333 |
| 765 | 3300050511 | nmdc:mga08y16_428604_c1 | nmdc:mga08y16_428604_c1_242_1273 | 333 |
| 766 | 3300050512 | nmdc:mga0n895_3166_c1 | nmdc:mga0n895_3166_c1_8449_9483 | 333 |
| 767 | 3300050515 | nmdc:mga0a205_5464_c1 | nmdc:mga0a205_5464_c1_3413_4447 | 333 |
| 768 | 3300053136 | Ga0500559_0009670 | Ga0500559_0009670_375_1376 | 333 |
| 769 | 3300061719 | Ga0466962_0002967 | Ga0466962_0002967_2695_3738 | 333 |
| 770 | 3300003323 | rootH1_10021415 | rootH1_100214158 | 334 |
| 771 | 3300003323 | rootH1_10039841 | rootH1_1003984154 | 334 |
| 772 | 3300003775 | Ga0055524_1000010 | Ga0055524_1000010172 | 334 |
| 773 | 3300005262 | Ga0065165_1034780 | Ga0065165_10347801 | 334 |
| 774 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002249 | 334 |
| 775 | 3300009036 | Ga0105244_10003017 | Ga0105244_100030176 | 334 |
| 776 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007550 | 334 |
| 777 | 3300025728 | Ga0207655_1001866 | Ga0207655_100186611 | 334 |
| 778 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001898 | 334 |
| 779 | 3300035398 | Ga0316574_0052152 | Ga0316574_0052152_235_1248 | 334 |
| 780 | 3300041486 | Ga0451807_0283309 | Ga0451807_0283309_531_1544 | 334 |
| 781 | 3300044842 | Ga0466957_0009575 | Ga0466957_0009575_3919_4962 | 334 |
| 782 | 3300046457 | Ga0495590_0000451 | Ga0495590_0000451_17050_18069 | 334 |
| 783 | 3300046463 | Ga0495653_0037136 | Ga0495653_0037136_1544_2563 | 334 |
| 784 | 3300046463 | Ga0495653_0107859 | Ga0495653_0107859_798_1817 | 334 |
| 785 | 3300046474 | Ga0495605_0000647 | Ga0495605_0000647_9767_10789 | 334 |
| 786 | 3300046474 | Ga0495605_0001330 | Ga0495605_0001330_6059_7063 | 334 |
| 787 | 3300046492 | Ga0495585_0127093 | Ga0495585_0127093_193_1215 | 334 |
| 788 | 3300046499 | Ga0495594_0071870 | Ga0495594_0071870_805_1827 | 334 |
| 789 | 3300046500 | Ga0495596_0000238 | Ga0495596_0000238_21173_22195 | 334 |
| 790 | 3300046500 | Ga0495596_0011687 | Ga0495596_0011687_61_1095 | 334 |
| 791 | 3300046501 | Ga0495607_0000995 | Ga0495607_0000995_15769_16791 | 334 |
| 792 | 3300046507 | Ga0495606_0026503 | Ga0495606_0026503_544_1566 | 334 |
| 793 | 3300046513 | Ga0495616_0003907 | Ga0495616_0003907_8325_9347 | 334 |
| 794 | 3300046513 | Ga0495616_0015645 | Ga0495616_0015645_3169_4191 | 334 |
| 795 | 3300046513 | Ga0495616_0016074 | Ga0495616_0016074_1991_3013 | 334 |
| 796 | 3300046513 | Ga0495616_0019225 | Ga0495616_0019225_141_1163 | 334 |
| 797 | 3300046518 | Ga0495631_0002607 | Ga0495631_0002607_8462_9484 | 334 |
| 798 | 3300046518 | Ga0495631_0032523 | Ga0495631_0032523_921_1949 | 334 |
| 799 | 3300046519 | Ga0495632_0000043 | Ga0495632_0000043_34063_35085 | 334 |
| 800 | 3300046520 | Ga0495637_0088223 | Ga0495637_0088223_167_1189 | 334 |
| 801 | 3300046523 | Ga0495644_0043394 | Ga0495644_0043394_322_1344 | 334 |
| 802 | 3300046524 | Ga0495648_0001910 | Ga0495648_0001910_15792_16814 | 334 |
| 803 | 3300046524 | Ga0495648_0015052 | Ga0495648_0015052_2579_3601 | 334 |
| 804 | 3300046528 | Ga0495642_0123538 | Ga0495642_0123538_79_1101 | 334 |
| 805 | 3300046530 | Ga0495654_0000692 | Ga0495654_0000692_9240_10262 | 334 |
| 806 | 3300046536 | Ga0495587_0025462 | Ga0495587_0025462_360_1379 | 334 |
| 807 | 3300046542 | Ga0495597_0000030 | Ga0495597_0000030_175_1197 | 334 |
| 808 | 3300046616 | Ga0495668_0000381 | Ga0495668_0000381_34077_35099 | 334 |
| 809 | 3300046616 | Ga0495668_0071989 | Ga0495668_0071989_69_1091 | 334 |
| 810 | 3300046616 | Ga0495668_0127239 | Ga0495668_0127239_337_1359 | 334 |
| 811 | 3300046684 | Ga0495669_0035976 | Ga0495669_0035976_785_1807 | 334 |
| 812 | 3300046691 | Ga0495670_0019879 | Ga0495670_0019879_2228_3250 | 334 |
| 813 | 3300046692 | Ga0495671_0000964 | Ga0495671_0000964_14923_15945 | 334 |
| 814 | 3300046694 | Ga0495649_0090965 | Ga0495649_0090965_403_1437 | 334 |
| 815 | 3300046794 | Ga0495589_0071881 | Ga0495589_0071881_543_1565 | 334 |
| 816 | 3300046810 | Ga0495660_0004629 | Ga0495660_0004629_1862_2884 | 334 |
| 817 | 3300047443 | Ga0495687_000067 | Ga0495687_000067_58549_59571 | 334 |
| 818 | 3300047443 | Ga0495687_009020 | Ga0495687_009020_3712_4734 | 334 |
| 819 | 3300047444 | Ga0495675_0084199 | Ga0495675_0084199_366_1385 | 334 |
| 820 | 3300047446 | Ga0495679_001202 | Ga0495679_001202_3341_4363 | 334 |
| 821 | 3300047447 | Ga0495685_003676 | Ga0495685_003676_2073_3095 | 334 |
| 822 | 3300047470 | Ga0495681_0010866 | Ga0495681_0010866_3569_4591 | 334 |
| 823 | 3300048088 | Ga0495602_0011369 | Ga0495602_0011369_2347_3366 | 334 |
| 824 | 3300048927 | Ga0496124_0024820 | Ga0496124_0024820_2268_3272 | 334 |
| 825 | 3300048927 | Ga0496124_0076307 | Ga0496124_0076307_1347_2369 | 334 |
| 826 | 3300049459 | Ga0495678_000178 | Ga0495678_000178_68545_69567 | 334 |
| 827 | 3300049459 | Ga0495678_003372 | Ga0495678_003372_2440_3462 | 334 |
| 828 | 3300049460 | Ga0495682_0000248 | Ga0495682_0000248_36140_37162 | 334 |
| 829 | 3300046694 | Ga0495649_0091566 | Ga0495649_0091566_513_1520 | 335 |
| 830 | iso_pu_bacteria | 2576861471 | 2578458314 | 335 |
| 831 | iso_pu_bacteria | 2857442823 | 2857443406 | 335 |
| 832 | iso_pu_bacteria | 2939622612 | 2939623690 | 335 |
| 833 | iso_pu_bacteria | 2941475908 | 2941478424 | 335 |
| 834 | iso_pu_bacteria | 2974307012 | 2974308831 | 335 |
| 835 | iso_pu_bacteria | 2977247770 | 2977249550 | 335 |
| 836 | iso_pu_bacteria | 2984514374 | 2984515961 | 335 |
| 837 | iso_pu_bacteria | 8021626552 | 8021628016 | 335 |
| 838 | iso_pu_bacteria | 8021648035 | 8021648927 | 335 |
| 839 | 3300037312 | Ga0395899_0000018 | Ga0395899_0000018_394391_395410 | 336 |
| 840 | 3300044658 | Ga0466972_0001066 | Ga0466972_0001066_4068_5090 | 336 |
| 841 | 3300044683 | Ga0466965_0001602 | Ga0466965_0001602_3280_4302 | 336 |
| 842 | 3300044706 | Ga0466964_0002334 | Ga0466964_0002334_3626_4648 | 336 |
| 843 | 3300044842 | Ga0466957_0070162 | Ga0466957_0070162_263_1285 | 336 |
| 844 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_215799_216821 | 336 |
| 845 | 3300046810 | Ga0495660_0004866 | Ga0495660_0004866_3430_4440 | 336 |
| 846 | 3300005617 | Ga0068859_100184334 | Ga0068859_1001843342 | 337 |
| 847 | 3300006931 | Ga0097620_100184339 | Ga0097620_1001843392 | 337 |
| 848 | 3300006948 | Ga0099826_10080508 | Ga0099826_100805082 | 337 |
| 849 | 3300009174 | Ga0105241_10246310 | Ga0105241_102463102 | 337 |
| 850 | 3300025911 | Ga0207654_10056875 | Ga0207654_100568752 | 337 |
| 851 | 3300028794 | Ga0307515_10014980 | Ga0307515_100149804 | 337 |
| 852 | 3300031456 | Ga0307513_10051744 | Ga0307513_100517443 | 337 |
| 853 | 3300032002 | Ga0307416_100096328 | Ga0307416_1000963282 | 337 |
| 854 | 3300045051 | Ga0451576_0016609 | Ga0451576_0016609_3449_4471 | 337 |
| 855 | 3300046471 | Ga0495650_0068094 | Ga0495650_0068094_93_1115 | 337 |
| 856 | 3300053092 | Ga0500583_0002256 | Ga0500583_0002256_2221_3240 | 337 |
| 857 | 3300053151 | Ga0500604_0006147 | Ga0500604_0006147_1333_2355 | 337 |
| 858 | 3300053153 | Ga0500616_0007463 | Ga0500616_0007463_5770_6792 | 337 |
| 859 | 3300053158 | Ga0500627_0045944 | Ga0500627_0045944_700_1719 | 337 |
| 860 | 3300005547 | Ga0070693_100001802 | Ga0070693_1000018022 | 338 |
| 861 | iso_pu_bacteria | 2690315857 | 2691329255 | 338 |
| 862 | iso_pu_bacteria | 2747842501 | 2748018141 | 338 |
| 863 | iso_pu_bacteria | 2919534386 | 2919537444 | 338 |
| 864 | 3300003781 | Ga0055536_1003467 | Ga0055536_10034674 | 339 |
| 865 | 3300003781 | Ga0055536_1003484 | Ga0055536_10034844 | 339 |
| 866 | 3300003791 | Ga0055530_10000056 | Ga0055530_100000562 | 339 |
| 867 | 3300003791 | Ga0055530_10000168 | Ga0055530_1000016847 | 339 |
| 868 | 3300003794 | Ga0055531_10004512 | Ga0055531_100045124 | 339 |
| 869 | 3300003794 | Ga0055531_10008426 | Ga0055531_100084263 | 339 |
| 870 | 3300006038 | Ga0075365_10081619 | Ga0075365_100816192 | 339 |
| 871 | 3300009011 | Ga0105251_10005338 | Ga0105251_100053385 | 339 |
| 872 | 3300013104 | Ga0157370_10013426 | Ga0157370_100134265 | 339 |
| 873 | 3300014497 | Ga0182008_10000013 | Ga0182008_1000001346 | 339 |
| 874 | 3300014497 | Ga0182008_10029729 | Ga0182008_100297292 | 339 |
| 875 | 3300015261 | Ga0182006_1076790 | Ga0182006_10767902 | 339 |
| 876 | 3300015265 | Ga0182005_1001569 | Ga0182005_10015697 | 339 |
| 877 | 3300017792 | Ga0163161_10035183 | Ga0163161_100351832 | 339 |
| 878 | 3300025245 | Ga0207425_1018172 | Ga0207425_10181722 | 339 |
| 879 | 3300025292 | Ga0209676_1000354 | Ga0209676_100035429 | 339 |
| 880 | 3300025298 | Ga0209050_1000069 | Ga0209050_1000069183 | 339 |
| 881 | 3300025298 | Ga0209050_1025682 | Ga0209050_10256822 | 339 |
| 882 | 3300025299 | Ga0209256_1000965 | Ga0209256_100096522 | 339 |
| 883 | 3300025299 | Ga0209256_1006508 | Ga0209256_10065083 | 339 |
| 884 | 3300025304 | Ga0209257_1000194 | Ga0209257_100019476 | 339 |
| 885 | 3300025304 | Ga0209257_1005408 | Ga0209257_10054088 | 339 |
| 886 | 3300025735 | Ga0207713_1039236 | Ga0207713_10392362 | 339 |
| 887 | 3300042006 | Ga0439432_029018 | Ga0439432_029018_508_1527 | 339 |
| 888 | 3300046460 | Ga0495638_0000604 | Ga0495638_0000604_15498_16517 | 339 |
| 889 | 3300046460 | Ga0495638_0002210 | Ga0495638_0002210_11269_12288 | 339 |
| 890 | 3300046525 | Ga0495663_0000785 | Ga0495663_0000785_8236_9255 | 339 |
| 891 | 3300046558 | Ga0495633_0008714 | Ga0495633_0008714_1420_2439 | 339 |
| 892 | 3300046660 | Ga0495625_0054903 | Ga0495625_0054903_816_1835 | 339 |
| 893 | 3300046660 | Ga0495625_0103307 | Ga0495625_0103307_120_1139 | 339 |
| 894 | 3300046660 | Ga0495625_0223552 | Ga0495625_0223552_94_1113 | 339 |
| 895 | 3300047320 | Ga0495672_0000006 | Ga0495672_0000006_375592_376611 | 339 |
| 896 | 3300047472 | Ga0495686_0006246 | Ga0495686_0006246_5662_6681 | 339 |
| 897 | 3300048913 | Ga0496110_0206371 | Ga0496110_0206371_352_1371 | 339 |
| 898 | 3300048916 | Ga0496113_0191476 | Ga0496113_0191476_411_1430 | 339 |
| 899 | 3300048919 | Ga0496116_0000757 | Ga0496116_0000757_5742_6761 | 339 |
| 900 | 3300048919 | Ga0496116_0028644 | Ga0496116_0028644_1081_2100 | 339 |
| 901 | 3300048920 | Ga0496117_0000065 | Ga0496117_0000065_72493_73512 | 339 |
| 902 | 3300048920 | Ga0496117_0000575 | Ga0496117_0000575_8852_9871 | 339 |
| 903 | 3300048921 | Ga0496118_0000033 | Ga0496118_0000033_252846_253865 | 339 |
| 904 | 3300048921 | Ga0496118_0000382 | Ga0496118_0000382_23726_24745 | 339 |
| 905 | 3300048921 | Ga0496118_0000557 | Ga0496118_0000557_3084_4103 | 339 |
| 906 | 3300048924 | Ga0496121_0002039 | Ga0496121_0002039_10619_11638 | 339 |
| 907 | 3300048925 | Ga0496122_0001066 | Ga0496122_0001066_37760_38779 | 339 |
| 908 | 3300048925 | Ga0496122_0001384 | Ga0496122_0001384_18597_19616 | 339 |
| 909 | 3300048926 | Ga0496123_0000419 | Ga0496123_0000419_8932_9951 | 339 |
| 910 | 3300048926 | Ga0496123_0008591 | Ga0496123_0008591_931_1950 | 339 |
| 911 | 3300048926 | Ga0496123_0014468 | Ga0496123_0014468_1658_2677 | 339 |
| 912 | 3300048927 | Ga0496124_0000569 | Ga0496124_0000569_53379_54398 | 339 |
| 913 | 3300048927 | Ga0496124_0003340 | Ga0496124_0003340_9591_10610 | 339 |
| 914 | 3300048927 | Ga0496124_0008940 | Ga0496124_0008940_6375_7394 | 339 |
| 915 | 3300048927 | Ga0496124_0009726 | Ga0496124_0009726_3110_4129 | 339 |
| 916 | 3300048927 | Ga0496124_0089965 | Ga0496124_0089965_692_1711 | 339 |
| 917 | 3300048928 | Ga0496125_0004414 | Ga0496125_0004414_13320_14339 | 339 |
| 918 | 3300048929 | Ga0496126_0079388 | Ga0496126_0079388_1085_2104 | 339 |
| 919 | 3300048929 | Ga0496126_0321628 | Ga0496126_0321628_120_1139 | 339 |
| 920 | 3300050492 | nmdc:mga0yw44_3099_c1 | nmdc:mga0yw44_3099_c1_404_1423 | 339 |
| 921 | 3300053128 | Ga0500626_005836 | Ga0500626_005836_1192_2211 | 339 |
| 922 | 3300005333 | Ga0070677_10041023 | Ga0070677_100410232 | 340 |
| 923 | 3300005356 | Ga0070674_100094663 | Ga0070674_1000946632 | 340 |
| 924 | 3300005548 | Ga0070665_100104534 | Ga0070665_1001045342 | 340 |
| 925 | 3300005841 | Ga0068863_100282113 | Ga0068863_1002821132 | 340 |
| 926 | 3300006358 | Ga0068871_100071864 | Ga0068871_1000718643 | 340 |
| 927 | 3300014325 | Ga0163163_10254585 | Ga0163163_102545852 | 340 |
| 928 | 3300025292 | Ga0209676_1010724 | Ga0209676_10107243 | 340 |
| 929 | 3300025294 | Ga0209025_1007736 | Ga0209025_10077363 | 340 |
| 930 | 3300041404 | Ga0439436_0012373 | Ga0439436_0012373_1338_2360 | 340 |
| 931 | 3300042007 | Ga0439449_0000144 | Ga0439449_0000144_21801_22823 | 340 |
| 932 | 3300046691 | Ga0495670_0048652 | Ga0495670_0048652_39_1061 | 340 |
| 933 | 3300048920 | Ga0496117_0060828 | Ga0496117_0060828_1267_2304 | 340 |
| 934 | 3300049568 | Ga0501031_0107988 | Ga0501031_0107988_736_1758 | 340 |
| 935 | 3300049569 | Ga0501032_0019857 | Ga0501032_0019857_180_1202 | 340 |
| 936 | 3300049571 | Ga0501034_0106416 | Ga0501034_0106416_736_1764 | 340 |
| 937 | 3300049573 | Ga0501037_0088170 | Ga0501037_0088170_517_1545 | 340 |
| 938 | 3300049574 | Ga0501038_0175998 | Ga0501038_0175998_385_1413 | 340 |
| 939 | 3300049574 | Ga0501038_0254452 | Ga0501038_0254452_125_1147 | 340 |
| 940 | 3300049575 | Ga0501039_0018765 | Ga0501039_0018765_4118_5146 | 340 |
| 941 | 3300049579 | Ga0501043_0257407 | Ga0501043_0257407_189_1211 | 340 |
| 942 | 3300049580 | Ga0501046_0008689 | Ga0501046_0008689_4794_5816 | 340 |
| 943 | 3300049580 | Ga0501046_0080098 | Ga0501046_0080098_361_1389 | 340 |
| 944 | 3300049580 | Ga0501046_0114398 | Ga0501046_0114398_758_1786 | 340 |
| 945 | 3300049580 | Ga0501046_0188502 | Ga0501046_0188502_402_1439 | 340 |
| 946 | 3300049581 | Ga0501047_0006271 | Ga0501047_0006271_1605_2633 | 340 |
| 947 | 3300049581 | Ga0501047_0294483 | Ga0501047_0294483_195_1217 | 340 |
| 948 | 3300049581 | Ga0501047_0319198 | Ga0501047_0319198_250_1278 | 340 |
| 949 | 3300049585 | Ga0501069_0031520 | Ga0501069_0031520_30_1058 | 340 |
| 950 | 3300049822 | Ga0501035_0026768 | Ga0501035_0026768_3370_4398 | 340 |
| 951 | 3300049822 | Ga0501035_0207431 | Ga0501035_0207431_321_1343 | 340 |
| 952 | 3300049823 | Ga0501044_0021716 | Ga0501044_0021716_299_1327 | 340 |
| 953 | 3300049823 | Ga0501044_0293691 | Ga0501044_0293691_427_1449 | 340 |
| 954 | 3300053156 | Ga0500622_0022344 | Ga0500622_0022344_1495_2532 | 340 |
| 955 | iso_pu_bacteria | 8003014200 | 8003016883 | 340 |
| 956 | 3300001990 | JGI24737J22298_10001060 | JGI24737J22298_100010602 | 343 |
| 957 | 3300005985 | Ga0081539_10011361 | Ga0081539_100113615 | 343 |
| 958 | 3300044842 | Ga0466957_0206970 | Ga0466957_0206970_77_1108 | 343 |
| 959 | 3300045976 | Ga0466967_0360652 | Ga0466967_0360652_72_1103 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hfb-assembly1.cif.gz_B | evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis | 0.8564 | 148 | 261 |
| 6ax3-assembly1.cif.gz_A | complex structure of jmjd5 and symmetric dimethyl-arginine (sdma) | 0.8548 | 5 | 264 |
| 1y3t-assembly1.cif.gz_B | crystal structure of yxag, a dioxygenase from bacillus subtilis | 0.8538 | 148 | 262 |
| 6ax3-assembly1.cif.gz_A | complex structure of jmjd5 and symmetric dimethyl-arginine (sdma) | 0.8516 | 5 | 264 |
| 6f4r-assembly1.cif.gz_A | human jmjd5 (n308c) in complex with mn(ii), nog and rccd1 (139-143) (complex-3) | 0.8501 | 7 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q17765_350_577_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8594 | 10 | 262 | 2.60.120.650 |
| af_A0A0P0XHH9_265_498_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8567 | 6 | 263 | 2.60.120.650 |
| af_Q9W0M3_161_400_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8551 | 8 | 263 | 2.60.120.650 |
| af_A0A0P0XHH9_265_498_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8533 | 6 | 263 | 2.60.120.650 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.852 | 143 | 262 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6NZ42-F1-model_v4 | JmjC domain-containing protein | 0.9906 | 5 | 343 |
|
| AF-A0A520FKW9-F1-model_v4 | deleted | 0.9878 | 1 | 343 |
|
| AF-A0A4Q6CEE4-F1-model_v4 | Cupin-like domain-containing protein | 0.987 | 22 | 343 |
|
| AF-A0A3R7VLW9-F1-model_v4 | deleted | 0.9866 | 6 | 343 |
|
| AF-A0A4P8HVQ4-F1-model_v4 | Uncharacterized protein | 0.9859 | 5 | 343 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar