F486829

General Info

Members Datasets Scaffolds Average Seq Length
959 414 934 337

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_46200_c1|nmdc:mga0rr50_46200_c1_513_1703
Length 396
Sequence LNQASIQIKIGAATAGTHPVPLAGSSGRAGLERPVDPERALRQHRWRLFGPHAMKPSTTEPGRISEYRDVDAVTFREEIVSRYRPAVLRGLVAQWPAVQRARTSIQAIGQYLSAFDKGGAVDVMMMPPHVHGRLFYSDDMRGFNFSRSKASIGEVSDKLLRYAKFEGRPSLAVQSALIADCLPGFASENRLAILDESVQPRIWLGNVVTTPAHFDESNNVACVVSGTRRFTLFPPEQIANLYIGPLGHAPTGTPISLVSLANPDFERFPRFRDALASALVAELEPGDAIYIPTLWWHHVQSLAKYNILVNYWWKGQVDAERVSDSALNCLLHCLLTLKDLPAEQRQVWRTLFDYYIFSANPRSVEHIPEQVRGVLGEISPELAKQVKAFLVTQLQR

Samples

Sample ID Description Type Environment
1 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
9 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2818991457 Xanthomonas translucens 569 Isolate Unclassified
13 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
14 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
15 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
16 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
17 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
18 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
19 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
20 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
21 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
22 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
218 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
249 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
250 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
253 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
280 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
397 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
399 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
403 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
410 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
411 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
412 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
413 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
414 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.1
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 10.01
Nodule 0.31
Rhizoplane 3.02
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001060 3300001990 Bacteria 9709
2 JGI24735J21928_10001233 3300002067 Bacteria 9087
3 JGI25165J46597_1001272 3300003214 Bacteria 14759
4 JGI25153J46596_10023669 3300003215 Bacteria 2233
5 rootH2_10023272 3300003320 Bacteria 8740
6 rootH2_10155199 3300003320 Bacteria 3317
7 rootH2_10180229 3300003320 Bacteria 1733
8 rootL2_10002566 3300003322 Bacteria 5393
9 rootL2_10220746 3300003322 Bacteria 1519
10 rootH1_10021415 3300003323 Bacteria 26101
11 rootH1_10039841 3300003316 Bacteria 6678
12 rootH1_10039841 3300003323 Bacteria 86560
13 Ga0055539_1000638 3300003752 Bacteria 9365
14 Ga0055535_1000387 3300003761 Bacteria 41727
15 Ga0055529_1000195 3300003763 Bacteria 82315
16 Ga0055526_1001611 3300003771 Bacteria 15841
17 Ga0055537_1000244 3300003773 Bacteria 39860
18 Ga0055524_1000010 3300003775 Bacteria 282893
19 Ga0055524_1005546 3300003775 Bacteria 5610
20 Ga0055536_1001570 3300003781 Bacteria 13668
21 Ga0055536_1003467 3300003781 Bacteria 8454
22 Ga0055536_1003484 3300003781 Bacteria 8436
23 Ga0055534_1000030 3300003784 Bacteria 121396
24 Ga0055534_1000219 3300003784 Bacteria 42036
25 Ga0055528_1000340 3300003790 Bacteria 38910
26 Ga0055528_1008032 3300003790 Bacteria 4582
27 Ga0055530_10000056 3300003791 Bacteria 100874
28 Ga0055530_10000168 3300003791 Bacteria 59457
29 Ga0055530_10000664 3300003791 Bacteria 29365
30 Ga0055530_10002027 3300003791 Bacteria 13694
31 Ga0055531_10004512 3300003794 Bacteria 8454
32 Ga0055531_10008426 3300003794 Bacteria 5439
33 Ga0065165_1002523 3300005262 Bacteria 15241
34 Ga0065165_1034780 3300005262 Bacteria 1554
35 Ga0065165_1049412 3300005262 Bacteria 1203
36 Ga0065712_10111141 3300005290 Bacteria 1823
37 Ga0065707_10081991 3300005295 Bacteria 25855
38 Ga0070658_10000199 3300005327 Bacteria 52822
39 Ga0070658_10008396 3300005327 Bacteria 8302
40 Ga0070658_10040607 3300005327 Bacteria 3754
41 Ga0070658_10076225 3300005327 Bacteria 2750
42 Ga0070676_10005363 3300005328 Bacteria 6829
43 Ga0070683_100034599 3300005329 Bacteria 4616
44 Ga0070683_100071615 3300005329 Bacteria 3234
45 Ga0070690_100027170 3300005330 Bacteria 3536
46 Ga0070690_100051971 3300005330 Bacteria 2618
47 Ga0070677_10041023 3300005333 Bacteria 1825
48 Ga0068869_100131228 3300005334 Bacteria 1926
49 Ga0070666_10108357 3300005335 Bacteria 1919
50 Ga0070680_100026810 3300005336 Bacteria 4609
51 Ga0070680_100114992 3300005336 Bacteria 2241
52 Ga0068868_100017884 3300005338 Bacteria 5288
53 Ga0070660_100000665 3300005339 Bacteria 22740
54 Ga0070660_100015100 3300005339 Bacteria 5573
55 Ga0070689_100050000 3300005340 Bacteria 3229
56 Ga0070691_10056239 3300005341 Bacteria 1885
57 Ga0070661_100002145 3300005344 Bacteria 13596
58 Ga0070661_100005541 3300005344 Bacteria 8702
59 Ga0070692_10058791 3300005345 Bacteria 2020
60 Ga0070675_100166202 3300005354 Bacteria 1900
61 Ga0070671_100028749 3300005355 Bacteria 4581
62 Ga0070674_100094663 3300005356 Bacteria 2164
63 Ga0070673_100000094 3300005364 Bacteria 39584
64 Ga0070673_100043679 3300005364 Bacteria 3465
65 Ga0070659_100004192 3300005366 Bacteria 10287
66 Ga0070659_100009487 3300005366 Bacteria 7151
67 Ga0070659_100010651 3300005366 Bacteria 6771
68 Ga0070659_100241568 3300005366 Bacteria 1495
69 Ga0070709_10186491 3300005434 Bacteria 1460
70 Ga0070714_100016222 3300005435 Bacteria 6008
71 Ga0070714_100018544 3300005435 Bacteria 5655
72 Ga0070714_100144956 3300005435 Bacteria 2135
73 Ga0070714_100237003 3300005435 Bacteria 1683
74 Ga0070713_100038870 3300005436 Bacteria 3859
75 Ga0070711_100099275 3300005439 Unclassified 2115
76 Ga0070663_100002094 3300005455 Bacteria 11164
77 Ga0070663_100013961 3300005455 Bacteria 5142
78 Ga0070662_100132406 3300005457 Bacteria 1924
79 Ga0070662_100145301 3300005457 Bacteria 1842
80 Ga0070681_10002376 3300005458 Bacteria 17189
81 Ga0070681_10054150 3300005458 Bacteria 3997
82 Ga0070681_10102190 3300005458 Bacteria 2812
83 Ga0068867_100000202 3300005459 Bacteria 39594
84 Ga0068867_100069424 3300005459 Bacteria 2632
85 Ga0070706_100028276 3300005467 Bacteria 5162
86 Ga0070706_100101529 3300005467 Bacteria 2673
87 Ga0070707_100051345 3300005468 Bacteria 3954
88 Ga0070699_100033798 3300005518 Bacteria 4419
89 Ga0070699_100039597 3300005518 Bacteria 4080
90 Ga0070699_100309784 3300005518 Bacteria 1417
91 Ga0070679_100080023 3300005530 Bacteria 3257
92 Ga0070679_100095255 3300005530 Bacteria 2965
93 Ga0070679_100180840 3300005530 Bacteria 2081
94 Ga0070679_100263932 3300005530 Bacteria 1677
95 Ga0070679_100291015 3300005530 Bacteria 1585
96 Ga0070697_100054002 3300005536 Bacteria 3265
97 Ga0070697_100072202 3300005536 Bacteria 2832
98 Ga0070697_100102787 3300005536 Bacteria 2375
99 Ga0068853_100028920 3300005539 Bacteria 4666
100 Ga0068853_100035161 3300005539 Bacteria 4255
101 Ga0068853_100064349 3300005539 Bacteria 3180
102 Ga0068853_100106756 3300005539 Bacteria 2482
103 Ga0070693_100001654 3300005547 Bacteria 10088
104 Ga0070693_100001802 3300005547 Bacteria 9762
105 Ga0070693_100092020 3300005547 Bacteria 1830
106 Ga0070665_100000894 3300005548 Bacteria 38327
107 Ga0070665_100002017 3300005548 Bacteria 22832
108 Ga0070665_100022797 3300005548 Bacteria 6303
109 Ga0070665_100049336 3300005548 Bacteria 4224
110 Ga0070665_100101390 3300005548 Bacteria 2882
111 Ga0070665_100104534 3300005548 Bacteria 2834
112 Ga0068855_100001261 3300005563 Bacteria 31420
113 Ga0068855_100033668 3300005563 Bacteria 6113
114 Ga0068855_100082538 3300005563 Bacteria 3725
115 Ga0068855_100116518 3300005563 Bacteria 3062
116 Ga0068855_100151776 3300005563 Bacteria 2634
117 Ga0068855_100160973 3300005563 Bacteria 2548
118 Ga0070664_100006965 3300005564 Bacteria 9112
119 Ga0070664_100098331 3300005564 Bacteria 2542
120 Ga0070664_100104731 3300005564 Bacteria 2463
121 Ga0070664_100256447 3300005564 Bacteria 1573
122 Ga0068857_100002632 3300005577 Bacteria 14734
123 Ga0068857_100277425 3300005577 Unclassified 1541
124 Ga0068854_100002955 3300005578 Bacteria 10546
125 Ga0068854_100014084 3300005578 Bacteria 5264
126 Ga0068854_100086291 3300005578 Bacteria 2326
127 Ga0068854_100232270 3300005578 Bacteria 1464
128 Ga0068854_100321989 3300005578 Bacteria 1257
129 Ga0068856_100008073 3300005614 Bacteria 10275
130 Ga0068856_100088973 3300005614 Bacteria 3070
131 Ga0068852_100008465 3300005616 Bacteria 7583
132 Ga0068852_100036281 3300005616 Bacteria 4124
133 Ga0068852_100046405 3300005616 Bacteria 3702
134 Ga0068852_100159710 3300005616 Bacteria 2104
135 Ga0068859_100184334 3300005617 Bacteria 2171
136 Ga0068859_100344749 3300005617 Bacteria 1584
137 Ga0068864_100081378 3300005618 Bacteria 2839
138 Ga0068866_10005953 3300005718 Bacteria 5071
139 Ga0068861_100008866 3300005719 Bacteria 6933
140 Ga0068861_100242951 3300005719 Bacteria 1532
141 Ga0068851_10157580 3300005834 Bacteria 1245
142 Ga0068863_100282113 3300005841 Bacteria 1609
143 Ga0068858_100085691 3300005842 Bacteria 2931
144 Ga0068860_100042046 3300005843 Bacteria 4367
145 Ga0068860_100168308 3300005843 Bacteria 2116
146 Ga0068862_100010147 3300005844 Bacteria 7771
147 Ga0081539_10011361 3300005985 Bacteria 7051
148 Ga0075365_10081619 3300006038 Bacteria 2191
149 Ga0070716_100073564 3300006173 Bacteria 2016
150 Ga0070712_100042678 3300006175 Bacteria 3119
151 Ga0070712_100144827 3300006175 Bacteria 1817
152 Ga0075369_10004557 3300006186 Bacteria 5132
153 Ga0075366_10138617 3300006195 Bacteria 1470
154 Ga0097621_100076899 3300006237 Bacteria 2769
155 Ga0097621_100206386 3300006237 Bacteria 1707
156 Ga0075370_10001687 3300006353 Bacteria 9794
157 Ga0068871_100054443 3300006358 Bacteria 3246
158 Ga0068871_100071864 3300006358 Bacteria 2847
159 Ga0068871_100121153 3300006358 Bacteria 2209
160 Ga0075428_100031973 3300006844 Bacteria 5813
161 Ga0075430_100006166 3300006846 Bacteria 10104
162 Ga0075431_100021591 3300006847 Bacteria 6585
163 Ga0075431_100034546 3300006847 Bacteria 5209
164 Ga0075433_10008489 3300006852 Bacteria 8198
165 Ga0075433_10170230 3300006852 Bacteria 1938
166 Ga0075434_100001830 3300006871 Bacteria 18355
167 Ga0075434_100145771 3300006871 Bacteria 2388
168 Ga0075429_100059872 3300006880 Bacteria 3318
169 Ga0068865_100000123 3300006881 Bacteria 39584
170 Ga0068865_100238121 3300006881 Bacteria 1431
171 Ga0097620_100184339 3300006931 Bacteria 2171
172 Ga0097620_100344768 3300006931 Bacteria 1584
173 Ga0099826_10000002 3300006948 Bacteria 1125830
174 Ga0099826_10080508 3300006948 Bacteria 2030
175 Ga0075435_100290690 3300007076 Bacteria 1396
176 Ga0105251_10005338 3300009011 Bacteria 8439
177 Ga0105244_10003017 3300009036 Bacteria 12355
178 Ga0105240_10001162 3300009093 Bacteria 46146
179 Ga0105240_10001872 3300009093 Bacteria 34979
180 Ga0105240_10003430 3300009093 Bacteria 24640
181 Ga0105240_10015370 3300009093 Bacteria 10409
182 Ga0105240_10019223 3300009093 Bacteria 9132
183 Ga0105240_10026360 3300009093 Bacteria 7625
184 Ga0105240_10040184 3300009093 Bacteria 5987
185 Ga0105240_10058942 3300009093 Bacteria 4792
186 Ga0105240_10090706 3300009093 Bacteria 3735
187 Ga0105240_10097332 3300009093 Bacteria 3586
188 Ga0105240_10203674 3300009093 Bacteria 2317
189 Ga0105240_10249255 3300009093 Bacteria 2055
190 Ga0105240_10319213 3300009093 Bacteria 1771
191 Ga0111539_10014312 3300009094 Bacteria 9906
192 Ga0111539_10559751 3300009094 Bacteria 1332
193 Ga0105245_10037993 3300009098 Bacteria 4282
194 Ga0105245_10114724 3300009098 Bacteria 2509
195 Ga0105247_10066340 3300009101 Bacteria 2247
196 Ga0114129_10061810 3300009147 Bacteria 5234
197 Ga0105243_10000794 3300009148 Bacteria 30172
198 Ga0105243_10229752 3300009148 Bacteria 1645
199 Ga0105241_10033744 3300009174 Bacteria 3843
200 Ga0105241_10154297 3300009174 Bacteria 1881
201 Ga0105241_10246310 3300009174 Bacteria 1513
202 Ga0105242_10000655 3300009176 Bacteria 27107
203 Ga0105242_10027366 3300009176 Bacteria 4526
204 Ga0105242_10332237 3300009176 Bacteria 1398
205 Ga0105242_10443690 3300009176 Bacteria 1222
206 Ga0105242_10510731 3300009176 Bacteria 1145
207 Ga0105248_10041522 3300009177 Bacteria 5157
208 Ga0105248_10090599 3300009177 Bacteria 3443
209 Ga0105248_10100561 3300009177 Bacteria 3258
210 Ga0105237_10017953 3300009545 Bacteria 7330
211 Ga0105237_10024588 3300009545 Bacteria 6159
212 Ga0105237_10033576 3300009545 Bacteria 5199
213 Ga0105237_10149784 3300009545 Bacteria 2329
214 Ga0105237_10153172 3300009545 Unclassified 2302
215 Ga0105237_10407828 3300009545 Bacteria 1364
216 Ga0105237_10453498 3300009545 Bacteria 1288
217 Ga0105238_10006972 3300009551 Bacteria 11290
218 Ga0105238_10041811 3300009551 Bacteria 4642
219 Ga0105238_10129475 3300009551 Unclassified 2502
220 Ga0105238_10148434 3300009551 Bacteria 2321
221 Ga0105249_10034746 3300009553 Bacteria 4568
222 Ga0105249_10088876 3300009553 Bacteria 2886
223 Ga0105249_10103516 3300009553 Bacteria 2681
224 Ga0105239_10009730 3300010375 Bacteria 10807
225 Ga0105239_10046917 3300010375 Bacteria 4733
226 Ga0105239_10080514 3300010375 Bacteria 3583
227 Ga0105239_10173252 3300010375 Bacteria 2413
228 Ga0105239_10202440 3300010375 Bacteria 2224
229 Ga0105246_10015636 3300011119 Bacteria 4794
230 Ga0105246_10215684 3300011119 Bacteria 1501
231 Ga0157373_10134857 3300013100 Bacteria 1736
232 Ga0157370_10001541 3300013104 Bacteria 28510
233 Ga0157370_10005410 3300013104 Bacteria 14325
234 Ga0157370_10013426 3300013104 Bacteria 8438
235 Ga0157370_10121627 3300013104 Bacteria 2437
236 Ga0157370_10485222 3300013104 Bacteria 1135
237 Ga0157369_10083491 3300013105 Bacteria 3416
238 Ga0157369_10185303 3300013105 Bacteria 2189
239 Ga0157369_10300382 3300013105 Bacteria 1670
240 Ga0157369_10378038 3300013105 Bacteria 1470
241 Ga0157369_10448340 3300013105 Bacteria 1336
242 Ga0157369_10468512 3300013105 Bacteria 1304
243 Ga0157374_10009427 3300013296 Bacteria 8380
244 Ga0157374_10047556 3300013296 Bacteria 3978
245 Ga0157374_10207730 3300013296 Bacteria 1919
246 Ga0157374_10212371 3300013296 Unclassified 1897
247 Ga0157378_10096164 3300013297 Bacteria 2699
248 Ga0157378_10219689 3300013297 Bacteria 1806
249 Ga0157378_10295180 3300013297 Bacteria 1567
250 Ga0157372_10021717 3300013307 Bacteria 6938
251 Ga0157372_10142697 3300013307 Bacteria 2761
252 Ga0157372_10250363 3300013307 Bacteria 2056
253 Ga0157372_10498548 3300013307 Bacteria 1420
254 Ga0163163_10254585 3300014325 Bacteria 1806
255 Ga0157380_10000779 3300014326 Bacteria 19967
256 Ga0182008_10000013 3300014497 Bacteria 286492
257 Ga0182008_10029729 3300014497 Bacteria 2758
258 Ga0157376_10000220 3300014969 Bacteria 39580
259 Ga0157376_10111488 3300014969 Bacteria 2409
260 Ga0182006_1076790 3300015261 Bacteria 1226
261 Ga0182007_10000004 3300015262 Bacteria 485875
262 Ga0182005_1001569 3300015265 Bacteria 9028
263 Ga0163161_10007435 3300017792 Bacteria 7569
264 Ga0163161_10035183 3300017792 Bacteria 3584
265 Ga0163161_10038272 3300017792 Bacteria 3440
266 Ga0213876_10000178 3300021384 Bacteria 65721
267 Ga0209563_100003 3300025230 Bacteria 1932942
268 Ga0207427_103171 3300025231 Bacteria 3660
269 Ga0209258_100291 3300025242 Bacteria 82373
270 Ga0209258_100872 3300025242 Bacteria 15897
271 Ga0207425_1018172 3300025245 Bacteria 1529
272 Ga0209026_1001218 3300025250 Bacteria 11877
273 Ga0209148_1000059 3300025254 Bacteria 350224
274 Ga0209148_1000394 3300025254 Bacteria 51565
275 Ga0209148_1002813 3300025254 Bacteria 5408
276 Ga0209148_1002879 3300025254 Bacteria 5276
277 Ga0209759_1002075 3300025256 Bacteria 9373
278 Ga0209233_1000003 3300025261 Bacteria 1607366
279 Ga0209565_1000024 3300025263 Bacteria 379907
280 Ga0209565_1000179 3300025263 Bacteria 79300
281 Ga0209455_1000208 3300025272 Bacteria 83420
282 Ga0209455_1000610 3300025272 Bacteria 22718
283 Ga0209673_1000237 3300025273 Bacteria 106342
284 Ga0209673_1001240 3300025273 Bacteria 26584
285 Ga0209675_1000107 3300025291 Bacteria 119593
286 Ga0209675_1002110 3300025291 Bacteria 10537
287 Ga0209676_1000011 3300025292 Bacteria 860463
288 Ga0209676_1000253 3300025292 Bacteria 113412
289 Ga0209676_1000354 3300025292 Bacteria 86753
290 Ga0209676_1002027 3300025292 Bacteria 15881
291 Ga0209676_1010724 3300025292 Bacteria 3776
292 Ga0209025_1007736 3300025294 Bacteria 7922
293 Ga0209564_1000422 3300025295 Bacteria 74531
294 Ga0209564_1013712 3300025295 Bacteria 3419
295 Ga0209758_1002900 3300025297 Bacteria 16557
296 Ga0209050_1000032 3300025298 Bacteria 456335
297 Ga0209050_1000069 3300025298 Bacteria 297615
298 Ga0209050_1000649 3300025298 Bacteria 53856
299 Ga0209050_1025682 3300025298 Bacteria 1994
300 Ga0209256_1000007 3300025299 Bacteria 1136599
301 Ga0209256_1000965 3300025299 Bacteria 34676
302 Ga0209256_1006508 3300025299 Bacteria 6143
303 Ga0209256_1018485 3300025299 Bacteria 2261
304 Ga0209051_1001126 3300025303 Bacteria 24440
305 Ga0209051_1002524 3300025303 Bacteria 12967
306 Ga0209257_1000014 3300025304 Bacteria 946850
307 Ga0209257_1000194 3300025304 Bacteria 150624
308 Ga0209257_1005408 3300025304 Bacteria 8983
309 Ga0209257_1007938 3300025304 Bacteria 6224
310 Ga0207655_1001866 3300025728 Bacteria 18158
311 Ga0207713_1039236 3300025735 Bacteria 1999
312 Ga0207680_10142096 3300025903 Bacteria 1592
313 Ga0207699_10108858 3300025906 Bacteria 1772
314 Ga0207645_10018197 3300025907 Bacteria 4628
315 Ga0207705_10000002 3300025909 Bacteria 2046852
316 Ga0207705_10000354 3300025909 Bacteria 41477
317 Ga0207705_10001638 3300025909 Bacteria 17774
318 Ga0207684_10024343 3300025910 Bacteria 5163
319 Ga0207684_10068684 3300025910 Bacteria 3011
320 Ga0207684_10305149 3300025910 Bacteria 1372
321 Ga0207654_10017619 3300025911 Bacteria 3738
322 Ga0207654_10056875 3300025911 Bacteria 2271
323 Ga0207707_10002777 3300025912 Bacteria 15616
324 Ga0207707_10059893 3300025912 Bacteria 3313
325 Ga0207707_10126652 3300025912 Bacteria 2234
326 Ga0207707_10161757 3300025912 Unclassified 1957
327 Ga0207695_10003912 3300025913 Bacteria 20607
328 Ga0207695_10005836 3300025913 Bacteria 16191
329 Ga0207695_10008285 3300025913 Bacteria 13036
330 Ga0207695_10022428 3300025913 Bacteria 7165
331 Ga0207695_10040862 3300025913 Bacteria 4967
332 Ga0207695_10067718 3300025913 Bacteria 3661
333 Ga0207695_10070174 3300025913 Bacteria 3583
334 Ga0207695_10076080 3300025913 Bacteria 3414
335 Ga0207695_10081284 3300025913 Bacteria 3279
336 Ga0207671_10020155 3300025914 Bacteria 5081
337 Ga0207671_10126783 3300025914 Bacteria 1956
338 Ga0207671_10336798 3300025914 Bacteria 1195
339 Ga0207693_10004578 3300025915 Bacteria 11670
340 Ga0207660_10001881 3300025917 Bacteria 13992
341 Ga0207660_10137755 3300025917 Bacteria 1864
342 Ga0207660_10315043 3300025917 Bacteria 1248
343 Ga0207660_10366691 3300025917 Bacteria 1156
344 Ga0207657_10001150 3300025919 Bacteria 28145
345 Ga0207657_10004105 3300025919 Bacteria 15466
346 Ga0207657_10015382 3300025919 Bacteria 7413
347 Ga0207649_10003619 3300025920 Bacteria 8439
348 Ga0207652_10002553 3300025921 Bacteria 15275
349 Ga0207652_10018371 3300025921 Bacteria 5733
350 Ga0207652_10140729 3300025921 Bacteria 2157
351 Ga0207652_10308289 3300025921 Bacteria 1429
352 Ga0207652_10315304 3300025921 Bacteria 1412
353 Ga0207646_10001282 3300025922 Bacteria 31406
354 Ga0207694_10020923 3300025924 Bacteria 4953
355 Ga0207694_10023181 3300025924 Bacteria 4713
356 Ga0207694_10042419 3300025924 Bacteria 3509
357 Ga0207659_10326802 3300025926 Bacteria 1267
358 Ga0207700_10057740 3300025928 Bacteria 2928
359 Ga0207664_10000197 3300025929 Bacteria 45209
360 Ga0207664_10354770 3300025929 Bacteria 1298
361 Ga0207690_10001754 3300025932 Bacteria 13317
362 Ga0207706_10038186 3300025933 Bacteria 4260
363 Ga0207706_10076169 3300025933 Bacteria 2951
364 Ga0207686_10001104 3300025934 Bacteria 15710
365 Ga0207686_10030398 3300025934 Bacteria 3197
366 Ga0207686_10038374 3300025934 Bacteria 2898
367 Ga0207709_10000254 3300025935 Bacteria 63973
368 Ga0207709_10130726 3300025935 Bacteria 1711
369 Ga0207670_10026013 3300025936 Bacteria 3683
370 Ga0207704_10000133 3300025938 Bacteria 40529
371 Ga0207665_10050752 3300025939 Bacteria 2790
372 Ga0207711_10147227 3300025941 Bacteria 2122
373 Ga0207689_10001230 3300025942 Bacteria 24641
374 Ga0207689_10089926 3300025942 Bacteria 2522
375 Ga0207661_10056936 3300025944 Unclassified 3141
376 Ga0207679_10009072 3300025945 Bacteria 6354
377 Ga0207679_10160279 3300025945 Bacteria 1841
378 Ga0207679_10247463 3300025945 Bacteria 1514
379 Ga0207667_10000116 3300025949 Bacteria 128218
380 Ga0207667_10005682 3300025949 Bacteria 15205
381 Ga0207667_10006471 3300025949 Bacteria 14174
382 Ga0207667_10019038 3300025949 Bacteria 7674
383 Ga0207667_10076365 3300025949 Bacteria 3476
384 Ga0207667_10139213 3300025949 Bacteria 2499
385 Ga0207667_10152042 3300025949 Bacteria 2382
386 Ga0207667_10162201 3300025949 Bacteria 2299
387 Ga0207651_10000012 3300025960 Bacteria 189928
388 Ga0207651_10092619 3300025960 Bacteria 2217
389 Ga0207640_10000021 3300025981 Bacteria 168138
390 Ga0207658_10156895 3300025986 Bacteria 1861
391 Ga0207703_10014632 3300026035 Bacteria 6120
392 Ga0207639_10005643 3300026041 Bacteria 8469
393 Ga0207639_10024259 3300026041 Bacteria 4387
394 Ga0207639_10137112 3300026041 Bacteria 2034
395 Ga0207639_10260801 3300026041 Unclassified 1516
396 Ga0207678_10005690 3300026067 Bacteria 11131
397 Ga0207702_10005695 3300026078 Bacteria 10866
398 Ga0207702_10030558 3300026078 Bacteria 4488
399 Ga0207702_10086540 3300026078 Bacteria 2733
400 Ga0207641_10272584 3300026088 Bacteria 1588
401 Ga0207648_10000628 3300026089 Bacteria 39541
402 Ga0207648_10197105 3300026089 Bacteria 1786
403 Ga0207674_10002241 3300026116 Bacteria 24492
404 Ga0207674_10004133 3300026116 Bacteria 17557
405 Ga0207674_10326551 3300026116 Bacteria 1484
406 Ga0207674_10358479 3300026116 Bacteria 1410
407 Ga0207698_10000754 3300026142 Bacteria 18785
408 Ga0207698_10053238 3300026142 Bacteria 3105
409 Ga0207698_10061744 3300026142 Bacteria 2922
410 Ga0207698_10275707 3300026142 Bacteria 1553
411 Ga0209282_1000001 3300027666 Bacteria 2450367
412 Ga0209974_10039278 3300027876 Bacteria 1574
413 Ga0207428_10010044 3300027907 Bacteria 8472
414 Ga0265354_1000560 3300028016 Bacteria 6357
415 Ga0268266_10001496 3300028379 Bacteria 27627
416 Ga0268266_10004360 3300028379 Bacteria 13596
417 Ga0268266_10014895 3300028379 Bacteria 6677
418 Ga0268266_10147209 3300028379 Bacteria 2119
419 Ga0268265_10025414 3300028380 Bacteria 4203
420 Ga0268265_10037847 3300028380 Bacteria 3543
421 Ga0268264_10158773 3300028381 Bacteria 2035
422 Ga0265336_10000032 3300028666 Bacteria 167925
423 Ga0307515_10014980 3300028794 Bacteria 14323
424 Ga0307515_10041594 3300028794 Bacteria 7218
425 Ga0316176_1102927 3300030732 Bacteria 4315
426 Ga0265770_1000540 3300030878 Bacteria 5255
427 Ga0307513_10051744 3300031456 Bacteria 4428
428 Ga0307513_10159844 3300031456 Bacteria 2147
429 Ga0307513_10186899 3300031456 Bacteria 1928
430 Ga0307408_100004051 3300031548 Bacteria 9994
431 Ga0316578_10030767 3300031728 Bacteria 3054
432 Ga0307516_10000068 3300031730 Bacteria 111515
433 Ga0307516_10001773 3300031730 Bacteria 29682
434 Ga0307516_10037833 3300031730 Bacteria 4820
435 Ga0307405_10002816 3300031731 Bacteria 7810
436 Ga0307410_10028523 3300031852 Bacteria 3542
437 Ga0307407_10021778 3300031903 Bacteria 3313
438 Ga0307409_100034119 3300031995 Bacteria 3712
439 Ga0307416_100000858 3300032002 Bacteria 15992
440 Ga0307416_100096328 3300032002 Bacteria 2559
441 Ga0307414_10250336 3300032004 Bacteria 1472
442 Ga0307411_10078898 3300032005 Unclassified 2259
443 Ga0307510_10126663 3300033180 Bacteria 2241
444 Ga0307510_10172201 3300033180 Unclassified 1742
445 Ga0373945_0024321 3300035116 Bacteria 2098
446 Ga0373956_0063969 3300035119 Bacteria 1670
447 Ga0373943_0019772 3300035170 Bacteria 3100
448 Ga0373955_0163715 3300035172 Bacteria 1314
449 Ga0316574_0052152 3300035398 Bacteria 2550
450 Ga0373924_0012506 3300035410 Bacteria 3173
451 Ga0373935_0187458 3300035692 Bacteria 1423
452 Ga0373947_0020569 3300035725 Bacteria 3811
453 Ga0373937_0066429 3300036401 Bacteria 3321
454 Ga0373937_0273019 3300036401 Unclassified 1596
455 Ga0373925_0009878 3300037068 Bacteria 6934
456 Ga0395899_0000018 3300037312 Bacteria 423194
457 Ga0395899_0000256 3300037312 Bacteria 70194
458 Ga0395899_0001762 3300037312 Bacteria 17985
459 Ga0395899_0002562 3300037312 Bacteria 14702
460 Ga0395899_0002656 3300037312 Bacteria 14408
461 Ga0395900_0000065 3300037418 Bacteria 196327
462 Ga0395900_0000312 3300037418 Bacteria 72126
463 Ga0395900_0011019 3300037418 Bacteria 9241
464 Ga0395900_0022389 3300037418 Bacteria 6463
465 Ga0395900_0033276 3300037418 Bacteria 5306
466 Ga0395900_0033672 3300037418 Bacteria 5273
467 Ga0395900_0054706 3300037418 Bacteria 4109
468 Ga0395900_0074018 3300037418 Bacteria 3502
469 Ga0395900_0140297 3300037418 Bacteria 2475
470 Ga0395900_0218988 3300037418 Bacteria 1920
471 Ga0395900_0221076 3300037418 Bacteria 1909
472 Ga0395900_0245407 3300037418 Bacteria 1794
473 Ga0395900_0401062 3300037418 Bacteria 1335
474 Ga0395898_0001598 3300037466 Bacteria 30916
475 Ga0395898_0017081 3300037466 Bacteria 7411
476 Ga0395898_0084646 3300037466 Bacteria 3056
477 Ga0395898_0097702 3300037466 Bacteria 2820
478 Ga0395898_0109304 3300037466 Unclassified 2651
479 Ga0395898_0183190 3300037466 Bacteria 2001
480 Ga0395898_0210535 3300037466 Bacteria 1854
481 Ga0395898_0292994 3300037466 Bacteria 1552
482 Ga0395898_0340430 3300037466 Bacteria 1430
483 Ga0395905_0005086 3300037471 Bacteria 13535
484 Ga0395905_0007563 3300037471 Bacteria 10794
485 Ga0395905_0020325 3300037471 Bacteria 6289
486 Ga0395905_0359087 3300037471 Bacteria 1349
487 Ga0395901_0000094 3300038443 Bacteria 120153
488 Ga0395901_0000442 3300038443 Bacteria 48366
489 Ga0395901_0002606 3300038443 Bacteria 18256
490 Ga0395901_0191624 3300038443 Bacteria 2144
491 Ga0395901_0385690 3300038443 Bacteria 1441
492 Ga0436365_1679154 3300039437 Bacteria 73730
493 Ga0439436_0012373 3300041404 Bacteria 2591
494 Ga0439453_0021431 3300041408 Bacteria 1165
495 Ga0451793_0304280 3300041452 Bacteria 6526
496 Ga0451806_137214 3300041462 Bacteria 4593
497 Ga0451807_0283309 3300041486 Bacteria 1710
498 Ga0439443_001810 3300042003 Bacteria 2452
499 Ga0439432_029018 3300042006 Bacteria 1800
500 Ga0439449_0000144 3300042007 Bacteria 24266
501 Ga0439452_025717 3300042010 Bacteria 1492
502 Ga0450920_017547 3300042122 Bacteria 1369
503 Ga0439446_0012684 3300042156 Bacteria 2303
504 Ga0439458_0005546 3300042157 Bacteria 2835
505 Ga0439434_0003947 3300042435 Bacteria 4332
506 Ga0466969_0006199 3300044656 Bacteria 6364
507 Ga0466969_0124756 3300044656 Bacteria 1197
508 Ga0466972_0001066 3300044658 Bacteria 13166
509 Ga0466965_0001602 3300044683 Bacteria 9240
510 Ga0466965_0015567 3300044683 Bacteria 3613
511 Ga0466965_0023267 3300044683 Bacteria 2991
512 Ga0466965_0036778 3300044683 Bacteria 2402
513 Ga0466966_0002495 3300044684 Bacteria 12058
514 Ga0466966_0003676 3300044684 Bacteria 10126
515 Ga0466966_0003847 3300044684 Bacteria 9910
516 Ga0466966_0007297 3300044684 Bacteria 7325
517 Ga0466966_0046280 3300044684 Bacteria 2778
518 Ga0466966_0070296 3300044684 Unclassified 2195
519 Ga0466961_0013406 3300044693 Bacteria 5248
520 Ga0466961_0022464 3300044693 Bacteria 4058
521 Ga0466961_0025235 3300044693 Bacteria 3823
522 Ga0466961_0047971 3300044693 Bacteria 2729
523 Ga0466961_0166085 3300044693 Bacteria 1374
524 Ga0466963_0051797 3300044694 Bacteria 2722
525 Ga0466964_0002334 3300044706 Bacteria 6732
526 Ga0466964_0032730 3300044706 Bacteria 2067
527 Ga0466971_0001227 3300044719 Bacteria 10649
528 Ga0466971_0001502 3300044719 Bacteria 9838
529 Ga0466971_0030426 3300044719 Bacteria 2415
530 Ga0466971_0080081 3300044719 Bacteria 1489
531 Ga0466968_0072509 3300044735 Bacteria 1501
532 Ga0466970_0009285 3300044765 Bacteria 4966
533 Ga0466970_0037762 3300044765 Bacteria 2561
534 Ga0466970_0093960 3300044765 Bacteria 1629
535 Ga0466957_0000006 3300044842 Bacteria 85752
536 Ga0466957_0009575 3300044842 Bacteria 5533
537 Ga0466957_0028197 3300044842 Bacteria 3341
538 Ga0466957_0030950 3300044842 Bacteria 3196
539 Ga0466957_0070162 3300044842 Bacteria 2165
540 Ga0466957_0206970 3300044842 Bacteria 1291
541 Ga0466959_0003211 3300045049 Bacteria 10630
542 Ga0466959_0048063 3300045049 Bacteria 3136
543 Ga0466959_0088267 3300045049 Bacteria 2229
544 Ga0451576_0016609 3300045051 Bacteria 8119
545 Ga0466958_0001145 3300045836 Bacteria 12283
546 Ga0466958_0024145 3300045836 Bacteria 3576
547 Ga0466958_0033486 3300045836 Bacteria 3061
548 Ga0466967_0007712 3300045976 Bacteria 7801
549 Ga0466967_0015652 3300045976 Bacteria 5953
550 Ga0466967_0036968 3300045976 Bacteria 4174
551 Ga0466967_0037992 3300045976 Bacteria 4126
552 Ga0466967_0065033 3300045976 Bacteria 3245
553 Ga0466967_0360652 3300045976 Bacteria 1408
554 Ga0495617_000001 3300046452 Bacteria 877032
555 Ga0495627_000026 3300046453 Bacteria 238494
556 Ga0495592_0108804 3300046454 Bacteria 1964
557 Ga0495603_0047497 3300046455 Bacteria 2556
558 Ga0495590_0000042 3300046457 Bacteria 120663
559 Ga0495590_0000451 3300046457 Bacteria 20284
560 Ga0495590_0003216 3300046457 Bacteria 6677
561 Ga0495590_0036144 3300046457 Bacteria 1723
562 Ga0495590_0048088 3300046457 Bacteria 1487
563 Ga0495591_000068 3300046458 Bacteria 117653
564 Ga0495638_0000604 3300046460 Bacteria 40235
565 Ga0495638_0000660 3300046460 Bacteria 37623
566 Ga0495638_0001264 3300046460 Bacteria 23634
567 Ga0495638_0002210 3300046460 Bacteria 16219
568 Ga0495638_0004597 3300046460 Bacteria 10447
569 Ga0495638_0133534 3300046460 Bacteria 1456
570 Ga0495651_0191254 3300046462 Bacteria 1440
571 Ga0495653_0037136 3300046463 Bacteria 3831
572 Ga0495653_0048195 3300046463 Bacteria 3290
573 Ga0495653_0107859 3300046463 Bacteria 2006
574 Ga0495650_0022270 3300046471 Bacteria 3043
575 Ga0495650_0034354 3300046471 Bacteria 2246
576 Ga0495650_0040080 3300046471 Bacteria 2015
577 Ga0495650_0068094 3300046471 Bacteria 1405
578 Ga0495582_0075282 3300046473 Bacteria 1869
579 Ga0495605_0000004 3300046474 Bacteria 395282
580 Ga0495605_0000084 3300046474 Bacteria 124941
581 Ga0495605_0000647 3300046474 Bacteria 26637
582 Ga0495605_0001330 3300046474 Bacteria 16349
583 Ga0495605_0014213 3300046474 Bacteria 4366
584 Ga0495605_0019389 3300046474 Bacteria 3632
585 Ga0495605_0048460 3300046474 Bacteria 2080
586 Ga0495584_0000041 3300046491 Bacteria 91074
587 Ga0495584_0000093 3300046491 Bacteria 61798
588 Ga0495584_0017090 3300046491 Bacteria 3698
589 Ga0495585_0002675 3300046492 Bacteria 12486
590 Ga0495585_0068780 3300046492 Bacteria 1933
591 Ga0495585_0127093 3300046492 Bacteria 1344
592 Ga0495594_0071870 3300046499 Bacteria 1924
593 Ga0495596_0000238 3300046500 Bacteria 37279
594 Ga0495596_0002734 3300046500 Bacteria 9268
595 Ga0495596_0006693 3300046500 Bacteria 5276
596 Ga0495596_0011687 3300046500 Bacteria 3775
597 Ga0495607_0000995 3300046501 Bacteria 26171
598 Ga0495607_0001794 3300046501 Bacteria 18325
599 Ga0495607_0002272 3300046501 Bacteria 15823
600 Ga0495607_0002667 3300046501 Bacteria 14276
601 Ga0495607_0008853 3300046501 Bacteria 6854
602 Ga0495583_0000170 3300046506 Bacteria 111003
603 Ga0495583_0000182 3300046506 Bacteria 107009
604 Ga0495583_0004765 3300046506 Bacteria 9525
605 Ga0495583_0006233 3300046506 Bacteria 7849
606 Ga0495583_0011541 3300046506 Bacteria 5065
607 Ga0495583_0038261 3300046506 Bacteria 2267
608 Ga0495583_0054440 3300046506 Bacteria 1811
609 Ga0495606_0014422 3300046507 Bacteria 6169
610 Ga0495606_0026503 3300046507 Bacteria 4131
611 Ga0495606_0031373 3300046507 Bacteria 3696
612 Ga0495606_0086650 3300046507 Bacteria 1935
613 Ga0495608_0248269 3300046511 Bacteria 1110
614 Ga0495610_0000712 3300046512 Bacteria 31727
615 Ga0495610_0002794 3300046512 Bacteria 14280
616 Ga0495610_0005868 3300046512 Bacteria 8619
617 Ga0495616_0000709 3300046513 Bacteria 24711
618 Ga0495616_0003907 3300046513 Bacteria 9491
619 Ga0495616_0011719 3300046513 Bacteria 5011
620 Ga0495616_0015645 3300046513 Bacteria 4215
621 Ga0495616_0016074 3300046513 Bacteria 4147
622 Ga0495616_0019225 3300046513 Bacteria 3731
623 Ga0495616_0035359 3300046513 Bacteria 2586
624 Ga0495616_0053801 3300046513 Bacteria 1999
625 Ga0495630_0029392 3300046517 Bacteria 4087
626 Ga0495631_0002607 3300046518 Bacteria 10080
627 Ga0495631_0003414 3300046518 Bacteria 8695
628 Ga0495631_0006009 3300046518 Bacteria 6313
629 Ga0495631_0011820 3300046518 Bacteria 4281
630 Ga0495631_0032523 3300046518 Bacteria 2351
631 Ga0495631_0032916 3300046518 Bacteria 2332
632 Ga0495631_0032917 3300046518 Bacteria 2332
633 Ga0495632_0000024 3300046519 Bacteria 179517
634 Ga0495632_0000028 3300046519 Bacteria 171089
635 Ga0495632_0000043 3300046519 Bacteria 143694
636 Ga0495632_0006837 3300046519 Bacteria 7276
637 Ga0495632_0030354 3300046519 Bacteria 2806
638 Ga0495632_0063798 3300046519 Bacteria 1783
639 Ga0495637_0000002 3300046520 Bacteria 629280
640 Ga0495637_0007144 3300046520 Bacteria 5560
641 Ga0495637_0007639 3300046520 Bacteria 5349
642 Ga0495637_0088223 3300046520 Bacteria 1227
643 Ga0495643_0006873 3300046522 Bacteria 7413
644 Ga0495643_0198176 3300046522 Bacteria 965
645 Ga0495644_0000801 3300046523 Bacteria 12974
646 Ga0495644_0007211 3300046523 Bacteria 4296
647 Ga0495644_0018712 3300046523 Bacteria 2643
648 Ga0495644_0043394 3300046523 Bacteria 1692
649 Ga0495648_0000221 3300046524 Bacteria 65359
650 Ga0495648_0001910 3300046524 Bacteria 19895
651 Ga0495648_0012173 3300046524 Bacteria 6433
652 Ga0495648_0015052 3300046524 Bacteria 5633
653 Ga0495663_0000785 3300046525 Bacteria 10848
654 Ga0495642_0000001 3300046528 Bacteria 389656
655 Ga0495642_0000041 3300046528 Bacteria 76279
656 Ga0495642_0000295 3300046528 Bacteria 28032
657 Ga0495642_0004347 3300046528 Bacteria 5501
658 Ga0495642_0118581 3300046528 Bacteria 1135
659 Ga0495642_0123538 3300046528 Bacteria 1111
660 Ga0495642_0130266 3300046528 Bacteria 1082
661 Ga0495652_0190946 3300046529 Bacteria 1563
662 Ga0495652_0274500 3300046529 Bacteria 1237
663 Ga0495654_0000692 3300046530 Bacteria 26426
664 Ga0495654_0005801 3300046530 Bacteria 7114
665 Ga0495654_0009776 3300046530 Bacteria 5244
666 Ga0495654_0029926 3300046530 Bacteria 2774
667 Ga0495587_0025462 3300046536 Bacteria 3615
668 Ga0495609_0000001 3300046538 Bacteria 1060094
669 Ga0495609_0003932 3300046538 Bacteria 8325
670 Ga0495609_0025869 3300046538 Bacteria 2688
671 Ga0495597_0000030 3300046542 Bacteria 134736
672 Ga0495597_0000501 3300046542 Bacteria 32664
673 Ga0495597_0002785 3300046542 Bacteria 10751
674 Ga0495597_0092485 3300046542 Bacteria 1282
675 Ga0495645_0001013 3300046543 Bacteria 19106
676 Ga0495645_0177605 3300046543 Bacteria 1461
677 Ga0495645_0245018 3300046543 Bacteria 1194
678 Ga0495633_0005044 3300046558 Bacteria 8231
679 Ga0495633_0008714 3300046558 Bacteria 5687
680 Ga0495667_0119331 3300046559 Bacteria 1703
681 Ga0495667_0215329 3300046559 Bacteria 1227
682 Ga0495656_0009162 3300046615 Bacteria 3556
683 Ga0495656_0037015 3300046615 Bacteria 2013
684 Ga0495668_0000040 3300046616 Bacteria 230681
685 Ga0495668_0000273 3300046616 Bacteria 72362
686 Ga0495668_0000381 3300046616 Bacteria 58825
687 Ga0495668_0000445 3300046616 Bacteria 52843
688 Ga0495668_0008975 3300046616 Bacteria 6174
689 Ga0495668_0020930 3300046616 Bacteria 3757
690 Ga0495668_0071989 3300046616 Bacteria 1899
691 Ga0495668_0127239 3300046616 Bacteria 1394
692 Ga0495611_0000547 3300046648 Bacteria 22026
693 Ga0495611_0001632 3300046648 Bacteria 10889
694 Ga0495625_0000064 3300046660 Bacteria 174730
695 Ga0495625_0002507 3300046660 Bacteria 19776
696 Ga0495625_0003961 3300046660 Bacteria 14221
697 Ga0495625_0004661 3300046660 Bacteria 12873
698 Ga0495625_0005864 3300046660 Bacteria 11075
699 Ga0495625_0013679 3300046660 Bacteria 6508
700 Ga0495625_0054903 3300046660 Bacteria 2843
701 Ga0495625_0103307 3300046660 Bacteria 1954
702 Ga0495625_0184376 3300046660 Bacteria 1386
703 Ga0495625_0200569 3300046660 Unclassified 1317
704 Ga0495625_0223552 3300046660 Bacteria 1232
705 Ga0495661_0000089 3300046665 Bacteria 110930
706 Ga0495661_0001275 3300046665 Bacteria 21615
707 Ga0495588_0000052 3300046674 Bacteria 304493
708 Ga0495588_0020140 3300046674 Bacteria 3274
709 Ga0495588_0057725 3300046674 Bacteria 2005
710 Ga0495599_0012626 3300046678 Bacteria 5208
711 Ga0495623_0006111 3300046679 Bacteria 7833
712 Ga0495623_0088549 3300046679 Bacteria 1905
713 Ga0495658_0285462 3300046683 Bacteria 1042
714 Ga0495669_0000055 3300046684 Bacteria 78120
715 Ga0495669_0009316 3300046684 Bacteria 4137
716 Ga0495669_0035976 3300046684 Bacteria 2187
717 Ga0495669_0056904 3300046684 Bacteria 1763
718 Ga0495670_0000024 3300046691 Bacteria 91893
719 Ga0495670_0007012 3300046691 Bacteria 5548
720 Ga0495670_0019879 3300046691 Bacteria 3309
721 Ga0495670_0048652 3300046691 Bacteria 2121
722 Ga0495671_0000167 3300046692 Bacteria 57939
723 Ga0495671_0000964 3300046692 Bacteria 20153
724 Ga0495671_0003542 3300046692 Bacteria 9542
725 Ga0495671_0037522 3300046692 Bacteria 2450
726 Ga0495649_0000029 3300046694 Bacteria 162379
727 Ga0495649_0060179 3300046694 Bacteria 2044
728 Ga0495649_0067967 3300046694 Bacteria 1912
729 Ga0495649_0074957 3300046694 Bacteria 1812
730 Ga0495649_0090965 3300046694 Bacteria 1626
731 Ga0495649_0091566 3300046694 Bacteria 1620
732 Ga0495589_0000015 3300046794 Bacteria 224112
733 Ga0495589_0000273 3300046794 Bacteria 42118
734 Ga0495589_0000962 3300046794 Bacteria 17596
735 Ga0495589_0010186 3300046794 Bacteria 4884
736 Ga0495589_0021898 3300046794 Bacteria 3265
737 Ga0495589_0022083 3300046794 Bacteria 3250
738 Ga0495589_0071881 3300046794 Bacteria 1690
739 Ga0495600_0063153 3300046809 Bacteria 2420
740 Ga0495660_0000123 3300046810 Bacteria 84616
741 Ga0495660_0004490 3300046810 Bacteria 8439
742 Ga0495660_0004629 3300046810 Bacteria 8296
743 Ga0495660_0004866 3300046810 Bacteria 8086
744 Ga0495660_0006883 3300046810 Bacteria 6695
745 Ga0495660_0028027 3300046810 Bacteria 3184
746 Ga0495660_0061945 3300046810 Bacteria 2006
747 Ga0495672_0000006 3300047320 Bacteria 589807
748 Ga0495672_0000065 3300047320 Bacteria 193941
749 Ga0495672_0000192 3300047320 Bacteria 87986
750 Ga0495672_0011820 3300047320 Bacteria 6132
751 Ga0495672_0015956 3300047320 Bacteria 5084
752 Ga0495680_0099721 3300047322 Bacteria 2165
753 Ga0495680_0256077 3300047322 Bacteria 1239
754 Ga0495683_0000012 3300047323 Bacteria 205754
755 Ga0495683_0018891 3300047323 Bacteria 3558
756 Ga0495683_0096411 3300047323 Bacteria 1427
757 Ga0495687_000003 3300047443 Bacteria 859509
758 Ga0495687_000007 3300047443 Bacteria 552679
759 Ga0495687_000067 3300047443 Bacteria 161372
760 Ga0495687_000295 3300047443 Bacteria 65636
761 Ga0495687_000691 3300047443 Bacteria 38250
762 Ga0495687_009020 3300047443 Bacteria 5629
763 Ga0495675_0084199 3300047444 Bacteria 2001
764 Ga0495675_0143083 3300047444 Bacteria 1481
765 Ga0495675_0203995 3300047444 Bacteria 1202
766 Ga0495677_0000001 3300047445 Bacteria 715000
767 Ga0495677_0001541 3300047445 Bacteria 9278
768 Ga0495677_0002563 3300047445 Bacteria 7114
769 Ga0495677_0006156 3300047445 Bacteria 4536
770 Ga0495679_001202 3300047446 Bacteria 15376
771 Ga0495679_018192 3300047446 Bacteria 2499
772 Ga0495685_003676 3300047447 Bacteria 4903
773 Ga0495681_0010866 3300047470 Bacteria 5477
774 Ga0495681_0022082 3300047470 Bacteria 3413
775 Ga0495684_0095976 3300047471 Bacteria 2244
776 Ga0495686_0000015 3300047472 Bacteria 471703
777 Ga0495686_0000190 3300047472 Bacteria 115114
778 Ga0495686_0001315 3300047472 Bacteria 27861
779 Ga0495686_0005278 3300047472 Bacteria 10255
780 Ga0495686_0006246 3300047472 Bacteria 9174
781 Ga0495686_0047006 3300047472 Bacteria 2726
782 Ga0495686_0075680 3300047472 Bacteria 2064
783 Ga0495686_0113247 3300047472 Bacteria 1624
784 Ga0495686_0179706 3300047472 Bacteria 1226
785 Ga0495686_0181944 3300047472 Bacteria 1217
786 Ga0495602_0011369 3300048088 Bacteria 9207
787 Ga0495626_0000020 3300048091 Bacteria 222537
788 Ga0495626_0000089 3300048091 Bacteria 119565
789 Ga0495626_0000200 3300048091 Bacteria 72580
790 Ga0495626_0010985 3300048091 Bacteria 4805
791 Ga0495626_0012037 3300048091 Bacteria 4552
792 Ga0495626_0016945 3300048091 Bacteria 3691
793 Ga0495626_0020349 3300048091 Bacteria 3308
794 Ga0495626_0043483 3300048091 Bacteria 2106
795 Ga0496100_0013476 3300048903 Bacteria 4717
796 Ga0496102_0000033 3300048905 Bacteria 213952
797 Ga0496102_0155105 3300048905 Bacteria 2153
798 Ga0496102_0287028 3300048905 Bacteria 1551
799 Ga0496103_0140655 3300048906 Bacteria 1543
800 Ga0496104_0000005 3300048907 Bacteria 620360
801 Ga0496104_0003936 3300048907 Bacteria 12849
802 Ga0496105_0000016 3300048908 Bacteria 212909
803 Ga0496105_0199239 3300048908 Bacteria 1634
804 Ga0496106_0002387 3300048909 Bacteria 13993
805 Ga0496106_0124162 3300048909 Bacteria 2020
806 Ga0496106_0275900 3300048909 Bacteria 1346
807 Ga0496106_0492369 3300048909 Bacteria 985
808 Ga0496107_0032190 3300048910 Bacteria 3747
809 Ga0496108_0079946 3300048911 Bacteria 2768
810 Ga0496109_0191569 3300048912 Bacteria 1922
811 Ga0496109_0245069 3300048912 Bacteria 1687
812 Ga0496110_0022464 3300048913 Bacteria 5357
813 Ga0496110_0206371 3300048913 Bacteria 1786
814 Ga0496112_0215924 3300048915 Bacteria 1874
815 Ga0496113_0039244 3300048916 Bacteria 3484
816 Ga0496113_0191476 3300048916 Bacteria 1623
817 Ga0496114_0003632 3300048917 Bacteria 11866
818 Ga0496114_0271751 3300048917 Bacteria 1494
819 Ga0496115_0334092 3300048918 Bacteria 1238
820 Ga0496116_0000757 3300048919 Bacteria 41050
821 Ga0496116_0028644 3300048919 Bacteria 4030
822 Ga0496117_0000065 3300048920 Bacteria 254215
823 Ga0496117_0000575 3300048920 Bacteria 60272
824 Ga0496117_0060828 3300048920 Bacteria 2600
825 Ga0496118_0000033 3300048921 Bacteria 326357
826 Ga0496118_0000382 3300048921 Bacteria 74559
827 Ga0496118_0000557 3300048921 Bacteria 61344
828 Ga0496118_0036397 3300048921 Bacteria 3980
829 Ga0496119_0009436 3300048922 Bacteria 8376
830 Ga0496120_0027380 3300048923 Bacteria 3507
831 Ga0496120_0119949 3300048923 Bacteria 1361
832 Ga0496121_0002039 3300048924 Bacteria 31980
833 Ga0496121_0046256 3300048924 Bacteria 3727
834 Ga0496122_0001066 3300048925 Bacteria 47710
835 Ga0496122_0001384 3300048925 Bacteria 39329
836 Ga0496122_0004104 3300048925 Bacteria 18449
837 Ga0496122_0033396 3300048925 Bacteria 4233
838 Ga0496123_0000419 3300048926 Bacteria 77130
839 Ga0496123_0005245 3300048926 Bacteria 13162
840 Ga0496123_0008591 3300048926 Bacteria 9354
841 Ga0496123_0014468 3300048926 Bacteria 6537
842 Ga0496123_0017267 3300048926 Bacteria 5816
843 Ga0496124_0000569 3300048927 Bacteria 62485
844 Ga0496124_0003340 3300048927 Bacteria 19750
845 Ga0496124_0006729 3300048927 Bacteria 12432
846 Ga0496124_0008940 3300048927 Bacteria 10378
847 Ga0496124_0009726 3300048927 Bacteria 9842
848 Ga0496124_0016760 3300048927 Bacteria 6948
849 Ga0496124_0024820 3300048927 Bacteria 5442
850 Ga0496124_0037080 3300048927 Bacteria 4244
851 Ga0496124_0061645 3300048927 Bacteria 3143
852 Ga0496124_0076307 3300048927 Bacteria 2767
853 Ga0496124_0089965 3300048927 Bacteria 2505
854 Ga0496124_0197905 3300048927 Bacteria 1531
855 Ga0496124_0245160 3300048927 Bacteria 1329
856 Ga0496125_0004414 3300048928 Bacteria 16254
857 Ga0496125_0012558 3300048928 Bacteria 8395
858 Ga0496125_0038358 3300048928 Bacteria 4148
859 Ga0496126_0003368 3300048929 Bacteria 20267
860 Ga0496126_0016900 3300048929 Bacteria 7280
861 Ga0496126_0079388 3300048929 Bacteria 2905
862 Ga0496126_0321628 3300048929 Bacteria 1271
863 Ga0495678_000015 3300049459 Bacteria 309544
864 Ga0495678_000178 3300049459 Bacteria 73165
865 Ga0495678_003372 3300049459 Bacteria 9942
866 Ga0495678_006425 3300049459 Bacteria 6253
867 Ga0495678_016551 3300049459 Bacteria 3367
868 Ga0495682_0000248 3300049460 Bacteria 42769
869 Ga0495682_0006111 3300049460 Bacteria 4910
870 Ga0501031_0107988 3300049568 Bacteria 1817
871 Ga0501032_0019857 3300049569 Bacteria 4691
872 Ga0501032_0368075 3300049569 Bacteria 925
873 Ga0501034_0106416 3300049571 Bacteria 2798
874 Ga0501034_0393371 3300049571 Bacteria 1310
875 Ga0501037_0088170 3300049573 Bacteria 2245
876 Ga0501038_0175998 3300049574 Bacteria 1729
877 Ga0501038_0254452 3300049574 Bacteria 1390
878 Ga0501039_0018765 3300049575 Bacteria 5308
879 Ga0501043_0257407 3300049579 Bacteria 1343
880 Ga0501046_0008689 3300049580 Bacteria 8829
881 Ga0501046_0080098 3300049580 Bacteria 2524
882 Ga0501046_0114398 3300049580 Bacteria 2058
883 Ga0501046_0188502 3300049580 Bacteria 1539
884 Ga0501047_0006271 3300049581 Bacteria 11177
885 Ga0501047_0294483 3300049581 Bacteria 1466
886 Ga0501047_0319198 3300049581 Bacteria 1393
887 Ga0501069_0031520 3300049585 Bacteria 2916
888 Ga0501035_0001876 3300049822 Bacteria 21173
889 Ga0501035_0026768 3300049822 Bacteria 5274
890 Ga0501035_0207431 3300049822 Bacteria 1678
891 Ga0501044_0021716 3300049823 Bacteria 6843
892 Ga0501044_0293691 3300049823 Bacteria 1556
893 nmdc:mga0yw44_3099_c1 3300050492 Bacteria 7287
894 nmdc:mga0k408_195565_c1 3300050493 Bacteria 1207
895 nmdc:mga07m45_278_c2 3300050496 Bacteria 17340
896 nmdc:mga05p37_154864_c1 3300050507 Bacteria 2801
897 nmdc:mga0qj67_9414_c1 3300050509 Bacteria 7268
898 nmdc:mga06r32_67633_c1 3300050510 Bacteria 3450
899 nmdc:mga08y16_130970_c1 3300050511 Bacteria 2608
900 nmdc:mga08y16_428604_c1 3300050511 Bacteria 1351
901 nmdc:mga0n895_3166_c1 3300050512 Bacteria 13149
902 nmdc:mga0n895_32315_c1 3300050512 Bacteria 5022
903 nmdc:mga0rr50_277413_c1 3300050513 Bacteria 1398
904 nmdc:mga0rr50_46200_c1 3300050513 Bacteria 3205
905 nmdc:mga0a205_33903_c1 3300050515 Bacteria 4896
906 nmdc:mga0a205_5464_c1 3300050515 Bacteria 11447
907 nmdc:mga0sz30_7450_c1 3300050516 Bacteria 3022
908 Ga0495601_0123986 3300053077 Bacteria 1680
909 Ga0500578_0000082 3300053086 Bacteria 105580
910 Ga0500643_000546 3300053087 Bacteria 26277
911 Ga0500644_0128314 3300053088 Bacteria 996
912 Ga0500583_0002256 3300053092 Bacteria 5744
913 Ga0500651_0146350 3300053093 Bacteria 1421
914 Ga0500554_006504 3300053102 Bacteria 2625
915 Ga0500594_0000209 3300053118 Bacteria 14427
916 Ga0500595_001147 3300053119 Bacteria 14712
917 Ga0500608_000348 3300053122 Bacteria 17856
918 Ga0500626_005836 3300053128 Bacteria 4848
919 Ga0500658_0005963 3300053134 Bacteria 4531
920 Ga0500559_0004275 3300053136 Bacteria 6835
921 Ga0500559_0009071 3300053136 Bacteria 4323
922 Ga0500559_0009670 3300053136 Bacteria 4164
923 Ga0500559_0112836 3300053136 Bacteria 1260
924 Ga0500604_0006147 3300053151 Bacteria 3172
925 Ga0500616_0007463 3300053153 Bacteria 6941
926 Ga0500622_0001253 3300053156 Bacteria 20749
927 Ga0500622_0022344 3300053156 Bacteria 3354
928 Ga0500622_0026816 3300053156 Bacteria 3038
929 Ga0500622_0041519 3300053156 Bacteria 2394
930 Ga0500627_0045944 3300053158 Bacteria 1892
931 Ga0466962_0002261 3300061719 Bacteria 9125
932 Ga0466962_0002967 3300061719 Bacteria 8093
933 Ga0466962_0019410 3300061719 Bacteria 3266
934 Ga0466962_0032872 3300061719 Bacteria 2482

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000199 Ga0070658_1000019929 261
2 3300025909 Ga0207705_10000002 Ga0207705_10000002706 261
3 3300045976 Ga0466967_0036968 Ga0466967_0036968_3319_4155 269
4 iso_pu_bacteria 2643221577 2643895563 283
5 iso_pu_bacteria 2643221685 2644477745 283
6 3300009176 Ga0105242_10443690 Ga0105242_104436902 287
7 3300049569 Ga0501032_0368075 Ga0501032_0368075_23_886 287
8 3300046694 Ga0495649_0060179 Ga0495649_0060179_1135_2031 291
9 3300048922 Ga0496119_0009436 Ga0496119_0009436_6286_7182 291
10 3300048923 Ga0496120_0027380 Ga0496120_0027380_1036_1932 291
11 3300048924 Ga0496121_0046256 Ga0496121_0046256_1487_2383 291
12 3300048928 Ga0496125_0012558 Ga0496125_0012558_6464_7360 291
13 3300048929 Ga0496126_0016900 Ga0496126_0016900_5424_6320 291
14 3300005339 Ga0070660_100000665 Ga0070660_1000006656 294
15 3300005366 Ga0070659_100004192 Ga0070659_1000041927 294
16 3300025919 Ga0207657_10001150 Ga0207657_100011506 294
17 3300025932 Ga0207690_10001754 Ga0207690_100017548 294
18 3300046522 Ga0495643_0198176 Ga0495643_0198176_29_922 297
19 3300046683 Ga0495658_0285462 Ga0495658_0285462_107_1021 297
20 3300053088 Ga0500644_0128314 Ga0500644_0128314_19_918 297
21 3300042010 Ga0439452_025717 Ga0439452_025717_10_906 298
22 3300049571 Ga0501034_0393371 Ga0501034_0393371_12_908 298
23 3300025913 Ga0207695_10022428 Ga0207695_100224284 301
24 3300025914 Ga0207671_10020155 Ga0207671_100201553 301
25 3300009094 Ga0111539_10014312 Ga0111539_100143129 303
26 3300031731 Ga0307405_10002816 Ga0307405_100028162 303
27 3300031852 Ga0307410_10028523 Ga0307410_100285234 303
28 3300031903 Ga0307407_10021778 Ga0307407_100217784 303
29 3300031995 Ga0307409_100034119 Ga0307409_1000341193 303
30 3300032002 Ga0307416_100000858 Ga0307416_1000008588 303
31 3300041408 Ga0439453_0021431 Ga0439453_0021431_102_1037 303
32 3300042003 Ga0439443_001810 Ga0439443_001810_829_1764 303
33 3300042122 Ga0450920_017547 Ga0450920_017547_98_1033 303
34 3300042156 Ga0439446_0012684 Ga0439446_0012684_1156_2091 303
35 3300042435 Ga0439434_0003947 Ga0439434_0003947_2975_3910 303
36 3300046691 Ga0495670_0000024 Ga0495670_0000024_29224_30177 303
37 3300025914 Ga0207671_10336798 Ga0207671_103367982 311
38 3300044684 Ga0466966_0070296 Ga0466966_0070296_618_1676 311
39 3300046692 Ga0495671_0037522 Ga0495671_0037522_41_1021 311
40 3300031456 Ga0307513_10186899 Ga0307513_101868992 314
41 3300046506 Ga0495583_0006233 Ga0495583_0006233_698_1675 314
42 3300046528 Ga0495642_0130266 Ga0495642_0130266_128_1072 314
43 3300046616 Ga0495668_0020930 Ga0495668_0020930_560_1537 314
44 3300046660 Ga0495625_0004661 Ga0495625_0004661_5856_6833 314
45 3300053136 Ga0500559_0112836 Ga0500559_0112836_80_1057 314
46 3300021384 Ga0213876_10000178 Ga0213876_100001784 315
47 3300039437 Ga0436365_1679154 Ga0436365_1679154_13878_14900 315
48 3300048927 Ga0496124_0016760 Ga0496124_0016760_5388_6335 315
49 3300031548 Ga0307408_100004051 Ga0307408_1000040517 316
50 3300048909 Ga0496106_0492369 Ga0496106_0492369_15_974 319
51 3300005329 Ga0070683_100034599 Ga0070683_1000345993 320
52 3300005336 Ga0070680_100114992 Ga0070680_1001149922 320
53 3300005436 Ga0070713_100038870 Ga0070713_1000388702 320
54 3300005530 Ga0070679_100095255 Ga0070679_1000952552 320
55 3300005577 Ga0068857_100277425 Ga0068857_1002774252 320
56 3300025912 Ga0207707_10161757 Ga0207707_101617572 320
57 3300025917 Ga0207660_10137755 Ga0207660_101377552 320
58 3300025944 Ga0207661_10056936 Ga0207661_100569362 320
59 3300053119 Ga0500595_001147 Ga0500595_001147_3304_4281 320
60 3300037418 Ga0395900_0033672 Ga0395900_0033672_1346_2383 322
61 3300037471 Ga0395905_0007563 Ga0395905_0007563_7016_8053 322
62 3300053093 Ga0500651_0146350 Ga0500651_0146350_204_1211 322
63 3300003781 Ga0055536_1001570 Ga0055536_10015705 323
64 3300003791 Ga0055530_10002027 Ga0055530_100020275 323
65 3300009147 Ga0114129_10061810 Ga0114129_100618104 323
66 3300025292 Ga0209676_1000253 Ga0209676_100025312 323
67 3300025298 Ga0209050_1000649 Ga0209050_100064917 323
68 3300025303 Ga0209051_1002524 Ga0209051_100252413 323
69 3300025304 Ga0209257_1007938 Ga0209257_10079385 323
70 3300050507 nmdc:mga05p37_154864_c1 nmdc:mga05p37_154864_c1_572_1594 323
71 3300053087 Ga0500643_000546 Ga0500643_000546_6816_7826 323
72 3300005548 Ga0070665_100101390 Ga0070665_1001013902 324
73 3300037418 Ga0395900_0218988 Ga0395900_0218988_18_1046 324
74 3300037466 Ga0395898_0017081 Ga0395898_0017081_3231_4259 324
75 3300005439 Ga0070711_100099275 Ga0070711_1000992752 325
76 3300005548 Ga0070665_100049336 Ga0070665_1000493363 325
77 3300033180 Ga0307510_10126663 Ga0307510_101266632 325
78 3300035119 Ga0373956_0063969 Ga0373956_0063969_157_1155 325
79 3300046660 Ga0495625_0005864 Ga0495625_0005864_1318_2337 325
80 3300048903 Ga0496100_0013476 Ga0496100_0013476_210_1208 325
81 3300048907 Ga0496104_0003936 Ga0496104_0003936_4287_5285 325
82 3300048908 Ga0496105_0199239 Ga0496105_0199239_395_1393 325
83 3300048917 Ga0496114_0003632 Ga0496114_0003632_4445_5443 325
84 3300053077 Ga0495601_0123986 Ga0495601_0123986_448_1446 325
85 3300003320 rootH2_10155199 rootH2_101551992 326
86 3300005548 Ga0070665_100022797 Ga0070665_1000227973 326
87 3300005617 Ga0068859_100344749 Ga0068859_1003447492 326
88 3300006931 Ga0097620_100344768 Ga0097620_1003447682 326
89 3300025913 Ga0207695_10067718 Ga0207695_100677182 326
90 3300028016 Ga0265354_1000560 Ga0265354_10005604 326
91 3300028379 Ga0268266_10014895 Ga0268266_100148954 326
92 3300028379 Ga0268266_10147209 Ga0268266_101472092 326
93 3300030878 Ga0265770_1000540 Ga0265770_10005404 326
94 3300044656 Ga0466969_0124756 Ga0466969_0124756_18_1043 326
95 3300044693 Ga0466961_0166085 Ga0466961_0166085_230_1255 326
96 3300046471 Ga0495650_0034354 Ga0495650_0034354_688_1689 326
97 iso_pu_bacteria 2582581279 2585147602 326
98 3300005548 Ga0070665_100000894 Ga0070665_10000089410 327
99 3300009093 Ga0105240_10097332 Ga0105240_100973321 327
100 3300010375 Ga0105239_10009730 Ga0105239_100097304 327
101 3300013297 Ga0157378_10219689 Ga0157378_102196892 327
102 3300025913 Ga0207695_10070174 Ga0207695_100701741 327
103 3300028379 Ga0268266_10001496 Ga0268266_100014963 327
104 3300028380 Ga0268265_10025414 Ga0268265_100254143 327
105 3300045976 Ga0466967_0065033 Ga0466967_0065033_1625_2629 327
106 3300046500 Ga0495596_0002734 Ga0495596_0002734_5478_6509 327
107 3300046518 Ga0495631_0011820 Ga0495631_0011820_1848_2879 327
108 3300046694 Ga0495649_0074957 Ga0495649_0074957_666_1667 327
109 3300047445 Ga0495677_0002563 Ga0495677_0002563_4511_5542 327
110 3300048929 Ga0496126_0003368 Ga0496126_0003368_896_1903 327
111 3300005290 Ga0065712_10111141 Ga0065712_101111411 328
112 3300005295 Ga0065707_10081991 Ga0065707_1008199115 328
113 3300005330 Ga0070690_100027170 Ga0070690_1000271703 328
114 3300005340 Ga0070689_100050000 Ga0070689_1000500004 328
115 3300005354 Ga0070675_100166202 Ga0070675_1001662022 328
116 3300005459 Ga0068867_100069424 Ga0068867_1000694242 328
117 3300005547 Ga0070693_100001654 Ga0070693_1000016549 328
118 3300005719 Ga0068861_100008866 Ga0068861_1000088663 328
119 3300005842 Ga0068858_100085691 Ga0068858_1000856913 328
120 3300006237 Ga0097621_100076899 Ga0097621_1000768992 328
121 3300006237 Ga0097621_100206386 Ga0097621_1002063863 328
122 3300006358 Ga0068871_100054443 Ga0068871_1000544433 328
123 3300006358 Ga0068871_100121153 Ga0068871_1001211532 328
124 3300009093 Ga0105240_10001162 Ga0105240_100011623 328
125 3300009093 Ga0105240_10319213 Ga0105240_103192132 328
126 3300009098 Ga0105245_10114724 Ga0105245_101147243 328
127 3300009176 Ga0105242_10027366 Ga0105242_100273663 328
128 3300009176 Ga0105242_10332237 Ga0105242_103322371 328
129 3300009177 Ga0105248_10041522 Ga0105248_100415225 328
130 3300009177 Ga0105248_10100561 Ga0105248_101005613 328
131 3300009545 Ga0105237_10017953 Ga0105237_100179533 328
132 3300009545 Ga0105237_10407828 Ga0105237_104078281 328
133 3300009553 Ga0105249_10088876 Ga0105249_100888762 328
134 3300010375 Ga0105239_10202440 Ga0105239_102024402 328
135 3300013296 Ga0157374_10047556 Ga0157374_100475562 328
136 3300013296 Ga0157374_10212371 Ga0157374_102123712 328
137 3300013297 Ga0157378_10096164 Ga0157378_100961643 328
138 3300013297 Ga0157378_10295180 Ga0157378_102951802 328
139 3300013307 Ga0157372_10250363 Ga0157372_102503632 328
140 3300014326 Ga0157380_10000779 Ga0157380_1000077916 328
141 3300014969 Ga0157376_10111488 Ga0157376_101114883 328
142 3300025934 Ga0207686_10030398 Ga0207686_100303983 328
143 3300025936 Ga0207670_10026013 Ga0207670_100260134 328
144 3300025941 Ga0207711_10147227 Ga0207711_101472272 328
145 3300025949 Ga0207667_10005682 Ga0207667_100056826 328
146 3300026035 Ga0207703_10014632 Ga0207703_100146323 328
147 3300026089 Ga0207648_10197105 Ga0207648_101971052 328
148 3300028666 Ga0265336_10000032 Ga0265336_10000032114 328
149 3300031730 Ga0307516_10037833 Ga0307516_100378332 328
150 3300035172 Ga0373955_0163715 Ga0373955_0163715_60_1067 328
151 3300035692 Ga0373935_0187458 Ga0373935_0187458_151_1158 328
152 3300036401 Ga0373937_0066429 Ga0373937_0066429_1784_2791 328
153 3300044683 Ga0466965_0015567 Ga0466965_0015567_1480_2466 328
154 3300046454 Ga0495592_0108804 Ga0495592_0108804_688_1695 328
155 3300046460 Ga0495638_0001264 Ga0495638_0001264_11335_12357 328
156 3300046462 Ga0495651_0191254 Ga0495651_0191254_366_1373 328
157 3300046511 Ga0495608_0248269 Ga0495608_0248269_62_1069 328
158 3300046529 Ga0495652_0190946 Ga0495652_0190946_367_1374 328
159 3300046543 Ga0495645_0001013 Ga0495645_0001013_17716_18723 328
160 3300046559 Ga0495667_0119331 Ga0495667_0119331_155_1162 328
161 3300046660 Ga0495625_0002507 Ga0495625_0002507_53_1075 328
162 3300046660 Ga0495625_0013679 Ga0495625_0013679_636_1637 328
163 3300046678 Ga0495599_0012626 Ga0495599_0012626_3417_4424 328
164 3300046679 Ga0495623_0088549 Ga0495623_0088549_20_1027 328
165 3300046809 Ga0495600_0063153 Ga0495600_0063153_822_1829 328
166 3300047322 Ga0495680_0256077 Ga0495680_0256077_188_1195 328
167 3300047444 Ga0495675_0143083 Ga0495675_0143083_101_1108 328
168 3300047471 Ga0495684_0095976 Ga0495684_0095976_682_1689 328
169 3300053102 Ga0500554_006504 Ga0500554_006504_849_1856 328
170 iso_pu_bacteria 2599185354 2600201619 328
171 iso_pu_bacteria 2751185897 2753763294 328
172 iso_pu_bacteria 2857504554 2857506101 328
173 3300005458 Ga0070681_10054150 Ga0070681_100541504 329
174 3300005578 Ga0068854_100321989 Ga0068854_1003219892 329
175 3300005843 Ga0068860_100168308 Ga0068860_1001683082 329
176 3300025912 Ga0207707_10059893 Ga0207707_100598934 329
177 3300025986 Ga0207658_10156895 Ga0207658_101568952 329
178 3300028381 Ga0268264_10158773 Ga0268264_101587732 329
179 3300028794 Ga0307515_10041594 Ga0307515_100415944 329
180 3300031730 Ga0307516_10000068 Ga0307516_1000006891 329
181 3300044684 Ga0466966_0003676 Ga0466966_0003676_7646_8722 329
182 3300044765 Ga0466970_0009285 Ga0466970_0009285_896_1972 329
183 3300046471 Ga0495650_0040080 Ga0495650_0040080_253_1260 329
184 3300046518 Ga0495631_0003414 Ga0495631_0003414_405_1412 329
185 3300047472 Ga0495686_0001315 Ga0495686_0001315_972_1979 329
186 3300048905 Ga0496102_0287028 Ga0496102_0287028_18_1007 329
187 3300049459 Ga0495678_006425 Ga0495678_006425_4736_5743 329
188 3300050493 nmdc:mga0k408_195565_c1 nmdc:mga0k408_195565_c1_14_1027 329
189 3300053118 Ga0500594_0000209 Ga0500594_0000209_3754_4761 329
190 3300053156 Ga0500622_0001253 Ga0500622_0001253_9516_10523 329
191 3300061719 Ga0466962_0002261 Ga0466962_0002261_4914_5990 329
192 iso_pu_bacteria 2852649853 2852650722 329
193 iso_pu_bacteria 2939589442 2939591635 329
194 3300005335 Ga0070666_10108357 Ga0070666_101083572 330
195 3300005338 Ga0068868_100017884 Ga0068868_1000178842 330
196 3300005355 Ga0070671_100028749 Ga0070671_1000287493 330
197 3300005364 Ga0070673_100043679 Ga0070673_1000436793 330
198 3300005563 Ga0068855_100001261 Ga0068855_10000126119 330
199 3300005578 Ga0068854_100086291 Ga0068854_1000862911 330
200 3300005618 Ga0068864_100081378 Ga0068864_1000813782 330
201 3300005843 Ga0068860_100042046 Ga0068860_1000420462 330
202 3300009101 Ga0105247_10066340 Ga0105247_100663402 330
203 3300013104 Ga0157370_10485222 Ga0157370_104852221 330
204 3300013105 Ga0157369_10083491 Ga0157369_100834913 330
205 3300025903 Ga0207680_10142096 Ga0207680_101420962 330
206 3300025933 Ga0207706_10076169 Ga0207706_100761692 330
207 3300025949 Ga0207667_10000116 Ga0207667_10000116110 330
208 3300025960 Ga0207651_10092619 Ga0207651_100926192 330
209 3300026088 Ga0207641_10272584 Ga0207641_102725842 330
210 3300031456 Ga0307513_10159844 Ga0307513_101598442 330
211 3300036401 Ga0373937_0273019 Ga0373937_0273019_476_1507 330
212 3300046455 Ga0495603_0047497 Ga0495603_0047497_912_1919 330
213 3300046460 Ga0495638_0000660 Ga0495638_0000660_2548_3552 330
214 3300046474 Ga0495605_0048460 Ga0495605_0048460_389_1396 330
215 3300046512 Ga0495610_0002794 Ga0495610_0002794_6229_7233 330
216 3300046513 Ga0495616_0000709 Ga0495616_0000709_22950_23957 330
217 3300046518 Ga0495631_0006009 Ga0495631_0006009_2870_3877 330
218 3300046519 Ga0495632_0000024 Ga0495632_0000024_25230_26237 330
219 3300046528 Ga0495642_0000041 Ga0495642_0000041_74588_75595 330
220 3300046528 Ga0495642_0118581 Ga0495642_0118581_26_1048 330
221 3300046529 Ga0495652_0274500 Ga0495652_0274500_91_1098 330
222 3300046530 Ga0495654_0029926 Ga0495654_0029926_281_1288 330
223 3300046543 Ga0495645_0177605 Ga0495645_0177605_334_1341 330
224 3300046665 Ga0495661_0001275 Ga0495661_0001275_16683_17690 330
225 3300046674 Ga0495588_0057725 Ga0495588_0057725_170_1177 330
226 3300046684 Ga0495669_0000055 Ga0495669_0000055_10033_11040 330
227 3300046692 Ga0495671_0000167 Ga0495671_0000167_42687_43694 330
228 3300049460 Ga0495682_0006111 Ga0495682_0006111_1664_2671 330
229 3300053086 Ga0500578_0000082 Ga0500578_0000082_68045_69049 330
230 3300053156 Ga0500622_0041519 Ga0500622_0041519_896_1891 330
231 iso_pu_bacteria 2643221663 2644354469 330
232 3300002067 JGI24735J21928_10001233 JGI24735J21928_100012333 331
233 3300003215 JGI25153J46596_10023669 JGI25153J46596_100236692 331
234 3300003320 rootH2_10180229 rootH2_101802291 331
235 3300003775 Ga0055524_1005546 Ga0055524_10055461 331
236 3300003790 Ga0055528_1008032 Ga0055528_10080322 331
237 3300005262 Ga0065165_1049412 Ga0065165_10494121 331
238 3300005339 Ga0070660_100015100 Ga0070660_1000151002 331
239 3300005435 Ga0070714_100237003 Ga0070714_1002370032 331
240 3300005457 Ga0070662_100132406 Ga0070662_1001324063 331
241 3300005458 Ga0070681_10002376 Ga0070681_100023767 331
242 3300005530 Ga0070679_100080023 Ga0070679_1000800232 331
243 3300005530 Ga0070679_100263932 Ga0070679_1002639322 331
244 3300005530 Ga0070679_100291015 Ga0070679_1002910152 331
245 3300005539 Ga0068853_100064349 Ga0068853_1000643492 331
246 3300005548 Ga0070665_100002017 Ga0070665_10000201719 331
247 3300005563 Ga0068855_100082538 Ga0068855_1000825382 331
248 3300005563 Ga0068855_100116518 Ga0068855_1001165183 331
249 3300005563 Ga0068855_100151776 Ga0068855_1001517762 331
250 3300005564 Ga0070664_100098331 Ga0070664_1000983312 331
251 3300005616 Ga0068852_100046405 Ga0068852_1000464053 331
252 3300005844 Ga0068862_100010147 Ga0068862_1000101472 331
253 3300009093 Ga0105240_10001872 Ga0105240_100018729 331
254 3300009093 Ga0105240_10003430 Ga0105240_1000343012 331
255 3300009093 Ga0105240_10019223 Ga0105240_100192232 331
256 3300009093 Ga0105240_10026360 Ga0105240_100263602 331
257 3300009093 Ga0105240_10090706 Ga0105240_100907064 331
258 3300009093 Ga0105240_10249255 Ga0105240_102492552 331
259 3300009174 Ga0105241_10154297 Ga0105241_101542973 331
260 3300009545 Ga0105237_10153172 Ga0105237_101531722 331
261 3300009545 Ga0105237_10453498 Ga0105237_104534982 331
262 3300009551 Ga0105238_10006972 Ga0105238_100069723 331
263 3300009551 Ga0105238_10129475 Ga0105238_101294751 331
264 3300009553 Ga0105249_10034746 Ga0105249_100347463 331
265 3300013104 Ga0157370_10001541 Ga0157370_100015418 331
266 3300013104 Ga0157370_10005410 Ga0157370_100054101 331
267 3300013105 Ga0157369_10300382 Ga0157369_103003822 331
268 3300013105 Ga0157369_10448340 Ga0157369_104483401 331
269 3300013307 Ga0157372_10142697 Ga0157372_101426971 331
270 3300013307 Ga0157372_10498548 Ga0157372_104985482 331
271 3300025254 Ga0209148_1002879 Ga0209148_10028793 331
272 3300025263 Ga0209565_1000179 Ga0209565_100017916 331
273 3300025272 Ga0209455_1000610 Ga0209455_10006106 331
274 3300025273 Ga0209673_1001240 Ga0209673_10012409 331
275 3300025291 Ga0209675_1002110 Ga0209675_10021108 331
276 3300025295 Ga0209564_1013712 Ga0209564_10137123 331
277 3300025297 Ga0209758_1002900 Ga0209758_100290012 331
278 3300025299 Ga0209256_1018485 Ga0209256_10184852 331
279 3300025912 Ga0207707_10002777 Ga0207707_100027772 331
280 3300025913 Ga0207695_10003912 Ga0207695_100039124 331
281 3300025913 Ga0207695_10008285 Ga0207695_1000828512 331
282 3300025913 Ga0207695_10081284 Ga0207695_100812841 331
283 3300025917 Ga0207660_10001881 Ga0207660_100018813 331
284 3300025919 Ga0207657_10004105 Ga0207657_100041053 331
285 3300025921 Ga0207652_10002553 Ga0207652_100025532 331
286 3300025921 Ga0207652_10018371 Ga0207652_100183712 331
287 3300025921 Ga0207652_10315304 Ga0207652_103153042 331
288 3300025924 Ga0207694_10023181 Ga0207694_100231813 331
289 3300025924 Ga0207694_10042419 Ga0207694_100424192 331
290 3300025945 Ga0207679_10247463 Ga0207679_102474632 331
291 3300025949 Ga0207667_10019038 Ga0207667_100190385 331
292 3300025949 Ga0207667_10076365 Ga0207667_100763652 331
293 3300025949 Ga0207667_10139213 Ga0207667_101392132 331
294 3300026041 Ga0207639_10137112 Ga0207639_101371122 331
295 3300026041 Ga0207639_10260801 Ga0207639_102608012 331
296 3300026116 Ga0207674_10326551 Ga0207674_103265511 331
297 3300026142 Ga0207698_10053238 Ga0207698_100532383 331
298 3300027876 Ga0209974_10039278 Ga0209974_100392782 331
299 3300028379 Ga0268266_10004360 Ga0268266_100043609 331
300 3300028380 Ga0268265_10037847 Ga0268265_100378472 331
301 3300032005 Ga0307411_10078898 Ga0307411_100788983 331
302 3300033180 Ga0307510_10172201 Ga0307510_101722012 331
303 3300037418 Ga0395900_0221076 Ga0395900_0221076_438_1475 331
304 3300037466 Ga0395898_0097702 Ga0395898_0097702_456_1484 331
305 3300037466 Ga0395898_0109304 Ga0395898_0109304_1600_2628 331
306 3300046460 Ga0495638_0004597 Ga0495638_0004597_4292_5329 331
307 3300046491 Ga0495584_0017090 Ga0495584_0017090_2088_3098 331
308 3300046492 Ga0495585_0068780 Ga0495585_0068780_296_1306 331
309 3300046501 Ga0495607_0008853 Ga0495607_0008853_2133_3143 331
310 3300046506 Ga0495583_0000182 Ga0495583_0000182_21235_22245 331
311 3300046506 Ga0495583_0011541 Ga0495583_0011541_1936_2946 331
312 3300046506 Ga0495583_0038261 Ga0495583_0038261_489_1499 331
313 3300046512 Ga0495610_0005868 Ga0495610_0005868_6120_7145 331
314 3300046520 Ga0495637_0007144 Ga0495637_0007144_924_1934 331
315 3300046520 Ga0495637_0007639 Ga0495637_0007639_1774_2817 331
316 3300046523 Ga0495644_0007211 Ga0495644_0007211_688_1698 331
317 3300046524 Ga0495648_0012173 Ga0495648_0012173_1532_2566 331
318 3300046528 Ga0495642_0004347 Ga0495642_0004347_1015_2025 331
319 3300046660 Ga0495625_0000064 Ga0495625_0000064_103106_104143 331
320 3300046660 Ga0495625_0184376 Ga0495625_0184376_213_1223 331
321 3300046660 Ga0495625_0200569 Ga0495625_0200569_232_1251 331
322 3300046691 Ga0495670_0007012 Ga0495670_0007012_820_1830 331
323 3300046692 Ga0495671_0003542 Ga0495671_0003542_2389_3399 331
324 3300046810 Ga0495660_0006883 Ga0495660_0006883_5458_6468 331
325 3300046810 Ga0495660_0061945 Ga0495660_0061945_701_1711 331
326 3300047323 Ga0495683_0018891 Ga0495683_0018891_1015_2025 331
327 3300047443 Ga0495687_000691 Ga0495687_000691_34118_35128 331
328 3300047446 Ga0495679_018192 Ga0495679_018192_297_1307 331
329 3300047472 Ga0495686_0047006 Ga0495686_0047006_1210_2235 331
330 3300047472 Ga0495686_0075680 Ga0495686_0075680_176_1219 331
331 3300047472 Ga0495686_0113247 Ga0495686_0113247_283_1296 331
332 3300047472 Ga0495686_0181944 Ga0495686_0181944_117_1154 331
333 3300048091 Ga0495626_0000020 Ga0495626_0000020_76400_77413 331
334 3300048091 Ga0495626_0010985 Ga0495626_0010985_1731_2741 331
335 3300048905 Ga0496102_0000033 Ga0496102_0000033_119162_120175 331
336 3300048918 Ga0496115_0334092 Ga0496115_0334092_115_1122 331
337 3300048921 Ga0496118_0036397 Ga0496118_0036397_354_1391 331
338 3300048923 Ga0496120_0119949 Ga0496120_0119949_311_1348 331
339 3300049459 Ga0495678_016551 Ga0495678_016551_52_1062 331
340 3300053134 Ga0500658_0005963 Ga0500658_0005963_1523_2560 331
341 3300053136 Ga0500559_0009071 Ga0500559_0009071_911_1945 331
342 iso_pu_bacteria 2643221684 2644474071 331
343 iso_pu_bacteria 8047673197 8047679707 331
344 3300003214 JGI25165J46597_1001272 JGI25165J46597_100127214 332
345 3300005327 Ga0070658_10008396 Ga0070658_100083961 332
346 3300005327 Ga0070658_10076225 Ga0070658_100762253 332
347 3300005328 Ga0070676_10005363 Ga0070676_100053635 332
348 3300005329 Ga0070683_100071615 Ga0070683_1000716154 332
349 3300005336 Ga0070680_100026810 Ga0070680_1000268105 332
350 3300005341 Ga0070691_10056239 Ga0070691_100562392 332
351 3300005344 Ga0070661_100002145 Ga0070661_1000021454 332
352 3300005345 Ga0070692_10058791 Ga0070692_100587912 332
353 3300005364 Ga0070673_100000094 Ga0070673_10000009412 332
354 3300005366 Ga0070659_100010651 Ga0070659_1000106513 332
355 3300005366 Ga0070659_100241568 Ga0070659_1002415682 332
356 3300005434 Ga0070709_10186491 Ga0070709_101864912 332
357 3300005435 Ga0070714_100016222 Ga0070714_1000162224 332
358 3300005435 Ga0070714_100018544 Ga0070714_1000185444 332
359 3300005435 Ga0070714_100144956 Ga0070714_1001449562 332
360 3300005455 Ga0070663_100002094 Ga0070663_10000209411 332
361 3300005455 Ga0070663_100013961 Ga0070663_1000139615 332
362 3300005457 Ga0070662_100145301 Ga0070662_1001453011 332
363 3300005458 Ga0070681_10102190 Ga0070681_101021903 332
364 3300005459 Ga0068867_100000202 Ga0068867_10000020212 332
365 3300005467 Ga0070706_100101529 Ga0070706_1001015292 332
366 3300005468 Ga0070707_100051345 Ga0070707_1000513452 332
367 3300005518 Ga0070699_100033798 Ga0070699_1000337983 332
368 3300005518 Ga0070699_100039597 Ga0070699_1000395972 332
369 3300005518 Ga0070699_100309784 Ga0070699_1003097842 332
370 3300005530 Ga0070679_100180840 Ga0070679_1001808403 332
371 3300005536 Ga0070697_100072202 Ga0070697_1000722022 332
372 3300005536 Ga0070697_100102787 Ga0070697_1001027873 332
373 3300005539 Ga0068853_100028920 Ga0068853_1000289203 332
374 3300005539 Ga0068853_100106756 Ga0068853_1001067563 332
375 3300005547 Ga0070693_100092020 Ga0070693_1000920201 332
376 3300005563 Ga0068855_100033668 Ga0068855_1000336682 332
377 3300005563 Ga0068855_100160973 Ga0068855_1001609732 332
378 3300005564 Ga0070664_100006965 Ga0070664_1000069657 332
379 3300005564 Ga0070664_100256447 Ga0070664_1002564472 332
380 3300005577 Ga0068857_100002632 Ga0068857_10000263212 332
381 3300005578 Ga0068854_100002955 Ga0068854_1000029556 332
382 3300005578 Ga0068854_100232270 Ga0068854_1002322701 332
383 3300005614 Ga0068856_100008073 Ga0068856_1000080731 332
384 3300005614 Ga0068856_100088973 Ga0068856_1000889732 332
385 3300005616 Ga0068852_100008465 Ga0068852_1000084652 332
386 3300005616 Ga0068852_100036281 Ga0068852_1000362812 332
387 3300005616 Ga0068852_100159710 Ga0068852_1001597102 332
388 3300005718 Ga0068866_10005953 Ga0068866_100059532 332
389 3300005834 Ga0068851_10157580 Ga0068851_101575801 332
390 3300006173 Ga0070716_100073564 Ga0070716_1000735642 332
391 3300006175 Ga0070712_100042678 Ga0070712_1000426781 332
392 3300006175 Ga0070712_100144827 Ga0070712_1001448272 332
393 3300006186 Ga0075369_10004557 Ga0075369_100045572 332
394 3300006852 Ga0075433_10170230 Ga0075433_101702301 332
395 3300006871 Ga0075434_100145771 Ga0075434_1001457712 332
396 3300006881 Ga0068865_100000123 Ga0068865_10000012312 332
397 3300006881 Ga0068865_100238121 Ga0068865_1002381212 332
398 3300007076 Ga0075435_100290690 Ga0075435_1002906902 332
399 3300009093 Ga0105240_10058942 Ga0105240_100589425 332
400 3300009093 Ga0105240_10203674 Ga0105240_102036743 332
401 3300009098 Ga0105245_10037993 Ga0105245_100379933 332
402 3300009148 Ga0105243_10000794 Ga0105243_1000079425 332
403 3300009176 Ga0105242_10000655 Ga0105242_1000065512 332
404 3300009177 Ga0105248_10090599 Ga0105248_100905991 332
405 3300009545 Ga0105237_10024588 Ga0105237_100245884 332
406 3300009545 Ga0105237_10033576 Ga0105237_100335765 332
407 3300009545 Ga0105237_10149784 Ga0105237_101497842 332
408 3300009551 Ga0105238_10041811 Ga0105238_100418113 332
409 3300009551 Ga0105238_10148434 Ga0105238_101484342 332
410 3300009553 Ga0105249_10103516 Ga0105249_101035162 332
411 3300010375 Ga0105239_10046917 Ga0105239_100469172 332
412 3300010375 Ga0105239_10080514 Ga0105239_100805145 332
413 3300010375 Ga0105239_10173252 Ga0105239_101732523 332
414 3300011119 Ga0105246_10215684 Ga0105246_102156841 332
415 3300013100 Ga0157373_10134857 Ga0157373_101348572 332
416 3300013104 Ga0157370_10121627 Ga0157370_101216273 332
417 3300013105 Ga0157369_10185303 Ga0157369_101853033 332
418 3300013105 Ga0157369_10378038 Ga0157369_103780381 332
419 3300013105 Ga0157369_10468512 Ga0157369_104685122 332
420 3300013296 Ga0157374_10009427 Ga0157374_100094275 332
421 3300013296 Ga0157374_10207730 Ga0157374_102077301 332
422 3300013307 Ga0157372_10021717 Ga0157372_100217174 332
423 3300014969 Ga0157376_10000220 Ga0157376_1000022012 332
424 3300025231 Ga0207427_103171 Ga0207427_1031711 332
425 3300025250 Ga0209026_1001218 Ga0209026_10012181 332
426 3300025254 Ga0209148_1000059 Ga0209148_100005911 332
427 3300025261 Ga0209233_1000003 Ga0209233_1000003498 332
428 3300025292 Ga0209676_1002027 Ga0209676_10020273 332
429 3300025906 Ga0207699_10108858 Ga0207699_101088582 332
430 3300025907 Ga0207645_10018197 Ga0207645_100181973 332
431 3300025909 Ga0207705_10000354 Ga0207705_1000035436 332
432 3300025910 Ga0207684_10068684 Ga0207684_100686844 332
433 3300025912 Ga0207707_10126652 Ga0207707_101266523 332
434 3300025913 Ga0207695_10040862 Ga0207695_100408623 332
435 3300025914 Ga0207671_10126783 Ga0207671_101267832 332
436 3300025915 Ga0207693_10004578 Ga0207693_100045785 332
437 3300025917 Ga0207660_10315043 Ga0207660_103150431 332
438 3300025917 Ga0207660_10366691 Ga0207660_103666911 332
439 3300025921 Ga0207652_10140729 Ga0207652_101407292 332
440 3300025921 Ga0207652_10308289 Ga0207652_103082892 332
441 3300025922 Ga0207646_10001282 Ga0207646_100012823 332
442 3300025924 Ga0207694_10020923 Ga0207694_100209233 332
443 3300025926 Ga0207659_10326802 Ga0207659_103268022 332
444 3300025928 Ga0207700_10057740 Ga0207700_100577402 332
445 3300025929 Ga0207664_10000197 Ga0207664_100001973 332
446 3300025929 Ga0207664_10354770 Ga0207664_103547702 332
447 3300025933 Ga0207706_10038186 Ga0207706_100381865 332
448 3300025934 Ga0207686_10001104 Ga0207686_100011044 332
449 3300025935 Ga0207709_10000254 Ga0207709_1000025447 332
450 3300025938 Ga0207704_10000133 Ga0207704_1000013325 332
451 3300025939 Ga0207665_10050752 Ga0207665_100507521 332
452 3300025942 Ga0207689_10001230 Ga0207689_1000123012 332
453 3300025945 Ga0207679_10009072 Ga0207679_100090723 332
454 3300025949 Ga0207667_10162201 Ga0207667_101622013 332
455 3300025960 Ga0207651_10000012 Ga0207651_10000012145 332
456 3300025981 Ga0207640_10000021 Ga0207640_100000219 332
457 3300026041 Ga0207639_10005643 Ga0207639_100056433 332
458 3300026067 Ga0207678_10005690 Ga0207678_1000569011 332
459 3300026078 Ga0207702_10005695 Ga0207702_100056958 332
460 3300026078 Ga0207702_10030558 Ga0207702_100305583 332
461 3300026078 Ga0207702_10086540 Ga0207702_100865402 332
462 3300026089 Ga0207648_10000628 Ga0207648_1000062812 332
463 3300026116 Ga0207674_10002241 Ga0207674_1000224115 332
464 3300026116 Ga0207674_10004133 Ga0207674_100041337 332
465 3300026116 Ga0207674_10358479 Ga0207674_103584792 332
466 3300026142 Ga0207698_10000754 Ga0207698_1000075412 332
467 3300026142 Ga0207698_10061744 Ga0207698_100617442 332
468 3300035116 Ga0373945_0024321 Ga0373945_0024321_870_1892 332
469 3300035170 Ga0373943_0019772 Ga0373943_0019772_1756_2847 332
470 3300035410 Ga0373924_0012506 Ga0373924_0012506_1981_3072 332
471 3300035725 Ga0373947_0020569 Ga0373947_0020569_1909_2931 332
472 3300037068 Ga0373925_0009878 Ga0373925_0009878_5108_6130 332
473 3300037312 Ga0395899_0002562 Ga0395899_0002562_13386_14426 332
474 3300037418 Ga0395900_0140297 Ga0395900_0140297_186_1226 332
475 3300038443 Ga0395901_0191624 Ga0395901_0191624_846_1886 332
476 3300044684 Ga0466966_0007297 Ga0466966_0007297_2913_3920 332
477 3300044693 Ga0466961_0013406 Ga0466961_0013406_1285_2283 332
478 3300044693 Ga0466961_0025235 Ga0466961_0025235_305_1345 332
479 3300044719 Ga0466971_0001502 Ga0466971_0001502_6688_7728 332
480 3300044719 Ga0466971_0030426 Ga0466971_0030426_886_1884 332
481 3300044765 Ga0466970_0037762 Ga0466970_0037762_633_1631 332
482 3300044842 Ga0466957_0028197 Ga0466957_0028197_532_1530 332
483 3300045049 Ga0466959_0003211 Ga0466959_0003211_2087_3085 332
484 3300045976 Ga0466967_0015652 Ga0466967_0015652_3260_4300 332
485 3300046457 Ga0495590_0003216 Ga0495590_0003216_1088_2116 332
486 3300046457 Ga0495590_0048088 Ga0495590_0048088_196_1203 332
487 3300046463 Ga0495653_0048195 Ga0495653_0048195_208_1215 332
488 3300046473 Ga0495582_0075282 Ga0495582_0075282_734_1741 332
489 3300046507 Ga0495606_0031373 Ga0495606_0031373_1668_2675 332
490 3300046513 Ga0495616_0053801 Ga0495616_0053801_139_1137 332
491 3300046517 Ga0495630_0029392 Ga0495630_0029392_1905_2912 332
492 3300046519 Ga0495632_0030354 Ga0495632_0030354_848_1876 332
493 3300046542 Ga0495597_0002785 Ga0495597_0002785_6467_7474 332
494 3300046543 Ga0495645_0245018 Ga0495645_0245018_92_1099 332
495 3300046559 Ga0495667_0215329 Ga0495667_0215329_188_1195 332
496 3300046615 Ga0495656_0037015 Ga0495656_0037015_252_1259 332
497 3300046616 Ga0495668_0000040 Ga0495668_0000040_8617_9633 332
498 3300046674 Ga0495588_0020140 Ga0495588_0020140_1774_2781 332
499 3300046679 Ga0495623_0006111 Ga0495623_0006111_4720_5727 332
500 3300046794 Ga0495589_0021898 Ga0495589_0021898_2080_3087 332
501 3300047322 Ga0495680_0099721 Ga0495680_0099721_244_1251 332
502 3300047444 Ga0495675_0203995 Ga0495675_0203995_116_1123 332
503 3300048091 Ga0495626_0012037 Ga0495626_0012037_1407_2414 332
504 3300048905 Ga0496102_0155105 Ga0496102_0155105_222_1262 332
505 3300048906 Ga0496103_0140655 Ga0496103_0140655_12_1034 332
506 3300048907 Ga0496104_0000005 Ga0496104_0000005_222241_223266 332
507 3300048908 Ga0496105_0000016 Ga0496105_0000016_128215_129240 332
508 3300048909 Ga0496106_0124162 Ga0496106_0124162_41_1063 332
509 3300048911 Ga0496108_0079946 Ga0496108_0079946_1345_2391 332
510 3300048912 Ga0496109_0245069 Ga0496109_0245069_592_1614 332
511 3300048913 Ga0496110_0022464 Ga0496110_0022464_4074_5120 332
512 3300048915 Ga0496112_0215924 Ga0496112_0215924_632_1654 332
513 3300048927 Ga0496124_0037080 Ga0496124_0037080_2730_3767 332
514 3300048927 Ga0496124_0245160 Ga0496124_0245160_108_1115 332
515 3300050512 nmdc:mga0n895_32315_c1 nmdc:mga0n895_32315_c1_374_1396 332
516 3300050513 nmdc:mga0rr50_277413_c1 nmdc:mga0rr50_277413_c1_242_1264 332
517 3300050513 nmdc:mga0rr50_46200_c1 nmdc:mga0rr50_46200_c1_513_1703 332
518 3300050515 nmdc:mga0a205_33903_c1 nmdc:mga0a205_33903_c1_683_1873 332
519 3300050516 nmdc:mga0sz30_7450_c1 nmdc:mga0sz30_7450_c1_542_1579 332
520 3300053122 Ga0500608_000348 Ga0500608_000348_12659_13687 332
521 3300053136 Ga0500559_0004275 Ga0500559_0004275_1359_2387 332
522 3300053156 Ga0500622_0026816 Ga0500622_0026816_463_1491 332
523 3300061719 Ga0466962_0019410 Ga0466962_0019410_856_1854 332
524 3300061719 Ga0466962_0032872 Ga0466962_0032872_1288_2328 332
525 iso_pu_bacteria 2738541276 2738715644 332
526 iso_pu_bacteria 2818991457 2819662083 332
527 3300003320 rootH2_10023272 rootH2_100232724 333
528 3300003322 rootL2_10002566 rootL2_100025665 333
529 3300003322 rootL2_10220746 rootL2_102207462 333
530 3300003752 Ga0055539_1000638 Ga0055539_10006384 333
531 3300003761 Ga0055535_1000387 Ga0055535_10003875 333
532 3300003763 Ga0055529_1000195 Ga0055529_100019567 333
533 3300003771 Ga0055526_1001611 Ga0055526_10016117 333
534 3300003773 Ga0055537_1000244 Ga0055537_100024410 333
535 3300003784 Ga0055534_1000030 Ga0055534_10000305 333
536 3300003784 Ga0055534_1000219 Ga0055534_100021918 333
537 3300003790 Ga0055528_1000340 Ga0055528_100034027 333
538 3300003791 Ga0055530_10000664 Ga0055530_1000066427 333
539 3300005262 Ga0065165_1002523 Ga0065165_10025235 333
540 3300005327 Ga0070658_10040607 Ga0070658_100406073 333
541 3300005330 Ga0070690_100051971 Ga0070690_1000519712 333
542 3300005334 Ga0068869_100131228 Ga0068869_1001312282 333
543 3300005344 Ga0070661_100005541 Ga0070661_1000055414 333
544 3300005366 Ga0070659_100009487 Ga0070659_1000094873 333
545 3300005467 Ga0070706_100028276 Ga0070706_1000282764 333
546 3300005536 Ga0070697_100054002 Ga0070697_1000540022 333
547 3300005539 Ga0068853_100035161 Ga0068853_1000351614 333
548 3300005564 Ga0070664_100104731 Ga0070664_1001047312 333
549 3300005578 Ga0068854_100014084 Ga0068854_1000140843 333
550 3300005719 Ga0068861_100242951 Ga0068861_1002429512 333
551 3300006195 Ga0075366_10138617 Ga0075366_101386171 333
552 3300006353 Ga0075370_10001687 Ga0075370_100016874 333
553 3300006844 Ga0075428_100031973 Ga0075428_1000319734 333
554 3300006846 Ga0075430_100006166 Ga0075430_1000061665 333
555 3300006847 Ga0075431_100021591 Ga0075431_1000215914 333
556 3300006847 Ga0075431_100034546 Ga0075431_1000345464 333
557 3300006852 Ga0075433_10008489 Ga0075433_100084892 333
558 3300006871 Ga0075434_100001830 Ga0075434_10000183011 333
559 3300006880 Ga0075429_100059872 Ga0075429_1000598723 333
560 3300009093 Ga0105240_10015370 Ga0105240_100153702 333
561 3300009093 Ga0105240_10040184 Ga0105240_100401845 333
562 3300009094 Ga0111539_10559751 Ga0111539_105597511 333
563 3300009148 Ga0105243_10229752 Ga0105243_102297522 333
564 3300009174 Ga0105241_10033744 Ga0105241_100337442 333
565 3300009176 Ga0105242_10510731 Ga0105242_105107312 333
566 3300011119 Ga0105246_10015636 Ga0105246_100156363 333
567 3300015262 Ga0182007_10000004 Ga0182007_10000004303 333
568 3300017792 Ga0163161_10007435 Ga0163161_100074352 333
569 3300017792 Ga0163161_10038272 Ga0163161_100382722 333
570 3300025230 Ga0209563_100003 Ga0209563_1000031445 333
571 3300025242 Ga0209258_100291 Ga0209258_10029168 333
572 3300025242 Ga0209258_100872 Ga0209258_1008727 333
573 3300025254 Ga0209148_1000394 Ga0209148_100039432 333
574 3300025254 Ga0209148_1002813 Ga0209148_10028132 333
575 3300025256 Ga0209759_1002075 Ga0209759_10020753 333
576 3300025263 Ga0209565_1000024 Ga0209565_1000024114 333
577 3300025272 Ga0209455_1000208 Ga0209455_10002085 333
578 3300025273 Ga0209673_1000237 Ga0209673_100023731 333
579 3300025291 Ga0209675_1000107 Ga0209675_10001076 333
580 3300025292 Ga0209676_1000011 Ga0209676_1000011315 333
581 3300025295 Ga0209564_1000422 Ga0209564_100042211 333
582 3300025298 Ga0209050_1000032 Ga0209050_1000032194 333
583 3300025303 Ga0209051_1001126 Ga0209051_100112610 333
584 3300025304 Ga0209257_1000014 Ga0209257_1000014374 333
585 3300025909 Ga0207705_10001638 Ga0207705_100016383 333
586 3300025910 Ga0207684_10024343 Ga0207684_100243432 333
587 3300025910 Ga0207684_10305149 Ga0207684_103051491 333
588 3300025911 Ga0207654_10017619 Ga0207654_100176192 333
589 3300025913 Ga0207695_10005836 Ga0207695_100058362 333
590 3300025913 Ga0207695_10076080 Ga0207695_100760803 333
591 3300025919 Ga0207657_10015382 Ga0207657_100153825 333
592 3300025920 Ga0207649_10003619 Ga0207649_100036195 333
593 3300025934 Ga0207686_10038374 Ga0207686_100383743 333
594 3300025935 Ga0207709_10130726 Ga0207709_101307262 333
595 3300025942 Ga0207689_10089926 Ga0207689_100899262 333
596 3300025945 Ga0207679_10160279 Ga0207679_101602792 333
597 3300025949 Ga0207667_10006471 Ga0207667_1000647112 333
598 3300025949 Ga0207667_10152042 Ga0207667_101520422 333
599 3300026041 Ga0207639_10024259 Ga0207639_100242592 333
600 3300026142 Ga0207698_10275707 Ga0207698_102757071 333
601 3300027907 Ga0207428_10010044 Ga0207428_100100447 333
602 3300030732 Ga0316176_1102927 Ga0316176_11029273 333
603 3300031728 Ga0316578_10030767 Ga0316578_100307672 333
604 3300031730 Ga0307516_10001773 Ga0307516_1000177331 333
605 3300032004 Ga0307414_10250336 Ga0307414_102503362 333
606 3300037312 Ga0395899_0000256 Ga0395899_0000256_30105_31115 333
607 3300037312 Ga0395899_0001762 Ga0395899_0001762_541_1551 333
608 3300037312 Ga0395899_0002656 Ga0395899_0002656_3305_4315 333
609 3300037418 Ga0395900_0000065 Ga0395900_0000065_18539_19549 333
610 3300037418 Ga0395900_0000312 Ga0395900_0000312_22619_23629 333
611 3300037418 Ga0395900_0011019 Ga0395900_0011019_6029_7039 333
612 3300037418 Ga0395900_0022389 Ga0395900_0022389_4874_5884 333
613 3300037418 Ga0395900_0033276 Ga0395900_0033276_3987_4997 333
614 3300037418 Ga0395900_0054706 Ga0395900_0054706_994_2004 333
615 3300037418 Ga0395900_0074018 Ga0395900_0074018_214_1224 333
616 3300037418 Ga0395900_0245407 Ga0395900_0245407_205_1215 333
617 3300037418 Ga0395900_0401062 Ga0395900_0401062_16_1026 333
618 3300037466 Ga0395898_0001598 Ga0395898_0001598_909_1919 333
619 3300037466 Ga0395898_0084646 Ga0395898_0084646_1779_2789 333
620 3300037466 Ga0395898_0183190 Ga0395898_0183190_880_1890 333
621 3300037466 Ga0395898_0210535 Ga0395898_0210535_307_1317 333
622 3300037466 Ga0395898_0292994 Ga0395898_0292994_394_1404 333
623 3300037466 Ga0395898_0340430 Ga0395898_0340430_376_1386 333
624 3300037471 Ga0395905_0005086 Ga0395905_0005086_873_1883 333
625 3300037471 Ga0395905_0020325 Ga0395905_0020325_1083_2093 333
626 3300037471 Ga0395905_0359087 Ga0395905_0359087_199_1209 333
627 3300038443 Ga0395901_0000094 Ga0395901_0000094_91804_92814 333
628 3300038443 Ga0395901_0000442 Ga0395901_0000442_18147_19157 333
629 3300038443 Ga0395901_0002606 Ga0395901_0002606_16700_17710 333
630 3300038443 Ga0395901_0385690 Ga0395901_0385690_172_1182 333
631 3300041452 Ga0451793_0304280 Ga0451793_0304280_2401_3402 333
632 3300041462 Ga0451806_137214 Ga0451806_137214_3578_4579 333
633 3300042157 Ga0439458_0005546 Ga0439458_0005546_1226_2236 333
634 3300044656 Ga0466969_0006199 Ga0466969_0006199_2787_3830 333
635 3300044683 Ga0466965_0023267 Ga0466965_0023267_1789_2832 333
636 3300044683 Ga0466965_0036778 Ga0466965_0036778_96_1106 333
637 3300044684 Ga0466966_0002495 Ga0466966_0002495_4286_5329 333
638 3300044684 Ga0466966_0003847 Ga0466966_0003847_5765_6766 333
639 3300044684 Ga0466966_0046280 Ga0466966_0046280_1395_2405 333
640 3300044693 Ga0466961_0022464 Ga0466961_0022464_982_1992 333
641 3300044693 Ga0466961_0047971 Ga0466961_0047971_375_1418 333
642 3300044694 Ga0466963_0051797 Ga0466963_0051797_58_1101 333
643 3300044706 Ga0466964_0032730 Ga0466964_0032730_814_1857 333
644 3300044719 Ga0466971_0001227 Ga0466971_0001227_1312_2355 333
645 3300044719 Ga0466971_0080081 Ga0466971_0080081_300_1310 333
646 3300044735 Ga0466968_0072509 Ga0466968_0072509_172_1182 333
647 3300044765 Ga0466970_0093960 Ga0466970_0093960_287_1297 333
648 3300044842 Ga0466957_0000006 Ga0466957_0000006_19235_20245 333
649 3300044842 Ga0466957_0030950 Ga0466957_0030950_109_1152 333
650 3300045049 Ga0466959_0048063 Ga0466959_0048063_1727_2770 333
651 3300045049 Ga0466959_0088267 Ga0466959_0088267_885_1895 333
652 3300045836 Ga0466958_0001145 Ga0466958_0001145_5505_6506 333
653 3300045836 Ga0466958_0024145 Ga0466958_0024145_246_1256 333
654 3300045836 Ga0466958_0033486 Ga0466958_0033486_1618_2661 333
655 3300045976 Ga0466967_0007712 Ga0466967_0007712_1926_2936 333
656 3300045976 Ga0466967_0037992 Ga0466967_0037992_2870_3913 333
657 3300046452 Ga0495617_000001 Ga0495617_000001_350801_351820 333
658 3300046453 Ga0495627_000026 Ga0495627_000026_137988_139007 333
659 3300046457 Ga0495590_0000042 Ga0495590_0000042_93388_94398 333
660 3300046457 Ga0495590_0036144 Ga0495590_0036144_252_1262 333
661 3300046458 Ga0495591_000068 Ga0495591_000068_22449_23459 333
662 3300046460 Ga0495638_0133534 Ga0495638_0133534_157_1167 333
663 3300046471 Ga0495650_0022270 Ga0495650_0022270_297_1298 333
664 3300046474 Ga0495605_0000004 Ga0495605_0000004_673_1692 333
665 3300046474 Ga0495605_0000084 Ga0495605_0000084_40853_41863 333
666 3300046474 Ga0495605_0014213 Ga0495605_0014213_858_1868 333
667 3300046474 Ga0495605_0019389 Ga0495605_0019389_405_1415 333
668 3300046491 Ga0495584_0000041 Ga0495584_0000041_3279_4289 333
669 3300046491 Ga0495584_0000093 Ga0495584_0000093_22028_23038 333
670 3300046492 Ga0495585_0002675 Ga0495585_0002675_8580_9590 333
671 3300046500 Ga0495596_0006693 Ga0495596_0006693_2502_3512 333
672 3300046501 Ga0495607_0001794 Ga0495607_0001794_1295_2305 333
673 3300046501 Ga0495607_0002272 Ga0495607_0002272_3121_4131 333
674 3300046501 Ga0495607_0002667 Ga0495607_0002667_4547_5566 333
675 3300046506 Ga0495583_0000170 Ga0495583_0000170_30186_31196 333
676 3300046506 Ga0495583_0004765 Ga0495583_0004765_4983_5993 333
677 3300046506 Ga0495583_0054440 Ga0495583_0054440_780_1790 333
678 3300046507 Ga0495606_0014422 Ga0495606_0014422_4919_5929 333
679 3300046507 Ga0495606_0086650 Ga0495606_0086650_699_1709 333
680 3300046512 Ga0495610_0000712 Ga0495610_0000712_18210_19220 333
681 3300046513 Ga0495616_0011719 Ga0495616_0011719_1425_2435 333
682 3300046513 Ga0495616_0035359 Ga0495616_0035359_523_1533 333
683 3300046518 Ga0495631_0032916 Ga0495631_0032916_273_1283 333
684 3300046518 Ga0495631_0032917 Ga0495631_0032917_273_1283 333
685 3300046519 Ga0495632_0000028 Ga0495632_0000028_80827_81837 333
686 3300046519 Ga0495632_0006837 Ga0495632_0006837_436_1446 333
687 3300046519 Ga0495632_0063798 Ga0495632_0063798_73_1083 333
688 3300046520 Ga0495637_0000002 Ga0495637_0000002_180398_181408 333
689 3300046522 Ga0495643_0006873 Ga0495643_0006873_1480_2490 333
690 3300046523 Ga0495644_0000801 Ga0495644_0000801_1295_2305 333
691 3300046523 Ga0495644_0018712 Ga0495644_0018712_926_1936 333
692 3300046524 Ga0495648_0000221 Ga0495648_0000221_2960_3979 333
693 3300046528 Ga0495642_0000001 Ga0495642_0000001_91589_92608 333
694 3300046528 Ga0495642_0000295 Ga0495642_0000295_23715_24722 333
695 3300046530 Ga0495654_0005801 Ga0495654_0005801_673_1692 333
696 3300046530 Ga0495654_0009776 Ga0495654_0009776_2686_3696 333
697 3300046538 Ga0495609_0000001 Ga0495609_0000001_891352_892362 333
698 3300046538 Ga0495609_0003932 Ga0495609_0003932_2196_3206 333
699 3300046538 Ga0495609_0025869 Ga0495609_0025869_441_1460 333
700 3300046542 Ga0495597_0000501 Ga0495597_0000501_14286_15296 333
701 3300046542 Ga0495597_0092485 Ga0495597_0092485_125_1135 333
702 3300046558 Ga0495633_0005044 Ga0495633_0005044_5039_6049 333
703 3300046615 Ga0495656_0009162 Ga0495656_0009162_2413_3423 333
704 3300046616 Ga0495668_0000273 Ga0495668_0000273_67904_68923 333
705 3300046616 Ga0495668_0000445 Ga0495668_0000445_32528_33538 333
706 3300046616 Ga0495668_0008975 Ga0495668_0008975_2678_3688 333
707 3300046648 Ga0495611_0000547 Ga0495611_0000547_17739_18749 333
708 3300046648 Ga0495611_0001632 Ga0495611_0001632_2193_3203 333
709 3300046660 Ga0495625_0003961 Ga0495625_0003961_5054_6076 333
710 3300046665 Ga0495661_0000089 Ga0495661_0000089_35823_36833 333
711 3300046684 Ga0495669_0009316 Ga0495669_0009316_2030_3040 333
712 3300046684 Ga0495669_0056904 Ga0495669_0056904_732_1751 333
713 3300046694 Ga0495649_0000029 Ga0495649_0000029_67653_68663 333
714 3300046694 Ga0495649_0067967 Ga0495649_0067967_126_1136 333
715 3300046794 Ga0495589_0000015 Ga0495589_0000015_148916_149926 333
716 3300046794 Ga0495589_0000273 Ga0495589_0000273_15959_16978 333
717 3300046794 Ga0495589_0000962 Ga0495589_0000962_12570_13580 333
718 3300046794 Ga0495589_0010186 Ga0495589_0010186_329_1339 333
719 3300046794 Ga0495589_0022083 Ga0495589_0022083_803_1813 333
720 3300046810 Ga0495660_0000123 Ga0495660_0000123_56322_57332 333
721 3300046810 Ga0495660_0004490 Ga0495660_0004490_5831_6841 333
722 3300046810 Ga0495660_0028027 Ga0495660_0028027_1857_2876 333
723 3300047320 Ga0495672_0000065 Ga0495672_0000065_96007_97017 333
724 3300047320 Ga0495672_0000192 Ga0495672_0000192_82691_83701 333
725 3300047320 Ga0495672_0011820 Ga0495672_0011820_3575_4585 333
726 3300047320 Ga0495672_0015956 Ga0495672_0015956_1578_2588 333
727 3300047323 Ga0495683_0000012 Ga0495683_0000012_66303_67313 333
728 3300047323 Ga0495683_0096411 Ga0495683_0096411_222_1232 333
729 3300047443 Ga0495687_000003 Ga0495687_000003_608439_609449 333
730 3300047443 Ga0495687_000007 Ga0495687_000007_253356_254366 333
731 3300047443 Ga0495687_000295 Ga0495687_000295_8305_9315 333
732 3300047445 Ga0495677_0000001 Ga0495677_0000001_549705_550715 333
733 3300047445 Ga0495677_0001541 Ga0495677_0001541_1827_2837 333
734 3300047445 Ga0495677_0006156 Ga0495677_0006156_243_1253 333
735 3300047470 Ga0495681_0022082 Ga0495681_0022082_2172_3182 333
736 3300047472 Ga0495686_0000015 Ga0495686_0000015_242651_243661 333
737 3300047472 Ga0495686_0000190 Ga0495686_0000190_36009_37019 333
738 3300047472 Ga0495686_0005278 Ga0495686_0005278_8519_9538 333
739 3300047472 Ga0495686_0179706 Ga0495686_0179706_201_1211 333
740 3300048091 Ga0495626_0000089 Ga0495626_0000089_103678_104688 333
741 3300048091 Ga0495626_0000200 Ga0495626_0000200_67129_68139 333
742 3300048091 Ga0495626_0016945 Ga0495626_0016945_1794_2804 333
743 3300048091 Ga0495626_0020349 Ga0495626_0020349_1940_2950 333
744 3300048091 Ga0495626_0043483 Ga0495626_0043483_748_1758 333
745 3300048909 Ga0496106_0002387 Ga0496106_0002387_3870_4880 333
746 3300048909 Ga0496106_0275900 Ga0496106_0275900_254_1264 333
747 3300048910 Ga0496107_0032190 Ga0496107_0032190_1385_2395 333
748 3300048912 Ga0496109_0191569 Ga0496109_0191569_899_1909 333
749 3300048916 Ga0496113_0039244 Ga0496113_0039244_993_2003 333
750 3300048917 Ga0496114_0271751 Ga0496114_0271751_335_1336 333
751 3300048925 Ga0496122_0004104 Ga0496122_0004104_2333_3343 333
752 3300048925 Ga0496122_0033396 Ga0496122_0033396_3047_4054 333
753 3300048926 Ga0496123_0005245 Ga0496123_0005245_3170_4177 333
754 3300048926 Ga0496123_0017267 Ga0496123_0017267_2383_3393 333
755 3300048927 Ga0496124_0006729 Ga0496124_0006729_2152_3162 333
756 3300048927 Ga0496124_0061645 Ga0496124_0061645_98_1108 333
757 3300048927 Ga0496124_0197905 Ga0496124_0197905_212_1219 333
758 3300048928 Ga0496125_0038358 Ga0496125_0038358_1918_2928 333
759 3300049459 Ga0495678_000015 Ga0495678_000015_92059_93069 333
760 3300049822 Ga0501035_0001876 Ga0501035_0001876_2392_3402 333
761 3300050496 nmdc:mga07m45_278_c2 nmdc:mga07m45_278_c2_9089_10099 333
762 3300050509 nmdc:mga0qj67_9414_c1 nmdc:mga0qj67_9414_c1_5920_6954 333
763 3300050510 nmdc:mga06r32_67633_c1 nmdc:mga06r32_67633_c1_1371_2405 333
764 3300050511 nmdc:mga08y16_130970_c1 nmdc:mga08y16_130970_c1_1158_2186 333
765 3300050511 nmdc:mga08y16_428604_c1 nmdc:mga08y16_428604_c1_242_1273 333
766 3300050512 nmdc:mga0n895_3166_c1 nmdc:mga0n895_3166_c1_8449_9483 333
767 3300050515 nmdc:mga0a205_5464_c1 nmdc:mga0a205_5464_c1_3413_4447 333
768 3300053136 Ga0500559_0009670 Ga0500559_0009670_375_1376 333
769 3300061719 Ga0466962_0002967 Ga0466962_0002967_2695_3738 333
770 3300003323 rootH1_10021415 rootH1_100214158 334
771 3300003323 rootH1_10039841 rootH1_1003984154 334
772 3300003775 Ga0055524_1000010 Ga0055524_1000010172 334
773 3300005262 Ga0065165_1034780 Ga0065165_10347801 334
774 3300006948 Ga0099826_10000002 Ga0099826_10000002249 334
775 3300009036 Ga0105244_10003017 Ga0105244_100030176 334
776 3300025299 Ga0209256_1000007 Ga0209256_1000007550 334
777 3300025728 Ga0207655_1001866 Ga0207655_100186611 334
778 3300027666 Ga0209282_1000001 Ga0209282_1000001898 334
779 3300035398 Ga0316574_0052152 Ga0316574_0052152_235_1248 334
780 3300041486 Ga0451807_0283309 Ga0451807_0283309_531_1544 334
781 3300044842 Ga0466957_0009575 Ga0466957_0009575_3919_4962 334
782 3300046457 Ga0495590_0000451 Ga0495590_0000451_17050_18069 334
783 3300046463 Ga0495653_0037136 Ga0495653_0037136_1544_2563 334
784 3300046463 Ga0495653_0107859 Ga0495653_0107859_798_1817 334
785 3300046474 Ga0495605_0000647 Ga0495605_0000647_9767_10789 334
786 3300046474 Ga0495605_0001330 Ga0495605_0001330_6059_7063 334
787 3300046492 Ga0495585_0127093 Ga0495585_0127093_193_1215 334
788 3300046499 Ga0495594_0071870 Ga0495594_0071870_805_1827 334
789 3300046500 Ga0495596_0000238 Ga0495596_0000238_21173_22195 334
790 3300046500 Ga0495596_0011687 Ga0495596_0011687_61_1095 334
791 3300046501 Ga0495607_0000995 Ga0495607_0000995_15769_16791 334
792 3300046507 Ga0495606_0026503 Ga0495606_0026503_544_1566 334
793 3300046513 Ga0495616_0003907 Ga0495616_0003907_8325_9347 334
794 3300046513 Ga0495616_0015645 Ga0495616_0015645_3169_4191 334
795 3300046513 Ga0495616_0016074 Ga0495616_0016074_1991_3013 334
796 3300046513 Ga0495616_0019225 Ga0495616_0019225_141_1163 334
797 3300046518 Ga0495631_0002607 Ga0495631_0002607_8462_9484 334
798 3300046518 Ga0495631_0032523 Ga0495631_0032523_921_1949 334
799 3300046519 Ga0495632_0000043 Ga0495632_0000043_34063_35085 334
800 3300046520 Ga0495637_0088223 Ga0495637_0088223_167_1189 334
801 3300046523 Ga0495644_0043394 Ga0495644_0043394_322_1344 334
802 3300046524 Ga0495648_0001910 Ga0495648_0001910_15792_16814 334
803 3300046524 Ga0495648_0015052 Ga0495648_0015052_2579_3601 334
804 3300046528 Ga0495642_0123538 Ga0495642_0123538_79_1101 334
805 3300046530 Ga0495654_0000692 Ga0495654_0000692_9240_10262 334
806 3300046536 Ga0495587_0025462 Ga0495587_0025462_360_1379 334
807 3300046542 Ga0495597_0000030 Ga0495597_0000030_175_1197 334
808 3300046616 Ga0495668_0000381 Ga0495668_0000381_34077_35099 334
809 3300046616 Ga0495668_0071989 Ga0495668_0071989_69_1091 334
810 3300046616 Ga0495668_0127239 Ga0495668_0127239_337_1359 334
811 3300046684 Ga0495669_0035976 Ga0495669_0035976_785_1807 334
812 3300046691 Ga0495670_0019879 Ga0495670_0019879_2228_3250 334
813 3300046692 Ga0495671_0000964 Ga0495671_0000964_14923_15945 334
814 3300046694 Ga0495649_0090965 Ga0495649_0090965_403_1437 334
815 3300046794 Ga0495589_0071881 Ga0495589_0071881_543_1565 334
816 3300046810 Ga0495660_0004629 Ga0495660_0004629_1862_2884 334
817 3300047443 Ga0495687_000067 Ga0495687_000067_58549_59571 334
818 3300047443 Ga0495687_009020 Ga0495687_009020_3712_4734 334
819 3300047444 Ga0495675_0084199 Ga0495675_0084199_366_1385 334
820 3300047446 Ga0495679_001202 Ga0495679_001202_3341_4363 334
821 3300047447 Ga0495685_003676 Ga0495685_003676_2073_3095 334
822 3300047470 Ga0495681_0010866 Ga0495681_0010866_3569_4591 334
823 3300048088 Ga0495602_0011369 Ga0495602_0011369_2347_3366 334
824 3300048927 Ga0496124_0024820 Ga0496124_0024820_2268_3272 334
825 3300048927 Ga0496124_0076307 Ga0496124_0076307_1347_2369 334
826 3300049459 Ga0495678_000178 Ga0495678_000178_68545_69567 334
827 3300049459 Ga0495678_003372 Ga0495678_003372_2440_3462 334
828 3300049460 Ga0495682_0000248 Ga0495682_0000248_36140_37162 334
829 3300046694 Ga0495649_0091566 Ga0495649_0091566_513_1520 335
830 iso_pu_bacteria 2576861471 2578458314 335
831 iso_pu_bacteria 2857442823 2857443406 335
832 iso_pu_bacteria 2939622612 2939623690 335
833 iso_pu_bacteria 2941475908 2941478424 335
834 iso_pu_bacteria 2974307012 2974308831 335
835 iso_pu_bacteria 2977247770 2977249550 335
836 iso_pu_bacteria 2984514374 2984515961 335
837 iso_pu_bacteria 8021626552 8021628016 335
838 iso_pu_bacteria 8021648035 8021648927 335
839 3300037312 Ga0395899_0000018 Ga0395899_0000018_394391_395410 336
840 3300044658 Ga0466972_0001066 Ga0466972_0001066_4068_5090 336
841 3300044683 Ga0466965_0001602 Ga0466965_0001602_3280_4302 336
842 3300044706 Ga0466964_0002334 Ga0466964_0002334_3626_4648 336
843 3300044842 Ga0466957_0070162 Ga0466957_0070162_263_1285 336
844 3300046674 Ga0495588_0000052 Ga0495588_0000052_215799_216821 336
845 3300046810 Ga0495660_0004866 Ga0495660_0004866_3430_4440 336
846 3300005617 Ga0068859_100184334 Ga0068859_1001843342 337
847 3300006931 Ga0097620_100184339 Ga0097620_1001843392 337
848 3300006948 Ga0099826_10080508 Ga0099826_100805082 337
849 3300009174 Ga0105241_10246310 Ga0105241_102463102 337
850 3300025911 Ga0207654_10056875 Ga0207654_100568752 337
851 3300028794 Ga0307515_10014980 Ga0307515_100149804 337
852 3300031456 Ga0307513_10051744 Ga0307513_100517443 337
853 3300032002 Ga0307416_100096328 Ga0307416_1000963282 337
854 3300045051 Ga0451576_0016609 Ga0451576_0016609_3449_4471 337
855 3300046471 Ga0495650_0068094 Ga0495650_0068094_93_1115 337
856 3300053092 Ga0500583_0002256 Ga0500583_0002256_2221_3240 337
857 3300053151 Ga0500604_0006147 Ga0500604_0006147_1333_2355 337
858 3300053153 Ga0500616_0007463 Ga0500616_0007463_5770_6792 337
859 3300053158 Ga0500627_0045944 Ga0500627_0045944_700_1719 337
860 3300005547 Ga0070693_100001802 Ga0070693_1000018022 338
861 iso_pu_bacteria 2690315857 2691329255 338
862 iso_pu_bacteria 2747842501 2748018141 338
863 iso_pu_bacteria 2919534386 2919537444 338
864 3300003781 Ga0055536_1003467 Ga0055536_10034674 339
865 3300003781 Ga0055536_1003484 Ga0055536_10034844 339
866 3300003791 Ga0055530_10000056 Ga0055530_100000562 339
867 3300003791 Ga0055530_10000168 Ga0055530_1000016847 339
868 3300003794 Ga0055531_10004512 Ga0055531_100045124 339
869 3300003794 Ga0055531_10008426 Ga0055531_100084263 339
870 3300006038 Ga0075365_10081619 Ga0075365_100816192 339
871 3300009011 Ga0105251_10005338 Ga0105251_100053385 339
872 3300013104 Ga0157370_10013426 Ga0157370_100134265 339
873 3300014497 Ga0182008_10000013 Ga0182008_1000001346 339
874 3300014497 Ga0182008_10029729 Ga0182008_100297292 339
875 3300015261 Ga0182006_1076790 Ga0182006_10767902 339
876 3300015265 Ga0182005_1001569 Ga0182005_10015697 339
877 3300017792 Ga0163161_10035183 Ga0163161_100351832 339
878 3300025245 Ga0207425_1018172 Ga0207425_10181722 339
879 3300025292 Ga0209676_1000354 Ga0209676_100035429 339
880 3300025298 Ga0209050_1000069 Ga0209050_1000069183 339
881 3300025298 Ga0209050_1025682 Ga0209050_10256822 339
882 3300025299 Ga0209256_1000965 Ga0209256_100096522 339
883 3300025299 Ga0209256_1006508 Ga0209256_10065083 339
884 3300025304 Ga0209257_1000194 Ga0209257_100019476 339
885 3300025304 Ga0209257_1005408 Ga0209257_10054088 339
886 3300025735 Ga0207713_1039236 Ga0207713_10392362 339
887 3300042006 Ga0439432_029018 Ga0439432_029018_508_1527 339
888 3300046460 Ga0495638_0000604 Ga0495638_0000604_15498_16517 339
889 3300046460 Ga0495638_0002210 Ga0495638_0002210_11269_12288 339
890 3300046525 Ga0495663_0000785 Ga0495663_0000785_8236_9255 339
891 3300046558 Ga0495633_0008714 Ga0495633_0008714_1420_2439 339
892 3300046660 Ga0495625_0054903 Ga0495625_0054903_816_1835 339
893 3300046660 Ga0495625_0103307 Ga0495625_0103307_120_1139 339
894 3300046660 Ga0495625_0223552 Ga0495625_0223552_94_1113 339
895 3300047320 Ga0495672_0000006 Ga0495672_0000006_375592_376611 339
896 3300047472 Ga0495686_0006246 Ga0495686_0006246_5662_6681 339
897 3300048913 Ga0496110_0206371 Ga0496110_0206371_352_1371 339
898 3300048916 Ga0496113_0191476 Ga0496113_0191476_411_1430 339
899 3300048919 Ga0496116_0000757 Ga0496116_0000757_5742_6761 339
900 3300048919 Ga0496116_0028644 Ga0496116_0028644_1081_2100 339
901 3300048920 Ga0496117_0000065 Ga0496117_0000065_72493_73512 339
902 3300048920 Ga0496117_0000575 Ga0496117_0000575_8852_9871 339
903 3300048921 Ga0496118_0000033 Ga0496118_0000033_252846_253865 339
904 3300048921 Ga0496118_0000382 Ga0496118_0000382_23726_24745 339
905 3300048921 Ga0496118_0000557 Ga0496118_0000557_3084_4103 339
906 3300048924 Ga0496121_0002039 Ga0496121_0002039_10619_11638 339
907 3300048925 Ga0496122_0001066 Ga0496122_0001066_37760_38779 339
908 3300048925 Ga0496122_0001384 Ga0496122_0001384_18597_19616 339
909 3300048926 Ga0496123_0000419 Ga0496123_0000419_8932_9951 339
910 3300048926 Ga0496123_0008591 Ga0496123_0008591_931_1950 339
911 3300048926 Ga0496123_0014468 Ga0496123_0014468_1658_2677 339
912 3300048927 Ga0496124_0000569 Ga0496124_0000569_53379_54398 339
913 3300048927 Ga0496124_0003340 Ga0496124_0003340_9591_10610 339
914 3300048927 Ga0496124_0008940 Ga0496124_0008940_6375_7394 339
915 3300048927 Ga0496124_0009726 Ga0496124_0009726_3110_4129 339
916 3300048927 Ga0496124_0089965 Ga0496124_0089965_692_1711 339
917 3300048928 Ga0496125_0004414 Ga0496125_0004414_13320_14339 339
918 3300048929 Ga0496126_0079388 Ga0496126_0079388_1085_2104 339
919 3300048929 Ga0496126_0321628 Ga0496126_0321628_120_1139 339
920 3300050492 nmdc:mga0yw44_3099_c1 nmdc:mga0yw44_3099_c1_404_1423 339
921 3300053128 Ga0500626_005836 Ga0500626_005836_1192_2211 339
922 3300005333 Ga0070677_10041023 Ga0070677_100410232 340
923 3300005356 Ga0070674_100094663 Ga0070674_1000946632 340
924 3300005548 Ga0070665_100104534 Ga0070665_1001045342 340
925 3300005841 Ga0068863_100282113 Ga0068863_1002821132 340
926 3300006358 Ga0068871_100071864 Ga0068871_1000718643 340
927 3300014325 Ga0163163_10254585 Ga0163163_102545852 340
928 3300025292 Ga0209676_1010724 Ga0209676_10107243 340
929 3300025294 Ga0209025_1007736 Ga0209025_10077363 340
930 3300041404 Ga0439436_0012373 Ga0439436_0012373_1338_2360 340
931 3300042007 Ga0439449_0000144 Ga0439449_0000144_21801_22823 340
932 3300046691 Ga0495670_0048652 Ga0495670_0048652_39_1061 340
933 3300048920 Ga0496117_0060828 Ga0496117_0060828_1267_2304 340
934 3300049568 Ga0501031_0107988 Ga0501031_0107988_736_1758 340
935 3300049569 Ga0501032_0019857 Ga0501032_0019857_180_1202 340
936 3300049571 Ga0501034_0106416 Ga0501034_0106416_736_1764 340
937 3300049573 Ga0501037_0088170 Ga0501037_0088170_517_1545 340
938 3300049574 Ga0501038_0175998 Ga0501038_0175998_385_1413 340
939 3300049574 Ga0501038_0254452 Ga0501038_0254452_125_1147 340
940 3300049575 Ga0501039_0018765 Ga0501039_0018765_4118_5146 340
941 3300049579 Ga0501043_0257407 Ga0501043_0257407_189_1211 340
942 3300049580 Ga0501046_0008689 Ga0501046_0008689_4794_5816 340
943 3300049580 Ga0501046_0080098 Ga0501046_0080098_361_1389 340
944 3300049580 Ga0501046_0114398 Ga0501046_0114398_758_1786 340
945 3300049580 Ga0501046_0188502 Ga0501046_0188502_402_1439 340
946 3300049581 Ga0501047_0006271 Ga0501047_0006271_1605_2633 340
947 3300049581 Ga0501047_0294483 Ga0501047_0294483_195_1217 340
948 3300049581 Ga0501047_0319198 Ga0501047_0319198_250_1278 340
949 3300049585 Ga0501069_0031520 Ga0501069_0031520_30_1058 340
950 3300049822 Ga0501035_0026768 Ga0501035_0026768_3370_4398 340
951 3300049822 Ga0501035_0207431 Ga0501035_0207431_321_1343 340
952 3300049823 Ga0501044_0021716 Ga0501044_0021716_299_1327 340
953 3300049823 Ga0501044_0293691 Ga0501044_0293691_427_1449 340
954 3300053156 Ga0500622_0022344 Ga0500622_0022344_1495_2532 340
955 iso_pu_bacteria 8003014200 8003016883 340
956 3300001990 JGI24737J22298_10001060 JGI24737J22298_100010602 343
957 3300005985 Ga0081539_10011361 Ga0081539_100113615 343
958 3300044842 Ga0466957_0206970 Ga0466957_0206970_77_1108 343
959 3300045976 Ga0466967_0360652 Ga0466967_0360652_72_1103 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13621

Cupin_8

Cupin-like domain

72

319

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8564 148 261
6ax3-assembly1.cif.gz_A complex structure of jmjd5 and symmetric dimethyl-arginine (sdma) 0.8548 5 264
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.8538 148 262
6ax3-assembly1.cif.gz_A complex structure of jmjd5 and symmetric dimethyl-arginine (sdma) 0.8516 5 264
6f4r-assembly1.cif.gz_A human jmjd5 (n308c) in complex with mn(ii), nog and rccd1 (139-143) (complex-3) 0.8501 7 264
ID Description Score Start End Superfamily
af_Q17765_350_577_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8594 10 262 2.60.120.650
af_A0A0P0XHH9_265_498_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8567 6 263 2.60.120.650
af_Q9W0M3_161_400_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8551 8 263 2.60.120.650
af_A0A0P0XHH9_265_498_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8533 6 263 2.60.120.650
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.852 143 262 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W6NZ42-F1-model_v4 JmjC domain-containing protein 0.9906 5 343
AF-A0A520FKW9-F1-model_v4 deleted 0.9878 1 343
AF-A0A4Q6CEE4-F1-model_v4 Cupin-like domain-containing protein 0.987 22 343
AF-A0A3R7VLW9-F1-model_v4 deleted 0.9866 6 343
AF-A0A4P8HVQ4-F1-model_v4 Uncharacterized protein 0.9859 5 343

Feature Viewer

pLDDT pTM Quality
95.19 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map