F486853

General Info

Members Datasets Scaffolds Average Seq Length
961 413 895 217

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1000852|JGI25160J50197_10008528
Length 258
Sequence MQFYMVAKVGNSPFMKKNYRHFFPTITLSFTSFVLLAYLSGMVLNLSDQHSLVSNWVSELRNVNIQSDRMRFRRNLERIGEIAAYEISKTLPFKEEEVQTPLGLHTSKLLAQQPVLATILRAGLPLHNGMLNYFDRADNAFVSAYRKHHRDGSFEINVEYMSCPTLENRIVIISDPMLATGASLVKTIAVMKEEGLPAEIHVVTAIACTVGIEFVRRESGEDIKIWCGDIDDELTAKGYIVPGLGDAGDLAFGPKNQS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
22 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
23 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
24 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
25 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
26 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
27 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
28 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
29 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
30 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
31 2818991444 Filimonas endophytica 3197 Isolate Unclassified
32 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
33 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
34 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
35 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
36 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
37 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
38 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
39 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
40 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
41 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
42 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
43 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
44 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
45 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
46 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
47 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
48 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
49 2914759650 Rhizosphaericola mali Isolate Rhizosphere
50 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
51 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
52 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
53 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
54 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
55 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
56 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
57 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
58 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
59 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
60 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
61 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
62 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
63 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
64 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
65 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
66 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
67 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
68 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
69 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
128 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
129 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
130 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
131 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
132 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
133 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
136 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
137 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
243 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
246 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
271 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
274 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
353 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
354 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
368 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
369 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
370 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
371 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
372 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
373 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
374 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
375 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
376 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
377 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
378 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
379 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
380 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
381 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
382 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
383 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
384 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
385 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
390 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
397 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
399 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
400 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
401 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
402 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
405 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0.21
Isolates 6.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 3.95
Nodule 0.1
Rhizoplane 0.94
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 7.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1635683 2162886007 Bacteria 1022
2 SwRhRL2b_contig_2652683 2162886007 Bacteria 2171
3 JGI24741J21665_1002924 3300001915 Bacteria 4267
4 JGI24740J21852_10002363 3300001979 Bacteria 8571
5 JGI24740J21852_10006066 3300001979 Bacteria 5050
6 JGI25406J46586_10001770 3300003203 Bacteria 10168
7 rootH1_10131517 3300003316 Bacteria 1292
8 rootH2_10095483 3300003320 Bacteria 2077
9 rootH2_10109685 3300003320 Bacteria 4956
10 rootL2_10063816 3300003322 Unclassified 4807
11 rootH1_10039994 3300003323 Bacteria 6274
12 rootH1_10147471 3300003323 Bacteria 4326
13 rootH1_10202610 3300003323 Bacteria 1080
14 JGI25160J50197_1000852 3300003354 Bacteria 16210
15 Ga0006562J51391_1011765 3300003578 Bacteria 1193
16 Ga0055534_1014943 3300003784 Bacteria 1438
17 Ga0055531_10000115 3300003794 Bacteria 88381
18 Ga0058860_11744412 3300004801 Bacteria 961
19 Ga0065165_1010249 3300005262 Bacteria 4080
20 Ga0065714_10065177 3300005288 Bacteria 12217
21 Ga0065714_10118035 3300005288 Bacteria 1384
22 Ga0065704_10071156 3300005289 Bacteria 12796
23 Ga0065704_10077203 3300005289 Bacteria 4820
24 Ga0065704_10086148 3300005289 Bacteria 3149
25 Ga0065704_10283138 3300005289 Bacteria 918
26 Ga0065712_10002959 3300005290 Bacteria 5986
27 Ga0065712_10027299 3300005290 Unclassified 1102
28 Ga0065712_10073468 3300005290 Bacteria 4382
29 Ga0065712_10167465 3300005290 Bacteria 1262
30 Ga0065715_10001700 3300005293 Bacteria 12165
31 Ga0065715_10132314 3300005293 Bacteria 1992
32 Ga0065707_10005547 3300005295 Bacteria 4010
33 Ga0065707_10092699 3300005295 Bacteria 3731
34 Ga0070658_10220966 3300005327 Unclassified 1602
35 Ga0070676_10000034 3300005328 Bacteria 41415
36 Ga0070676_10012393 3300005328 Bacteria 4652
37 Ga0070676_10130395 3300005328 Unclassified 1589
38 Ga0070676_10498460 3300005328 Unclassified 864
39 Ga0070683_100000659 3300005329 Bacteria 24948
40 Ga0070683_100008602 3300005329 Bacteria 8675
41 Ga0070683_100014987 3300005329 Bacteria 6800
42 Ga0070683_100167534 3300005329 Unclassified 2085
43 Ga0070690_100050853 3300005330 Unclassified 2644
44 Ga0070690_100122306 3300005330 Bacteria 1748
45 Ga0070690_100213108 3300005330 Bacteria 1350
46 Ga0070690_100363542 3300005330 Bacteria 1054
47 Ga0070670_100032746 3300005331 Bacteria 4478
48 Ga0070670_100036355 3300005331 Unclassified 4238
49 Ga0070670_100039493 3300005331 Bacteria 4058
50 Ga0070670_100124310 3300005331 Bacteria 2226
51 Ga0070670_100192437 3300005331 Bacteria 1772
52 Ga0070670_100499735 3300005331 Bacteria 1081
53 Ga0070670_100907355 3300005331 Bacteria 799
54 Ga0068869_100019822 3300005334 Bacteria 4604
55 Ga0068869_100047968 3300005334 Bacteria 3086
56 Ga0068869_100065506 3300005334 Unclassified 2675
57 Ga0070666_10000431 3300005335 Bacteria 25787
58 Ga0070666_10020565 3300005335 Bacteria 4268
59 Ga0070666_10051457 3300005335 Unclassified 2774
60 Ga0070682_100000474 3300005337 Bacteria 25301
61 Ga0070682_100189797 3300005337 Bacteria 1442
62 Ga0068868_100001305 3300005338 Bacteria 17174
63 Ga0068868_100014762 3300005338 Bacteria 5764
64 Ga0068868_100057484 3300005338 Unclassified 3073
65 Ga0068868_100209799 3300005338 Unclassified 1627
66 Ga0070660_100340634 3300005339 Bacteria 1234
67 Ga0070689_100077183 3300005340 Unclassified 2611
68 Ga0070689_100120093 3300005340 Bacteria 2099
69 Ga0070689_100179787 3300005340 Bacteria 1717
70 Ga0070689_100434389 3300005340 Bacteria 1115
71 Ga0070661_100009156 3300005344 Bacteria 6843
72 Ga0070661_100009332 3300005344 Bacteria 6788
73 Ga0070661_100101022 3300005344 Bacteria 2145
74 Ga0070668_100000087 3300005347 Bacteria 57426
75 Ga0070668_100136073 3300005347 Bacteria 1976
76 Ga0070669_100029165 3300005353 Bacteria 3976
77 Ga0070669_100279480 3300005353 Bacteria 1337
78 Ga0070669_100284695 3300005353 Unclassified 1325
79 Ga0070669_100298236 3300005353 Unclassified 1296
80 Ga0070675_100016216 3300005354 Bacteria 5911
81 Ga0070675_100117374 3300005354 Unclassified 2258
82 Ga0070675_100118146 3300005354 Bacteria 2251
83 Ga0070675_100141582 3300005354 Unclassified 2056
84 Ga0070675_100157019 3300005354 Unclassified 1954
85 Ga0070675_100164717 3300005354 Unclassified 1909
86 Ga0070675_100247803 3300005354 Bacteria 1558
87 Ga0070675_100520910 3300005354 Bacteria 1073
88 Ga0070671_100021476 3300005355 Bacteria 5272
89 Ga0070671_100063802 3300005355 Unclassified 3068
90 Ga0070671_100110437 3300005355 Bacteria 2309
91 Ga0070674_100040831 3300005356 Bacteria 3140
92 Ga0070674_100045340 3300005356 Unclassified 3004
93 Ga0070674_100144957 3300005356 Bacteria 1786
94 Ga0070673_100000074 3300005364 Bacteria 42660
95 Ga0070673_100006567 3300005364 Bacteria 7569
96 Ga0070673_100016521 3300005364 Bacteria 5222
97 Ga0070673_100020236 3300005364 Bacteria 4796
98 Ga0070673_100028926 3300005364 Bacteria 4127
99 Ga0070673_100131684 3300005364 Unclassified 2099
100 Ga0070673_100203480 3300005364 Bacteria 1706
101 Ga0070673_100413458 3300005364 Bacteria 1208
102 Ga0070688_100009006 3300005365 Bacteria 5441
103 Ga0070688_100032610 3300005365 Unclassified 3142
104 Ga0070688_100084330 3300005365 Unclassified 2064
105 Ga0070688_100112042 3300005365 Bacteria 1816
106 Ga0070688_100222132 3300005365 Bacteria 1332
107 Ga0070659_100004124 3300005366 Bacteria 10359
108 Ga0070659_100022811 3300005366 Bacteria 4782
109 Ga0070659_100048868 3300005366 Bacteria 3324
110 Ga0070667_100000031 3300005367 Bacteria 177447
111 Ga0070667_100016900 3300005367 Bacteria 6038
112 Ga0070667_100057008 3300005367 Bacteria 3300
113 Ga0070667_100368257 3300005367 Bacteria 1303
114 Ga0070701_10208116 3300005438 Bacteria 1160
115 Ga0070663_100409489 3300005455 Unclassified 1110
116 Ga0070663_100652464 3300005455 Bacteria 890
117 Ga0070678_100082152 3300005456 Unclassified 2445
118 Ga0070678_100194169 3300005456 Bacteria 1671
119 Ga0070678_100413227 3300005456 Unclassified 1175
120 Ga0070678_100776741 3300005456 Unclassified 868
121 Ga0070662_100003774 3300005457 Bacteria 9477
122 Ga0070662_100010942 3300005457 Bacteria 5980
123 Ga0070662_100012743 3300005457 Bacteria 5581
124 Ga0070662_100067746 3300005457 Unclassified 2622
125 Ga0070662_100078679 3300005457 Bacteria 2450
126 Ga0070662_100139660 3300005457 Bacteria 1876
127 Ga0068867_100010592 3300005459 Bacteria 6507
128 Ga0068867_100048371 3300005459 Bacteria 3128
129 Ga0068867_100245665 3300005459 Bacteria 1453
130 Ga0068867_100281240 3300005459 Bacteria 1364
131 Ga0068867_100372018 3300005459 Bacteria 1198
132 Ga0068867_100664731 3300005459 Unclassified 916
133 Ga0070685_10010889 3300005466 Bacteria 4741
134 Ga0070685_10017106 3300005466 Unclassified 3876
135 Ga0070685_10035260 3300005466 Unclassified 2821
136 Ga0070685_10063704 3300005466 Unclassified 2166
137 Ga0070685_10262359 3300005466 Bacteria 1149
138 Ga0070698_100005145 3300005471 Bacteria 14305
139 Ga0070698_100245197 3300005471 Bacteria 1724
140 Ga0070679_100189034 3300005530 Bacteria 2029
141 Ga0070679_100237816 3300005530 Bacteria 1780
142 Ga0070684_100001403 3300005535 Bacteria 17339
143 Ga0070684_100003737 3300005535 Bacteria 11481
144 Ga0070684_100020041 3300005535 Bacteria 5544
145 Ga0070684_100192781 3300005535 Bacteria 1855
146 Ga0070684_100242305 3300005535 Bacteria 1648
147 Ga0068853_100004545 3300005539 Bacteria 10768
148 Ga0068853_100008021 3300005539 Bacteria 8471
149 Ga0068853_100013622 3300005539 Bacteria 6646
150 Ga0068853_100016660 3300005539 Bacteria 6052
151 Ga0068853_100453109 3300005539 Bacteria 1207
152 Ga0070672_100000002 3300005543 Bacteria 159809
153 Ga0070672_100196987 3300005543 Bacteria 1683
154 Ga0070672_100213041 3300005543 Unclassified 1618
155 Ga0070672_100334937 3300005543 Bacteria 1288
156 Ga0070672_100426982 3300005543 Bacteria 1139
157 Ga0070672_100847629 3300005543 Bacteria 806
158 Ga0070686_100111833 3300005544 Unclassified 1862
159 Ga0070665_100000222 3300005548 Bacteria 94961
160 Ga0070665_100004685 3300005548 Bacteria 14276
161 Ga0068855_100026121 3300005563 Bacteria 6986
162 Ga0068855_100070405 3300005563 Bacteria 4069
163 Ga0070664_100000140 3300005564 Bacteria 49126
164 Ga0070664_100004377 3300005564 Bacteria 11348
165 Ga0070664_100046706 3300005564 Unclassified 3658
166 Ga0070664_100124460 3300005564 Bacteria 2260
167 Ga0070664_100141526 3300005564 Bacteria 2119
168 Ga0068857_100017088 3300005577 Bacteria 6355
169 Ga0068857_100021957 3300005577 Bacteria 5617
170 Ga0068857_100052373 3300005577 Bacteria 3622
171 Ga0068857_100053671 3300005577 Bacteria 3575
172 Ga0068857_100313255 3300005577 Bacteria 1448
173 Ga0068857_100382233 3300005577 Bacteria 1308
174 Ga0068854_100196964 3300005578 Unclassified 1581
175 Ga0068856_100013283 3300005614 Bacteria 7976
176 Ga0068856_100385193 3300005614 Bacteria 1422
177 Ga0068852_100089148 3300005616 Bacteria 2756
178 Ga0068852_100094789 3300005616 Unclassified 2679
179 Ga0068852_100137786 3300005616 Bacteria 2255
180 Ga0068852_100143997 3300005616 Bacteria 2209
181 Ga0068852_100367051 3300005616 Bacteria 1409
182 Ga0068852_100744796 3300005616 Bacteria 992
183 Ga0068859_100021050 3300005617 Bacteria 6545
184 Ga0068859_100032817 3300005617 Bacteria 5216
185 Ga0068859_100047523 3300005617 Bacteria 4312
186 Ga0068859_100277182 3300005617 Bacteria 1769
187 Ga0068859_100497615 3300005617 Bacteria 1314
188 Ga0068864_100007000 3300005618 Bacteria 9253
189 Ga0068864_100013799 3300005618 Bacteria 6697
190 Ga0068864_100017006 3300005618 Bacteria 6060
191 Ga0068864_100030338 3300005618 Unclassified 4582
192 Ga0068864_100112585 3300005618 Bacteria 2426
193 Ga0068864_100150762 3300005618 Unclassified 2106
194 Ga0068864_100162138 3300005618 Bacteria 2033
195 Ga0068864_100221186 3300005618 Bacteria 1747
196 Ga0068864_100356698 3300005618 Bacteria 1381
197 Ga0068866_10144134 3300005718 Bacteria 1371
198 Ga0068861_100008249 3300005719 Bacteria 7167
199 Ga0068861_101086946 3300005719 Bacteria 768
200 Ga0068851_10034023 3300005834 Bacteria 2542
201 Ga0068851_10156310 3300005834 Bacteria 1250
202 Ga0068870_10010587 3300005840 Bacteria 4243
203 Ga0068870_10026063 3300005840 Bacteria 2910
204 Ga0068863_100004520 3300005841 Bacteria 13723
205 Ga0068863_100029214 3300005841 Bacteria 5264
206 Ga0068863_100081959 3300005841 Bacteria 3057
207 Ga0068863_100140676 3300005841 Unclassified 2306
208 Ga0068863_100315848 3300005841 Bacteria 1517
209 Ga0068863_100405879 3300005841 Unclassified 1333
210 Ga0068858_100001512 3300005842 Bacteria 23886
211 Ga0068858_100017339 3300005842 Bacteria 6754
212 Ga0068858_100062769 3300005842 Unclassified 3436
213 Ga0068858_100556786 3300005842 Bacteria 1110
214 Ga0068860_100009821 3300005843 Bacteria 9495
215 Ga0068860_100060843 3300005843 Bacteria 3588
216 Ga0068860_100166484 3300005843 Bacteria 2128
217 Ga0068860_100258732 3300005843 Unclassified 1696
218 Ga0068860_100327688 3300005843 Bacteria 1504
219 Ga0068860_100328343 3300005843 Bacteria 1502
220 Ga0068860_100612197 3300005843 Bacteria 1095
221 Ga0068862_101171056 3300005844 Bacteria 766
222 Ga0068862_101183361 3300005844 Bacteria 762
223 Ga0081539_10003031 3300005985 Bacteria 21772
224 Ga0070715_10068794 3300006163 Unclassified 1575
225 Ga0070716_100134074 3300006173 Bacteria 1570
226 Ga0075366_10246641 3300006195 Bacteria 1089
227 Ga0097621_100000118 3300006237 Bacteria 45384
228 Ga0097621_100008450 3300006237 Bacteria 7417
229 Ga0097621_100013072 3300006237 Bacteria 6173
230 Ga0097621_100062601 3300006237 Unclassified 3055
231 Ga0097621_100067320 3300006237 Unclassified 2952
232 Ga0068871_100002078 3300006358 Bacteria 13539
233 Ga0068871_100004602 3300006358 Bacteria 9627
234 Ga0068871_100008550 3300006358 Bacteria 7357
235 Ga0068871_100042168 3300006358 Unclassified 3662
236 Ga0068871_100111340 3300006358 Bacteria 2303
237 Ga0068871_100558475 3300006358 Bacteria 1037
238 Ga0075434_100334330 3300006871 Bacteria 1535
239 Ga0068865_100004341 3300006881 Bacteria 8557
240 Ga0068865_100208063 3300006881 Bacteria 1523
241 Ga0068865_100506559 3300006881 Unclassified 1007
242 Ga0097620_100021048 3300006931 Bacteria 6545
243 Ga0097620_100032818 3300006931 Bacteria 5216
244 Ga0097620_100047525 3300006931 Bacteria 4312
245 Ga0097620_100277184 3300006931 Bacteria 1769
246 Ga0097620_100497611 3300006931 Bacteria 1314
247 Ga0075435_100596107 3300007076 Bacteria 958
248 Ga0105251_10221810 3300009011 Unclassified 851
249 Ga0105244_10000001 3300009036 Bacteria 1034899
250 Ga0105240_10091298 3300009093 Bacteria 3721
251 Ga0105240_10141802 3300009093 Unclassified 2872
252 Ga0105240_10172116 3300009093 Bacteria 2563
253 Ga0105240_10327262 3300009093 Bacteria 1745
254 Ga0105240_10492096 3300009093 Bacteria 1365
255 Ga0111539_10011540 3300009094 Bacteria 11086
256 Ga0111539_11289095 3300009094 Unclassified 848
257 Ga0105245_10105819 3300009098 Bacteria 2610
258 Ga0105247_10103967 3300009101 Unclassified 1819
259 Ga0105243_10000043 3300009148 Bacteria 158809
260 Ga0105243_10000471 3300009148 Bacteria 41457
261 Ga0105243_10254725 3300009148 Bacteria 1569
262 Ga0105243_10360534 3300009148 Bacteria 1338
263 Ga0105241_10097710 3300009174 Unclassified 2329
264 Ga0105241_10591351 3300009174 Unclassified 1001
265 Ga0105242_10002571 3300009176 Bacteria 14204
266 Ga0105242_10033243 3300009176 Bacteria 4129
267 Ga0105242_10160382 3300009176 Bacteria 1968
268 Ga0105242_10320408 3300009176 Unclassified 1421
269 Ga0105242_10786708 3300009176 Unclassified 940
270 Ga0105248_10007403 3300009177 Bacteria 12044
271 Ga0105248_10046955 3300009177 Bacteria 4842
272 Ga0105248_10112484 3300009177 Unclassified 3070
273 Ga0105248_10705530 3300009177 Bacteria 1138
274 Ga0105248_10789651 3300009177 Unclassified 1072
275 Ga0105237_10003065 3300009545 Bacteria 20154
276 Ga0105237_10008005 3300009545 Bacteria 11503
277 Ga0105237_10064235 3300009545 Bacteria 3667
278 Ga0105238_10040835 3300009551 Bacteria 4700
279 Ga0105238_10087548 3300009551 Bacteria 3102
280 Ga0105249_10004261 3300009553 Bacteria 12362
281 Ga0105249_10012725 3300009553 Bacteria 7415
282 Ga0105249_10016984 3300009553 Bacteria 6456
283 Ga0105249_10018030 3300009553 Bacteria 6275
284 Ga0105249_10981098 3300009553 Bacteria 913
285 Ga0105239_10007361 3300010375 Bacteria 12641
286 Ga0105239_10027880 3300010375 Bacteria 6214
287 Ga0105239_10093905 3300010375 Bacteria 3313
288 Ga0105239_10226412 3300010375 Bacteria 2098
289 Ga0105246_10054873 3300011119 Bacteria 2748
290 Ga0105246_10318941 3300011119 Unclassified 1262
291 Ga0105246_10352988 3300011119 Bacteria 1206
292 Ga0157373_10045686 3300013100 Bacteria 3126
293 Ga0157373_10093372 3300013100 Bacteria 2119
294 Ga0157373_10144437 3300013100 Bacteria 1673
295 Ga0157373_10259770 3300013100 Bacteria 1229
296 Ga0157371_10001559 3300013102 Bacteria 23578
297 Ga0157371_10041420 3300013102 Bacteria 3287
298 Ga0157371_10072212 3300013102 Bacteria 2444
299 Ga0157371_10223246 3300013102 Bacteria 1353
300 Ga0157370_10002236 3300013104 Bacteria 23541
301 Ga0157370_10002888 3300013104 Bacteria 20484
302 Ga0157370_10091456 3300013104 Bacteria 2857
303 Ga0157370_10103586 3300013104 Bacteria 2664
304 Ga0157370_10124926 3300013104 Bacteria 2402
305 Ga0157369_10003002 3300013105 Bacteria 20184
306 Ga0157369_10058863 3300013105 Bacteria 4144
307 Ga0157369_10069399 3300013105 Bacteria 3786
308 Ga0157369_10116156 3300013105 Bacteria 2842
309 Ga0157369_10202772 3300013105 Bacteria 2081
310 Ga0157374_10000015 3300013296 Bacteria 296773
311 Ga0157374_10000074 3300013296 Bacteria 99947
312 Ga0157374_10012937 3300013296 Bacteria 7272
313 Ga0157374_10014871 3300013296 Bacteria 6819
314 Ga0157374_10017378 3300013296 Bacteria 6331
315 Ga0157374_10029637 3300013296 Bacteria 4959
316 Ga0157374_10142976 3300013296 Bacteria 2323
317 Ga0157374_10163280 3300013296 Bacteria 2170
318 Ga0157374_10548155 3300013296 Bacteria 1164
319 Ga0157378_10005674 3300013297 Bacteria 10920
320 Ga0157378_10009176 3300013297 Bacteria 8612
321 Ga0157378_10013430 3300013297 Bacteria 7159
322 Ga0157378_10029744 3300013297 Bacteria 4823
323 Ga0157378_10075578 3300013297 Bacteria 3033
324 Ga0157378_10198282 3300013297 Unclassified 1897
325 Ga0157378_10245695 3300013297 Unclassified 1711
326 Ga0157378_10580255 3300013297 Bacteria 1130
327 Ga0157378_10731065 3300013297 Bacteria 1011
328 Ga0163162_10000029 3300013306 Bacteria 168510
329 Ga0163162_10000086 3300013306 Bacteria 85949
330 Ga0163162_10004131 3300013306 Bacteria 13940
331 Ga0163162_10004603 3300013306 Bacteria 13291
332 Ga0163162_10197211 3300013306 Unclassified 2142
333 Ga0163162_10355334 3300013306 Unclassified 1598
334 Ga0163162_10620865 3300013306 Unclassified 1206
335 Ga0163162_10807736 3300013306 Bacteria 1055
336 Ga0157372_10070798 3300013307 Bacteria 3925
337 Ga0157372_10106229 3300013307 Bacteria 3211
338 Ga0157372_10139972 3300013307 Bacteria 2787
339 Ga0157372_10597830 3300013307 Bacteria 1286
340 Ga0157372_10802269 3300013307 Bacteria 1094
341 Ga0157372_10923679 3300013307 Bacteria 1012
342 Ga0157375_10000042 3300013308 Bacteria 160008
343 Ga0157375_10000115 3300013308 Bacteria 77964
344 Ga0157375_10000174 3300013308 Bacteria 59683
345 Ga0157375_10078815 3300013308 Bacteria 3329
346 Ga0157375_10118381 3300013308 Unclassified 2755
347 Ga0157375_10181851 3300013308 Bacteria 2254
348 Ga0157375_10208349 3300013308 Unclassified 2112
349 Ga0157375_10305831 3300013308 Unclassified 1754
350 Ga0157375_10454684 3300013308 Bacteria 1446
351 Ga0157375_10798836 3300013308 Unclassified 1092
352 Ga0157375_11464420 3300013308 Bacteria 805
353 Ga0163163_10000088 3300014325 Bacteria 101126
354 Ga0163163_10000174 3300014325 Bacteria 67568
355 Ga0163163_10000244 3300014325 Bacteria 55634
356 Ga0163163_10145144 3300014325 Bacteria 2416
357 Ga0163163_10247930 3300014325 Bacteria 1831
358 Ga0163163_10440651 3300014325 Bacteria 1362
359 Ga0163163_10664681 3300014325 Unclassified 1105
360 Ga0163163_10699592 3300014325 Bacteria 1077
361 Ga0163163_11006258 3300014325 Unclassified 897
362 Ga0157380_10000378 3300014326 Bacteria 26833
363 Ga0157380_10006646 3300014326 Bacteria 8156
364 Ga0157380_10040272 3300014326 Bacteria 3639
365 Ga0157380_10081061 3300014326 Bacteria 2653
366 Ga0157380_10093003 3300014326 Bacteria 2493
367 Ga0157380_10187389 3300014326 Unclassified 1823
368 Ga0157380_10378584 3300014326 Bacteria 1335
369 Ga0157380_10828521 3300014326 Unclassified 945
370 Ga0182008_10000016 3300014497 Bacteria 241246
371 Ga0157377_10012000 3300014745 Bacteria 4345
372 Ga0157377_10014162 3300014745 Bacteria 4053
373 Ga0157377_10021205 3300014745 Bacteria 3416
374 Ga0157379_10000080 3300014968 Bacteria 63139
375 Ga0157379_10013554 3300014968 Bacteria 7144
376 Ga0157379_10057820 3300014968 Bacteria 3466
377 Ga0157379_10188762 3300014968 Bacteria 1863
378 Ga0157376_10000429 3300014969 Bacteria 27200
379 Ga0157376_10000521 3300014969 Bacteria 24829
380 Ga0157376_10029340 3300014969 Bacteria 4381
381 Ga0157376_10141024 3300014969 Unclassified 2162
382 Ga0157376_10190638 3300014969 Bacteria 1880
383 Ga0157376_10307915 3300014969 Bacteria 1502
384 Ga0157376_10460497 3300014969 Bacteria 1242
385 Ga0182006_1000003 3300015261 Bacteria 826681
386 Ga0163161_10000888 3300017792 Bacteria 23222
387 Ga0163161_10001507 3300017792 Bacteria 17223
388 Ga0163161_10003749 3300017792 Bacteria 10646
389 Ga0163161_10008155 3300017792 Bacteria 7243
390 Ga0163161_10009144 3300017792 Bacteria 6848
391 Ga0163161_10038599 3300017792 Bacteria 3426
392 Ga0163161_10141137 3300017792 Unclassified 1824
393 Ga0163161_10144238 3300017792 Bacteria 1805
394 Ga0163161_10177114 3300017792 Bacteria 1633
395 Ga0163161_10289236 3300017792 Bacteria 1288
396 Ga0213876_10001099 3300021384 Bacteria 17320
397 Ga0213876_10049238 3300021384 Unclassified 2226
398 Ga0209436_100993 3300025208 Bacteria 10936
399 Ga0209436_103150 3300025208 Bacteria 4524
400 Ga0209258_100032 3300025242 Bacteria 452764
401 Ga0209148_1000223 3300025254 Bacteria 93490
402 Ga0209130_1000921 3300025284 Bacteria 23640
403 Ga0209675_1000077 3300025291 Bacteria 156212
404 Ga0207426_1000023 3300025302 Bacteria 545465
405 Ga0207426_1000660 3300025302 Bacteria 42245
406 Ga0209257_1000128 3300025304 Bacteria 214268
407 Ga0207697_10049958 3300025315 Bacteria 1726
408 Ga0207655_1000013 3300025728 Bacteria 637510
409 Ga0207682_10191120 3300025893 Unclassified 938
410 Ga0207642_10025259 3300025899 Unclassified 2400
411 Ga0207642_10305716 3300025899 Bacteria 924
412 Ga0207680_10000657 3300025903 Bacteria 16337
413 Ga0207680_10308407 3300025903 Unclassified 1104
414 Ga0207647_10004968 3300025904 Bacteria 9804
415 Ga0207647_10051468 3300025904 Bacteria 2545
416 Ga0207647_10094133 3300025904 Bacteria 1785
417 Ga0207645_10002924 3300025907 Bacteria 13200
418 Ga0207645_10016615 3300025907 Bacteria 4869
419 Ga0207645_10027548 3300025907 Bacteria 3668
420 Ga0207645_10134884 3300025907 Unclassified 1607
421 Ga0207643_10006094 3300025908 Bacteria 6446
422 Ga0207705_10001116 3300025909 Bacteria 21828
423 Ga0207705_10564271 3300025909 Unclassified 885
424 Ga0207707_10069257 3300025912 Bacteria 3075
425 Ga0207695_10000102 3300025913 Bacteria 257838
426 Ga0207695_10029925 3300025913 Bacteria 6006
427 Ga0207695_10130932 3300025913 Unclassified 2466
428 Ga0207671_10000468 3300025914 Bacteria 55019
429 Ga0207671_10033270 3300025914 Bacteria 3836
430 Ga0207671_10068007 3300025914 Bacteria 2654
431 Ga0207660_10633999 3300025917 Bacteria 871
432 Ga0207662_10025036 3300025918 Bacteria 3436
433 Ga0207662_10116436 3300025918 Bacteria 1671
434 Ga0207657_10015786 3300025919 Bacteria 7300
435 Ga0207657_10124646 3300025919 Unclassified 2117
436 Ga0207657_10247420 3300025919 Bacteria 1422
437 Ga0207649_10055435 3300025920 Bacteria 2471
438 Ga0207649_10147537 3300025920 Unclassified 1616
439 Ga0207652_10491483 3300025921 Bacteria 1105
440 Ga0207681_10039258 3300025923 Bacteria 3142
441 Ga0207681_10192606 3300025923 Unclassified 1561
442 Ga0207681_10448642 3300025923 Unclassified 1049
443 Ga0207694_10279482 3300025924 Bacteria 1371
444 Ga0207694_10738189 3300025924 Bacteria 831
445 Ga0207650_10018943 3300025925 Bacteria 4836
446 Ga0207650_10125668 3300025925 Bacteria 2002
447 Ga0207650_10150508 3300025925 Bacteria 1836
448 Ga0207650_10407797 3300025925 Bacteria 1126
449 Ga0207650_10583021 3300025925 Bacteria 939
450 Ga0207659_10020002 3300025926 Bacteria 4417
451 Ga0207659_10454406 3300025926 Unclassified 1079
452 Ga0207687_10127317 3300025927 Bacteria 1914
453 Ga0207644_10107109 3300025931 Unclassified 2108
454 Ga0207644_10441847 3300025931 Bacteria 1068
455 Ga0207690_10051840 3300025932 Bacteria 2746
456 Ga0207690_10166548 3300025932 Bacteria 1647
457 Ga0207706_10008032 3300025933 Bacteria 9738
458 Ga0207706_10010943 3300025933 Bacteria 8274
459 Ga0207706_10012549 3300025933 Bacteria 7716
460 Ga0207706_10013744 3300025933 Bacteria 7347
461 Ga0207706_10070196 3300025933 Bacteria 3081
462 Ga0207706_10075734 3300025933 Unclassified 2960
463 Ga0207686_10011930 3300025934 Bacteria 4769
464 Ga0207686_10018560 3300025934 Bacteria 3941
465 Ga0207686_10405055 3300025934 Unclassified 1040
466 Ga0207709_10000021 3300025935 Bacteria 386722
467 Ga0207709_10000161 3300025935 Bacteria 91314
468 Ga0207670_10012853 3300025936 Bacteria 4914
469 Ga0207670_10072521 3300025936 Bacteria 2384
470 Ga0207670_10166974 3300025936 Bacteria 1647
471 Ga0207670_10433465 3300025936 Bacteria 1057
472 Ga0207670_10459536 3300025936 Unclassified 1028
473 Ga0207669_10065247 3300025937 Unclassified 2258
474 Ga0207704_10007511 3300025938 Bacteria 5155
475 Ga0207704_10055534 3300025938 Unclassified 2421
476 Ga0207704_10684314 3300025938 Bacteria 848
477 Ga0207704_10897420 3300025938 Bacteria 745
478 Ga0207665_10153835 3300025939 Bacteria 1649
479 Ga0207691_10000004 3300025940 Bacteria 168729
480 Ga0207691_10035545 3300025940 Bacteria 4623
481 Ga0207691_10090583 3300025940 Bacteria 2741
482 Ga0207691_10136519 3300025940 Bacteria 2163
483 Ga0207691_10419484 3300025940 Bacteria 1140
484 Ga0207711_10257699 3300025941 Unclassified 1602
485 Ga0207689_10007281 3300025942 Bacteria 9713
486 Ga0207689_10011219 3300025942 Bacteria 7689
487 Ga0207689_10016209 3300025942 Bacteria 6312
488 Ga0207689_10030376 3300025942 Bacteria 4503
489 Ga0207689_10088090 3300025942 Unclassified 2550
490 Ga0207689_10170321 3300025942 Bacteria 1795
491 Ga0207661_10001545 3300025944 Bacteria 15653
492 Ga0207661_10004190 3300025944 Bacteria 10090
493 Ga0207661_10042201 3300025944 Bacteria 3596
494 Ga0207661_10057427 3300025944 Unclassified 3129
495 Ga0207661_10134542 3300025944 Unclassified 2122
496 Ga0207679_10001022 3300025945 Bacteria 17875
497 Ga0207679_10005167 3300025945 Bacteria 8174
498 Ga0207679_10011099 3300025945 Bacteria 5817
499 Ga0207679_10021679 3300025945 Unclassified 4361
500 Ga0207679_10080698 3300025945 Bacteria 2484
501 Ga0207679_10096051 3300025945 Bacteria 2305
502 Ga0207679_10530757 3300025945 Unclassified 1054
503 Ga0207667_10027774 3300025949 Bacteria 6155
504 Ga0207667_10030844 3300025949 Bacteria 5794
505 Ga0207667_10710302 3300025949 Bacteria 1007
506 Ga0207651_10001790 3300025960 Bacteria 9986
507 Ga0207651_10099712 3300025960 Bacteria 2152
508 Ga0207651_10318984 3300025960 Bacteria 1298
509 Ga0207651_10448637 3300025960 Bacteria 1106
510 Ga0207651_10769714 3300025960 Unclassified 852
511 Ga0207712_10007623 3300025961 Bacteria 6841
512 Ga0207712_10012756 3300025961 Bacteria 5373
513 Ga0207712_10013338 3300025961 Bacteria 5267
514 Ga0207712_10140974 3300025961 Unclassified 1850
515 Ga0207712_10261826 3300025961 Unclassified 1403
516 Ga0207712_10673409 3300025961 Bacteria 901
517 Ga0207668_10001201 3300025972 Bacteria 15384
518 Ga0207668_10097826 3300025972 Bacteria 2173
519 Ga0207668_10110395 3300025972 Bacteria 2062
520 Ga0207668_10194964 3300025972 Bacteria 1609
521 Ga0207640_10065684 3300025981 Bacteria 2421
522 Ga0207640_10106514 3300025981 Bacteria 1978
523 Ga0207640_10257043 3300025981 Bacteria 1359
524 Ga0207640_10627914 3300025981 Bacteria 913
525 Ga0207658_10000059 3300025986 Bacteria 121530
526 Ga0207658_10005894 3300025986 Bacteria 8373
527 Ga0207658_10050997 3300025986 Unclassified 3048
528 Ga0207658_10313673 3300025986 Unclassified 1355
529 Ga0207677_10002598 3300026023 Bacteria 9495
530 Ga0207677_10021177 3300026023 Bacteria 3966
531 Ga0207677_10054179 3300026023 Unclassified 2735
532 Ga0207677_10131600 3300026023 Unclassified 1900
533 Ga0207677_10277844 3300026023 Bacteria 1373
534 Ga0207703_10003800 3300026035 Bacteria 12542
535 Ga0207703_10088458 3300026035 Unclassified 2600
536 Ga0207703_10158786 3300026035 Unclassified 1979
537 Ga0207703_10617325 3300026035 Unclassified 1026
538 Ga0207703_10784318 3300026035 Unclassified 909
539 Ga0207639_10009648 3300026041 Bacteria 6668
540 Ga0207639_10034590 3300026041 Bacteria 3735
541 Ga0207639_10062364 3300026041 Bacteria 2882
542 Ga0207639_10062961 3300026041 Bacteria 2870
543 Ga0207639_10299287 3300026041 Bacteria 1421
544 Ga0207678_10120280 3300026067 Bacteria 2241
545 Ga0207641_10000416 3300026088 Bacteria 49757
546 Ga0207641_10002750 3300026088 Bacteria 16046
547 Ga0207641_10096221 3300026088 Unclassified 2600
548 Ga0207641_10309349 3300026088 Unclassified 1495
549 Ga0207641_10346500 3300026088 Bacteria 1415
550 Ga0207641_10853016 3300026088 Bacteria 903
551 Ga0207641_10916999 3300026088 Unclassified 870
552 Ga0207648_10007533 3300026089 Bacteria 10684
553 Ga0207648_10025200 3300026089 Bacteria 5302
554 Ga0207648_10026318 3300026089 Bacteria 5171
555 Ga0207648_10027541 3300026089 Bacteria 5045
556 Ga0207648_10062661 3300026089 Unclassified 3241
557 Ga0207648_10112573 3300026089 Unclassified 2390
558 Ga0207648_10187170 3300026089 Bacteria 1834
559 Ga0207648_10269578 3300026089 Unclassified 1521
560 Ga0207648_10312426 3300026089 Bacteria 1411
561 Ga0207676_10002009 3300026095 Bacteria 14820
562 Ga0207676_10005115 3300026095 Bacteria 9285
563 Ga0207676_10006355 3300026095 Bacteria 8347
564 Ga0207676_10020266 3300026095 Unclassified 4863
565 Ga0207676_10077769 3300026095 Unclassified 2685
566 Ga0207676_10126836 3300026095 Bacteria 2163
567 Ga0207676_10180756 3300026095 Bacteria 1847
568 Ga0207676_10633249 3300026095 Unclassified 1030
569 Ga0207674_10002088 3300026116 Bacteria 25283
570 Ga0207674_10005225 3300026116 Bacteria 15451
571 Ga0207674_10040453 3300026116 Bacteria 4828
572 Ga0207674_10054338 3300026116 Bacteria 4077
573 Ga0207674_10146288 3300026116 Bacteria 2322
574 Ga0207674_10296804 3300026116 Bacteria 1565
575 Ga0207675_100005095 3300026118 Bacteria 12643
576 Ga0207675_100090596 3300026118 Unclassified 2875
577 Ga0207675_100094080 3300026118 Bacteria 2819
578 Ga0207675_100748370 3300026118 Bacteria 988
579 Ga0207675_101264295 3300026118 Bacteria 758
580 Ga0207683_10037634 3300026121 Unclassified 4214
581 Ga0207683_10046789 3300026121 Bacteria 3787
582 Ga0207683_10100558 3300026121 Bacteria 2581
583 Ga0207683_10863981 3300026121 Bacteria 840
584 Ga0207683_11104728 3300026121 Bacteria 736
585 Ga0207698_10010669 3300026142 Bacteria 5922
586 Ga0207698_10071522 3300026142 Unclassified 2753
587 Ga0207698_10170744 3300026142 Bacteria 1914
588 Ga0207698_10356392 3300026142 Bacteria 1384
589 Ga0207698_10501130 3300026142 Bacteria 1182
590 Ga0207698_10700201 3300026142 Bacteria 1008
591 Ga0207698_11014294 3300026142 Bacteria 841
592 Ga0207428_10112757 3300027907 Bacteria 2091
593 Ga0207428_10410913 3300027907 Bacteria 990
594 Ga0268266_10006335 3300028379 Bacteria 10848
595 Ga0268265_10094979 3300028380 Bacteria 2393
596 Ga0268264_10006876 3300028381 Bacteria 9546
597 Ga0268264_10015827 3300028381 Bacteria 6176
598 Ga0268264_10035714 3300028381 Bacteria 4092
599 Ga0268264_10247792 3300028381 Bacteria 1653
600 Ga0268264_10250648 3300028381 Unclassified 1645
601 Ga0268264_10408330 3300028381 Bacteria 1307
602 Ga0268264_10727426 3300028381 Bacteria 987
603 Ga0265318_10035597 3300028577 Bacteria 1913
604 Ga0265318_10045050 3300028577 Unclassified 1668
605 Ga0265323_10069694 3300028653 Bacteria 1205
606 Ga0307515_10000078 3300028794 Bacteria 227988
607 Ga0307515_10131954 3300028794 Bacteria 2744
608 Ga0307515_10140321 3300028794 Bacteria 2597
609 Ga0316183_1026574 3300030742 Bacteria 1102
610 Ga0265329_10023836 3300031242 Unclassified 2035
611 Ga0265331_10013215 3300031250 Unclassified 4446
612 Ga0265327_10000338 3300031251 Bacteria 88898
613 Ga0265327_10018384 3300031251 Unclassified 4336
614 Ga0265327_10043261 3300031251 Bacteria 2411
615 Ga0265327_10112822 3300031251 Bacteria 1297
616 Ga0265316_10505380 3300031344 Unclassified 863
617 Ga0307513_10352768 3300031456 Unclassified 1218
618 Ga0307509_10034214 3300031507 Bacteria 5583
619 Ga0307509_10082146 3300031507 Bacteria 3325
620 Ga0307509_10111461 3300031507 Bacteria 2739
621 Ga0307509_10305470 3300031507 Bacteria 1336
622 Ga0307408_100000170 3300031548 Bacteria 73350
623 Ga0307408_100000517 3300031548 Bacteria 33313
624 Ga0307508_10001710 3300031616 Bacteria 24355
625 Ga0265314_10018173 3300031711 Bacteria 5490
626 Ga0316576_10092644 3300031727 Bacteria 2252
627 Ga0316576_10104670 3300031727 Bacteria 2118
628 Ga0307516_10000665 3300031730 Bacteria 46476
629 Ga0307412_10000096 3300031911 Bacteria 74069
630 Ga0307412_10000389 3300031911 Bacteria 27301
631 Ga0307412_10007996 3300031911 Bacteria 6029
632 Ga0307412_10053581 3300031911 Bacteria 2674
633 Ga0307416_100000013 3300032002 Bacteria 283585
634 Ga0307414_10000004 3300032004 Bacteria 472218
635 Ga0307414_10134392 3300032004 Bacteria 1926
636 Ga0307414_10614900 3300032004 Bacteria 976
637 Ga0307411_10014850 3300032005 Bacteria 4350
638 Ga0307507_10044361 3300033179 Bacteria 4397
639 Ga0373923_0023938 3300035111 Bacteria 2407
640 Ga0373943_0203036 3300035170 Bacteria 1098
641 Ga0373955_0002985 3300035172 Bacteria 7415
642 Ga0373935_0399189 3300035692 Bacteria 987
643 Ga0373933_0033852 3300035724 Bacteria 2975
644 Ga0373933_0262603 3300035724 Bacteria 1113
645 Ga0373937_0119669 3300036401 Bacteria 2454
646 Ga0373937_0127172 3300036401 Bacteria 2378
647 Ga0373937_0214646 3300036401 Bacteria 1811
648 Ga0373925_0307908 3300037068 Bacteria 1280
649 Ga0436365_0504388 3300039437 Bacteria 1113
650 Ga0436365_0701023 3300039437 Bacteria 3129
651 Ga0436365_0888373 3300039437 Bacteria 6515
652 Ga0436365_1207402 3300039437 Bacteria 4528
653 Ga0436365_1285242 3300039437 Bacteria 1861
654 Ga0436365_1591745 3300039437 Bacteria 18185
655 Ga0439436_0005435 3300041404 Bacteria 3903
656 Ga0439439_0027259 3300041406 Bacteria 1443
657 Ga0451807_2281288 3300041486 Bacteria 1917
658 Ga0451839_0948395 3300041496 Bacteria 1243
659 Ga0451855_1570704 3300041511 Bacteria 1613
660 Ga0439445_0000575 3300042004 Bacteria 7509
661 Ga0439457_003008 3300042014 Bacteria 4684
662 Ga0439462_0004845 3300042015 Bacteria 3301
663 Ga0439434_0112614 3300042435 Unclassified 882
664 Ga0451577_0000279 3300042876 Bacteria 99236
665 Ga0451577_0014708 3300042876 Bacteria 7290
666 Ga0451577_0029042 3300042876 Bacteria 5000
667 Ga0451577_0076278 3300042876 Bacteria 2989
668 Ga0451577_0164192 3300042876 Bacteria 2001
669 Ga0451577_0207196 3300042876 Bacteria 1771
670 Ga0451577_0265742 3300042876 Bacteria 1553
671 Ga0451577_0321281 3300042876 Unclassified 1404
672 Ga0451577_0335192 3300042876 Bacteria 1372
673 Ga0451577_0515992 3300042876 Bacteria 1085
674 Ga0466969_0000152 3300044656 Bacteria 37627
675 Ga0466969_0136195 3300044656 Bacteria 1137
676 Ga0466972_0010553 3300044658 Bacteria 4636
677 Ga0453683_0000031 3300044673 Bacteria 241998
678 Ga0453683_0000190 3300044673 Bacteria 85362
679 Ga0453683_0000238 3300044673 Bacteria 73041
680 Ga0453683_0001799 3300044673 Bacteria 17704
681 Ga0453683_0014745 3300044673 Bacteria 5071
682 Ga0453683_0019154 3300044673 Unclassified 4384
683 Ga0453683_0105006 3300044673 Bacteria 1774
684 Ga0453683_0354738 3300044673 Bacteria 942
685 Ga0466966_0000567 3300044684 Bacteria 23584
686 Ga0466961_0430216 3300044693 Bacteria 799
687 Ga0466964_0058152 3300044706 Bacteria 1602
688 Ga0453684_0000161 3300044712 Bacteria 298175
689 Ga0453684_0000213 3300044712 Bacteria 253663
690 Ga0453684_0000225 3300044712 Bacteria 245902
691 Ga0453684_0000929 3300044712 Bacteria 96874
692 Ga0453684_0001226 3300044712 Bacteria 78620
693 Ga0453684_0002475 3300044712 Bacteria 44641
694 Ga0453684_0007656 3300044712 Bacteria 19769
695 Ga0453684_0011479 3300044712 Bacteria 14838
696 Ga0453684_0041744 3300044712 Bacteria 6196
697 Ga0453684_0051343 3300044712 Bacteria 5407
698 Ga0453684_0089052 3300044712 Unclassified 3819
699 Ga0453684_0091408 3300044712 Bacteria 3757
700 Ga0453684_0098471 3300044712 Bacteria 3585
701 Ga0453684_0188039 3300044712 Bacteria 2418
702 Ga0453684_0343859 3300044712 Bacteria 1684
703 Ga0453684_0558655 3300044712 Unclassified 1260
704 Ga0466971_0117009 3300044719 Bacteria 1232
705 Ga0466968_0102946 3300044735 Bacteria 1276
706 Ga0466968_0192069 3300044735 Unclassified 953
707 Ga0466970_0107980 3300044765 Bacteria 1519
708 Ga0466957_0005078 3300044842 Bacteria 7363
709 Ga0466960_0427038 3300044901 Bacteria 767
710 Ga0466959_0000016 3300045049 Bacteria 144600
711 Ga0451576_0000012 3300045051 Bacteria 674684
712 Ga0451576_0000059 3300045051 Bacteria 296795
713 Ga0451576_0000414 3300045051 Bacteria 99196
714 Ga0451576_0000729 3300045051 Bacteria 66020
715 Ga0451576_0000948 3300045051 Bacteria 54439
716 Ga0451576_0011923 3300045051 Bacteria 9829
717 Ga0451576_0017125 3300045051 Bacteria 7971
718 Ga0451576_0020992 3300045051 Bacteria 7105
719 Ga0451576_0191966 3300045051 Unclassified 2133
720 Ga0451576_0238236 3300045051 Bacteria 1900
721 Ga0451576_0811336 3300045051 Bacteria 982
722 Ga0495627_000219 3300046453 Bacteria 61845
723 Ga0495627_027208 3300046453 Bacteria 1837
724 Ga0495592_0079131 3300046454 Bacteria 2380
725 Ga0495590_0001941 3300046457 Bacteria 8740
726 Ga0495629_0028307 3300046459 Bacteria 3979
727 Ga0495638_0085224 3300046460 Bacteria 1911
728 Ga0495651_0537990 3300046462 Unclassified 744
729 Ga0495653_0045247 3300046463 Bacteria 3413
730 Ga0495605_0071591 3300046474 Bacteria 1637
731 Ga0495596_0000647 3300046500 Bacteria 21867
732 Ga0495606_0002853 3300046507 Bacteria 19146
733 Ga0495606_0010801 3300046507 Bacteria 7524
734 Ga0495610_0000006 3300046512 Bacteria 856822
735 Ga0495618_0033387 3300046514 Bacteria 3227
736 Ga0495628_0008008 3300046516 Bacteria 9106
737 Ga0495630_0007375 3300046517 Bacteria 7856
738 Ga0495632_0000601 3300046519 Bacteria 33346
739 Ga0495643_0035860 3300046522 Bacteria 2729
740 Ga0495643_0078851 3300046522 Bacteria 1718
741 Ga0495648_0005568 3300046524 Bacteria 10448
742 Ga0495663_0000105 3300046525 Bacteria 34550
743 Ga0495663_0005212 3300046525 Bacteria 3619
744 Ga0495652_0120404 3300046529 Unclassified 2095
745 Ga0495654_0000006 3300046530 Bacteria 451432
746 Ga0495665_0082512 3300046531 Bacteria 1690
747 Ga0495640_0150605 3300046533 Bacteria 1495
748 Ga0495640_0164852 3300046533 Bacteria 1418
749 Ga0495587_0006727 3300046536 Bacteria 7486
750 Ga0495587_0114052 3300046536 Bacteria 1551
751 Ga0495598_0009457 3300046537 Unclassified 2305
752 Ga0495609_0000017 3300046538 Bacteria 306684
753 Ga0495621_0021996 3300046539 Bacteria 2109
754 Ga0495621_0033075 3300046539 Bacteria 1781
755 Ga0495621_0111701 3300046539 Bacteria 1049
756 Ga0495633_0000037 3300046558 Bacteria 184006
757 Ga0495633_0002549 3300046558 Bacteria 12789
758 Ga0495668_0008836 3300046616 Bacteria 6243
759 Ga0495634_0027915 3300046642 Bacteria 3923
760 Ga0495611_0057401 3300046648 Bacteria 1764
761 Ga0495625_0001048 3300046660 Bacteria 36295
762 Ga0495625_0232174 3300046660 Bacteria 1204
763 Ga0495661_0003215 3300046665 Bacteria 12199
764 Ga0495599_0158960 3300046678 Bacteria 1397
765 Ga0495658_0209545 3300046683 Bacteria 1217
766 Ga0495613_0106828 3300046689 Bacteria 2020
767 Ga0495600_0023886 3300046809 Bacteria 3934
768 Ga0495604_0104009 3300047317 Bacteria 2082
769 Ga0495674_0042827 3300047319 Bacteria 4035
770 Ga0495674_0184469 3300047319 Unclassified 1736
771 Ga0495675_0400516 3300047444 Bacteria 800
772 Ga0495684_0062929 3300047471 Bacteria 2822
773 Ga0495686_0000414 3300047472 Bacteria 67712
774 Ga0495686_0006673 3300047472 Bacteria 8787
775 Ga0496100_0085564 3300048903 Unclassified 2140
776 Ga0496102_0007137 3300048905 Bacteria 9541
777 Ga0496106_0193839 3300048909 Bacteria 1616
778 Ga0496107_0279946 3300048910 Unclassified 1242
779 Ga0496107_0765422 3300048910 Bacteria 708
780 Ga0496109_0017189 3300048912 Bacteria 6335
781 Ga0496114_0115964 3300048917 Unclassified 2299
782 Ga0496115_0074175 3300048918 Bacteria 2763
783 Ga0496116_0000006 3300048919 Bacteria 811937
784 Ga0496116_0046869 3300048919 Bacteria 2914
785 Ga0496117_0000027 3300048920 Bacteria 412234
786 Ga0496117_0002735 3300048920 Bacteria 21646
787 Ga0496118_0000141 3300048921 Bacteria 126552
788 Ga0496118_0139503 3300048921 Bacteria 1540
789 Ga0496118_0305931 3300048921 Bacteria 870
790 Ga0496119_0000006 3300048922 Bacteria 505999
791 Ga0496120_0069333 3300048923 Bacteria 1942
792 Ga0496122_0000229 3300048925 Bacteria 125600
793 Ga0496122_0000397 3300048925 Bacteria 92511
794 Ga0496122_0002499 3300048925 Bacteria 25974
795 Ga0496122_0004955 3300048925 Bacteria 16134
796 Ga0496123_0003892 3300048926 Bacteria 16242
797 Ga0496123_0006136 3300048926 Bacteria 11783
798 Ga0496123_0006638 3300048926 Bacteria 11163
799 Ga0496124_0113677 3300048927 Bacteria 2175
800 Ga0496124_0131644 3300048927 Bacteria 1986
801 Ga0496125_0001071 3300048928 Bacteria 42210
802 Ga0496125_0003176 3300048928 Bacteria 20363
803 Ga0496125_0110625 3300048928 Bacteria 1991
804 Ga0496126_0001395 3300048929 Bacteria 38244
805 Ga0496126_0474476 3300048929 Bacteria 1003
806 Ga0501293_002230 3300049516 Bacteria 1472
807 Ga0501296_023011 3300049519 Bacteria 805
808 Ga0501297_003781 3300049520 Bacteria 1525
809 Ga0501032_0088594 3300049569 Unclassified 2055
810 Ga0501033_0124084 3300049570 Bacteria 1873
811 Ga0501033_0508324 3300049570 Bacteria 833
812 Ga0501034_0000002 3300049571 Bacteria 565510
813 Ga0501034_0004933 3300049571 Bacteria 14687
814 Ga0501034_0120580 3300049571 Unclassified 2609
815 Ga0501036_0120599 3300049572 Bacteria 2215
816 Ga0501043_0473433 3300049579 Unclassified 939
817 Ga0501046_0103890 3300049580 Unclassified 2178
818 Ga0501047_0195837 3300049581 Bacteria 1883
819 Ga0501047_0359744 3300049581 Bacteria 1291
820 Ga0501047_0380161 3300049581 Bacteria 1247
821 Ga0501048_0194390 3300049582 Bacteria 1438
822 Ga0501068_0005707 3300049584 Bacteria 6821
823 Ga0501070_0412788 3300049586 Bacteria 1091
824 Ga0501073_0094009 3300049589 Unclassified 2082
825 Ga0501073_0096255 3300049589 Bacteria 2056
826 Ga0501074_0135693 3300049590 Unclassified 1760
827 Ga0501198_003624 3300049649 Bacteria 2117
828 Ga0501201_001434 3300049651 Bacteria 2228
829 Ga0501202_000359 3300049652 Bacteria 6357
830 Ga0501216_002848 3300049660 Bacteria 2484
831 Ga0501216_003468 3300049660 Bacteria 2296
832 Ga0501217_000190 3300049661 Bacteria 9148
833 Ga0501217_006657 3300049661 Bacteria 2462
834 Ga0501222_000546 3300049662 Bacteria 5580
835 Ga0501223_001006 3300049663 Bacteria 6666
836 Ga0501223_007708 3300049663 Bacteria 2199
837 Ga0501224_001719 3300049664 Bacteria 2935
838 Ga0501228_002191 3300049666 Bacteria 1508
839 Ga0501235_004964 3300049669 Bacteria 2886
840 Ga0501240_000690 3300049673 Bacteria 2928
841 Ga0501243_002611 3300049675 Bacteria 2648
842 Ga0501251_003437 3300049681 Bacteria 1583
843 Ga0501253_004133 3300049683 Bacteria 1808
844 Ga0501259_000656 3300049688 Bacteria 5559
845 Ga0501221_000013 3300049704 Bacteria 22152
846 Ga0501225_0003389 3300049705 Bacteria 4841
847 Ga0501234_000394 3300049707 Bacteria 6465
848 Ga0501245_000600 3300049708 Bacteria 4425
849 Ga0501245_010467 3300049708 Unclassified 1340
850 Ga0501079_0225516 3300049741 Unclassified 1464
851 Ga0501080_0628152 3300049742 Bacteria 952
852 Ga0501083_0089499 3300049744 Unclassified 2034
853 Ga0501083_0105612 3300049744 Unclassified 1854
854 Ga0501241_000003 3300049758 Bacteria 178857
855 Ga0501241_020851 3300049758 Bacteria 1207
856 Ga0501267_000649 3300049764 Bacteria 2760
857 Ga0501035_0074759 3300049822 Bacteria 2997
858 Ga0501035_0150406 3300049822 Bacteria 2021
859 Ga0501035_0161255 3300049822 Bacteria 1941
860 Ga0501035_0496559 3300049822 Bacteria 1005
861 Ga0501044_0087396 3300049823 Unclassified 3149
862 Ga0501044_0093319 3300049823 Bacteria 3035
863 Ga0501044_0109831 3300049823 Unclassified 2767
864 Ga0501044_0124127 3300049823 Bacteria 2580
865 Ga0501044_0333409 3300049823 Bacteria 1439
866 Ga0501212_000331 3300049851 Bacteria 4411
867 nmdc:mga08y16_518020_c1 3300050511 Bacteria 1210
868 nmdc:mga0n895_476600_c1 3300050512 Bacteria 1259
869 Ga0500644_0089806 3300053088 Bacteria 1147
870 Ga0500583_0000009 3300053092 Bacteria 160749
871 Ga0500583_0015550 3300053092 Unclassified 3013
872 Ga0500583_0019316 3300053092 Bacteria 2791
873 Ga0500651_0104709 3300053093 Bacteria 1732
874 Ga0500651_0305007 3300053093 Bacteria 913
875 Ga0500562_000035 3300053108 Bacteria 81116
876 Ga0500569_000056 3300053109 Bacteria 19932
877 Ga0500594_0113772 3300053118 Bacteria 844
878 Ga0500642_0005680 3300053130 Bacteria 4048
879 Ga0500559_0029770 3300053136 Bacteria 2340
880 Ga0500559_0125128 3300053136 Bacteria 1198
881 Ga0500577_0001778 3300053142 Bacteria 5510
882 Ga0500588_0001992 3300053146 Bacteria 4045
883 Ga0500616_0006723 3300053153 Bacteria 7463
884 Ga0500616_0084767 3300053153 Bacteria 1584
885 Ga0500616_0136258 3300053153 Unclassified 1153
886 Ga0500622_0001619 3300053156 Bacteria 17667
887 Ga0500622_0002834 3300053156 Bacteria 12162
888 Ga0500622_0037129 3300053156 Bacteria 2546
889 Ga0500622_0101421 3300053156 Bacteria 1417
890 Ga0500622_0128548 3300053156 Bacteria 1220
891 Ga0500637_0171897 3300053178 Bacteria 1245
892 Ga0500645_065109 3300053730 Bacteria 1050
893 Ga0501084_0366934 3300054114 Unclassified 1216
894 Ga0501082_0154692 3300060353 Unclassified 1992
895 Ga0466962_0092153 3300061719 Bacteria 1452

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10091456 Ga0157370_100914564 180
2 3300046512 Ga0495610_0000006 Ga0495610_0000006_446686_447234 180
3 3300046660 Ga0495625_0001048 Ga0495625_0001048_28188_28736 180
4 3300048905 Ga0496102_0007137 Ga0496102_0007137_1051_1599 180
5 3300048920 Ga0496117_0000027 Ga0496117_0000027_355361_355909 180
6 3300048921 Ga0496118_0000141 Ga0496118_0000141_8470_9018 180
7 3300048922 Ga0496119_0000006 Ga0496119_0000006_234185_234733 180
8 3300048923 Ga0496120_0069333 Ga0496120_0069333_648_1196 180
9 3300048925 Ga0496122_0004955 Ga0496122_0004955_15468_16016 180
10 3300048926 Ga0496123_0006136 Ga0496123_0006136_8099_8647 180
11 3300048927 Ga0496124_0131644 Ga0496124_0131644_687_1235 180
12 3300048928 Ga0496125_0003176 Ga0496125_0003176_18204_18752 180
13 3300048929 Ga0496126_0474476 Ga0496126_0474476_121_669 180
14 3300049758 Ga0501241_000003 Ga0501241_000003_129447_129995 180
15 3300009036 Ga0105244_10000001 Ga0105244_10000001464 186
16 3300048921 Ga0496118_0139503 Ga0496118_0139503_67_633 186
17 3300046453 Ga0495627_027208 Ga0495627_027208_787_1440 198
18 3300046460 Ga0495638_0085224 Ga0495638_0085224_152_805 198
19 3300046522 Ga0495643_0078851 Ga0495643_0078851_201_854 198
20 3300047472 Ga0495686_0006673 Ga0495686_0006673_182_835 198
21 3300013104 Ga0157370_10103586 Ga0157370_101035863 205
22 3300014497 Ga0182008_10000016 Ga0182008_10000016120 205
23 iso_pu_bacteria 2914759650 2914762308 207
24 iso_pu_bacteria 2511231000 2511234378 210
25 iso_pu_bacteria 2523533629 2524006845 210
26 iso_pu_bacteria 2582581278 2585145018 210
27 iso_pu_bacteria 2582581281 2585158417 210
28 iso_pu_bacteria 2582581282 2585162628 210
29 iso_pu_bacteria 2582581873 2585425798 210
30 iso_pu_bacteria 2585428045 2587678573 210
31 iso_pu_bacteria 2585428061 2587753357 210
32 iso_pu_bacteria 2585428095 2587867109 210
33 iso_pu_bacteria 2585428182 2588210366 210
34 iso_pu_bacteria 2585428183 2588214390 210
35 iso_pu_bacteria 2585428184 2588217644 210
36 iso_pu_bacteria 2585428185 2588223164 210
37 iso_pu_bacteria 2588254255 2590601623 210
38 iso_pu_bacteria 2721755487 2722726297 210
39 iso_pu_bacteria 2738541273 2738699866 210
40 iso_pu_bacteria 2738543014 2739253615 210
41 iso_pu_bacteria 2739367874 2740059140 210
42 iso_pu_bacteria 2751185877 2753673197 210
43 iso_pu_bacteria 2765235839 2765574278 210
44 iso_pu_bacteria 2772190705 2772603772 210
45 iso_pu_bacteria 2816332188 2816874488 210
46 iso_pu_bacteria 2871720351 2871724173 210
47 iso_pu_bacteria 2887375801 2887379730 210
48 iso_pu_bacteria 2889290771 2889295192 210
49 iso_pu_bacteria 2890737413 2890737460 210
50 iso_pu_bacteria 2896317667 2896321044 210
51 iso_pu_bacteria 2896344016 2896344347 210
52 iso_pu_bacteria 2898713307 2898716496 210
53 iso_pu_bacteria 2902048731 2902050766 210
54 iso_pu_bacteria 2904780799 2904783818 210
55 iso_pu_bacteria 2905999023 2906000115 210
56 iso_pu_bacteria 2919177583 2919181934 210
57 iso_pu_bacteria 2919399522 2919403817 210
58 iso_pu_bacteria 3003233435 3003236934 210
59 iso_pu_bacteria 2585428060 2587746264 211
60 iso_pu_bacteria 2585428115 2587941675 211
61 iso_pu_bacteria 2585428187 2588232857 211
62 iso_pu_bacteria 2588253712 2588443973 211
63 iso_pu_bacteria 2588254257 2590613671 211
64 iso_pu_bacteria 2728369107 2729200151 211
65 iso_pu_bacteria 2775506739 2775671893 211
66 iso_pu_bacteria 2818991444 2819589834 211
67 iso_pu_bacteria 2818991460 2819676439 211
68 iso_pu_bacteria 2821136567 2821140594 211
69 iso_pu_bacteria 2842083920 2842088437 211
70 iso_pu_bacteria 2884791551 2884796270 211
71 iso_pu_bacteria 2890804823 2890805076 211
72 iso_pu_bacteria 2904467357 2904473013 211
73 iso_pu_bacteria 2919097161 2919098668 211
74 iso_pu_bacteria 2929154850 2929160084 211
75 iso_pu_bacteria 2929177148 2929178212 211
76 iso_pu_bacteria 2929239360 2929240523 211
77 iso_pu_bacteria 2929921140 2929922360 211
78 iso_pu_bacteria 2945924605 2945925958 211
79 iso_pu_bacteria 2945977869 2945980574 211
80 iso_pu_bacteria 2946013367 2946013563 211
81 iso_pu_bacteria 2946019816 2946022761 211
82 iso_pu_bacteria 2977243572 2977244884 211
83 iso_pu_bacteria 2993372514 2993374699 211
84 iso_pu_bacteria 2993480792 2993481582 211
85 iso_pu_bacteria 8003151029 8003156778 211
86 3300015261 Ga0182006_1000003 Ga0182006_1000003403 213
87 3300030742 Ga0316183_1026574 Ga0316183_10265741 213
88 3300031911 Ga0307412_10053581 Ga0307412_100535812 213
89 3300032002 Ga0307416_100000013 Ga0307416_100000013269 213
90 3300032004 Ga0307414_10614900 Ga0307414_106149001 213
91 2162886007 SwRhRL2b_contig_2652683 SwRhRL2b_0766.00003750 214
92 3300001915 JGI24741J21665_1002924 JGI24741J21665_10029245 214
93 3300003316 rootH1_10131517 rootH1_101315172 214
94 3300003323 rootH1_10147471 rootH1_101474712 214
95 3300003323 rootH1_10202610 rootH1_102026101 214
96 3300003578 Ga0006562J51391_1011765 Ga0006562J51391_10117651 214
97 3300003784 Ga0055534_1014943 Ga0055534_10149432 214
98 3300004801 Ga0058860_11744412 Ga0058860_117444121 214
99 3300005288 Ga0065714_10065177 Ga0065714_100651775 214
100 3300005288 Ga0065714_10118035 Ga0065714_101180351 214
101 3300005289 Ga0065704_10071156 Ga0065704_100711569 214
102 3300005289 Ga0065704_10077203 Ga0065704_100772035 214
103 3300005289 Ga0065704_10086148 Ga0065704_100861482 214
104 3300005289 Ga0065704_10283138 Ga0065704_102831382 214
105 3300005290 Ga0065712_10002959 Ga0065712_1000295911 214
106 3300005290 Ga0065712_10027299 Ga0065712_100272991 214
107 3300005290 Ga0065712_10073468 Ga0065712_100734684 214
108 3300005290 Ga0065712_10167465 Ga0065712_101674651 214
109 3300005293 Ga0065715_10001700 Ga0065715_1000170019 214
110 3300005293 Ga0065715_10132314 Ga0065715_101323143 214
111 3300005295 Ga0065707_10005547 Ga0065707_100055475 214
112 3300005295 Ga0065707_10092699 Ga0065707_100926993 214
113 3300005328 Ga0070676_10000034 Ga0070676_1000003428 214
114 3300005328 Ga0070676_10012393 Ga0070676_100123935 214
115 3300005328 Ga0070676_10130395 Ga0070676_101303951 214
116 3300005328 Ga0070676_10498460 Ga0070676_104984601 214
117 3300005329 Ga0070683_100000659 Ga0070683_1000006594 214
118 3300005329 Ga0070683_100014987 Ga0070683_1000149876 214
119 3300005329 Ga0070683_100167534 Ga0070683_1001675342 214
120 3300005330 Ga0070690_100050853 Ga0070690_1000508532 214
121 3300005330 Ga0070690_100122306 Ga0070690_1001223062 214
122 3300005330 Ga0070690_100213108 Ga0070690_1002131082 214
123 3300005330 Ga0070690_100363542 Ga0070690_1003635421 214
124 3300005331 Ga0070670_100032746 Ga0070670_1000327465 214
125 3300005331 Ga0070670_100039493 Ga0070670_1000394933 214
126 3300005331 Ga0070670_100124310 Ga0070670_1001243102 214
127 3300005331 Ga0070670_100192437 Ga0070670_1001924372 214
128 3300005331 Ga0070670_100499735 Ga0070670_1004997352 214
129 3300005334 Ga0068869_100019822 Ga0068869_1000198222 214
130 3300005334 Ga0068869_100047968 Ga0068869_1000479682 214
131 3300005334 Ga0068869_100065506 Ga0068869_1000655062 214
132 3300005335 Ga0070666_10000431 Ga0070666_100004314 214
133 3300005335 Ga0070666_10051457 Ga0070666_100514572 214
134 3300005337 Ga0070682_100000474 Ga0070682_1000004748 214
135 3300005337 Ga0070682_100189797 Ga0070682_1001897972 214
136 3300005338 Ga0068868_100001305 Ga0068868_10000130518 214
137 3300005338 Ga0068868_100014762 Ga0068868_1000147622 214
138 3300005338 Ga0068868_100057484 Ga0068868_1000574842 214
139 3300005338 Ga0068868_100209799 Ga0068868_1002097992 214
140 3300005339 Ga0070660_100340634 Ga0070660_1003406342 214
141 3300005340 Ga0070689_100077183 Ga0070689_1000771832 214
142 3300005340 Ga0070689_100120093 Ga0070689_1001200932 214
143 3300005340 Ga0070689_100179787 Ga0070689_1001797872 214
144 3300005344 Ga0070661_100009156 Ga0070661_1000091563 214
145 3300005344 Ga0070661_100101022 Ga0070661_1001010223 214
146 3300005347 Ga0070668_100000087 Ga0070668_10000008714 214
147 3300005347 Ga0070668_100136073 Ga0070668_1001360732 214
148 3300005353 Ga0070669_100029165 Ga0070669_1000291653 214
149 3300005353 Ga0070669_100279480 Ga0070669_1002794801 214
150 3300005353 Ga0070669_100284695 Ga0070669_1002846952 214
151 3300005353 Ga0070669_100298236 Ga0070669_1002982362 214
152 3300005354 Ga0070675_100016216 Ga0070675_1000162165 214
153 3300005354 Ga0070675_100118146 Ga0070675_1001181462 214
154 3300005354 Ga0070675_100141582 Ga0070675_1001415822 214
155 3300005354 Ga0070675_100157019 Ga0070675_1001570192 214
156 3300005354 Ga0070675_100164717 Ga0070675_1001647172 214
157 3300005354 Ga0070675_100247803 Ga0070675_1002478032 214
158 3300005355 Ga0070671_100021476 Ga0070671_1000214766 214
159 3300005355 Ga0070671_100063802 Ga0070671_1000638023 214
160 3300005355 Ga0070671_100110437 Ga0070671_1001104372 214
161 3300005356 Ga0070674_100040831 Ga0070674_1000408314 214
162 3300005356 Ga0070674_100045340 Ga0070674_1000453402 214
163 3300005356 Ga0070674_100144957 Ga0070674_1001449572 214
164 3300005364 Ga0070673_100000074 Ga0070673_10000007420 214
165 3300005364 Ga0070673_100006567 Ga0070673_1000065676 214
166 3300005364 Ga0070673_100016521 Ga0070673_1000165213 214
167 3300005364 Ga0070673_100020236 Ga0070673_1000202369 214
168 3300005364 Ga0070673_100028926 Ga0070673_1000289262 214
169 3300005364 Ga0070673_100131684 Ga0070673_1001316842 214
170 3300005364 Ga0070673_100203480 Ga0070673_1002034802 214
171 3300005364 Ga0070673_100413458 Ga0070673_1004134581 214
172 3300005365 Ga0070688_100009006 Ga0070688_1000090062 214
173 3300005365 Ga0070688_100032610 Ga0070688_1000326102 214
174 3300005365 Ga0070688_100084330 Ga0070688_1000843302 214
175 3300005365 Ga0070688_100112042 Ga0070688_1001120421 214
176 3300005366 Ga0070659_100022811 Ga0070659_1000228116 214
177 3300005366 Ga0070659_100048868 Ga0070659_1000488683 214
178 3300005367 Ga0070667_100000031 Ga0070667_10000003161 214
179 3300005367 Ga0070667_100016900 Ga0070667_1000169004 214
180 3300005367 Ga0070667_100057008 Ga0070667_1000570083 214
181 3300005367 Ga0070667_100368257 Ga0070667_1003682572 214
182 3300005455 Ga0070663_100652464 Ga0070663_1006524641 214
183 3300005456 Ga0070678_100082152 Ga0070678_1000821522 214
184 3300005456 Ga0070678_100194169 Ga0070678_1001941692 214
185 3300005456 Ga0070678_100413227 Ga0070678_1004132271 214
186 3300005456 Ga0070678_100776741 Ga0070678_1007767411 214
187 3300005457 Ga0070662_100003774 Ga0070662_1000037747 214
188 3300005457 Ga0070662_100010942 Ga0070662_1000109426 214
189 3300005457 Ga0070662_100012743 Ga0070662_1000127435 214
190 3300005457 Ga0070662_100067746 Ga0070662_1000677462 214
191 3300005457 Ga0070662_100139660 Ga0070662_1001396601 214
192 3300005459 Ga0068867_100010592 Ga0068867_1000105926 214
193 3300005459 Ga0068867_100048371 Ga0068867_1000483711 214
194 3300005459 Ga0068867_100372018 Ga0068867_1003720182 214
195 3300005459 Ga0068867_100664731 Ga0068867_1006647311 214
196 3300005466 Ga0070685_10017106 Ga0070685_100171062 214
197 3300005466 Ga0070685_10035260 Ga0070685_100352603 214
198 3300005466 Ga0070685_10262359 Ga0070685_102623592 214
199 3300005471 Ga0070698_100005145 Ga0070698_1000051454 214
200 3300005471 Ga0070698_100245197 Ga0070698_1002451971 214
201 3300005535 Ga0070684_100001403 Ga0070684_10000140314 214
202 3300005535 Ga0070684_100003737 Ga0070684_10000373712 214
203 3300005535 Ga0070684_100192781 Ga0070684_1001927812 214
204 3300005539 Ga0068853_100004545 Ga0068853_10000454513 214
205 3300005539 Ga0068853_100013622 Ga0068853_1000136227 214
206 3300005539 Ga0068853_100016660 Ga0068853_1000166604 214
207 3300005539 Ga0068853_100453109 Ga0068853_1004531092 214
208 3300005543 Ga0070672_100000002 Ga0070672_10000000243 214
209 3300005543 Ga0070672_100196987 Ga0070672_1001969872 214
210 3300005543 Ga0070672_100213041 Ga0070672_1002130411 214
211 3300005543 Ga0070672_100334937 Ga0070672_1003349372 214
212 3300005543 Ga0070672_100426982 Ga0070672_1004269822 214
213 3300005543 Ga0070672_100847629 Ga0070672_1008476291 214
214 3300005544 Ga0070686_100111833 Ga0070686_1001118332 214
215 3300005548 Ga0070665_100000222 Ga0070665_10000022273 214
216 3300005548 Ga0070665_100004685 Ga0070665_1000046852 214
217 3300005563 Ga0068855_100026121 Ga0068855_1000261212 214
218 3300005564 Ga0070664_100000140 Ga0070664_1000001405 214
219 3300005564 Ga0070664_100004377 Ga0070664_10000437712 214
220 3300005564 Ga0070664_100046706 Ga0070664_1000467061 214
221 3300005564 Ga0070664_100124460 Ga0070664_1001244602 214
222 3300005564 Ga0070664_100141526 Ga0070664_1001415262 214
223 3300005577 Ga0068857_100017088 Ga0068857_1000170882 214
224 3300005577 Ga0068857_100021957 Ga0068857_1000219574 214
225 3300005577 Ga0068857_100053671 Ga0068857_1000536713 214
226 3300005577 Ga0068857_100313255 Ga0068857_1003132552 214
227 3300005577 Ga0068857_100382233 Ga0068857_1003822332 214
228 3300005578 Ga0068854_100196964 Ga0068854_1001969642 214
229 3300005614 Ga0068856_100385193 Ga0068856_1003851933 214
230 3300005616 Ga0068852_100094789 Ga0068852_1000947893 214
231 3300005616 Ga0068852_100143997 Ga0068852_1001439972 214
232 3300005616 Ga0068852_100367051 Ga0068852_1003670512 214
233 3300005616 Ga0068852_100744796 Ga0068852_1007447961 214
234 3300005617 Ga0068859_100021050 Ga0068859_1000210507 214
235 3300005617 Ga0068859_100032817 Ga0068859_1000328174 214
236 3300005617 Ga0068859_100047523 Ga0068859_1000475232 214
237 3300005617 Ga0068859_100277182 Ga0068859_1002771822 214
238 3300005617 Ga0068859_100497615 Ga0068859_1004976151 214
239 3300005618 Ga0068864_100007000 Ga0068864_1000070008 214
240 3300005618 Ga0068864_100013799 Ga0068864_1000137996 214
241 3300005618 Ga0068864_100017006 Ga0068864_1000170063 214
242 3300005618 Ga0068864_100030338 Ga0068864_1000303383 214
243 3300005618 Ga0068864_100112585 Ga0068864_1001125853 214
244 3300005618 Ga0068864_100150762 Ga0068864_1001507622 214
245 3300005618 Ga0068864_100162138 Ga0068864_1001621382 214
246 3300005718 Ga0068866_10144134 Ga0068866_101441342 214
247 3300005719 Ga0068861_100008249 Ga0068861_1000082495 214
248 3300005719 Ga0068861_101086946 Ga0068861_1010869461 214
249 3300005834 Ga0068851_10034023 Ga0068851_100340233 214
250 3300005834 Ga0068851_10156310 Ga0068851_101563101 214
251 3300005840 Ga0068870_10010587 Ga0068870_100105875 214
252 3300005840 Ga0068870_10026063 Ga0068870_100260633 214
253 3300005841 Ga0068863_100004520 Ga0068863_1000045208 214
254 3300005841 Ga0068863_100029214 Ga0068863_1000292141 214
255 3300005841 Ga0068863_100081959 Ga0068863_1000819593 214
256 3300005841 Ga0068863_100140676 Ga0068863_1001406763 214
257 3300005841 Ga0068863_100315848 Ga0068863_1003158482 214
258 3300005841 Ga0068863_100405879 Ga0068863_1004058791 214
259 3300005842 Ga0068858_100001512 Ga0068858_1000015128 214
260 3300005842 Ga0068858_100017339 Ga0068858_1000173396 214
261 3300005842 Ga0068858_100062769 Ga0068858_1000627692 214
262 3300005842 Ga0068858_100556786 Ga0068858_1005567861 214
263 3300005843 Ga0068860_100009821 Ga0068860_1000098217 214
264 3300005843 Ga0068860_100060843 Ga0068860_1000608434 214
265 3300005843 Ga0068860_100166484 Ga0068860_1001664842 214
266 3300005843 Ga0068860_100258732 Ga0068860_1002587322 214
267 3300005843 Ga0068860_100327688 Ga0068860_1003276882 214
268 3300005844 Ga0068862_101171056 Ga0068862_1011710561 214
269 3300006163 Ga0070715_10068794 Ga0070715_100687942 214
270 3300006173 Ga0070716_100134074 Ga0070716_1001340742 214
271 3300006237 Ga0097621_100000118 Ga0097621_10000011833 214
272 3300006237 Ga0097621_100008450 Ga0097621_1000084508 214
273 3300006237 Ga0097621_100013072 Ga0097621_1000130727 214
274 3300006237 Ga0097621_100062601 Ga0097621_1000626012 214
275 3300006237 Ga0097621_100067320 Ga0097621_1000673203 214
276 3300006358 Ga0068871_100002078 Ga0068871_10000207812 214
277 3300006358 Ga0068871_100004602 Ga0068871_1000046029 214
278 3300006358 Ga0068871_100008550 Ga0068871_1000085507 214
279 3300006358 Ga0068871_100042168 Ga0068871_1000421684 214
280 3300006358 Ga0068871_100111340 Ga0068871_1001113403 214
281 3300006358 Ga0068871_100558475 Ga0068871_1005584752 214
282 3300006871 Ga0075434_100334330 Ga0075434_1003343302 214
283 3300006881 Ga0068865_100004341 Ga0068865_1000043414 214
284 3300006881 Ga0068865_100208063 Ga0068865_1002080632 214
285 3300006881 Ga0068865_100506559 Ga0068865_1005065592 214
286 3300006931 Ga0097620_100021048 Ga0097620_1000210482 214
287 3300006931 Ga0097620_100032818 Ga0097620_1000328182 214
288 3300006931 Ga0097620_100047525 Ga0097620_1000475252 214
289 3300006931 Ga0097620_100277184 Ga0097620_1002771842 214
290 3300006931 Ga0097620_100497611 Ga0097620_1004976111 214
291 3300007076 Ga0075435_100596107 Ga0075435_1005961072 214
292 3300009011 Ga0105251_10221810 Ga0105251_102218102 214
293 3300009093 Ga0105240_10091298 Ga0105240_100912984 214
294 3300009093 Ga0105240_10141802 Ga0105240_101418022 214
295 3300009093 Ga0105240_10172116 Ga0105240_101721161 214
296 3300009093 Ga0105240_10327262 Ga0105240_103272622 214
297 3300009093 Ga0105240_10492096 Ga0105240_104920962 214
298 3300009094 Ga0111539_10011540 Ga0111539_100115406 214
299 3300009094 Ga0111539_11289095 Ga0111539_112890951 214
300 3300009098 Ga0105245_10105819 Ga0105245_101058191 214
301 3300009101 Ga0105247_10103967 Ga0105247_101039672 214
302 3300009148 Ga0105243_10000043 Ga0105243_1000004315 214
303 3300009148 Ga0105243_10000471 Ga0105243_1000047138 214
304 3300009148 Ga0105243_10254725 Ga0105243_102547252 214
305 3300009148 Ga0105243_10360534 Ga0105243_103605342 214
306 3300009174 Ga0105241_10097710 Ga0105241_100977102 214
307 3300009174 Ga0105241_10591351 Ga0105241_105913511 214
308 3300009176 Ga0105242_10002571 Ga0105242_100025715 214
309 3300009176 Ga0105242_10033243 Ga0105242_100332435 214
310 3300009176 Ga0105242_10786708 Ga0105242_107867081 214
311 3300009177 Ga0105248_10007403 Ga0105248_100074036 214
312 3300009177 Ga0105248_10046955 Ga0105248_100469554 214
313 3300009177 Ga0105248_10112484 Ga0105248_101124842 214
314 3300009177 Ga0105248_10705530 Ga0105248_107055301 214
315 3300009177 Ga0105248_10789651 Ga0105248_107896511 214
316 3300009545 Ga0105237_10008005 Ga0105237_100080058 214
317 3300009545 Ga0105237_10064235 Ga0105237_100642354 214
318 3300009551 Ga0105238_10040835 Ga0105238_100408352 214
319 3300009551 Ga0105238_10087548 Ga0105238_100875482 214
320 3300009553 Ga0105249_10004261 Ga0105249_1000426110 214
321 3300009553 Ga0105249_10012725 Ga0105249_100127252 214
322 3300009553 Ga0105249_10016984 Ga0105249_100169846 214
323 3300009553 Ga0105249_10018030 Ga0105249_100180304 214
324 3300009553 Ga0105249_10981098 Ga0105249_109810982 214
325 3300010375 Ga0105239_10007361 Ga0105239_100073617 214
326 3300010375 Ga0105239_10027880 Ga0105239_100278804 214
327 3300010375 Ga0105239_10093905 Ga0105239_100939052 214
328 3300010375 Ga0105239_10226412 Ga0105239_102264121 214
329 3300011119 Ga0105246_10054873 Ga0105246_100548732 214
330 3300011119 Ga0105246_10318941 Ga0105246_103189412 214
331 3300013100 Ga0157373_10045686 Ga0157373_100456862 214
332 3300013100 Ga0157373_10144437 Ga0157373_101444371 214
333 3300013102 Ga0157371_10001559 Ga0157371_100015597 214
334 3300013102 Ga0157371_10072212 Ga0157371_100722122 214
335 3300013102 Ga0157371_10223246 Ga0157371_102232462 214
336 3300013104 Ga0157370_10002236 Ga0157370_100022362 214
337 3300013104 Ga0157370_10002888 Ga0157370_1000288813 214
338 3300013104 Ga0157370_10124926 Ga0157370_101249262 214
339 3300013105 Ga0157369_10003002 Ga0157369_1000300224 214
340 3300013105 Ga0157369_10116156 Ga0157369_101161562 214
341 3300013105 Ga0157369_10202772 Ga0157369_102027721 214
342 3300013296 Ga0157374_10000015 Ga0157374_1000001514 214
343 3300013296 Ga0157374_10000074 Ga0157374_1000007491 214
344 3300013296 Ga0157374_10012937 Ga0157374_100129372 214
345 3300013296 Ga0157374_10029637 Ga0157374_100296375 214
346 3300013296 Ga0157374_10142976 Ga0157374_101429762 214
347 3300013296 Ga0157374_10163280 Ga0157374_101632802 214
348 3300013296 Ga0157374_10548155 Ga0157374_105481552 214
349 3300013297 Ga0157378_10005674 Ga0157378_100056747 214
350 3300013297 Ga0157378_10009176 Ga0157378_100091761 214
351 3300013297 Ga0157378_10029744 Ga0157378_100297442 214
352 3300013297 Ga0157378_10198282 Ga0157378_101982822 214
353 3300013297 Ga0157378_10245695 Ga0157378_102456952 214
354 3300013297 Ga0157378_10580255 Ga0157378_105802552 214
355 3300013297 Ga0157378_10731065 Ga0157378_107310651 214
356 3300013306 Ga0163162_10000029 Ga0163162_1000002953 214
357 3300013306 Ga0163162_10000086 Ga0163162_1000008639 214
358 3300013306 Ga0163162_10004131 Ga0163162_100041316 214
359 3300013306 Ga0163162_10004603 Ga0163162_100046034 214
360 3300013306 Ga0163162_10197211 Ga0163162_101972111 214
361 3300013306 Ga0163162_10355334 Ga0163162_103553342 214
362 3300013306 Ga0163162_10620865 Ga0163162_106208651 214
363 3300013307 Ga0157372_10070798 Ga0157372_100707982 214
364 3300013307 Ga0157372_10802269 Ga0157372_108022691 214
365 3300013308 Ga0157375_10000042 Ga0157375_10000042108 214
366 3300013308 Ga0157375_10000115 Ga0157375_1000011539 214
367 3300013308 Ga0157375_10000174 Ga0157375_1000017447 214
368 3300013308 Ga0157375_10078815 Ga0157375_100788153 214
369 3300013308 Ga0157375_10118381 Ga0157375_101183813 214
370 3300013308 Ga0157375_10181851 Ga0157375_101818512 214
371 3300013308 Ga0157375_10208349 Ga0157375_102083492 214
372 3300013308 Ga0157375_10305831 Ga0157375_103058311 214
373 3300013308 Ga0157375_10454684 Ga0157375_104546842 214
374 3300013308 Ga0157375_11464420 Ga0157375_114644201 214
375 3300014325 Ga0163163_10000088 Ga0163163_1000008887 214
376 3300014325 Ga0163163_10000174 Ga0163163_1000017461 214
377 3300014325 Ga0163163_10000244 Ga0163163_1000024439 214
378 3300014325 Ga0163163_10145144 Ga0163163_101451443 214
379 3300014325 Ga0163163_10247930 Ga0163163_102479302 214
380 3300014325 Ga0163163_11006258 Ga0163163_110062581 214
381 3300014326 Ga0157380_10000378 Ga0157380_1000037815 214
382 3300014326 Ga0157380_10040272 Ga0157380_100402721 214
383 3300014326 Ga0157380_10081061 Ga0157380_100810611 214
384 3300014326 Ga0157380_10187389 Ga0157380_101873891 214
385 3300014326 Ga0157380_10378584 Ga0157380_103785842 214
386 3300014326 Ga0157380_10828521 Ga0157380_108285211 214
387 3300014745 Ga0157377_10012000 Ga0157377_100120002 214
388 3300014745 Ga0157377_10014162 Ga0157377_100141623 214
389 3300014745 Ga0157377_10021205 Ga0157377_100212054 214
390 3300014968 Ga0157379_10000080 Ga0157379_1000008013 214
391 3300014968 Ga0157379_10013554 Ga0157379_100135542 214
392 3300014968 Ga0157379_10057820 Ga0157379_100578204 214
393 3300014968 Ga0157379_10188762 Ga0157379_101887622 214
394 3300014969 Ga0157376_10000429 Ga0157376_1000042919 214
395 3300014969 Ga0157376_10000521 Ga0157376_100005219 214
396 3300014969 Ga0157376_10029340 Ga0157376_100293403 214
397 3300014969 Ga0157376_10141024 Ga0157376_101410241 214
398 3300014969 Ga0157376_10307915 Ga0157376_103079152 214
399 3300014969 Ga0157376_10460497 Ga0157376_104604972 214
400 3300017792 Ga0163161_10000888 Ga0163161_1000088821 214
401 3300017792 Ga0163161_10001507 Ga0163161_100015076 214
402 3300017792 Ga0163161_10003749 Ga0163161_100037497 214
403 3300017792 Ga0163161_10008155 Ga0163161_100081558 214
404 3300017792 Ga0163161_10009144 Ga0163161_100091443 214
405 3300017792 Ga0163161_10038599 Ga0163161_100385994 214
406 3300017792 Ga0163161_10144238 Ga0163161_101442382 214
407 3300017792 Ga0163161_10177114 Ga0163161_101771142 214
408 3300017792 Ga0163161_10289236 Ga0163161_102892362 214
409 3300025291 Ga0209675_1000077 Ga0209675_1000077121 214
410 3300025315 Ga0207697_10049958 Ga0207697_100499582 214
411 3300025728 Ga0207655_1000013 Ga0207655_1000013590 214
412 3300025893 Ga0207682_10191120 Ga0207682_101911201 214
413 3300025899 Ga0207642_10025259 Ga0207642_100252592 214
414 3300025899 Ga0207642_10305716 Ga0207642_103057161 214
415 3300025903 Ga0207680_10000657 Ga0207680_100006577 214
416 3300025903 Ga0207680_10308407 Ga0207680_103084072 214
417 3300025904 Ga0207647_10004968 Ga0207647_100049688 214
418 3300025904 Ga0207647_10094133 Ga0207647_100941332 214
419 3300025907 Ga0207645_10002924 Ga0207645_1000292412 214
420 3300025907 Ga0207645_10016615 Ga0207645_100166152 214
421 3300025907 Ga0207645_10027548 Ga0207645_100275481 214
422 3300025907 Ga0207645_10134884 Ga0207645_101348841 214
423 3300025908 Ga0207643_10006094 Ga0207643_100060943 214
424 3300025909 Ga0207705_10001116 Ga0207705_1000111614 214
425 3300025912 Ga0207707_10069257 Ga0207707_100692573 214
426 3300025913 Ga0207695_10000102 Ga0207695_10000102115 214
427 3300025913 Ga0207695_10029925 Ga0207695_100299257 214
428 3300025913 Ga0207695_10130932 Ga0207695_101309322 214
429 3300025914 Ga0207671_10000468 Ga0207671_100004685 214
430 3300025914 Ga0207671_10033270 Ga0207671_100332702 214
431 3300025918 Ga0207662_10025036 Ga0207662_100250363 214
432 3300025919 Ga0207657_10124646 Ga0207657_101246462 214
433 3300025919 Ga0207657_10247420 Ga0207657_102474202 214
434 3300025920 Ga0207649_10147537 Ga0207649_101475372 214
435 3300025923 Ga0207681_10192606 Ga0207681_101926062 214
436 3300025923 Ga0207681_10448642 Ga0207681_104486422 214
437 3300025924 Ga0207694_10279482 Ga0207694_102794822 214
438 3300025924 Ga0207694_10738189 Ga0207694_107381891 214
439 3300025925 Ga0207650_10018943 Ga0207650_100189432 214
440 3300025925 Ga0207650_10125668 Ga0207650_101256682 214
441 3300025925 Ga0207650_10150508 Ga0207650_101505081 214
442 3300025925 Ga0207650_10407797 Ga0207650_104077972 214
443 3300025925 Ga0207650_10583021 Ga0207650_105830211 214
444 3300025926 Ga0207659_10020002 Ga0207659_100200023 214
445 3300025926 Ga0207659_10454406 Ga0207659_104544062 214
446 3300025927 Ga0207687_10127317 Ga0207687_101273172 214
447 3300025931 Ga0207644_10107109 Ga0207644_101071092 214
448 3300025932 Ga0207690_10051840 Ga0207690_100518402 214
449 3300025932 Ga0207690_10166548 Ga0207690_101665481 214
450 3300025933 Ga0207706_10008032 Ga0207706_100080327 214
451 3300025933 Ga0207706_10010943 Ga0207706_100109436 214
452 3300025933 Ga0207706_10012549 Ga0207706_100125493 214
453 3300025933 Ga0207706_10070196 Ga0207706_100701962 214
454 3300025933 Ga0207706_10075734 Ga0207706_100757342 214
455 3300025934 Ga0207686_10011930 Ga0207686_100119306 214
456 3300025934 Ga0207686_10018560 Ga0207686_100185605 214
457 3300025935 Ga0207709_10000021 Ga0207709_10000021296 214
458 3300025935 Ga0207709_10000161 Ga0207709_1000016143 214
459 3300025936 Ga0207670_10012853 Ga0207670_100128534 214
460 3300025936 Ga0207670_10072521 Ga0207670_100725213 214
461 3300025936 Ga0207670_10166974 Ga0207670_101669742 214
462 3300025936 Ga0207670_10459536 Ga0207670_104595362 214
463 3300025937 Ga0207669_10065247 Ga0207669_100652471 214
464 3300025938 Ga0207704_10007511 Ga0207704_100075114 214
465 3300025938 Ga0207704_10055534 Ga0207704_100555342 214
466 3300025938 Ga0207704_10684314 Ga0207704_106843141 214
467 3300025938 Ga0207704_10897420 Ga0207704_108974201 214
468 3300025940 Ga0207691_10000004 Ga0207691_1000000453 214
469 3300025940 Ga0207691_10035545 Ga0207691_100355458 214
470 3300025940 Ga0207691_10090583 Ga0207691_100905831 214
471 3300025940 Ga0207691_10136519 Ga0207691_101365192 214
472 3300025940 Ga0207691_10419484 Ga0207691_104194841 214
473 3300025941 Ga0207711_10257699 Ga0207711_102576992 214
474 3300025942 Ga0207689_10007281 Ga0207689_100072814 214
475 3300025942 Ga0207689_10011219 Ga0207689_100112194 214
476 3300025942 Ga0207689_10016209 Ga0207689_100162096 214
477 3300025942 Ga0207689_10030376 Ga0207689_100303764 214
478 3300025942 Ga0207689_10088090 Ga0207689_100880902 214
479 3300025944 Ga0207661_10001545 Ga0207661_1000154513 214
480 3300025944 Ga0207661_10004190 Ga0207661_100041904 214
481 3300025944 Ga0207661_10057427 Ga0207661_100574272 214
482 3300025944 Ga0207661_10134542 Ga0207661_101345422 214
483 3300025945 Ga0207679_10001022 Ga0207679_1000102214 214
484 3300025945 Ga0207679_10011099 Ga0207679_100110993 214
485 3300025945 Ga0207679_10021679 Ga0207679_100216794 214
486 3300025945 Ga0207679_10080698 Ga0207679_100806982 214
487 3300025945 Ga0207679_10096051 Ga0207679_100960512 214
488 3300025945 Ga0207679_10530757 Ga0207679_105307571 214
489 3300025949 Ga0207667_10027774 Ga0207667_100277744 214
490 3300025949 Ga0207667_10030844 Ga0207667_100308444 214
491 3300025949 Ga0207667_10710302 Ga0207667_107103021 214
492 3300025960 Ga0207651_10001790 Ga0207651_100017907 214
493 3300025960 Ga0207651_10099712 Ga0207651_100997121 214
494 3300025960 Ga0207651_10318984 Ga0207651_103189842 214
495 3300025960 Ga0207651_10448637 Ga0207651_104486372 214
496 3300025960 Ga0207651_10769714 Ga0207651_107697141 214
497 3300025961 Ga0207712_10007623 Ga0207712_100076232 214
498 3300025961 Ga0207712_10012756 Ga0207712_100127565 214
499 3300025961 Ga0207712_10013338 Ga0207712_100133386 214
500 3300025961 Ga0207712_10140974 Ga0207712_101409742 214
501 3300025961 Ga0207712_10261826 Ga0207712_102618262 214
502 3300025961 Ga0207712_10673409 Ga0207712_106734092 214
503 3300025972 Ga0207668_10001201 Ga0207668_100012016 214
504 3300025972 Ga0207668_10097826 Ga0207668_100978262 214
505 3300025972 Ga0207668_10110395 Ga0207668_101103952 214
506 3300025972 Ga0207668_10194964 Ga0207668_101949642 214
507 3300025981 Ga0207640_10106514 Ga0207640_101065142 214
508 3300025981 Ga0207640_10257043 Ga0207640_102570433 214
509 3300025986 Ga0207658_10000059 Ga0207658_1000005988 214
510 3300025986 Ga0207658_10005894 Ga0207658_100058947 214
511 3300025986 Ga0207658_10050997 Ga0207658_100509973 214
512 3300025986 Ga0207658_10313673 Ga0207658_103136733 214
513 3300026023 Ga0207677_10002598 Ga0207677_100025982 214
514 3300026023 Ga0207677_10021177 Ga0207677_100211772 214
515 3300026023 Ga0207677_10054179 Ga0207677_100541793 214
516 3300026023 Ga0207677_10131600 Ga0207677_101316002 214
517 3300026023 Ga0207677_10277844 Ga0207677_102778442 214
518 3300026035 Ga0207703_10003800 Ga0207703_100038004 214
519 3300026035 Ga0207703_10088458 Ga0207703_100884582 214
520 3300026035 Ga0207703_10158786 Ga0207703_101587861 214
521 3300026035 Ga0207703_10617325 Ga0207703_106173251 214
522 3300026041 Ga0207639_10009648 Ga0207639_100096482 214
523 3300026041 Ga0207639_10034590 Ga0207639_100345904 214
524 3300026041 Ga0207639_10062961 Ga0207639_100629613 214
525 3300026088 Ga0207641_10000416 Ga0207641_100004169 214
526 3300026088 Ga0207641_10002750 Ga0207641_1000275010 214
527 3300026088 Ga0207641_10096221 Ga0207641_100962212 214
528 3300026088 Ga0207641_10309349 Ga0207641_103093492 214
529 3300026088 Ga0207641_10346500 Ga0207641_103465002 214
530 3300026088 Ga0207641_10853016 Ga0207641_108530161 214
531 3300026088 Ga0207641_10916999 Ga0207641_109169991 214
532 3300026089 Ga0207648_10025200 Ga0207648_100252001 214
533 3300026089 Ga0207648_10026318 Ga0207648_100263182 214
534 3300026089 Ga0207648_10027541 Ga0207648_100275416 214
535 3300026089 Ga0207648_10062661 Ga0207648_100626615 214
536 3300026089 Ga0207648_10112573 Ga0207648_101125733 214
537 3300026089 Ga0207648_10269578 Ga0207648_102695782 214
538 3300026089 Ga0207648_10312426 Ga0207648_103124262 214
539 3300026095 Ga0207676_10002009 Ga0207676_1000200912 214
540 3300026095 Ga0207676_10005115 Ga0207676_100051153 214
541 3300026095 Ga0207676_10006355 Ga0207676_100063555 214
542 3300026095 Ga0207676_10020266 Ga0207676_100202663 214
543 3300026095 Ga0207676_10077769 Ga0207676_100777693 214
544 3300026095 Ga0207676_10126836 Ga0207676_101268362 214
545 3300026095 Ga0207676_10633249 Ga0207676_106332491 214
546 3300026116 Ga0207674_10002088 Ga0207674_1000208821 214
547 3300026116 Ga0207674_10005225 Ga0207674_1000522518 214
548 3300026116 Ga0207674_10040453 Ga0207674_100404535 214
549 3300026116 Ga0207674_10146288 Ga0207674_101462883 214
550 3300026116 Ga0207674_10296804 Ga0207674_102968042 214
551 3300026118 Ga0207675_100005095 Ga0207675_10000509512 214
552 3300026118 Ga0207675_100090596 Ga0207675_1000905962 214
553 3300026118 Ga0207675_100094080 Ga0207675_1000940802 214
554 3300026118 Ga0207675_101264295 Ga0207675_1012642951 214
555 3300026121 Ga0207683_10037634 Ga0207683_100376343 214
556 3300026121 Ga0207683_10046789 Ga0207683_100467892 214
557 3300026121 Ga0207683_10100558 Ga0207683_101005583 214
558 3300026121 Ga0207683_10863981 Ga0207683_108639811 214
559 3300026121 Ga0207683_11104728 Ga0207683_111047281 214
560 3300026142 Ga0207698_10010669 Ga0207698_100106692 214
561 3300026142 Ga0207698_10071522 Ga0207698_100715222 214
562 3300026142 Ga0207698_10501130 Ga0207698_105011301 214
563 3300026142 Ga0207698_11014294 Ga0207698_110142941 214
564 3300027907 Ga0207428_10112757 Ga0207428_101127573 214
565 3300027907 Ga0207428_10410913 Ga0207428_104109132 214
566 3300028379 Ga0268266_10006335 Ga0268266_100063353 214
567 3300028380 Ga0268265_10094979 Ga0268265_100949792 214
568 3300028381 Ga0268264_10006876 Ga0268264_100068763 214
569 3300028381 Ga0268264_10015827 Ga0268264_100158277 214
570 3300028381 Ga0268264_10247792 Ga0268264_102477922 214
571 3300028381 Ga0268264_10250648 Ga0268264_102506481 214
572 3300028381 Ga0268264_10727426 Ga0268264_107274262 214
573 3300028577 Ga0265318_10045050 Ga0265318_100450502 214
574 3300028794 Ga0307515_10000078 Ga0307515_1000007815 214
575 3300028794 Ga0307515_10131954 Ga0307515_101319541 214
576 3300031242 Ga0265329_10023836 Ga0265329_100238362 214
577 3300031250 Ga0265331_10013215 Ga0265331_100132152 214
578 3300031251 Ga0265327_10000338 Ga0265327_1000033845 214
579 3300031251 Ga0265327_10112822 Ga0265327_101128221 214
580 3300031344 Ga0265316_10505380 Ga0265316_105053801 214
581 3300031456 Ga0307513_10352768 Ga0307513_103527682 214
582 3300031507 Ga0307509_10034214 Ga0307509_100342143 214
583 3300031507 Ga0307509_10082146 Ga0307509_100821461 214
584 3300031507 Ga0307509_10111461 Ga0307509_101114613 214
585 3300031507 Ga0307509_10305470 Ga0307509_103054702 214
586 3300031548 Ga0307408_100000517 Ga0307408_10000051729 214
587 3300031616 Ga0307508_10001710 Ga0307508_1000171011 214
588 3300031711 Ga0265314_10018173 Ga0265314_100181737 214
589 3300031730 Ga0307516_10000665 Ga0307516_1000066514 214
590 3300031911 Ga0307412_10000096 Ga0307412_1000009671 214
591 3300031911 Ga0307412_10000389 Ga0307412_1000038927 214
592 3300031911 Ga0307412_10007996 Ga0307412_100079964 214
593 3300032004 Ga0307414_10000004 Ga0307414_1000000473 214
594 3300032004 Ga0307414_10134392 Ga0307414_101343922 214
595 3300033179 Ga0307507_10044361 Ga0307507_100443612 214
596 3300035111 Ga0373923_0023938 Ga0373923_0023938_1590_2240 214
597 3300035170 Ga0373943_0203036 Ga0373943_0203036_395_1045 214
598 3300035172 Ga0373955_0002985 Ga0373955_0002985_1994_2710 214
599 3300035692 Ga0373935_0399189 Ga0373935_0399189_134_784 214
600 3300035724 Ga0373933_0033852 Ga0373933_0033852_857_1507 214
601 3300035724 Ga0373933_0262603 Ga0373933_0262603_91_741 214
602 3300036401 Ga0373937_0119669 Ga0373937_0119669_1521_2171 214
603 3300036401 Ga0373937_0127172 Ga0373937_0127172_486_1136 214
604 3300037068 Ga0373925_0307908 Ga0373925_0307908_494_1144 214
605 3300039437 Ga0436365_1285242 Ga0436365_1285242_844_1494 214
606 3300041404 Ga0439436_0005435 Ga0439436_0005435_3125_3775 214
607 3300041406 Ga0439439_0027259 Ga0439439_0027259_144_794 214
608 3300041486 Ga0451807_2281288 Ga0451807_2281288_530_1180 214
609 3300041496 Ga0451839_0948395 Ga0451839_0948395_39_689 214
610 3300041511 Ga0451855_1570704 Ga0451855_1570704_572_1222 214
611 3300042004 Ga0439445_0000575 Ga0439445_0000575_4784_5437 214
612 3300042014 Ga0439457_003008 Ga0439457_003008_2394_3044 214
613 3300042015 Ga0439462_0004845 Ga0439462_0004845_1545_2195 214
614 3300042435 Ga0439434_0112614 Ga0439434_0112614_214_864 214
615 3300044656 Ga0466969_0000152 Ga0466969_0000152_21324_21974 214
616 3300044656 Ga0466969_0136195 Ga0466969_0136195_290_940 214
617 3300044658 Ga0466972_0010553 Ga0466972_0010553_1812_2462 214
618 3300044684 Ga0466966_0000567 Ga0466966_0000567_12349_12999 214
619 3300044693 Ga0466961_0430216 Ga0466961_0430216_102_752 214
620 3300044706 Ga0466964_0058152 Ga0466964_0058152_717_1367 214
621 3300044712 Ga0453684_0089052 Ga0453684_0089052_557_1207 214
622 3300044712 Ga0453684_0188039 Ga0453684_0188039_221_871 214
623 3300044719 Ga0466971_0117009 Ga0466971_0117009_325_975 214
624 3300044735 Ga0466968_0192069 Ga0466968_0192069_138_788 214
625 3300044842 Ga0466957_0005078 Ga0466957_0005078_5116_5766 214
626 3300044901 Ga0466960_0427038 Ga0466960_0427038_29_679 214
627 3300045049 Ga0466959_0000016 Ga0466959_0000016_27304_27954 214
628 3300046453 Ga0495627_000219 Ga0495627_000219_59384_60037 214
629 3300046454 Ga0495592_0079131 Ga0495592_0079131_1269_1919 214
630 3300046457 Ga0495590_0001941 Ga0495590_0001941_743_1393 214
631 3300046459 Ga0495629_0028307 Ga0495629_0028307_1963_2613 214
632 3300046462 Ga0495651_0537990 Ga0495651_0537990_63_713 214
633 3300046463 Ga0495653_0045247 Ga0495653_0045247_37_687 214
634 3300046474 Ga0495605_0071591 Ga0495605_0071591_794_1438 214
635 3300046500 Ga0495596_0000647 Ga0495596_0000647_11200_11850 214
636 3300046507 Ga0495606_0002853 Ga0495606_0002853_4088_4738 214
637 3300046507 Ga0495606_0010801 Ga0495606_0010801_438_1088 214
638 3300046514 Ga0495618_0033387 Ga0495618_0033387_1096_1812 214
639 3300046516 Ga0495628_0008008 Ga0495628_0008008_2324_2974 214
640 3300046517 Ga0495630_0007375 Ga0495630_0007375_497_1147 214
641 3300046519 Ga0495632_0000601 Ga0495632_0000601_27232_27885 214
642 3300046522 Ga0495643_0035860 Ga0495643_0035860_280_933 214
643 3300046524 Ga0495648_0005568 Ga0495648_0005568_8089_8739 214
644 3300046525 Ga0495663_0000105 Ga0495663_0000105_21301_21951 214
645 3300046525 Ga0495663_0005212 Ga0495663_0005212_1623_2273 214
646 3300046529 Ga0495652_0120404 Ga0495652_0120404_566_1216 214
647 3300046530 Ga0495654_0000006 Ga0495654_0000006_17056_17709 214
648 3300046531 Ga0495665_0082512 Ga0495665_0082512_691_1341 214
649 3300046533 Ga0495640_0150605 Ga0495640_0150605_402_1052 214
650 3300046536 Ga0495587_0006727 Ga0495587_0006727_6087_6737 214
651 3300046536 Ga0495587_0114052 Ga0495587_0114052_180_830 214
652 3300046537 Ga0495598_0009457 Ga0495598_0009457_722_1372 214
653 3300046538 Ga0495609_0000017 Ga0495609_0000017_78247_78897 214
654 3300046539 Ga0495621_0021996 Ga0495621_0021996_695_1345 214
655 3300046539 Ga0495621_0033075 Ga0495621_0033075_336_986 214
656 3300046539 Ga0495621_0111701 Ga0495621_0111701_287_967 214
657 3300046558 Ga0495633_0000037 Ga0495633_0000037_17261_17914 214
658 3300046558 Ga0495633_0002549 Ga0495633_0002549_1462_2115 214
659 3300046616 Ga0495668_0008836 Ga0495668_0008836_1240_1890 214
660 3300046648 Ga0495611_0057401 Ga0495611_0057401_26_676 214
661 3300046660 Ga0495625_0232174 Ga0495625_0232174_517_1167 214
662 3300046665 Ga0495661_0003215 Ga0495661_0003215_3790_4434 214
663 3300046678 Ga0495599_0158960 Ga0495599_0158960_281_931 214
664 3300046683 Ga0495658_0209545 Ga0495658_0209545_330_980 214
665 3300046689 Ga0495613_0106828 Ga0495613_0106828_546_1196 214
666 3300046809 Ga0495600_0023886 Ga0495600_0023886_2675_3325 214
667 3300047317 Ga0495604_0104009 Ga0495604_0104009_1191_1841 214
668 3300047319 Ga0495674_0042827 Ga0495674_0042827_2375_3025 214
669 3300047319 Ga0495674_0184469 Ga0495674_0184469_233_883 214
670 3300047444 Ga0495675_0400516 Ga0495675_0400516_33_683 214
671 3300047471 Ga0495684_0062929 Ga0495684_0062929_1521_2171 214
672 3300047472 Ga0495686_0000414 Ga0495686_0000414_63900_64550 214
673 3300048903 Ga0496100_0085564 Ga0496100_0085564_1235_1885 214
674 3300048909 Ga0496106_0193839 Ga0496106_0193839_750_1400 214
675 3300048910 Ga0496107_0279946 Ga0496107_0279946_567_1217 214
676 3300048910 Ga0496107_0765422 Ga0496107_0765422_22_672 214
677 3300048912 Ga0496109_0017189 Ga0496109_0017189_907_1557 214
678 3300048917 Ga0496114_0115964 Ga0496114_0115964_408_1058 214
679 3300048918 Ga0496115_0074175 Ga0496115_0074175_1529_2173 214
680 3300048919 Ga0496116_0000006 Ga0496116_0000006_332_982 214
681 3300048919 Ga0496116_0046869 Ga0496116_0046869_1293_1940 214
682 3300048920 Ga0496117_0002735 Ga0496117_0002735_4216_4863 214
683 3300048921 Ga0496118_0305931 Ga0496118_0305931_120_767 214
684 3300048925 Ga0496122_0000229 Ga0496122_0000229_42273_42923 214
685 3300048925 Ga0496122_0000397 Ga0496122_0000397_45536_46186 214
686 3300048925 Ga0496122_0002499 Ga0496122_0002499_4639_5289 214
687 3300048926 Ga0496123_0003892 Ga0496123_0003892_9412_10062 214
688 3300048926 Ga0496123_0006638 Ga0496123_0006638_9387_10037 214
689 3300048928 Ga0496125_0001071 Ga0496125_0001071_22475_23125 214
690 3300048928 Ga0496125_0110625 Ga0496125_0110625_267_914 214
691 3300048929 Ga0496126_0001395 Ga0496126_0001395_8028_8678 214
692 3300049516 Ga0501293_002230 Ga0501293_002230_90_740 214
693 3300049519 Ga0501296_023011 Ga0501296_023011_123_773 214
694 3300049520 Ga0501297_003781 Ga0501297_003781_377_1027 214
695 3300049569 Ga0501032_0088594 Ga0501032_0088594_544_1194 214
696 3300049570 Ga0501033_0508324 Ga0501033_0508324_77_727 214
697 3300049571 Ga0501034_0000002 Ga0501034_0000002_216718_217368 214
698 3300049571 Ga0501034_0004933 Ga0501034_0004933_12637_13326 214
699 3300049571 Ga0501034_0120580 Ga0501034_0120580_1948_2598 214
700 3300049572 Ga0501036_0120599 Ga0501036_0120599_140_829 214
701 3300049579 Ga0501043_0473433 Ga0501043_0473433_88_738 214
702 3300049580 Ga0501046_0103890 Ga0501046_0103890_25_675 214
703 3300049581 Ga0501047_0195837 Ga0501047_0195837_741_1391 214
704 3300049581 Ga0501047_0359744 Ga0501047_0359744_235_885 214
705 3300049581 Ga0501047_0380161 Ga0501047_0380161_573_1223 214
706 3300049582 Ga0501048_0194390 Ga0501048_0194390_332_982 214
707 3300049584 Ga0501068_0005707 Ga0501068_0005707_2776_3426 214
708 3300049589 Ga0501073_0094009 Ga0501073_0094009_442_1092 214
709 3300049590 Ga0501074_0135693 Ga0501074_0135693_493_1143 214
710 3300049651 Ga0501201_001434 Ga0501201_001434_715_1365 214
711 3300049652 Ga0501202_000359 Ga0501202_000359_5544_6194 214
712 3300049660 Ga0501216_002848 Ga0501216_002848_965_1615 214
713 3300049660 Ga0501216_003468 Ga0501216_003468_957_1607 214
714 3300049661 Ga0501217_000190 Ga0501217_000190_968_1618 214
715 3300049661 Ga0501217_006657 Ga0501217_006657_496_1146 214
716 3300049662 Ga0501222_000546 Ga0501222_000546_2295_2945 214
717 3300049663 Ga0501223_001006 Ga0501223_001006_5027_5677 214
718 3300049663 Ga0501223_007708 Ga0501223_007708_1123_1773 214
719 3300049664 Ga0501224_001719 Ga0501224_001719_262_912 214
720 3300049666 Ga0501228_002191 Ga0501228_002191_668_1318 214
721 3300049669 Ga0501235_004964 Ga0501235_004964_381_1031 214
722 3300049673 Ga0501240_000690 Ga0501240_000690_217_867 214
723 3300049675 Ga0501243_002611 Ga0501243_002611_133_783 214
724 3300049681 Ga0501251_003437 Ga0501251_003437_54_704 214
725 3300049683 Ga0501253_004133 Ga0501253_004133_1115_1765 214
726 3300049688 Ga0501259_000656 Ga0501259_000656_4037_4687 214
727 3300049704 Ga0501221_000013 Ga0501221_000013_11831_12481 214
728 3300049705 Ga0501225_0003389 Ga0501225_0003389_2070_2720 214
729 3300049707 Ga0501234_000394 Ga0501234_000394_1509_2159 214
730 3300049708 Ga0501245_000600 Ga0501245_000600_3200_3850 214
731 3300049708 Ga0501245_010467 Ga0501245_010467_545_1195 214
732 3300049741 Ga0501079_0225516 Ga0501079_0225516_183_833 214
733 3300049744 Ga0501083_0089499 Ga0501083_0089499_1036_1686 214
734 3300049744 Ga0501083_0105612 Ga0501083_0105612_915_1565 214
735 3300049758 Ga0501241_020851 Ga0501241_020851_78_728 214
736 3300049764 Ga0501267_000649 Ga0501267_000649_262_912 214
737 3300049822 Ga0501035_0074759 Ga0501035_0074759_2186_2836 214
738 3300049822 Ga0501035_0150406 Ga0501035_0150406_192_881 214
739 3300049822 Ga0501035_0161255 Ga0501035_0161255_817_1467 214
740 3300049823 Ga0501044_0087396 Ga0501044_0087396_1002_1652 214
741 3300049823 Ga0501044_0093319 Ga0501044_0093319_739_1428 214
742 3300049823 Ga0501044_0109831 Ga0501044_0109831_221_871 214
743 3300049823 Ga0501044_0124127 Ga0501044_0124127_99_788 214
744 3300049823 Ga0501044_0333409 Ga0501044_0333409_391_1041 214
745 3300049851 Ga0501212_000331 Ga0501212_000331_1753_2403 214
746 3300050511 nmdc:mga08y16_518020_c1 nmdc:mga08y16_518020_c1_472_1122 214
747 3300050512 nmdc:mga0n895_476600_c1 nmdc:mga0n895_476600_c1_265_915 214
748 3300053092 Ga0500583_0000009 Ga0500583_0000009_155263_155913 214
749 3300053092 Ga0500583_0019316 Ga0500583_0019316_1931_2581 214
750 3300053093 Ga0500651_0305007 Ga0500651_0305007_59_709 214
751 3300053118 Ga0500594_0113772 Ga0500594_0113772_10_660 214
752 3300053130 Ga0500642_0005680 Ga0500642_0005680_3286_3936 214
753 3300053136 Ga0500559_0029770 Ga0500559_0029770_428_1078 214
754 3300053136 Ga0500559_0125128 Ga0500559_0125128_452_1102 214
755 3300053146 Ga0500588_0001992 Ga0500588_0001992_777_1427 214
756 3300053153 Ga0500616_0006723 Ga0500616_0006723_1294_1944 214
757 3300053156 Ga0500622_0002834 Ga0500622_0002834_1142_1792 214
758 3300053156 Ga0500622_0037129 Ga0500622_0037129_170_820 214
759 3300053156 Ga0500622_0101421 Ga0500622_0101421_328_978 214
760 3300053156 Ga0500622_0128548 Ga0500622_0128548_337_987 214
761 3300053178 Ga0500637_0171897 Ga0500637_0171897_420_1070 214
762 3300054114 Ga0501084_0366934 Ga0501084_0366934_466_1116 214
763 3300060353 Ga0501082_0154692 Ga0501082_0154692_54_704 214
764 3300061719 Ga0466962_0092153 Ga0466962_0092153_421_1071 214
765 iso_pu_bacteria 2839989709 2839992815 214
766 iso_pu_bacteria 2984572630 2984573205 214
767 iso_pu_bacteria 2984606641 2984610658 214
768 2162886007 SwRhRL2b_contig_1635683 SwRhRL2b_0497.00004990 215
769 3300001979 JGI24740J21852_10002363 JGI24740J21852_100023635 215
770 3300001979 JGI24740J21852_10006066 JGI24740J21852_100060664 215
771 3300003203 JGI25406J46586_10001770 JGI25406J46586_1000177011 215
772 3300003320 rootH2_10095483 rootH2_100954832 215
773 3300003320 rootH2_10109685 rootH2_101096851 215
774 3300003322 rootL2_10063816 rootL2_100638164 215
775 3300003323 rootH1_10039994 rootH1_100399944 215
776 3300003354 JGI25160J50197_1000852 JGI25160J50197_10008528 215
777 3300003794 Ga0055531_10000115 Ga0055531_1000011549 215
778 3300005262 Ga0065165_1010249 Ga0065165_10102495 215
779 3300005327 Ga0070658_10220966 Ga0070658_102209662 215
780 3300005329 Ga0070683_100008602 Ga0070683_1000086022 215
781 3300005331 Ga0070670_100036355 Ga0070670_1000363554 215
782 3300005331 Ga0070670_100907355 Ga0070670_1009073551 215
783 3300005335 Ga0070666_10020565 Ga0070666_100205652 215
784 3300005340 Ga0070689_100434389 Ga0070689_1004343892 215
785 3300005344 Ga0070661_100009332 Ga0070661_1000093321 215
786 3300005354 Ga0070675_100117374 Ga0070675_1001173742 215
787 3300005354 Ga0070675_100520910 Ga0070675_1005209101 215
788 3300005365 Ga0070688_100222132 Ga0070688_1002221322 215
789 3300005366 Ga0070659_100004124 Ga0070659_1000041242 215
790 3300005438 Ga0070701_10208116 Ga0070701_102081161 215
791 3300005455 Ga0070663_100409489 Ga0070663_1004094892 215
792 3300005457 Ga0070662_100078679 Ga0070662_1000786792 215
793 3300005459 Ga0068867_100245665 Ga0068867_1002456652 215
794 3300005459 Ga0068867_100281240 Ga0068867_1002812402 215
795 3300005466 Ga0070685_10010889 Ga0070685_100108893 215
796 3300005466 Ga0070685_10063704 Ga0070685_100637042 215
797 3300005530 Ga0070679_100189034 Ga0070679_1001890343 215
798 3300005530 Ga0070679_100237816 Ga0070679_1002378161 215
799 3300005535 Ga0070684_100020041 Ga0070684_1000200414 215
800 3300005535 Ga0070684_100242305 Ga0070684_1002423052 215
801 3300005539 Ga0068853_100008021 Ga0068853_1000080212 215
802 3300005563 Ga0068855_100070405 Ga0068855_1000704052 215
803 3300005577 Ga0068857_100052373 Ga0068857_1000523732 215
804 3300005614 Ga0068856_100013283 Ga0068856_1000132832 215
805 3300005616 Ga0068852_100089148 Ga0068852_1000891482 215
806 3300005616 Ga0068852_100137786 Ga0068852_1001377862 215
807 3300005618 Ga0068864_100221186 Ga0068864_1002211862 215
808 3300005618 Ga0068864_100356698 Ga0068864_1003566982 215
809 3300005843 Ga0068860_100328343 Ga0068860_1003283432 215
810 3300005843 Ga0068860_100612197 Ga0068860_1006121972 215
811 3300005844 Ga0068862_101183361 Ga0068862_1011833611 215
812 3300005985 Ga0081539_10003031 Ga0081539_1000303112 215
813 3300006195 Ga0075366_10246641 Ga0075366_102466412 215
814 3300009176 Ga0105242_10160382 Ga0105242_101603822 215
815 3300009176 Ga0105242_10320408 Ga0105242_103204082 215
816 3300009545 Ga0105237_10003065 Ga0105237_1000306511 215
817 3300011119 Ga0105246_10352988 Ga0105246_103529881 215
818 3300013100 Ga0157373_10093372 Ga0157373_100933723 215
819 3300013100 Ga0157373_10259770 Ga0157373_102597702 215
820 3300013102 Ga0157371_10041420 Ga0157371_100414202 215
821 3300013105 Ga0157369_10058863 Ga0157369_100588634 215
822 3300013105 Ga0157369_10069399 Ga0157369_100693993 215
823 3300013296 Ga0157374_10014871 Ga0157374_100148713 215
824 3300013296 Ga0157374_10017378 Ga0157374_100173783 215
825 3300013297 Ga0157378_10013430 Ga0157378_100134305 215
826 3300013297 Ga0157378_10075578 Ga0157378_100755782 215
827 3300013306 Ga0163162_10807736 Ga0163162_108077362 215
828 3300013307 Ga0157372_10106229 Ga0157372_101062292 215
829 3300013307 Ga0157372_10139972 Ga0157372_101399722 215
830 3300013307 Ga0157372_10597830 Ga0157372_105978302 215
831 3300013307 Ga0157372_10923679 Ga0157372_109236792 215
832 3300013308 Ga0157375_10798836 Ga0157375_107988362 215
833 3300014325 Ga0163163_10440651 Ga0163163_104406512 215
834 3300014325 Ga0163163_10664681 Ga0163163_106646812 215
835 3300014325 Ga0163163_10699592 Ga0163163_106995922 215
836 3300014326 Ga0157380_10006646 Ga0157380_100066462 215
837 3300014326 Ga0157380_10093003 Ga0157380_100930033 215
838 3300014969 Ga0157376_10190638 Ga0157376_101906382 215
839 3300017792 Ga0163161_10141137 Ga0163161_101411372 215
840 3300021384 Ga0213876_10001099 Ga0213876_1000109913 215
841 3300021384 Ga0213876_10049238 Ga0213876_100492381 215
842 3300025208 Ga0209436_100993 Ga0209436_1009933 215
843 3300025208 Ga0209436_103150 Ga0209436_1031502 215
844 3300025242 Ga0209258_100032 Ga0209258_10003288 215
845 3300025254 Ga0209148_1000223 Ga0209148_100022338 215
846 3300025284 Ga0209130_1000921 Ga0209130_10009216 215
847 3300025302 Ga0207426_1000023 Ga0207426_100002399 215
848 3300025302 Ga0207426_1000660 Ga0207426_100066036 215
849 3300025304 Ga0209257_1000128 Ga0209257_1000128139 215
850 3300025904 Ga0207647_10051468 Ga0207647_100514682 215
851 3300025909 Ga0207705_10564271 Ga0207705_105642711 215
852 3300025914 Ga0207671_10068007 Ga0207671_100680073 215
853 3300025917 Ga0207660_10633999 Ga0207660_106339992 215
854 3300025918 Ga0207662_10116436 Ga0207662_101164362 215
855 3300025919 Ga0207657_10015786 Ga0207657_100157864 215
856 3300025920 Ga0207649_10055435 Ga0207649_100554352 215
857 3300025921 Ga0207652_10491483 Ga0207652_104914832 215
858 3300025923 Ga0207681_10039258 Ga0207681_100392582 215
859 3300025931 Ga0207644_10441847 Ga0207644_104418471 215
860 3300025933 Ga0207706_10013744 Ga0207706_100137446 215
861 3300025934 Ga0207686_10405055 Ga0207686_104050551 215
862 3300025936 Ga0207670_10433465 Ga0207670_104334651 215
863 3300025939 Ga0207665_10153835 Ga0207665_101538352 215
864 3300025942 Ga0207689_10170321 Ga0207689_101703212 215
865 3300025944 Ga0207661_10042201 Ga0207661_100422012 215
866 3300025945 Ga0207679_10005167 Ga0207679_100051672 215
867 3300025981 Ga0207640_10065684 Ga0207640_100656842 215
868 3300025981 Ga0207640_10627914 Ga0207640_106279141 215
869 3300026035 Ga0207703_10784318 Ga0207703_107843182 215
870 3300026041 Ga0207639_10062364 Ga0207639_100623642 215
871 3300026041 Ga0207639_10299287 Ga0207639_102992872 215
872 3300026067 Ga0207678_10120280 Ga0207678_101202802 215
873 3300026089 Ga0207648_10007533 Ga0207648_100075336 215
874 3300026089 Ga0207648_10187170 Ga0207648_101871701 215
875 3300026095 Ga0207676_10180756 Ga0207676_101807563 215
876 3300026116 Ga0207674_10054338 Ga0207674_100543382 215
877 3300026118 Ga0207675_100748370 Ga0207675_1007483701 215
878 3300026142 Ga0207698_10170744 Ga0207698_101707442 215
879 3300026142 Ga0207698_10356392 Ga0207698_103563922 215
880 3300026142 Ga0207698_10700201 Ga0207698_107002011 215
881 3300028381 Ga0268264_10035714 Ga0268264_100357141 215
882 3300028381 Ga0268264_10408330 Ga0268264_104083302 215
883 3300028577 Ga0265318_10035597 Ga0265318_100355973 215
884 3300028653 Ga0265323_10069694 Ga0265323_100696942 215
885 3300028794 Ga0307515_10140321 Ga0307515_101403211 215
886 3300031251 Ga0265327_10018384 Ga0265327_100183843 215
887 3300031251 Ga0265327_10043261 Ga0265327_100432613 215
888 3300031548 Ga0307408_100000170 Ga0307408_10000017028 215
889 3300031727 Ga0316576_10092644 Ga0316576_100926442 215
890 3300031727 Ga0316576_10104670 Ga0316576_101046702 215
891 3300032005 Ga0307411_10014850 Ga0307411_100148505 215
892 3300036401 Ga0373937_0214646 Ga0373937_0214646_234_881 215
893 3300039437 Ga0436365_0504388 Ga0436365_0504388_212_865 215
894 3300039437 Ga0436365_0701023 Ga0436365_0701023_1550_2203 215
895 3300039437 Ga0436365_0888373 Ga0436365_0888373_4165_4818 215
896 3300039437 Ga0436365_1207402 Ga0436365_1207402_2055_2708 215
897 3300039437 Ga0436365_1591745 Ga0436365_1591745_13522_14175 215
898 3300042876 Ga0451577_0000279 Ga0451577_0000279_55343_56026 215
899 3300042876 Ga0451577_0014708 Ga0451577_0014708_3882_4544 215
900 3300042876 Ga0451577_0029042 Ga0451577_0029042_1589_2251 215
901 3300042876 Ga0451577_0076278 Ga0451577_0076278_1848_2498 215
902 3300042876 Ga0451577_0164192 Ga0451577_0164192_1080_1742 215
903 3300042876 Ga0451577_0207196 Ga0451577_0207196_1021_1683 215
904 3300042876 Ga0451577_0265742 Ga0451577_0265742_335_1018 215
905 3300042876 Ga0451577_0321281 Ga0451577_0321281_510_1163 215
906 3300042876 Ga0451577_0335192 Ga0451577_0335192_695_1357 215
907 3300042876 Ga0451577_0515992 Ga0451577_0515992_48_710 215
908 3300044673 Ga0453683_0000031 Ga0453683_0000031_200554_201237 215
909 3300044673 Ga0453683_0000190 Ga0453683_0000190_51982_52644 215
910 3300044673 Ga0453683_0000238 Ga0453683_0000238_51123_51785 215
911 3300044673 Ga0453683_0001799 Ga0453683_0001799_12528_13190 215
912 3300044673 Ga0453683_0014745 Ga0453683_0014745_2307_2960 215
913 3300044673 Ga0453683_0019154 Ga0453683_0019154_2622_3284 215
914 3300044673 Ga0453683_0105006 Ga0453683_0105006_1036_1698 215
915 3300044673 Ga0453683_0354738 Ga0453683_0354738_185_847 215
916 3300044712 Ga0453684_0000161 Ga0453684_0000161_32719_33381 215
917 3300044712 Ga0453684_0000213 Ga0453684_0000213_141487_142149 215
918 3300044712 Ga0453684_0000225 Ga0453684_0000225_225197_225859 215
919 3300044712 Ga0453684_0000929 Ga0453684_0000929_55343_56026 215
920 3300044712 Ga0453684_0001226 Ga0453684_0001226_6177_6839 215
921 3300044712 Ga0453684_0002475 Ga0453684_0002475_35774_36424 215
922 3300044712 Ga0453684_0007656 Ga0453684_0007656_8775_9521 215
923 3300044712 Ga0453684_0011479 Ga0453684_0011479_3460_4110 215
924 3300044712 Ga0453684_0041744 Ga0453684_0041744_252_914 215
925 3300044712 Ga0453684_0051343 Ga0453684_0051343_1999_2661 215
926 3300044712 Ga0453684_0091408 Ga0453684_0091408_690_1352 215
927 3300044712 Ga0453684_0098471 Ga0453684_0098471_1954_2616 215
928 3300044712 Ga0453684_0343859 Ga0453684_0343859_12_695 215
929 3300044712 Ga0453684_0558655 Ga0453684_0558655_237_887 215
930 3300044735 Ga0466968_0102946 Ga0466968_0102946_27_680 215
931 3300044765 Ga0466970_0107980 Ga0466970_0107980_836_1489 215
932 3300045051 Ga0451576_0000012 Ga0451576_0000012_277331_277978 215
933 3300045051 Ga0451576_0000059 Ga0451576_0000059_264795_265457 215
934 3300045051 Ga0451576_0000414 Ga0451576_0000414_55343_56026 215
935 3300045051 Ga0451576_0000729 Ga0451576_0000729_35846_36508 215
936 3300045051 Ga0451576_0000948 Ga0451576_0000948_47601_48263 215
937 3300045051 Ga0451576_0011923 Ga0451576_0011923_4411_5073 215
938 3300045051 Ga0451576_0017125 Ga0451576_0017125_1734_2396 215
939 3300045051 Ga0451576_0020992 Ga0451576_0020992_3175_3858 215
940 3300045051 Ga0451576_0191966 Ga0451576_0191966_521_1204 215
941 3300045051 Ga0451576_0238236 Ga0451576_0238236_87_749 215
942 3300045051 Ga0451576_0811336 Ga0451576_0811336_107_769 215
943 3300046533 Ga0495640_0164852 Ga0495640_0164852_260_907 215
944 3300046642 Ga0495634_0027915 Ga0495634_0027915_509_1156 215
945 3300048927 Ga0496124_0113677 Ga0496124_0113677_470_1123 215
946 3300049570 Ga0501033_0124084 Ga0501033_0124084_89_742 215
947 3300049586 Ga0501070_0412788 Ga0501070_0412788_78_731 215
948 3300049589 Ga0501073_0096255 Ga0501073_0096255_775_1428 215
949 3300049649 Ga0501198_003624 Ga0501198_003624_927_1574 215
950 3300049742 Ga0501080_0628152 Ga0501080_0628152_138_791 215
951 3300049822 Ga0501035_0496559 Ga0501035_0496559_288_941 215
952 3300053088 Ga0500644_0089806 Ga0500644_0089806_248_997 215
953 3300053092 Ga0500583_0015550 Ga0500583_0015550_270_947 215
954 3300053093 Ga0500651_0104709 Ga0500651_0104709_223_900 215
955 3300053108 Ga0500562_000035 Ga0500562_000035_1190_1939 215
956 3300053109 Ga0500569_000056 Ga0500569_000056_15956_16633 215
957 3300053142 Ga0500577_0001778 Ga0500577_0001778_3963_4640 215
958 3300053153 Ga0500616_0084767 Ga0500616_0084767_447_1124 215
959 3300053153 Ga0500616_0136258 Ga0500616_0136258_454_1107 215
960 3300053156 Ga0500622_0001619 Ga0500622_0001619_10108_10761 215
961 3300053730 Ga0500645_065109 Ga0500645_065109_97_750 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14681

UPRTase

Uracil phosphoribosyltransferase

46

254

0.91

PF00156

Pribosyltran

Phosphoribosyl transferase domain

79

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5o-assembly1.cif.gz_B crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution 0.8833 2 214
2e55-assembly1.cif.gz_D structure of aq2163 protein from aquifex aeolicus 0.8832 1 211
1v9s-assembly1.cif.gz_C crystal structure of tt0130 protein from thermus thermophilus hb8 0.8757 2 214
6wn8-assembly1.cif.gz_D 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.875 2 214
6wn8-assembly3.cif.gz_I 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae 0.874 2 214
ID Description Score Start End Superfamily
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8832 1 211 3.40.50.2020
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8773 2 214 3.40.50.2020
af_Q5ANN6_315_525_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8759 2 190 3.40.50.2020
5e38B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8668 3 211 3.40.50.2020
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8616 2 214 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A350YYJ4-F1-model_v4 Uracil phosphoribosyltransferase 0.979 2 187 GO:0016757
AF-A0A6L4ZC58-F1-model_v4 Uracil phosphoribosyltransferase 0.978 1 161
AF-A0A661Y0E1-F1-model_v4 Uracil phosphoribosyltransferase 0.9679 3 92 GO:0016757
AF-A0A6L4ZC58-F1-model_v4 Uracil phosphoribosyltransferase 0.9604 1 161
AF-A0A350YYJ4-F1-model_v4 Uracil phosphoribosyltransferase 0.9587 2 187 GO:0016757

Feature Viewer

pLDDT pTM Quality
88.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map