F486853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 961 | 413 | 895 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300003354|JGI25160J50197_1000852|JGI25160J50197_10008528 |
| Length | 258 |
| Sequence | MQFYMVAKVGNSPFMKKNYRHFFPTITLSFTSFVLLAYLSGMVLNLSDQHSLVSNWVSELRNVNIQSDRMRFRRNLERIGEIAAYEISKTLPFKEEEVQTPLGLHTSKLLAQQPVLATILRAGLPLHNGMLNYFDRADNAFVSAYRKHHRDGSFEINVEYMSCPTLENRIVIISDPMLATGASLVKTIAVMKEEGLPAEIHVVTAIACTVGIEFVRRESGEDIKIWCGDIDDELTAKGYIVPGLGDAGDLAFGPKNQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 4 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 5 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 6 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 7 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 8 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 9 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 10 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 11 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 22 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 23 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 24 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 25 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 26 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 27 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 28 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 29 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 30 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 31 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 32 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 33 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 34 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 35 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 36 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 37 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 38 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 39 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 40 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 41 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 42 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 43 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 44 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 45 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 46 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 47 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 48 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 49 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 50 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 51 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 52 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 53 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 55 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 56 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 57 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 58 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 59 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 60 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 61 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 62 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 63 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 64 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 65 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 66 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 67 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 68 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 69 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 71 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 76 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 83 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 89 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 128 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 129 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 130 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 131 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 132 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 133 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 134 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 135 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 136 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 178 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 246 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 256 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 262 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 271 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 274 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 294 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 354 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 368 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 371 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 372 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 373 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 376 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 378 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 379 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 380 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 381 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 382 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 383 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 386 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 398 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 399 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 409 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.92 |
| Metatranscriptomes | 0.21 |
| Isolates | 6.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0.1 |
| Rhizoplane | 0.94 |
| Rhizosphere | 87.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1635683 | 2162886007 | Bacteria | 1022 |
| 2 | SwRhRL2b_contig_2652683 | 2162886007 | Bacteria | 2171 |
| 3 | JGI24741J21665_1002924 | 3300001915 | Bacteria | 4267 |
| 4 | JGI24740J21852_10002363 | 3300001979 | Bacteria | 8571 |
| 5 | JGI24740J21852_10006066 | 3300001979 | Bacteria | 5050 |
| 6 | JGI25406J46586_10001770 | 3300003203 | Bacteria | 10168 |
| 7 | rootH1_10131517 | 3300003316 | Bacteria | 1292 |
| 8 | rootH2_10095483 | 3300003320 | Bacteria | 2077 |
| 9 | rootH2_10109685 | 3300003320 | Bacteria | 4956 |
| 10 | rootL2_10063816 | 3300003322 | Unclassified | 4807 |
| 11 | rootH1_10039994 | 3300003323 | Bacteria | 6274 |
| 12 | rootH1_10147471 | 3300003323 | Bacteria | 4326 |
| 13 | rootH1_10202610 | 3300003323 | Bacteria | 1080 |
| 14 | JGI25160J50197_1000852 | 3300003354 | Bacteria | 16210 |
| 15 | Ga0006562J51391_1011765 | 3300003578 | Bacteria | 1193 |
| 16 | Ga0055534_1014943 | 3300003784 | Bacteria | 1438 |
| 17 | Ga0055531_10000115 | 3300003794 | Bacteria | 88381 |
| 18 | Ga0058860_11744412 | 3300004801 | Bacteria | 961 |
| 19 | Ga0065165_1010249 | 3300005262 | Bacteria | 4080 |
| 20 | Ga0065714_10065177 | 3300005288 | Bacteria | 12217 |
| 21 | Ga0065714_10118035 | 3300005288 | Bacteria | 1384 |
| 22 | Ga0065704_10071156 | 3300005289 | Bacteria | 12796 |
| 23 | Ga0065704_10077203 | 3300005289 | Bacteria | 4820 |
| 24 | Ga0065704_10086148 | 3300005289 | Bacteria | 3149 |
| 25 | Ga0065704_10283138 | 3300005289 | Bacteria | 918 |
| 26 | Ga0065712_10002959 | 3300005290 | Bacteria | 5986 |
| 27 | Ga0065712_10027299 | 3300005290 | Unclassified | 1102 |
| 28 | Ga0065712_10073468 | 3300005290 | Bacteria | 4382 |
| 29 | Ga0065712_10167465 | 3300005290 | Bacteria | 1262 |
| 30 | Ga0065715_10001700 | 3300005293 | Bacteria | 12165 |
| 31 | Ga0065715_10132314 | 3300005293 | Bacteria | 1992 |
| 32 | Ga0065707_10005547 | 3300005295 | Bacteria | 4010 |
| 33 | Ga0065707_10092699 | 3300005295 | Bacteria | 3731 |
| 34 | Ga0070658_10220966 | 3300005327 | Unclassified | 1602 |
| 35 | Ga0070676_10000034 | 3300005328 | Bacteria | 41415 |
| 36 | Ga0070676_10012393 | 3300005328 | Bacteria | 4652 |
| 37 | Ga0070676_10130395 | 3300005328 | Unclassified | 1589 |
| 38 | Ga0070676_10498460 | 3300005328 | Unclassified | 864 |
| 39 | Ga0070683_100000659 | 3300005329 | Bacteria | 24948 |
| 40 | Ga0070683_100008602 | 3300005329 | Bacteria | 8675 |
| 41 | Ga0070683_100014987 | 3300005329 | Bacteria | 6800 |
| 42 | Ga0070683_100167534 | 3300005329 | Unclassified | 2085 |
| 43 | Ga0070690_100050853 | 3300005330 | Unclassified | 2644 |
| 44 | Ga0070690_100122306 | 3300005330 | Bacteria | 1748 |
| 45 | Ga0070690_100213108 | 3300005330 | Bacteria | 1350 |
| 46 | Ga0070690_100363542 | 3300005330 | Bacteria | 1054 |
| 47 | Ga0070670_100032746 | 3300005331 | Bacteria | 4478 |
| 48 | Ga0070670_100036355 | 3300005331 | Unclassified | 4238 |
| 49 | Ga0070670_100039493 | 3300005331 | Bacteria | 4058 |
| 50 | Ga0070670_100124310 | 3300005331 | Bacteria | 2226 |
| 51 | Ga0070670_100192437 | 3300005331 | Bacteria | 1772 |
| 52 | Ga0070670_100499735 | 3300005331 | Bacteria | 1081 |
| 53 | Ga0070670_100907355 | 3300005331 | Bacteria | 799 |
| 54 | Ga0068869_100019822 | 3300005334 | Bacteria | 4604 |
| 55 | Ga0068869_100047968 | 3300005334 | Bacteria | 3086 |
| 56 | Ga0068869_100065506 | 3300005334 | Unclassified | 2675 |
| 57 | Ga0070666_10000431 | 3300005335 | Bacteria | 25787 |
| 58 | Ga0070666_10020565 | 3300005335 | Bacteria | 4268 |
| 59 | Ga0070666_10051457 | 3300005335 | Unclassified | 2774 |
| 60 | Ga0070682_100000474 | 3300005337 | Bacteria | 25301 |
| 61 | Ga0070682_100189797 | 3300005337 | Bacteria | 1442 |
| 62 | Ga0068868_100001305 | 3300005338 | Bacteria | 17174 |
| 63 | Ga0068868_100014762 | 3300005338 | Bacteria | 5764 |
| 64 | Ga0068868_100057484 | 3300005338 | Unclassified | 3073 |
| 65 | Ga0068868_100209799 | 3300005338 | Unclassified | 1627 |
| 66 | Ga0070660_100340634 | 3300005339 | Bacteria | 1234 |
| 67 | Ga0070689_100077183 | 3300005340 | Unclassified | 2611 |
| 68 | Ga0070689_100120093 | 3300005340 | Bacteria | 2099 |
| 69 | Ga0070689_100179787 | 3300005340 | Bacteria | 1717 |
| 70 | Ga0070689_100434389 | 3300005340 | Bacteria | 1115 |
| 71 | Ga0070661_100009156 | 3300005344 | Bacteria | 6843 |
| 72 | Ga0070661_100009332 | 3300005344 | Bacteria | 6788 |
| 73 | Ga0070661_100101022 | 3300005344 | Bacteria | 2145 |
| 74 | Ga0070668_100000087 | 3300005347 | Bacteria | 57426 |
| 75 | Ga0070668_100136073 | 3300005347 | Bacteria | 1976 |
| 76 | Ga0070669_100029165 | 3300005353 | Bacteria | 3976 |
| 77 | Ga0070669_100279480 | 3300005353 | Bacteria | 1337 |
| 78 | Ga0070669_100284695 | 3300005353 | Unclassified | 1325 |
| 79 | Ga0070669_100298236 | 3300005353 | Unclassified | 1296 |
| 80 | Ga0070675_100016216 | 3300005354 | Bacteria | 5911 |
| 81 | Ga0070675_100117374 | 3300005354 | Unclassified | 2258 |
| 82 | Ga0070675_100118146 | 3300005354 | Bacteria | 2251 |
| 83 | Ga0070675_100141582 | 3300005354 | Unclassified | 2056 |
| 84 | Ga0070675_100157019 | 3300005354 | Unclassified | 1954 |
| 85 | Ga0070675_100164717 | 3300005354 | Unclassified | 1909 |
| 86 | Ga0070675_100247803 | 3300005354 | Bacteria | 1558 |
| 87 | Ga0070675_100520910 | 3300005354 | Bacteria | 1073 |
| 88 | Ga0070671_100021476 | 3300005355 | Bacteria | 5272 |
| 89 | Ga0070671_100063802 | 3300005355 | Unclassified | 3068 |
| 90 | Ga0070671_100110437 | 3300005355 | Bacteria | 2309 |
| 91 | Ga0070674_100040831 | 3300005356 | Bacteria | 3140 |
| 92 | Ga0070674_100045340 | 3300005356 | Unclassified | 3004 |
| 93 | Ga0070674_100144957 | 3300005356 | Bacteria | 1786 |
| 94 | Ga0070673_100000074 | 3300005364 | Bacteria | 42660 |
| 95 | Ga0070673_100006567 | 3300005364 | Bacteria | 7569 |
| 96 | Ga0070673_100016521 | 3300005364 | Bacteria | 5222 |
| 97 | Ga0070673_100020236 | 3300005364 | Bacteria | 4796 |
| 98 | Ga0070673_100028926 | 3300005364 | Bacteria | 4127 |
| 99 | Ga0070673_100131684 | 3300005364 | Unclassified | 2099 |
| 100 | Ga0070673_100203480 | 3300005364 | Bacteria | 1706 |
| 101 | Ga0070673_100413458 | 3300005364 | Bacteria | 1208 |
| 102 | Ga0070688_100009006 | 3300005365 | Bacteria | 5441 |
| 103 | Ga0070688_100032610 | 3300005365 | Unclassified | 3142 |
| 104 | Ga0070688_100084330 | 3300005365 | Unclassified | 2064 |
| 105 | Ga0070688_100112042 | 3300005365 | Bacteria | 1816 |
| 106 | Ga0070688_100222132 | 3300005365 | Bacteria | 1332 |
| 107 | Ga0070659_100004124 | 3300005366 | Bacteria | 10359 |
| 108 | Ga0070659_100022811 | 3300005366 | Bacteria | 4782 |
| 109 | Ga0070659_100048868 | 3300005366 | Bacteria | 3324 |
| 110 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 111 | Ga0070667_100016900 | 3300005367 | Bacteria | 6038 |
| 112 | Ga0070667_100057008 | 3300005367 | Bacteria | 3300 |
| 113 | Ga0070667_100368257 | 3300005367 | Bacteria | 1303 |
| 114 | Ga0070701_10208116 | 3300005438 | Bacteria | 1160 |
| 115 | Ga0070663_100409489 | 3300005455 | Unclassified | 1110 |
| 116 | Ga0070663_100652464 | 3300005455 | Bacteria | 890 |
| 117 | Ga0070678_100082152 | 3300005456 | Unclassified | 2445 |
| 118 | Ga0070678_100194169 | 3300005456 | Bacteria | 1671 |
| 119 | Ga0070678_100413227 | 3300005456 | Unclassified | 1175 |
| 120 | Ga0070678_100776741 | 3300005456 | Unclassified | 868 |
| 121 | Ga0070662_100003774 | 3300005457 | Bacteria | 9477 |
| 122 | Ga0070662_100010942 | 3300005457 | Bacteria | 5980 |
| 123 | Ga0070662_100012743 | 3300005457 | Bacteria | 5581 |
| 124 | Ga0070662_100067746 | 3300005457 | Unclassified | 2622 |
| 125 | Ga0070662_100078679 | 3300005457 | Bacteria | 2450 |
| 126 | Ga0070662_100139660 | 3300005457 | Bacteria | 1876 |
| 127 | Ga0068867_100010592 | 3300005459 | Bacteria | 6507 |
| 128 | Ga0068867_100048371 | 3300005459 | Bacteria | 3128 |
| 129 | Ga0068867_100245665 | 3300005459 | Bacteria | 1453 |
| 130 | Ga0068867_100281240 | 3300005459 | Bacteria | 1364 |
| 131 | Ga0068867_100372018 | 3300005459 | Bacteria | 1198 |
| 132 | Ga0068867_100664731 | 3300005459 | Unclassified | 916 |
| 133 | Ga0070685_10010889 | 3300005466 | Bacteria | 4741 |
| 134 | Ga0070685_10017106 | 3300005466 | Unclassified | 3876 |
| 135 | Ga0070685_10035260 | 3300005466 | Unclassified | 2821 |
| 136 | Ga0070685_10063704 | 3300005466 | Unclassified | 2166 |
| 137 | Ga0070685_10262359 | 3300005466 | Bacteria | 1149 |
| 138 | Ga0070698_100005145 | 3300005471 | Bacteria | 14305 |
| 139 | Ga0070698_100245197 | 3300005471 | Bacteria | 1724 |
| 140 | Ga0070679_100189034 | 3300005530 | Bacteria | 2029 |
| 141 | Ga0070679_100237816 | 3300005530 | Bacteria | 1780 |
| 142 | Ga0070684_100001403 | 3300005535 | Bacteria | 17339 |
| 143 | Ga0070684_100003737 | 3300005535 | Bacteria | 11481 |
| 144 | Ga0070684_100020041 | 3300005535 | Bacteria | 5544 |
| 145 | Ga0070684_100192781 | 3300005535 | Bacteria | 1855 |
| 146 | Ga0070684_100242305 | 3300005535 | Bacteria | 1648 |
| 147 | Ga0068853_100004545 | 3300005539 | Bacteria | 10768 |
| 148 | Ga0068853_100008021 | 3300005539 | Bacteria | 8471 |
| 149 | Ga0068853_100013622 | 3300005539 | Bacteria | 6646 |
| 150 | Ga0068853_100016660 | 3300005539 | Bacteria | 6052 |
| 151 | Ga0068853_100453109 | 3300005539 | Bacteria | 1207 |
| 152 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 153 | Ga0070672_100196987 | 3300005543 | Bacteria | 1683 |
| 154 | Ga0070672_100213041 | 3300005543 | Unclassified | 1618 |
| 155 | Ga0070672_100334937 | 3300005543 | Bacteria | 1288 |
| 156 | Ga0070672_100426982 | 3300005543 | Bacteria | 1139 |
| 157 | Ga0070672_100847629 | 3300005543 | Bacteria | 806 |
| 158 | Ga0070686_100111833 | 3300005544 | Unclassified | 1862 |
| 159 | Ga0070665_100000222 | 3300005548 | Bacteria | 94961 |
| 160 | Ga0070665_100004685 | 3300005548 | Bacteria | 14276 |
| 161 | Ga0068855_100026121 | 3300005563 | Bacteria | 6986 |
| 162 | Ga0068855_100070405 | 3300005563 | Bacteria | 4069 |
| 163 | Ga0070664_100000140 | 3300005564 | Bacteria | 49126 |
| 164 | Ga0070664_100004377 | 3300005564 | Bacteria | 11348 |
| 165 | Ga0070664_100046706 | 3300005564 | Unclassified | 3658 |
| 166 | Ga0070664_100124460 | 3300005564 | Bacteria | 2260 |
| 167 | Ga0070664_100141526 | 3300005564 | Bacteria | 2119 |
| 168 | Ga0068857_100017088 | 3300005577 | Bacteria | 6355 |
| 169 | Ga0068857_100021957 | 3300005577 | Bacteria | 5617 |
| 170 | Ga0068857_100052373 | 3300005577 | Bacteria | 3622 |
| 171 | Ga0068857_100053671 | 3300005577 | Bacteria | 3575 |
| 172 | Ga0068857_100313255 | 3300005577 | Bacteria | 1448 |
| 173 | Ga0068857_100382233 | 3300005577 | Bacteria | 1308 |
| 174 | Ga0068854_100196964 | 3300005578 | Unclassified | 1581 |
| 175 | Ga0068856_100013283 | 3300005614 | Bacteria | 7976 |
| 176 | Ga0068856_100385193 | 3300005614 | Bacteria | 1422 |
| 177 | Ga0068852_100089148 | 3300005616 | Bacteria | 2756 |
| 178 | Ga0068852_100094789 | 3300005616 | Unclassified | 2679 |
| 179 | Ga0068852_100137786 | 3300005616 | Bacteria | 2255 |
| 180 | Ga0068852_100143997 | 3300005616 | Bacteria | 2209 |
| 181 | Ga0068852_100367051 | 3300005616 | Bacteria | 1409 |
| 182 | Ga0068852_100744796 | 3300005616 | Bacteria | 992 |
| 183 | Ga0068859_100021050 | 3300005617 | Bacteria | 6545 |
| 184 | Ga0068859_100032817 | 3300005617 | Bacteria | 5216 |
| 185 | Ga0068859_100047523 | 3300005617 | Bacteria | 4312 |
| 186 | Ga0068859_100277182 | 3300005617 | Bacteria | 1769 |
| 187 | Ga0068859_100497615 | 3300005617 | Bacteria | 1314 |
| 188 | Ga0068864_100007000 | 3300005618 | Bacteria | 9253 |
| 189 | Ga0068864_100013799 | 3300005618 | Bacteria | 6697 |
| 190 | Ga0068864_100017006 | 3300005618 | Bacteria | 6060 |
| 191 | Ga0068864_100030338 | 3300005618 | Unclassified | 4582 |
| 192 | Ga0068864_100112585 | 3300005618 | Bacteria | 2426 |
| 193 | Ga0068864_100150762 | 3300005618 | Unclassified | 2106 |
| 194 | Ga0068864_100162138 | 3300005618 | Bacteria | 2033 |
| 195 | Ga0068864_100221186 | 3300005618 | Bacteria | 1747 |
| 196 | Ga0068864_100356698 | 3300005618 | Bacteria | 1381 |
| 197 | Ga0068866_10144134 | 3300005718 | Bacteria | 1371 |
| 198 | Ga0068861_100008249 | 3300005719 | Bacteria | 7167 |
| 199 | Ga0068861_101086946 | 3300005719 | Bacteria | 768 |
| 200 | Ga0068851_10034023 | 3300005834 | Bacteria | 2542 |
| 201 | Ga0068851_10156310 | 3300005834 | Bacteria | 1250 |
| 202 | Ga0068870_10010587 | 3300005840 | Bacteria | 4243 |
| 203 | Ga0068870_10026063 | 3300005840 | Bacteria | 2910 |
| 204 | Ga0068863_100004520 | 3300005841 | Bacteria | 13723 |
| 205 | Ga0068863_100029214 | 3300005841 | Bacteria | 5264 |
| 206 | Ga0068863_100081959 | 3300005841 | Bacteria | 3057 |
| 207 | Ga0068863_100140676 | 3300005841 | Unclassified | 2306 |
| 208 | Ga0068863_100315848 | 3300005841 | Bacteria | 1517 |
| 209 | Ga0068863_100405879 | 3300005841 | Unclassified | 1333 |
| 210 | Ga0068858_100001512 | 3300005842 | Bacteria | 23886 |
| 211 | Ga0068858_100017339 | 3300005842 | Bacteria | 6754 |
| 212 | Ga0068858_100062769 | 3300005842 | Unclassified | 3436 |
| 213 | Ga0068858_100556786 | 3300005842 | Bacteria | 1110 |
| 214 | Ga0068860_100009821 | 3300005843 | Bacteria | 9495 |
| 215 | Ga0068860_100060843 | 3300005843 | Bacteria | 3588 |
| 216 | Ga0068860_100166484 | 3300005843 | Bacteria | 2128 |
| 217 | Ga0068860_100258732 | 3300005843 | Unclassified | 1696 |
| 218 | Ga0068860_100327688 | 3300005843 | Bacteria | 1504 |
| 219 | Ga0068860_100328343 | 3300005843 | Bacteria | 1502 |
| 220 | Ga0068860_100612197 | 3300005843 | Bacteria | 1095 |
| 221 | Ga0068862_101171056 | 3300005844 | Bacteria | 766 |
| 222 | Ga0068862_101183361 | 3300005844 | Bacteria | 762 |
| 223 | Ga0081539_10003031 | 3300005985 | Bacteria | 21772 |
| 224 | Ga0070715_10068794 | 3300006163 | Unclassified | 1575 |
| 225 | Ga0070716_100134074 | 3300006173 | Bacteria | 1570 |
| 226 | Ga0075366_10246641 | 3300006195 | Bacteria | 1089 |
| 227 | Ga0097621_100000118 | 3300006237 | Bacteria | 45384 |
| 228 | Ga0097621_100008450 | 3300006237 | Bacteria | 7417 |
| 229 | Ga0097621_100013072 | 3300006237 | Bacteria | 6173 |
| 230 | Ga0097621_100062601 | 3300006237 | Unclassified | 3055 |
| 231 | Ga0097621_100067320 | 3300006237 | Unclassified | 2952 |
| 232 | Ga0068871_100002078 | 3300006358 | Bacteria | 13539 |
| 233 | Ga0068871_100004602 | 3300006358 | Bacteria | 9627 |
| 234 | Ga0068871_100008550 | 3300006358 | Bacteria | 7357 |
| 235 | Ga0068871_100042168 | 3300006358 | Unclassified | 3662 |
| 236 | Ga0068871_100111340 | 3300006358 | Bacteria | 2303 |
| 237 | Ga0068871_100558475 | 3300006358 | Bacteria | 1037 |
| 238 | Ga0075434_100334330 | 3300006871 | Bacteria | 1535 |
| 239 | Ga0068865_100004341 | 3300006881 | Bacteria | 8557 |
| 240 | Ga0068865_100208063 | 3300006881 | Bacteria | 1523 |
| 241 | Ga0068865_100506559 | 3300006881 | Unclassified | 1007 |
| 242 | Ga0097620_100021048 | 3300006931 | Bacteria | 6545 |
| 243 | Ga0097620_100032818 | 3300006931 | Bacteria | 5216 |
| 244 | Ga0097620_100047525 | 3300006931 | Bacteria | 4312 |
| 245 | Ga0097620_100277184 | 3300006931 | Bacteria | 1769 |
| 246 | Ga0097620_100497611 | 3300006931 | Bacteria | 1314 |
| 247 | Ga0075435_100596107 | 3300007076 | Bacteria | 958 |
| 248 | Ga0105251_10221810 | 3300009011 | Unclassified | 851 |
| 249 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 250 | Ga0105240_10091298 | 3300009093 | Bacteria | 3721 |
| 251 | Ga0105240_10141802 | 3300009093 | Unclassified | 2872 |
| 252 | Ga0105240_10172116 | 3300009093 | Bacteria | 2563 |
| 253 | Ga0105240_10327262 | 3300009093 | Bacteria | 1745 |
| 254 | Ga0105240_10492096 | 3300009093 | Bacteria | 1365 |
| 255 | Ga0111539_10011540 | 3300009094 | Bacteria | 11086 |
| 256 | Ga0111539_11289095 | 3300009094 | Unclassified | 848 |
| 257 | Ga0105245_10105819 | 3300009098 | Bacteria | 2610 |
| 258 | Ga0105247_10103967 | 3300009101 | Unclassified | 1819 |
| 259 | Ga0105243_10000043 | 3300009148 | Bacteria | 158809 |
| 260 | Ga0105243_10000471 | 3300009148 | Bacteria | 41457 |
| 261 | Ga0105243_10254725 | 3300009148 | Bacteria | 1569 |
| 262 | Ga0105243_10360534 | 3300009148 | Bacteria | 1338 |
| 263 | Ga0105241_10097710 | 3300009174 | Unclassified | 2329 |
| 264 | Ga0105241_10591351 | 3300009174 | Unclassified | 1001 |
| 265 | Ga0105242_10002571 | 3300009176 | Bacteria | 14204 |
| 266 | Ga0105242_10033243 | 3300009176 | Bacteria | 4129 |
| 267 | Ga0105242_10160382 | 3300009176 | Bacteria | 1968 |
| 268 | Ga0105242_10320408 | 3300009176 | Unclassified | 1421 |
| 269 | Ga0105242_10786708 | 3300009176 | Unclassified | 940 |
| 270 | Ga0105248_10007403 | 3300009177 | Bacteria | 12044 |
| 271 | Ga0105248_10046955 | 3300009177 | Bacteria | 4842 |
| 272 | Ga0105248_10112484 | 3300009177 | Unclassified | 3070 |
| 273 | Ga0105248_10705530 | 3300009177 | Bacteria | 1138 |
| 274 | Ga0105248_10789651 | 3300009177 | Unclassified | 1072 |
| 275 | Ga0105237_10003065 | 3300009545 | Bacteria | 20154 |
| 276 | Ga0105237_10008005 | 3300009545 | Bacteria | 11503 |
| 277 | Ga0105237_10064235 | 3300009545 | Bacteria | 3667 |
| 278 | Ga0105238_10040835 | 3300009551 | Bacteria | 4700 |
| 279 | Ga0105238_10087548 | 3300009551 | Bacteria | 3102 |
| 280 | Ga0105249_10004261 | 3300009553 | Bacteria | 12362 |
| 281 | Ga0105249_10012725 | 3300009553 | Bacteria | 7415 |
| 282 | Ga0105249_10016984 | 3300009553 | Bacteria | 6456 |
| 283 | Ga0105249_10018030 | 3300009553 | Bacteria | 6275 |
| 284 | Ga0105249_10981098 | 3300009553 | Bacteria | 913 |
| 285 | Ga0105239_10007361 | 3300010375 | Bacteria | 12641 |
| 286 | Ga0105239_10027880 | 3300010375 | Bacteria | 6214 |
| 287 | Ga0105239_10093905 | 3300010375 | Bacteria | 3313 |
| 288 | Ga0105239_10226412 | 3300010375 | Bacteria | 2098 |
| 289 | Ga0105246_10054873 | 3300011119 | Bacteria | 2748 |
| 290 | Ga0105246_10318941 | 3300011119 | Unclassified | 1262 |
| 291 | Ga0105246_10352988 | 3300011119 | Bacteria | 1206 |
| 292 | Ga0157373_10045686 | 3300013100 | Bacteria | 3126 |
| 293 | Ga0157373_10093372 | 3300013100 | Bacteria | 2119 |
| 294 | Ga0157373_10144437 | 3300013100 | Bacteria | 1673 |
| 295 | Ga0157373_10259770 | 3300013100 | Bacteria | 1229 |
| 296 | Ga0157371_10001559 | 3300013102 | Bacteria | 23578 |
| 297 | Ga0157371_10041420 | 3300013102 | Bacteria | 3287 |
| 298 | Ga0157371_10072212 | 3300013102 | Bacteria | 2444 |
| 299 | Ga0157371_10223246 | 3300013102 | Bacteria | 1353 |
| 300 | Ga0157370_10002236 | 3300013104 | Bacteria | 23541 |
| 301 | Ga0157370_10002888 | 3300013104 | Bacteria | 20484 |
| 302 | Ga0157370_10091456 | 3300013104 | Bacteria | 2857 |
| 303 | Ga0157370_10103586 | 3300013104 | Bacteria | 2664 |
| 304 | Ga0157370_10124926 | 3300013104 | Bacteria | 2402 |
| 305 | Ga0157369_10003002 | 3300013105 | Bacteria | 20184 |
| 306 | Ga0157369_10058863 | 3300013105 | Bacteria | 4144 |
| 307 | Ga0157369_10069399 | 3300013105 | Bacteria | 3786 |
| 308 | Ga0157369_10116156 | 3300013105 | Bacteria | 2842 |
| 309 | Ga0157369_10202772 | 3300013105 | Bacteria | 2081 |
| 310 | Ga0157374_10000015 | 3300013296 | Bacteria | 296773 |
| 311 | Ga0157374_10000074 | 3300013296 | Bacteria | 99947 |
| 312 | Ga0157374_10012937 | 3300013296 | Bacteria | 7272 |
| 313 | Ga0157374_10014871 | 3300013296 | Bacteria | 6819 |
| 314 | Ga0157374_10017378 | 3300013296 | Bacteria | 6331 |
| 315 | Ga0157374_10029637 | 3300013296 | Bacteria | 4959 |
| 316 | Ga0157374_10142976 | 3300013296 | Bacteria | 2323 |
| 317 | Ga0157374_10163280 | 3300013296 | Bacteria | 2170 |
| 318 | Ga0157374_10548155 | 3300013296 | Bacteria | 1164 |
| 319 | Ga0157378_10005674 | 3300013297 | Bacteria | 10920 |
| 320 | Ga0157378_10009176 | 3300013297 | Bacteria | 8612 |
| 321 | Ga0157378_10013430 | 3300013297 | Bacteria | 7159 |
| 322 | Ga0157378_10029744 | 3300013297 | Bacteria | 4823 |
| 323 | Ga0157378_10075578 | 3300013297 | Bacteria | 3033 |
| 324 | Ga0157378_10198282 | 3300013297 | Unclassified | 1897 |
| 325 | Ga0157378_10245695 | 3300013297 | Unclassified | 1711 |
| 326 | Ga0157378_10580255 | 3300013297 | Bacteria | 1130 |
| 327 | Ga0157378_10731065 | 3300013297 | Bacteria | 1011 |
| 328 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 329 | Ga0163162_10000086 | 3300013306 | Bacteria | 85949 |
| 330 | Ga0163162_10004131 | 3300013306 | Bacteria | 13940 |
| 331 | Ga0163162_10004603 | 3300013306 | Bacteria | 13291 |
| 332 | Ga0163162_10197211 | 3300013306 | Unclassified | 2142 |
| 333 | Ga0163162_10355334 | 3300013306 | Unclassified | 1598 |
| 334 | Ga0163162_10620865 | 3300013306 | Unclassified | 1206 |
| 335 | Ga0163162_10807736 | 3300013306 | Bacteria | 1055 |
| 336 | Ga0157372_10070798 | 3300013307 | Bacteria | 3925 |
| 337 | Ga0157372_10106229 | 3300013307 | Bacteria | 3211 |
| 338 | Ga0157372_10139972 | 3300013307 | Bacteria | 2787 |
| 339 | Ga0157372_10597830 | 3300013307 | Bacteria | 1286 |
| 340 | Ga0157372_10802269 | 3300013307 | Bacteria | 1094 |
| 341 | Ga0157372_10923679 | 3300013307 | Bacteria | 1012 |
| 342 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 343 | Ga0157375_10000115 | 3300013308 | Bacteria | 77964 |
| 344 | Ga0157375_10000174 | 3300013308 | Bacteria | 59683 |
| 345 | Ga0157375_10078815 | 3300013308 | Bacteria | 3329 |
| 346 | Ga0157375_10118381 | 3300013308 | Unclassified | 2755 |
| 347 | Ga0157375_10181851 | 3300013308 | Bacteria | 2254 |
| 348 | Ga0157375_10208349 | 3300013308 | Unclassified | 2112 |
| 349 | Ga0157375_10305831 | 3300013308 | Unclassified | 1754 |
| 350 | Ga0157375_10454684 | 3300013308 | Bacteria | 1446 |
| 351 | Ga0157375_10798836 | 3300013308 | Unclassified | 1092 |
| 352 | Ga0157375_11464420 | 3300013308 | Bacteria | 805 |
| 353 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 354 | Ga0163163_10000174 | 3300014325 | Bacteria | 67568 |
| 355 | Ga0163163_10000244 | 3300014325 | Bacteria | 55634 |
| 356 | Ga0163163_10145144 | 3300014325 | Bacteria | 2416 |
| 357 | Ga0163163_10247930 | 3300014325 | Bacteria | 1831 |
| 358 | Ga0163163_10440651 | 3300014325 | Bacteria | 1362 |
| 359 | Ga0163163_10664681 | 3300014325 | Unclassified | 1105 |
| 360 | Ga0163163_10699592 | 3300014325 | Bacteria | 1077 |
| 361 | Ga0163163_11006258 | 3300014325 | Unclassified | 897 |
| 362 | Ga0157380_10000378 | 3300014326 | Bacteria | 26833 |
| 363 | Ga0157380_10006646 | 3300014326 | Bacteria | 8156 |
| 364 | Ga0157380_10040272 | 3300014326 | Bacteria | 3639 |
| 365 | Ga0157380_10081061 | 3300014326 | Bacteria | 2653 |
| 366 | Ga0157380_10093003 | 3300014326 | Bacteria | 2493 |
| 367 | Ga0157380_10187389 | 3300014326 | Unclassified | 1823 |
| 368 | Ga0157380_10378584 | 3300014326 | Bacteria | 1335 |
| 369 | Ga0157380_10828521 | 3300014326 | Unclassified | 945 |
| 370 | Ga0182008_10000016 | 3300014497 | Bacteria | 241246 |
| 371 | Ga0157377_10012000 | 3300014745 | Bacteria | 4345 |
| 372 | Ga0157377_10014162 | 3300014745 | Bacteria | 4053 |
| 373 | Ga0157377_10021205 | 3300014745 | Bacteria | 3416 |
| 374 | Ga0157379_10000080 | 3300014968 | Bacteria | 63139 |
| 375 | Ga0157379_10013554 | 3300014968 | Bacteria | 7144 |
| 376 | Ga0157379_10057820 | 3300014968 | Bacteria | 3466 |
| 377 | Ga0157379_10188762 | 3300014968 | Bacteria | 1863 |
| 378 | Ga0157376_10000429 | 3300014969 | Bacteria | 27200 |
| 379 | Ga0157376_10000521 | 3300014969 | Bacteria | 24829 |
| 380 | Ga0157376_10029340 | 3300014969 | Bacteria | 4381 |
| 381 | Ga0157376_10141024 | 3300014969 | Unclassified | 2162 |
| 382 | Ga0157376_10190638 | 3300014969 | Bacteria | 1880 |
| 383 | Ga0157376_10307915 | 3300014969 | Bacteria | 1502 |
| 384 | Ga0157376_10460497 | 3300014969 | Bacteria | 1242 |
| 385 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 386 | Ga0163161_10000888 | 3300017792 | Bacteria | 23222 |
| 387 | Ga0163161_10001507 | 3300017792 | Bacteria | 17223 |
| 388 | Ga0163161_10003749 | 3300017792 | Bacteria | 10646 |
| 389 | Ga0163161_10008155 | 3300017792 | Bacteria | 7243 |
| 390 | Ga0163161_10009144 | 3300017792 | Bacteria | 6848 |
| 391 | Ga0163161_10038599 | 3300017792 | Bacteria | 3426 |
| 392 | Ga0163161_10141137 | 3300017792 | Unclassified | 1824 |
| 393 | Ga0163161_10144238 | 3300017792 | Bacteria | 1805 |
| 394 | Ga0163161_10177114 | 3300017792 | Bacteria | 1633 |
| 395 | Ga0163161_10289236 | 3300017792 | Bacteria | 1288 |
| 396 | Ga0213876_10001099 | 3300021384 | Bacteria | 17320 |
| 397 | Ga0213876_10049238 | 3300021384 | Unclassified | 2226 |
| 398 | Ga0209436_100993 | 3300025208 | Bacteria | 10936 |
| 399 | Ga0209436_103150 | 3300025208 | Bacteria | 4524 |
| 400 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 401 | Ga0209148_1000223 | 3300025254 | Bacteria | 93490 |
| 402 | Ga0209130_1000921 | 3300025284 | Bacteria | 23640 |
| 403 | Ga0209675_1000077 | 3300025291 | Bacteria | 156212 |
| 404 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 405 | Ga0207426_1000660 | 3300025302 | Bacteria | 42245 |
| 406 | Ga0209257_1000128 | 3300025304 | Bacteria | 214268 |
| 407 | Ga0207697_10049958 | 3300025315 | Bacteria | 1726 |
| 408 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 409 | Ga0207682_10191120 | 3300025893 | Unclassified | 938 |
| 410 | Ga0207642_10025259 | 3300025899 | Unclassified | 2400 |
| 411 | Ga0207642_10305716 | 3300025899 | Bacteria | 924 |
| 412 | Ga0207680_10000657 | 3300025903 | Bacteria | 16337 |
| 413 | Ga0207680_10308407 | 3300025903 | Unclassified | 1104 |
| 414 | Ga0207647_10004968 | 3300025904 | Bacteria | 9804 |
| 415 | Ga0207647_10051468 | 3300025904 | Bacteria | 2545 |
| 416 | Ga0207647_10094133 | 3300025904 | Bacteria | 1785 |
| 417 | Ga0207645_10002924 | 3300025907 | Bacteria | 13200 |
| 418 | Ga0207645_10016615 | 3300025907 | Bacteria | 4869 |
| 419 | Ga0207645_10027548 | 3300025907 | Bacteria | 3668 |
| 420 | Ga0207645_10134884 | 3300025907 | Unclassified | 1607 |
| 421 | Ga0207643_10006094 | 3300025908 | Bacteria | 6446 |
| 422 | Ga0207705_10001116 | 3300025909 | Bacteria | 21828 |
| 423 | Ga0207705_10564271 | 3300025909 | Unclassified | 885 |
| 424 | Ga0207707_10069257 | 3300025912 | Bacteria | 3075 |
| 425 | Ga0207695_10000102 | 3300025913 | Bacteria | 257838 |
| 426 | Ga0207695_10029925 | 3300025913 | Bacteria | 6006 |
| 427 | Ga0207695_10130932 | 3300025913 | Unclassified | 2466 |
| 428 | Ga0207671_10000468 | 3300025914 | Bacteria | 55019 |
| 429 | Ga0207671_10033270 | 3300025914 | Bacteria | 3836 |
| 430 | Ga0207671_10068007 | 3300025914 | Bacteria | 2654 |
| 431 | Ga0207660_10633999 | 3300025917 | Bacteria | 871 |
| 432 | Ga0207662_10025036 | 3300025918 | Bacteria | 3436 |
| 433 | Ga0207662_10116436 | 3300025918 | Bacteria | 1671 |
| 434 | Ga0207657_10015786 | 3300025919 | Bacteria | 7300 |
| 435 | Ga0207657_10124646 | 3300025919 | Unclassified | 2117 |
| 436 | Ga0207657_10247420 | 3300025919 | Bacteria | 1422 |
| 437 | Ga0207649_10055435 | 3300025920 | Bacteria | 2471 |
| 438 | Ga0207649_10147537 | 3300025920 | Unclassified | 1616 |
| 439 | Ga0207652_10491483 | 3300025921 | Bacteria | 1105 |
| 440 | Ga0207681_10039258 | 3300025923 | Bacteria | 3142 |
| 441 | Ga0207681_10192606 | 3300025923 | Unclassified | 1561 |
| 442 | Ga0207681_10448642 | 3300025923 | Unclassified | 1049 |
| 443 | Ga0207694_10279482 | 3300025924 | Bacteria | 1371 |
| 444 | Ga0207694_10738189 | 3300025924 | Bacteria | 831 |
| 445 | Ga0207650_10018943 | 3300025925 | Bacteria | 4836 |
| 446 | Ga0207650_10125668 | 3300025925 | Bacteria | 2002 |
| 447 | Ga0207650_10150508 | 3300025925 | Bacteria | 1836 |
| 448 | Ga0207650_10407797 | 3300025925 | Bacteria | 1126 |
| 449 | Ga0207650_10583021 | 3300025925 | Bacteria | 939 |
| 450 | Ga0207659_10020002 | 3300025926 | Bacteria | 4417 |
| 451 | Ga0207659_10454406 | 3300025926 | Unclassified | 1079 |
| 452 | Ga0207687_10127317 | 3300025927 | Bacteria | 1914 |
| 453 | Ga0207644_10107109 | 3300025931 | Unclassified | 2108 |
| 454 | Ga0207644_10441847 | 3300025931 | Bacteria | 1068 |
| 455 | Ga0207690_10051840 | 3300025932 | Bacteria | 2746 |
| 456 | Ga0207690_10166548 | 3300025932 | Bacteria | 1647 |
| 457 | Ga0207706_10008032 | 3300025933 | Bacteria | 9738 |
| 458 | Ga0207706_10010943 | 3300025933 | Bacteria | 8274 |
| 459 | Ga0207706_10012549 | 3300025933 | Bacteria | 7716 |
| 460 | Ga0207706_10013744 | 3300025933 | Bacteria | 7347 |
| 461 | Ga0207706_10070196 | 3300025933 | Bacteria | 3081 |
| 462 | Ga0207706_10075734 | 3300025933 | Unclassified | 2960 |
| 463 | Ga0207686_10011930 | 3300025934 | Bacteria | 4769 |
| 464 | Ga0207686_10018560 | 3300025934 | Bacteria | 3941 |
| 465 | Ga0207686_10405055 | 3300025934 | Unclassified | 1040 |
| 466 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 467 | Ga0207709_10000161 | 3300025935 | Bacteria | 91314 |
| 468 | Ga0207670_10012853 | 3300025936 | Bacteria | 4914 |
| 469 | Ga0207670_10072521 | 3300025936 | Bacteria | 2384 |
| 470 | Ga0207670_10166974 | 3300025936 | Bacteria | 1647 |
| 471 | Ga0207670_10433465 | 3300025936 | Bacteria | 1057 |
| 472 | Ga0207670_10459536 | 3300025936 | Unclassified | 1028 |
| 473 | Ga0207669_10065247 | 3300025937 | Unclassified | 2258 |
| 474 | Ga0207704_10007511 | 3300025938 | Bacteria | 5155 |
| 475 | Ga0207704_10055534 | 3300025938 | Unclassified | 2421 |
| 476 | Ga0207704_10684314 | 3300025938 | Bacteria | 848 |
| 477 | Ga0207704_10897420 | 3300025938 | Bacteria | 745 |
| 478 | Ga0207665_10153835 | 3300025939 | Bacteria | 1649 |
| 479 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 480 | Ga0207691_10035545 | 3300025940 | Bacteria | 4623 |
| 481 | Ga0207691_10090583 | 3300025940 | Bacteria | 2741 |
| 482 | Ga0207691_10136519 | 3300025940 | Bacteria | 2163 |
| 483 | Ga0207691_10419484 | 3300025940 | Bacteria | 1140 |
| 484 | Ga0207711_10257699 | 3300025941 | Unclassified | 1602 |
| 485 | Ga0207689_10007281 | 3300025942 | Bacteria | 9713 |
| 486 | Ga0207689_10011219 | 3300025942 | Bacteria | 7689 |
| 487 | Ga0207689_10016209 | 3300025942 | Bacteria | 6312 |
| 488 | Ga0207689_10030376 | 3300025942 | Bacteria | 4503 |
| 489 | Ga0207689_10088090 | 3300025942 | Unclassified | 2550 |
| 490 | Ga0207689_10170321 | 3300025942 | Bacteria | 1795 |
| 491 | Ga0207661_10001545 | 3300025944 | Bacteria | 15653 |
| 492 | Ga0207661_10004190 | 3300025944 | Bacteria | 10090 |
| 493 | Ga0207661_10042201 | 3300025944 | Bacteria | 3596 |
| 494 | Ga0207661_10057427 | 3300025944 | Unclassified | 3129 |
| 495 | Ga0207661_10134542 | 3300025944 | Unclassified | 2122 |
| 496 | Ga0207679_10001022 | 3300025945 | Bacteria | 17875 |
| 497 | Ga0207679_10005167 | 3300025945 | Bacteria | 8174 |
| 498 | Ga0207679_10011099 | 3300025945 | Bacteria | 5817 |
| 499 | Ga0207679_10021679 | 3300025945 | Unclassified | 4361 |
| 500 | Ga0207679_10080698 | 3300025945 | Bacteria | 2484 |
| 501 | Ga0207679_10096051 | 3300025945 | Bacteria | 2305 |
| 502 | Ga0207679_10530757 | 3300025945 | Unclassified | 1054 |
| 503 | Ga0207667_10027774 | 3300025949 | Bacteria | 6155 |
| 504 | Ga0207667_10030844 | 3300025949 | Bacteria | 5794 |
| 505 | Ga0207667_10710302 | 3300025949 | Bacteria | 1007 |
| 506 | Ga0207651_10001790 | 3300025960 | Bacteria | 9986 |
| 507 | Ga0207651_10099712 | 3300025960 | Bacteria | 2152 |
| 508 | Ga0207651_10318984 | 3300025960 | Bacteria | 1298 |
| 509 | Ga0207651_10448637 | 3300025960 | Bacteria | 1106 |
| 510 | Ga0207651_10769714 | 3300025960 | Unclassified | 852 |
| 511 | Ga0207712_10007623 | 3300025961 | Bacteria | 6841 |
| 512 | Ga0207712_10012756 | 3300025961 | Bacteria | 5373 |
| 513 | Ga0207712_10013338 | 3300025961 | Bacteria | 5267 |
| 514 | Ga0207712_10140974 | 3300025961 | Unclassified | 1850 |
| 515 | Ga0207712_10261826 | 3300025961 | Unclassified | 1403 |
| 516 | Ga0207712_10673409 | 3300025961 | Bacteria | 901 |
| 517 | Ga0207668_10001201 | 3300025972 | Bacteria | 15384 |
| 518 | Ga0207668_10097826 | 3300025972 | Bacteria | 2173 |
| 519 | Ga0207668_10110395 | 3300025972 | Bacteria | 2062 |
| 520 | Ga0207668_10194964 | 3300025972 | Bacteria | 1609 |
| 521 | Ga0207640_10065684 | 3300025981 | Bacteria | 2421 |
| 522 | Ga0207640_10106514 | 3300025981 | Bacteria | 1978 |
| 523 | Ga0207640_10257043 | 3300025981 | Bacteria | 1359 |
| 524 | Ga0207640_10627914 | 3300025981 | Bacteria | 913 |
| 525 | Ga0207658_10000059 | 3300025986 | Bacteria | 121530 |
| 526 | Ga0207658_10005894 | 3300025986 | Bacteria | 8373 |
| 527 | Ga0207658_10050997 | 3300025986 | Unclassified | 3048 |
| 528 | Ga0207658_10313673 | 3300025986 | Unclassified | 1355 |
| 529 | Ga0207677_10002598 | 3300026023 | Bacteria | 9495 |
| 530 | Ga0207677_10021177 | 3300026023 | Bacteria | 3966 |
| 531 | Ga0207677_10054179 | 3300026023 | Unclassified | 2735 |
| 532 | Ga0207677_10131600 | 3300026023 | Unclassified | 1900 |
| 533 | Ga0207677_10277844 | 3300026023 | Bacteria | 1373 |
| 534 | Ga0207703_10003800 | 3300026035 | Bacteria | 12542 |
| 535 | Ga0207703_10088458 | 3300026035 | Unclassified | 2600 |
| 536 | Ga0207703_10158786 | 3300026035 | Unclassified | 1979 |
| 537 | Ga0207703_10617325 | 3300026035 | Unclassified | 1026 |
| 538 | Ga0207703_10784318 | 3300026035 | Unclassified | 909 |
| 539 | Ga0207639_10009648 | 3300026041 | Bacteria | 6668 |
| 540 | Ga0207639_10034590 | 3300026041 | Bacteria | 3735 |
| 541 | Ga0207639_10062364 | 3300026041 | Bacteria | 2882 |
| 542 | Ga0207639_10062961 | 3300026041 | Bacteria | 2870 |
| 543 | Ga0207639_10299287 | 3300026041 | Bacteria | 1421 |
| 544 | Ga0207678_10120280 | 3300026067 | Bacteria | 2241 |
| 545 | Ga0207641_10000416 | 3300026088 | Bacteria | 49757 |
| 546 | Ga0207641_10002750 | 3300026088 | Bacteria | 16046 |
| 547 | Ga0207641_10096221 | 3300026088 | Unclassified | 2600 |
| 548 | Ga0207641_10309349 | 3300026088 | Unclassified | 1495 |
| 549 | Ga0207641_10346500 | 3300026088 | Bacteria | 1415 |
| 550 | Ga0207641_10853016 | 3300026088 | Bacteria | 903 |
| 551 | Ga0207641_10916999 | 3300026088 | Unclassified | 870 |
| 552 | Ga0207648_10007533 | 3300026089 | Bacteria | 10684 |
| 553 | Ga0207648_10025200 | 3300026089 | Bacteria | 5302 |
| 554 | Ga0207648_10026318 | 3300026089 | Bacteria | 5171 |
| 555 | Ga0207648_10027541 | 3300026089 | Bacteria | 5045 |
| 556 | Ga0207648_10062661 | 3300026089 | Unclassified | 3241 |
| 557 | Ga0207648_10112573 | 3300026089 | Unclassified | 2390 |
| 558 | Ga0207648_10187170 | 3300026089 | Bacteria | 1834 |
| 559 | Ga0207648_10269578 | 3300026089 | Unclassified | 1521 |
| 560 | Ga0207648_10312426 | 3300026089 | Bacteria | 1411 |
| 561 | Ga0207676_10002009 | 3300026095 | Bacteria | 14820 |
| 562 | Ga0207676_10005115 | 3300026095 | Bacteria | 9285 |
| 563 | Ga0207676_10006355 | 3300026095 | Bacteria | 8347 |
| 564 | Ga0207676_10020266 | 3300026095 | Unclassified | 4863 |
| 565 | Ga0207676_10077769 | 3300026095 | Unclassified | 2685 |
| 566 | Ga0207676_10126836 | 3300026095 | Bacteria | 2163 |
| 567 | Ga0207676_10180756 | 3300026095 | Bacteria | 1847 |
| 568 | Ga0207676_10633249 | 3300026095 | Unclassified | 1030 |
| 569 | Ga0207674_10002088 | 3300026116 | Bacteria | 25283 |
| 570 | Ga0207674_10005225 | 3300026116 | Bacteria | 15451 |
| 571 | Ga0207674_10040453 | 3300026116 | Bacteria | 4828 |
| 572 | Ga0207674_10054338 | 3300026116 | Bacteria | 4077 |
| 573 | Ga0207674_10146288 | 3300026116 | Bacteria | 2322 |
| 574 | Ga0207674_10296804 | 3300026116 | Bacteria | 1565 |
| 575 | Ga0207675_100005095 | 3300026118 | Bacteria | 12643 |
| 576 | Ga0207675_100090596 | 3300026118 | Unclassified | 2875 |
| 577 | Ga0207675_100094080 | 3300026118 | Bacteria | 2819 |
| 578 | Ga0207675_100748370 | 3300026118 | Bacteria | 988 |
| 579 | Ga0207675_101264295 | 3300026118 | Bacteria | 758 |
| 580 | Ga0207683_10037634 | 3300026121 | Unclassified | 4214 |
| 581 | Ga0207683_10046789 | 3300026121 | Bacteria | 3787 |
| 582 | Ga0207683_10100558 | 3300026121 | Bacteria | 2581 |
| 583 | Ga0207683_10863981 | 3300026121 | Bacteria | 840 |
| 584 | Ga0207683_11104728 | 3300026121 | Bacteria | 736 |
| 585 | Ga0207698_10010669 | 3300026142 | Bacteria | 5922 |
| 586 | Ga0207698_10071522 | 3300026142 | Unclassified | 2753 |
| 587 | Ga0207698_10170744 | 3300026142 | Bacteria | 1914 |
| 588 | Ga0207698_10356392 | 3300026142 | Bacteria | 1384 |
| 589 | Ga0207698_10501130 | 3300026142 | Bacteria | 1182 |
| 590 | Ga0207698_10700201 | 3300026142 | Bacteria | 1008 |
| 591 | Ga0207698_11014294 | 3300026142 | Bacteria | 841 |
| 592 | Ga0207428_10112757 | 3300027907 | Bacteria | 2091 |
| 593 | Ga0207428_10410913 | 3300027907 | Bacteria | 990 |
| 594 | Ga0268266_10006335 | 3300028379 | Bacteria | 10848 |
| 595 | Ga0268265_10094979 | 3300028380 | Bacteria | 2393 |
| 596 | Ga0268264_10006876 | 3300028381 | Bacteria | 9546 |
| 597 | Ga0268264_10015827 | 3300028381 | Bacteria | 6176 |
| 598 | Ga0268264_10035714 | 3300028381 | Bacteria | 4092 |
| 599 | Ga0268264_10247792 | 3300028381 | Bacteria | 1653 |
| 600 | Ga0268264_10250648 | 3300028381 | Unclassified | 1645 |
| 601 | Ga0268264_10408330 | 3300028381 | Bacteria | 1307 |
| 602 | Ga0268264_10727426 | 3300028381 | Bacteria | 987 |
| 603 | Ga0265318_10035597 | 3300028577 | Bacteria | 1913 |
| 604 | Ga0265318_10045050 | 3300028577 | Unclassified | 1668 |
| 605 | Ga0265323_10069694 | 3300028653 | Bacteria | 1205 |
| 606 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 607 | Ga0307515_10131954 | 3300028794 | Bacteria | 2744 |
| 608 | Ga0307515_10140321 | 3300028794 | Bacteria | 2597 |
| 609 | Ga0316183_1026574 | 3300030742 | Bacteria | 1102 |
| 610 | Ga0265329_10023836 | 3300031242 | Unclassified | 2035 |
| 611 | Ga0265331_10013215 | 3300031250 | Unclassified | 4446 |
| 612 | Ga0265327_10000338 | 3300031251 | Bacteria | 88898 |
| 613 | Ga0265327_10018384 | 3300031251 | Unclassified | 4336 |
| 614 | Ga0265327_10043261 | 3300031251 | Bacteria | 2411 |
| 615 | Ga0265327_10112822 | 3300031251 | Bacteria | 1297 |
| 616 | Ga0265316_10505380 | 3300031344 | Unclassified | 863 |
| 617 | Ga0307513_10352768 | 3300031456 | Unclassified | 1218 |
| 618 | Ga0307509_10034214 | 3300031507 | Bacteria | 5583 |
| 619 | Ga0307509_10082146 | 3300031507 | Bacteria | 3325 |
| 620 | Ga0307509_10111461 | 3300031507 | Bacteria | 2739 |
| 621 | Ga0307509_10305470 | 3300031507 | Bacteria | 1336 |
| 622 | Ga0307408_100000170 | 3300031548 | Bacteria | 73350 |
| 623 | Ga0307408_100000517 | 3300031548 | Bacteria | 33313 |
| 624 | Ga0307508_10001710 | 3300031616 | Bacteria | 24355 |
| 625 | Ga0265314_10018173 | 3300031711 | Bacteria | 5490 |
| 626 | Ga0316576_10092644 | 3300031727 | Bacteria | 2252 |
| 627 | Ga0316576_10104670 | 3300031727 | Bacteria | 2118 |
| 628 | Ga0307516_10000665 | 3300031730 | Bacteria | 46476 |
| 629 | Ga0307412_10000096 | 3300031911 | Bacteria | 74069 |
| 630 | Ga0307412_10000389 | 3300031911 | Bacteria | 27301 |
| 631 | Ga0307412_10007996 | 3300031911 | Bacteria | 6029 |
| 632 | Ga0307412_10053581 | 3300031911 | Bacteria | 2674 |
| 633 | Ga0307416_100000013 | 3300032002 | Bacteria | 283585 |
| 634 | Ga0307414_10000004 | 3300032004 | Bacteria | 472218 |
| 635 | Ga0307414_10134392 | 3300032004 | Bacteria | 1926 |
| 636 | Ga0307414_10614900 | 3300032004 | Bacteria | 976 |
| 637 | Ga0307411_10014850 | 3300032005 | Bacteria | 4350 |
| 638 | Ga0307507_10044361 | 3300033179 | Bacteria | 4397 |
| 639 | Ga0373923_0023938 | 3300035111 | Bacteria | 2407 |
| 640 | Ga0373943_0203036 | 3300035170 | Bacteria | 1098 |
| 641 | Ga0373955_0002985 | 3300035172 | Bacteria | 7415 |
| 642 | Ga0373935_0399189 | 3300035692 | Bacteria | 987 |
| 643 | Ga0373933_0033852 | 3300035724 | Bacteria | 2975 |
| 644 | Ga0373933_0262603 | 3300035724 | Bacteria | 1113 |
| 645 | Ga0373937_0119669 | 3300036401 | Bacteria | 2454 |
| 646 | Ga0373937_0127172 | 3300036401 | Bacteria | 2378 |
| 647 | Ga0373937_0214646 | 3300036401 | Bacteria | 1811 |
| 648 | Ga0373925_0307908 | 3300037068 | Bacteria | 1280 |
| 649 | Ga0436365_0504388 | 3300039437 | Bacteria | 1113 |
| 650 | Ga0436365_0701023 | 3300039437 | Bacteria | 3129 |
| 651 | Ga0436365_0888373 | 3300039437 | Bacteria | 6515 |
| 652 | Ga0436365_1207402 | 3300039437 | Bacteria | 4528 |
| 653 | Ga0436365_1285242 | 3300039437 | Bacteria | 1861 |
| 654 | Ga0436365_1591745 | 3300039437 | Bacteria | 18185 |
| 655 | Ga0439436_0005435 | 3300041404 | Bacteria | 3903 |
| 656 | Ga0439439_0027259 | 3300041406 | Bacteria | 1443 |
| 657 | Ga0451807_2281288 | 3300041486 | Bacteria | 1917 |
| 658 | Ga0451839_0948395 | 3300041496 | Bacteria | 1243 |
| 659 | Ga0451855_1570704 | 3300041511 | Bacteria | 1613 |
| 660 | Ga0439445_0000575 | 3300042004 | Bacteria | 7509 |
| 661 | Ga0439457_003008 | 3300042014 | Bacteria | 4684 |
| 662 | Ga0439462_0004845 | 3300042015 | Bacteria | 3301 |
| 663 | Ga0439434_0112614 | 3300042435 | Unclassified | 882 |
| 664 | Ga0451577_0000279 | 3300042876 | Bacteria | 99236 |
| 665 | Ga0451577_0014708 | 3300042876 | Bacteria | 7290 |
| 666 | Ga0451577_0029042 | 3300042876 | Bacteria | 5000 |
| 667 | Ga0451577_0076278 | 3300042876 | Bacteria | 2989 |
| 668 | Ga0451577_0164192 | 3300042876 | Bacteria | 2001 |
| 669 | Ga0451577_0207196 | 3300042876 | Bacteria | 1771 |
| 670 | Ga0451577_0265742 | 3300042876 | Bacteria | 1553 |
| 671 | Ga0451577_0321281 | 3300042876 | Unclassified | 1404 |
| 672 | Ga0451577_0335192 | 3300042876 | Bacteria | 1372 |
| 673 | Ga0451577_0515992 | 3300042876 | Bacteria | 1085 |
| 674 | Ga0466969_0000152 | 3300044656 | Bacteria | 37627 |
| 675 | Ga0466969_0136195 | 3300044656 | Bacteria | 1137 |
| 676 | Ga0466972_0010553 | 3300044658 | Bacteria | 4636 |
| 677 | Ga0453683_0000031 | 3300044673 | Bacteria | 241998 |
| 678 | Ga0453683_0000190 | 3300044673 | Bacteria | 85362 |
| 679 | Ga0453683_0000238 | 3300044673 | Bacteria | 73041 |
| 680 | Ga0453683_0001799 | 3300044673 | Bacteria | 17704 |
| 681 | Ga0453683_0014745 | 3300044673 | Bacteria | 5071 |
| 682 | Ga0453683_0019154 | 3300044673 | Unclassified | 4384 |
| 683 | Ga0453683_0105006 | 3300044673 | Bacteria | 1774 |
| 684 | Ga0453683_0354738 | 3300044673 | Bacteria | 942 |
| 685 | Ga0466966_0000567 | 3300044684 | Bacteria | 23584 |
| 686 | Ga0466961_0430216 | 3300044693 | Bacteria | 799 |
| 687 | Ga0466964_0058152 | 3300044706 | Bacteria | 1602 |
| 688 | Ga0453684_0000161 | 3300044712 | Bacteria | 298175 |
| 689 | Ga0453684_0000213 | 3300044712 | Bacteria | 253663 |
| 690 | Ga0453684_0000225 | 3300044712 | Bacteria | 245902 |
| 691 | Ga0453684_0000929 | 3300044712 | Bacteria | 96874 |
| 692 | Ga0453684_0001226 | 3300044712 | Bacteria | 78620 |
| 693 | Ga0453684_0002475 | 3300044712 | Bacteria | 44641 |
| 694 | Ga0453684_0007656 | 3300044712 | Bacteria | 19769 |
| 695 | Ga0453684_0011479 | 3300044712 | Bacteria | 14838 |
| 696 | Ga0453684_0041744 | 3300044712 | Bacteria | 6196 |
| 697 | Ga0453684_0051343 | 3300044712 | Bacteria | 5407 |
| 698 | Ga0453684_0089052 | 3300044712 | Unclassified | 3819 |
| 699 | Ga0453684_0091408 | 3300044712 | Bacteria | 3757 |
| 700 | Ga0453684_0098471 | 3300044712 | Bacteria | 3585 |
| 701 | Ga0453684_0188039 | 3300044712 | Bacteria | 2418 |
| 702 | Ga0453684_0343859 | 3300044712 | Bacteria | 1684 |
| 703 | Ga0453684_0558655 | 3300044712 | Unclassified | 1260 |
| 704 | Ga0466971_0117009 | 3300044719 | Bacteria | 1232 |
| 705 | Ga0466968_0102946 | 3300044735 | Bacteria | 1276 |
| 706 | Ga0466968_0192069 | 3300044735 | Unclassified | 953 |
| 707 | Ga0466970_0107980 | 3300044765 | Bacteria | 1519 |
| 708 | Ga0466957_0005078 | 3300044842 | Bacteria | 7363 |
| 709 | Ga0466960_0427038 | 3300044901 | Bacteria | 767 |
| 710 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 711 | Ga0451576_0000012 | 3300045051 | Bacteria | 674684 |
| 712 | Ga0451576_0000059 | 3300045051 | Bacteria | 296795 |
| 713 | Ga0451576_0000414 | 3300045051 | Bacteria | 99196 |
| 714 | Ga0451576_0000729 | 3300045051 | Bacteria | 66020 |
| 715 | Ga0451576_0000948 | 3300045051 | Bacteria | 54439 |
| 716 | Ga0451576_0011923 | 3300045051 | Bacteria | 9829 |
| 717 | Ga0451576_0017125 | 3300045051 | Bacteria | 7971 |
| 718 | Ga0451576_0020992 | 3300045051 | Bacteria | 7105 |
| 719 | Ga0451576_0191966 | 3300045051 | Unclassified | 2133 |
| 720 | Ga0451576_0238236 | 3300045051 | Bacteria | 1900 |
| 721 | Ga0451576_0811336 | 3300045051 | Bacteria | 982 |
| 722 | Ga0495627_000219 | 3300046453 | Bacteria | 61845 |
| 723 | Ga0495627_027208 | 3300046453 | Bacteria | 1837 |
| 724 | Ga0495592_0079131 | 3300046454 | Bacteria | 2380 |
| 725 | Ga0495590_0001941 | 3300046457 | Bacteria | 8740 |
| 726 | Ga0495629_0028307 | 3300046459 | Bacteria | 3979 |
| 727 | Ga0495638_0085224 | 3300046460 | Bacteria | 1911 |
| 728 | Ga0495651_0537990 | 3300046462 | Unclassified | 744 |
| 729 | Ga0495653_0045247 | 3300046463 | Bacteria | 3413 |
| 730 | Ga0495605_0071591 | 3300046474 | Bacteria | 1637 |
| 731 | Ga0495596_0000647 | 3300046500 | Bacteria | 21867 |
| 732 | Ga0495606_0002853 | 3300046507 | Bacteria | 19146 |
| 733 | Ga0495606_0010801 | 3300046507 | Bacteria | 7524 |
| 734 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 735 | Ga0495618_0033387 | 3300046514 | Bacteria | 3227 |
| 736 | Ga0495628_0008008 | 3300046516 | Bacteria | 9106 |
| 737 | Ga0495630_0007375 | 3300046517 | Bacteria | 7856 |
| 738 | Ga0495632_0000601 | 3300046519 | Bacteria | 33346 |
| 739 | Ga0495643_0035860 | 3300046522 | Bacteria | 2729 |
| 740 | Ga0495643_0078851 | 3300046522 | Bacteria | 1718 |
| 741 | Ga0495648_0005568 | 3300046524 | Bacteria | 10448 |
| 742 | Ga0495663_0000105 | 3300046525 | Bacteria | 34550 |
| 743 | Ga0495663_0005212 | 3300046525 | Bacteria | 3619 |
| 744 | Ga0495652_0120404 | 3300046529 | Unclassified | 2095 |
| 745 | Ga0495654_0000006 | 3300046530 | Bacteria | 451432 |
| 746 | Ga0495665_0082512 | 3300046531 | Bacteria | 1690 |
| 747 | Ga0495640_0150605 | 3300046533 | Bacteria | 1495 |
| 748 | Ga0495640_0164852 | 3300046533 | Bacteria | 1418 |
| 749 | Ga0495587_0006727 | 3300046536 | Bacteria | 7486 |
| 750 | Ga0495587_0114052 | 3300046536 | Bacteria | 1551 |
| 751 | Ga0495598_0009457 | 3300046537 | Unclassified | 2305 |
| 752 | Ga0495609_0000017 | 3300046538 | Bacteria | 306684 |
| 753 | Ga0495621_0021996 | 3300046539 | Bacteria | 2109 |
| 754 | Ga0495621_0033075 | 3300046539 | Bacteria | 1781 |
| 755 | Ga0495621_0111701 | 3300046539 | Bacteria | 1049 |
| 756 | Ga0495633_0000037 | 3300046558 | Bacteria | 184006 |
| 757 | Ga0495633_0002549 | 3300046558 | Bacteria | 12789 |
| 758 | Ga0495668_0008836 | 3300046616 | Bacteria | 6243 |
| 759 | Ga0495634_0027915 | 3300046642 | Bacteria | 3923 |
| 760 | Ga0495611_0057401 | 3300046648 | Bacteria | 1764 |
| 761 | Ga0495625_0001048 | 3300046660 | Bacteria | 36295 |
| 762 | Ga0495625_0232174 | 3300046660 | Bacteria | 1204 |
| 763 | Ga0495661_0003215 | 3300046665 | Bacteria | 12199 |
| 764 | Ga0495599_0158960 | 3300046678 | Bacteria | 1397 |
| 765 | Ga0495658_0209545 | 3300046683 | Bacteria | 1217 |
| 766 | Ga0495613_0106828 | 3300046689 | Bacteria | 2020 |
| 767 | Ga0495600_0023886 | 3300046809 | Bacteria | 3934 |
| 768 | Ga0495604_0104009 | 3300047317 | Bacteria | 2082 |
| 769 | Ga0495674_0042827 | 3300047319 | Bacteria | 4035 |
| 770 | Ga0495674_0184469 | 3300047319 | Unclassified | 1736 |
| 771 | Ga0495675_0400516 | 3300047444 | Bacteria | 800 |
| 772 | Ga0495684_0062929 | 3300047471 | Bacteria | 2822 |
| 773 | Ga0495686_0000414 | 3300047472 | Bacteria | 67712 |
| 774 | Ga0495686_0006673 | 3300047472 | Bacteria | 8787 |
| 775 | Ga0496100_0085564 | 3300048903 | Unclassified | 2140 |
| 776 | Ga0496102_0007137 | 3300048905 | Bacteria | 9541 |
| 777 | Ga0496106_0193839 | 3300048909 | Bacteria | 1616 |
| 778 | Ga0496107_0279946 | 3300048910 | Unclassified | 1242 |
| 779 | Ga0496107_0765422 | 3300048910 | Bacteria | 708 |
| 780 | Ga0496109_0017189 | 3300048912 | Bacteria | 6335 |
| 781 | Ga0496114_0115964 | 3300048917 | Unclassified | 2299 |
| 782 | Ga0496115_0074175 | 3300048918 | Bacteria | 2763 |
| 783 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 784 | Ga0496116_0046869 | 3300048919 | Bacteria | 2914 |
| 785 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 786 | Ga0496117_0002735 | 3300048920 | Bacteria | 21646 |
| 787 | Ga0496118_0000141 | 3300048921 | Bacteria | 126552 |
| 788 | Ga0496118_0139503 | 3300048921 | Bacteria | 1540 |
| 789 | Ga0496118_0305931 | 3300048921 | Bacteria | 870 |
| 790 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 791 | Ga0496120_0069333 | 3300048923 | Bacteria | 1942 |
| 792 | Ga0496122_0000229 | 3300048925 | Bacteria | 125600 |
| 793 | Ga0496122_0000397 | 3300048925 | Bacteria | 92511 |
| 794 | Ga0496122_0002499 | 3300048925 | Bacteria | 25974 |
| 795 | Ga0496122_0004955 | 3300048925 | Bacteria | 16134 |
| 796 | Ga0496123_0003892 | 3300048926 | Bacteria | 16242 |
| 797 | Ga0496123_0006136 | 3300048926 | Bacteria | 11783 |
| 798 | Ga0496123_0006638 | 3300048926 | Bacteria | 11163 |
| 799 | Ga0496124_0113677 | 3300048927 | Bacteria | 2175 |
| 800 | Ga0496124_0131644 | 3300048927 | Bacteria | 1986 |
| 801 | Ga0496125_0001071 | 3300048928 | Bacteria | 42210 |
| 802 | Ga0496125_0003176 | 3300048928 | Bacteria | 20363 |
| 803 | Ga0496125_0110625 | 3300048928 | Bacteria | 1991 |
| 804 | Ga0496126_0001395 | 3300048929 | Bacteria | 38244 |
| 805 | Ga0496126_0474476 | 3300048929 | Bacteria | 1003 |
| 806 | Ga0501293_002230 | 3300049516 | Bacteria | 1472 |
| 807 | Ga0501296_023011 | 3300049519 | Bacteria | 805 |
| 808 | Ga0501297_003781 | 3300049520 | Bacteria | 1525 |
| 809 | Ga0501032_0088594 | 3300049569 | Unclassified | 2055 |
| 810 | Ga0501033_0124084 | 3300049570 | Bacteria | 1873 |
| 811 | Ga0501033_0508324 | 3300049570 | Bacteria | 833 |
| 812 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 813 | Ga0501034_0004933 | 3300049571 | Bacteria | 14687 |
| 814 | Ga0501034_0120580 | 3300049571 | Unclassified | 2609 |
| 815 | Ga0501036_0120599 | 3300049572 | Bacteria | 2215 |
| 816 | Ga0501043_0473433 | 3300049579 | Unclassified | 939 |
| 817 | Ga0501046_0103890 | 3300049580 | Unclassified | 2178 |
| 818 | Ga0501047_0195837 | 3300049581 | Bacteria | 1883 |
| 819 | Ga0501047_0359744 | 3300049581 | Bacteria | 1291 |
| 820 | Ga0501047_0380161 | 3300049581 | Bacteria | 1247 |
| 821 | Ga0501048_0194390 | 3300049582 | Bacteria | 1438 |
| 822 | Ga0501068_0005707 | 3300049584 | Bacteria | 6821 |
| 823 | Ga0501070_0412788 | 3300049586 | Bacteria | 1091 |
| 824 | Ga0501073_0094009 | 3300049589 | Unclassified | 2082 |
| 825 | Ga0501073_0096255 | 3300049589 | Bacteria | 2056 |
| 826 | Ga0501074_0135693 | 3300049590 | Unclassified | 1760 |
| 827 | Ga0501198_003624 | 3300049649 | Bacteria | 2117 |
| 828 | Ga0501201_001434 | 3300049651 | Bacteria | 2228 |
| 829 | Ga0501202_000359 | 3300049652 | Bacteria | 6357 |
| 830 | Ga0501216_002848 | 3300049660 | Bacteria | 2484 |
| 831 | Ga0501216_003468 | 3300049660 | Bacteria | 2296 |
| 832 | Ga0501217_000190 | 3300049661 | Bacteria | 9148 |
| 833 | Ga0501217_006657 | 3300049661 | Bacteria | 2462 |
| 834 | Ga0501222_000546 | 3300049662 | Bacteria | 5580 |
| 835 | Ga0501223_001006 | 3300049663 | Bacteria | 6666 |
| 836 | Ga0501223_007708 | 3300049663 | Bacteria | 2199 |
| 837 | Ga0501224_001719 | 3300049664 | Bacteria | 2935 |
| 838 | Ga0501228_002191 | 3300049666 | Bacteria | 1508 |
| 839 | Ga0501235_004964 | 3300049669 | Bacteria | 2886 |
| 840 | Ga0501240_000690 | 3300049673 | Bacteria | 2928 |
| 841 | Ga0501243_002611 | 3300049675 | Bacteria | 2648 |
| 842 | Ga0501251_003437 | 3300049681 | Bacteria | 1583 |
| 843 | Ga0501253_004133 | 3300049683 | Bacteria | 1808 |
| 844 | Ga0501259_000656 | 3300049688 | Bacteria | 5559 |
| 845 | Ga0501221_000013 | 3300049704 | Bacteria | 22152 |
| 846 | Ga0501225_0003389 | 3300049705 | Bacteria | 4841 |
| 847 | Ga0501234_000394 | 3300049707 | Bacteria | 6465 |
| 848 | Ga0501245_000600 | 3300049708 | Bacteria | 4425 |
| 849 | Ga0501245_010467 | 3300049708 | Unclassified | 1340 |
| 850 | Ga0501079_0225516 | 3300049741 | Unclassified | 1464 |
| 851 | Ga0501080_0628152 | 3300049742 | Bacteria | 952 |
| 852 | Ga0501083_0089499 | 3300049744 | Unclassified | 2034 |
| 853 | Ga0501083_0105612 | 3300049744 | Unclassified | 1854 |
| 854 | Ga0501241_000003 | 3300049758 | Bacteria | 178857 |
| 855 | Ga0501241_020851 | 3300049758 | Bacteria | 1207 |
| 856 | Ga0501267_000649 | 3300049764 | Bacteria | 2760 |
| 857 | Ga0501035_0074759 | 3300049822 | Bacteria | 2997 |
| 858 | Ga0501035_0150406 | 3300049822 | Bacteria | 2021 |
| 859 | Ga0501035_0161255 | 3300049822 | Bacteria | 1941 |
| 860 | Ga0501035_0496559 | 3300049822 | Bacteria | 1005 |
| 861 | Ga0501044_0087396 | 3300049823 | Unclassified | 3149 |
| 862 | Ga0501044_0093319 | 3300049823 | Bacteria | 3035 |
| 863 | Ga0501044_0109831 | 3300049823 | Unclassified | 2767 |
| 864 | Ga0501044_0124127 | 3300049823 | Bacteria | 2580 |
| 865 | Ga0501044_0333409 | 3300049823 | Bacteria | 1439 |
| 866 | Ga0501212_000331 | 3300049851 | Bacteria | 4411 |
| 867 | nmdc:mga08y16_518020_c1 | 3300050511 | Bacteria | 1210 |
| 868 | nmdc:mga0n895_476600_c1 | 3300050512 | Bacteria | 1259 |
| 869 | Ga0500644_0089806 | 3300053088 | Bacteria | 1147 |
| 870 | Ga0500583_0000009 | 3300053092 | Bacteria | 160749 |
| 871 | Ga0500583_0015550 | 3300053092 | Unclassified | 3013 |
| 872 | Ga0500583_0019316 | 3300053092 | Bacteria | 2791 |
| 873 | Ga0500651_0104709 | 3300053093 | Bacteria | 1732 |
| 874 | Ga0500651_0305007 | 3300053093 | Bacteria | 913 |
| 875 | Ga0500562_000035 | 3300053108 | Bacteria | 81116 |
| 876 | Ga0500569_000056 | 3300053109 | Bacteria | 19932 |
| 877 | Ga0500594_0113772 | 3300053118 | Bacteria | 844 |
| 878 | Ga0500642_0005680 | 3300053130 | Bacteria | 4048 |
| 879 | Ga0500559_0029770 | 3300053136 | Bacteria | 2340 |
| 880 | Ga0500559_0125128 | 3300053136 | Bacteria | 1198 |
| 881 | Ga0500577_0001778 | 3300053142 | Bacteria | 5510 |
| 882 | Ga0500588_0001992 | 3300053146 | Bacteria | 4045 |
| 883 | Ga0500616_0006723 | 3300053153 | Bacteria | 7463 |
| 884 | Ga0500616_0084767 | 3300053153 | Bacteria | 1584 |
| 885 | Ga0500616_0136258 | 3300053153 | Unclassified | 1153 |
| 886 | Ga0500622_0001619 | 3300053156 | Bacteria | 17667 |
| 887 | Ga0500622_0002834 | 3300053156 | Bacteria | 12162 |
| 888 | Ga0500622_0037129 | 3300053156 | Bacteria | 2546 |
| 889 | Ga0500622_0101421 | 3300053156 | Bacteria | 1417 |
| 890 | Ga0500622_0128548 | 3300053156 | Bacteria | 1220 |
| 891 | Ga0500637_0171897 | 3300053178 | Bacteria | 1245 |
| 892 | Ga0500645_065109 | 3300053730 | Bacteria | 1050 |
| 893 | Ga0501084_0366934 | 3300054114 | Unclassified | 1216 |
| 894 | Ga0501082_0154692 | 3300060353 | Unclassified | 1992 |
| 895 | Ga0466962_0092153 | 3300061719 | Bacteria | 1452 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10091456 | Ga0157370_100914564 | 180 |
| 2 | 3300046512 | Ga0495610_0000006 | Ga0495610_0000006_446686_447234 | 180 |
| 3 | 3300046660 | Ga0495625_0001048 | Ga0495625_0001048_28188_28736 | 180 |
| 4 | 3300048905 | Ga0496102_0007137 | Ga0496102_0007137_1051_1599 | 180 |
| 5 | 3300048920 | Ga0496117_0000027 | Ga0496117_0000027_355361_355909 | 180 |
| 6 | 3300048921 | Ga0496118_0000141 | Ga0496118_0000141_8470_9018 | 180 |
| 7 | 3300048922 | Ga0496119_0000006 | Ga0496119_0000006_234185_234733 | 180 |
| 8 | 3300048923 | Ga0496120_0069333 | Ga0496120_0069333_648_1196 | 180 |
| 9 | 3300048925 | Ga0496122_0004955 | Ga0496122_0004955_15468_16016 | 180 |
| 10 | 3300048926 | Ga0496123_0006136 | Ga0496123_0006136_8099_8647 | 180 |
| 11 | 3300048927 | Ga0496124_0131644 | Ga0496124_0131644_687_1235 | 180 |
| 12 | 3300048928 | Ga0496125_0003176 | Ga0496125_0003176_18204_18752 | 180 |
| 13 | 3300048929 | Ga0496126_0474476 | Ga0496126_0474476_121_669 | 180 |
| 14 | 3300049758 | Ga0501241_000003 | Ga0501241_000003_129447_129995 | 180 |
| 15 | 3300009036 | Ga0105244_10000001 | Ga0105244_10000001464 | 186 |
| 16 | 3300048921 | Ga0496118_0139503 | Ga0496118_0139503_67_633 | 186 |
| 17 | 3300046453 | Ga0495627_027208 | Ga0495627_027208_787_1440 | 198 |
| 18 | 3300046460 | Ga0495638_0085224 | Ga0495638_0085224_152_805 | 198 |
| 19 | 3300046522 | Ga0495643_0078851 | Ga0495643_0078851_201_854 | 198 |
| 20 | 3300047472 | Ga0495686_0006673 | Ga0495686_0006673_182_835 | 198 |
| 21 | 3300013104 | Ga0157370_10103586 | Ga0157370_101035863 | 205 |
| 22 | 3300014497 | Ga0182008_10000016 | Ga0182008_10000016120 | 205 |
| 23 | iso_pu_bacteria | 2914759650 | 2914762308 | 207 |
| 24 | iso_pu_bacteria | 2511231000 | 2511234378 | 210 |
| 25 | iso_pu_bacteria | 2523533629 | 2524006845 | 210 |
| 26 | iso_pu_bacteria | 2582581278 | 2585145018 | 210 |
| 27 | iso_pu_bacteria | 2582581281 | 2585158417 | 210 |
| 28 | iso_pu_bacteria | 2582581282 | 2585162628 | 210 |
| 29 | iso_pu_bacteria | 2582581873 | 2585425798 | 210 |
| 30 | iso_pu_bacteria | 2585428045 | 2587678573 | 210 |
| 31 | iso_pu_bacteria | 2585428061 | 2587753357 | 210 |
| 32 | iso_pu_bacteria | 2585428095 | 2587867109 | 210 |
| 33 | iso_pu_bacteria | 2585428182 | 2588210366 | 210 |
| 34 | iso_pu_bacteria | 2585428183 | 2588214390 | 210 |
| 35 | iso_pu_bacteria | 2585428184 | 2588217644 | 210 |
| 36 | iso_pu_bacteria | 2585428185 | 2588223164 | 210 |
| 37 | iso_pu_bacteria | 2588254255 | 2590601623 | 210 |
| 38 | iso_pu_bacteria | 2721755487 | 2722726297 | 210 |
| 39 | iso_pu_bacteria | 2738541273 | 2738699866 | 210 |
| 40 | iso_pu_bacteria | 2738543014 | 2739253615 | 210 |
| 41 | iso_pu_bacteria | 2739367874 | 2740059140 | 210 |
| 42 | iso_pu_bacteria | 2751185877 | 2753673197 | 210 |
| 43 | iso_pu_bacteria | 2765235839 | 2765574278 | 210 |
| 44 | iso_pu_bacteria | 2772190705 | 2772603772 | 210 |
| 45 | iso_pu_bacteria | 2816332188 | 2816874488 | 210 |
| 46 | iso_pu_bacteria | 2871720351 | 2871724173 | 210 |
| 47 | iso_pu_bacteria | 2887375801 | 2887379730 | 210 |
| 48 | iso_pu_bacteria | 2889290771 | 2889295192 | 210 |
| 49 | iso_pu_bacteria | 2890737413 | 2890737460 | 210 |
| 50 | iso_pu_bacteria | 2896317667 | 2896321044 | 210 |
| 51 | iso_pu_bacteria | 2896344016 | 2896344347 | 210 |
| 52 | iso_pu_bacteria | 2898713307 | 2898716496 | 210 |
| 53 | iso_pu_bacteria | 2902048731 | 2902050766 | 210 |
| 54 | iso_pu_bacteria | 2904780799 | 2904783818 | 210 |
| 55 | iso_pu_bacteria | 2905999023 | 2906000115 | 210 |
| 56 | iso_pu_bacteria | 2919177583 | 2919181934 | 210 |
| 57 | iso_pu_bacteria | 2919399522 | 2919403817 | 210 |
| 58 | iso_pu_bacteria | 3003233435 | 3003236934 | 210 |
| 59 | iso_pu_bacteria | 2585428060 | 2587746264 | 211 |
| 60 | iso_pu_bacteria | 2585428115 | 2587941675 | 211 |
| 61 | iso_pu_bacteria | 2585428187 | 2588232857 | 211 |
| 62 | iso_pu_bacteria | 2588253712 | 2588443973 | 211 |
| 63 | iso_pu_bacteria | 2588254257 | 2590613671 | 211 |
| 64 | iso_pu_bacteria | 2728369107 | 2729200151 | 211 |
| 65 | iso_pu_bacteria | 2775506739 | 2775671893 | 211 |
| 66 | iso_pu_bacteria | 2818991444 | 2819589834 | 211 |
| 67 | iso_pu_bacteria | 2818991460 | 2819676439 | 211 |
| 68 | iso_pu_bacteria | 2821136567 | 2821140594 | 211 |
| 69 | iso_pu_bacteria | 2842083920 | 2842088437 | 211 |
| 70 | iso_pu_bacteria | 2884791551 | 2884796270 | 211 |
| 71 | iso_pu_bacteria | 2890804823 | 2890805076 | 211 |
| 72 | iso_pu_bacteria | 2904467357 | 2904473013 | 211 |
| 73 | iso_pu_bacteria | 2919097161 | 2919098668 | 211 |
| 74 | iso_pu_bacteria | 2929154850 | 2929160084 | 211 |
| 75 | iso_pu_bacteria | 2929177148 | 2929178212 | 211 |
| 76 | iso_pu_bacteria | 2929239360 | 2929240523 | 211 |
| 77 | iso_pu_bacteria | 2929921140 | 2929922360 | 211 |
| 78 | iso_pu_bacteria | 2945924605 | 2945925958 | 211 |
| 79 | iso_pu_bacteria | 2945977869 | 2945980574 | 211 |
| 80 | iso_pu_bacteria | 2946013367 | 2946013563 | 211 |
| 81 | iso_pu_bacteria | 2946019816 | 2946022761 | 211 |
| 82 | iso_pu_bacteria | 2977243572 | 2977244884 | 211 |
| 83 | iso_pu_bacteria | 2993372514 | 2993374699 | 211 |
| 84 | iso_pu_bacteria | 2993480792 | 2993481582 | 211 |
| 85 | iso_pu_bacteria | 8003151029 | 8003156778 | 211 |
| 86 | 3300015261 | Ga0182006_1000003 | Ga0182006_1000003403 | 213 |
| 87 | 3300030742 | Ga0316183_1026574 | Ga0316183_10265741 | 213 |
| 88 | 3300031911 | Ga0307412_10053581 | Ga0307412_100535812 | 213 |
| 89 | 3300032002 | Ga0307416_100000013 | Ga0307416_100000013269 | 213 |
| 90 | 3300032004 | Ga0307414_10614900 | Ga0307414_106149001 | 213 |
| 91 | 2162886007 | SwRhRL2b_contig_2652683 | SwRhRL2b_0766.00003750 | 214 |
| 92 | 3300001915 | JGI24741J21665_1002924 | JGI24741J21665_10029245 | 214 |
| 93 | 3300003316 | rootH1_10131517 | rootH1_101315172 | 214 |
| 94 | 3300003323 | rootH1_10147471 | rootH1_101474712 | 214 |
| 95 | 3300003323 | rootH1_10202610 | rootH1_102026101 | 214 |
| 96 | 3300003578 | Ga0006562J51391_1011765 | Ga0006562J51391_10117651 | 214 |
| 97 | 3300003784 | Ga0055534_1014943 | Ga0055534_10149432 | 214 |
| 98 | 3300004801 | Ga0058860_11744412 | Ga0058860_117444121 | 214 |
| 99 | 3300005288 | Ga0065714_10065177 | Ga0065714_100651775 | 214 |
| 100 | 3300005288 | Ga0065714_10118035 | Ga0065714_101180351 | 214 |
| 101 | 3300005289 | Ga0065704_10071156 | Ga0065704_100711569 | 214 |
| 102 | 3300005289 | Ga0065704_10077203 | Ga0065704_100772035 | 214 |
| 103 | 3300005289 | Ga0065704_10086148 | Ga0065704_100861482 | 214 |
| 104 | 3300005289 | Ga0065704_10283138 | Ga0065704_102831382 | 214 |
| 105 | 3300005290 | Ga0065712_10002959 | Ga0065712_1000295911 | 214 |
| 106 | 3300005290 | Ga0065712_10027299 | Ga0065712_100272991 | 214 |
| 107 | 3300005290 | Ga0065712_10073468 | Ga0065712_100734684 | 214 |
| 108 | 3300005290 | Ga0065712_10167465 | Ga0065712_101674651 | 214 |
| 109 | 3300005293 | Ga0065715_10001700 | Ga0065715_1000170019 | 214 |
| 110 | 3300005293 | Ga0065715_10132314 | Ga0065715_101323143 | 214 |
| 111 | 3300005295 | Ga0065707_10005547 | Ga0065707_100055475 | 214 |
| 112 | 3300005295 | Ga0065707_10092699 | Ga0065707_100926993 | 214 |
| 113 | 3300005328 | Ga0070676_10000034 | Ga0070676_1000003428 | 214 |
| 114 | 3300005328 | Ga0070676_10012393 | Ga0070676_100123935 | 214 |
| 115 | 3300005328 | Ga0070676_10130395 | Ga0070676_101303951 | 214 |
| 116 | 3300005328 | Ga0070676_10498460 | Ga0070676_104984601 | 214 |
| 117 | 3300005329 | Ga0070683_100000659 | Ga0070683_1000006594 | 214 |
| 118 | 3300005329 | Ga0070683_100014987 | Ga0070683_1000149876 | 214 |
| 119 | 3300005329 | Ga0070683_100167534 | Ga0070683_1001675342 | 214 |
| 120 | 3300005330 | Ga0070690_100050853 | Ga0070690_1000508532 | 214 |
| 121 | 3300005330 | Ga0070690_100122306 | Ga0070690_1001223062 | 214 |
| 122 | 3300005330 | Ga0070690_100213108 | Ga0070690_1002131082 | 214 |
| 123 | 3300005330 | Ga0070690_100363542 | Ga0070690_1003635421 | 214 |
| 124 | 3300005331 | Ga0070670_100032746 | Ga0070670_1000327465 | 214 |
| 125 | 3300005331 | Ga0070670_100039493 | Ga0070670_1000394933 | 214 |
| 126 | 3300005331 | Ga0070670_100124310 | Ga0070670_1001243102 | 214 |
| 127 | 3300005331 | Ga0070670_100192437 | Ga0070670_1001924372 | 214 |
| 128 | 3300005331 | Ga0070670_100499735 | Ga0070670_1004997352 | 214 |
| 129 | 3300005334 | Ga0068869_100019822 | Ga0068869_1000198222 | 214 |
| 130 | 3300005334 | Ga0068869_100047968 | Ga0068869_1000479682 | 214 |
| 131 | 3300005334 | Ga0068869_100065506 | Ga0068869_1000655062 | 214 |
| 132 | 3300005335 | Ga0070666_10000431 | Ga0070666_100004314 | 214 |
| 133 | 3300005335 | Ga0070666_10051457 | Ga0070666_100514572 | 214 |
| 134 | 3300005337 | Ga0070682_100000474 | Ga0070682_1000004748 | 214 |
| 135 | 3300005337 | Ga0070682_100189797 | Ga0070682_1001897972 | 214 |
| 136 | 3300005338 | Ga0068868_100001305 | Ga0068868_10000130518 | 214 |
| 137 | 3300005338 | Ga0068868_100014762 | Ga0068868_1000147622 | 214 |
| 138 | 3300005338 | Ga0068868_100057484 | Ga0068868_1000574842 | 214 |
| 139 | 3300005338 | Ga0068868_100209799 | Ga0068868_1002097992 | 214 |
| 140 | 3300005339 | Ga0070660_100340634 | Ga0070660_1003406342 | 214 |
| 141 | 3300005340 | Ga0070689_100077183 | Ga0070689_1000771832 | 214 |
| 142 | 3300005340 | Ga0070689_100120093 | Ga0070689_1001200932 | 214 |
| 143 | 3300005340 | Ga0070689_100179787 | Ga0070689_1001797872 | 214 |
| 144 | 3300005344 | Ga0070661_100009156 | Ga0070661_1000091563 | 214 |
| 145 | 3300005344 | Ga0070661_100101022 | Ga0070661_1001010223 | 214 |
| 146 | 3300005347 | Ga0070668_100000087 | Ga0070668_10000008714 | 214 |
| 147 | 3300005347 | Ga0070668_100136073 | Ga0070668_1001360732 | 214 |
| 148 | 3300005353 | Ga0070669_100029165 | Ga0070669_1000291653 | 214 |
| 149 | 3300005353 | Ga0070669_100279480 | Ga0070669_1002794801 | 214 |
| 150 | 3300005353 | Ga0070669_100284695 | Ga0070669_1002846952 | 214 |
| 151 | 3300005353 | Ga0070669_100298236 | Ga0070669_1002982362 | 214 |
| 152 | 3300005354 | Ga0070675_100016216 | Ga0070675_1000162165 | 214 |
| 153 | 3300005354 | Ga0070675_100118146 | Ga0070675_1001181462 | 214 |
| 154 | 3300005354 | Ga0070675_100141582 | Ga0070675_1001415822 | 214 |
| 155 | 3300005354 | Ga0070675_100157019 | Ga0070675_1001570192 | 214 |
| 156 | 3300005354 | Ga0070675_100164717 | Ga0070675_1001647172 | 214 |
| 157 | 3300005354 | Ga0070675_100247803 | Ga0070675_1002478032 | 214 |
| 158 | 3300005355 | Ga0070671_100021476 | Ga0070671_1000214766 | 214 |
| 159 | 3300005355 | Ga0070671_100063802 | Ga0070671_1000638023 | 214 |
| 160 | 3300005355 | Ga0070671_100110437 | Ga0070671_1001104372 | 214 |
| 161 | 3300005356 | Ga0070674_100040831 | Ga0070674_1000408314 | 214 |
| 162 | 3300005356 | Ga0070674_100045340 | Ga0070674_1000453402 | 214 |
| 163 | 3300005356 | Ga0070674_100144957 | Ga0070674_1001449572 | 214 |
| 164 | 3300005364 | Ga0070673_100000074 | Ga0070673_10000007420 | 214 |
| 165 | 3300005364 | Ga0070673_100006567 | Ga0070673_1000065676 | 214 |
| 166 | 3300005364 | Ga0070673_100016521 | Ga0070673_1000165213 | 214 |
| 167 | 3300005364 | Ga0070673_100020236 | Ga0070673_1000202369 | 214 |
| 168 | 3300005364 | Ga0070673_100028926 | Ga0070673_1000289262 | 214 |
| 169 | 3300005364 | Ga0070673_100131684 | Ga0070673_1001316842 | 214 |
| 170 | 3300005364 | Ga0070673_100203480 | Ga0070673_1002034802 | 214 |
| 171 | 3300005364 | Ga0070673_100413458 | Ga0070673_1004134581 | 214 |
| 172 | 3300005365 | Ga0070688_100009006 | Ga0070688_1000090062 | 214 |
| 173 | 3300005365 | Ga0070688_100032610 | Ga0070688_1000326102 | 214 |
| 174 | 3300005365 | Ga0070688_100084330 | Ga0070688_1000843302 | 214 |
| 175 | 3300005365 | Ga0070688_100112042 | Ga0070688_1001120421 | 214 |
| 176 | 3300005366 | Ga0070659_100022811 | Ga0070659_1000228116 | 214 |
| 177 | 3300005366 | Ga0070659_100048868 | Ga0070659_1000488683 | 214 |
| 178 | 3300005367 | Ga0070667_100000031 | Ga0070667_10000003161 | 214 |
| 179 | 3300005367 | Ga0070667_100016900 | Ga0070667_1000169004 | 214 |
| 180 | 3300005367 | Ga0070667_100057008 | Ga0070667_1000570083 | 214 |
| 181 | 3300005367 | Ga0070667_100368257 | Ga0070667_1003682572 | 214 |
| 182 | 3300005455 | Ga0070663_100652464 | Ga0070663_1006524641 | 214 |
| 183 | 3300005456 | Ga0070678_100082152 | Ga0070678_1000821522 | 214 |
| 184 | 3300005456 | Ga0070678_100194169 | Ga0070678_1001941692 | 214 |
| 185 | 3300005456 | Ga0070678_100413227 | Ga0070678_1004132271 | 214 |
| 186 | 3300005456 | Ga0070678_100776741 | Ga0070678_1007767411 | 214 |
| 187 | 3300005457 | Ga0070662_100003774 | Ga0070662_1000037747 | 214 |
| 188 | 3300005457 | Ga0070662_100010942 | Ga0070662_1000109426 | 214 |
| 189 | 3300005457 | Ga0070662_100012743 | Ga0070662_1000127435 | 214 |
| 190 | 3300005457 | Ga0070662_100067746 | Ga0070662_1000677462 | 214 |
| 191 | 3300005457 | Ga0070662_100139660 | Ga0070662_1001396601 | 214 |
| 192 | 3300005459 | Ga0068867_100010592 | Ga0068867_1000105926 | 214 |
| 193 | 3300005459 | Ga0068867_100048371 | Ga0068867_1000483711 | 214 |
| 194 | 3300005459 | Ga0068867_100372018 | Ga0068867_1003720182 | 214 |
| 195 | 3300005459 | Ga0068867_100664731 | Ga0068867_1006647311 | 214 |
| 196 | 3300005466 | Ga0070685_10017106 | Ga0070685_100171062 | 214 |
| 197 | 3300005466 | Ga0070685_10035260 | Ga0070685_100352603 | 214 |
| 198 | 3300005466 | Ga0070685_10262359 | Ga0070685_102623592 | 214 |
| 199 | 3300005471 | Ga0070698_100005145 | Ga0070698_1000051454 | 214 |
| 200 | 3300005471 | Ga0070698_100245197 | Ga0070698_1002451971 | 214 |
| 201 | 3300005535 | Ga0070684_100001403 | Ga0070684_10000140314 | 214 |
| 202 | 3300005535 | Ga0070684_100003737 | Ga0070684_10000373712 | 214 |
| 203 | 3300005535 | Ga0070684_100192781 | Ga0070684_1001927812 | 214 |
| 204 | 3300005539 | Ga0068853_100004545 | Ga0068853_10000454513 | 214 |
| 205 | 3300005539 | Ga0068853_100013622 | Ga0068853_1000136227 | 214 |
| 206 | 3300005539 | Ga0068853_100016660 | Ga0068853_1000166604 | 214 |
| 207 | 3300005539 | Ga0068853_100453109 | Ga0068853_1004531092 | 214 |
| 208 | 3300005543 | Ga0070672_100000002 | Ga0070672_10000000243 | 214 |
| 209 | 3300005543 | Ga0070672_100196987 | Ga0070672_1001969872 | 214 |
| 210 | 3300005543 | Ga0070672_100213041 | Ga0070672_1002130411 | 214 |
| 211 | 3300005543 | Ga0070672_100334937 | Ga0070672_1003349372 | 214 |
| 212 | 3300005543 | Ga0070672_100426982 | Ga0070672_1004269822 | 214 |
| 213 | 3300005543 | Ga0070672_100847629 | Ga0070672_1008476291 | 214 |
| 214 | 3300005544 | Ga0070686_100111833 | Ga0070686_1001118332 | 214 |
| 215 | 3300005548 | Ga0070665_100000222 | Ga0070665_10000022273 | 214 |
| 216 | 3300005548 | Ga0070665_100004685 | Ga0070665_1000046852 | 214 |
| 217 | 3300005563 | Ga0068855_100026121 | Ga0068855_1000261212 | 214 |
| 218 | 3300005564 | Ga0070664_100000140 | Ga0070664_1000001405 | 214 |
| 219 | 3300005564 | Ga0070664_100004377 | Ga0070664_10000437712 | 214 |
| 220 | 3300005564 | Ga0070664_100046706 | Ga0070664_1000467061 | 214 |
| 221 | 3300005564 | Ga0070664_100124460 | Ga0070664_1001244602 | 214 |
| 222 | 3300005564 | Ga0070664_100141526 | Ga0070664_1001415262 | 214 |
| 223 | 3300005577 | Ga0068857_100017088 | Ga0068857_1000170882 | 214 |
| 224 | 3300005577 | Ga0068857_100021957 | Ga0068857_1000219574 | 214 |
| 225 | 3300005577 | Ga0068857_100053671 | Ga0068857_1000536713 | 214 |
| 226 | 3300005577 | Ga0068857_100313255 | Ga0068857_1003132552 | 214 |
| 227 | 3300005577 | Ga0068857_100382233 | Ga0068857_1003822332 | 214 |
| 228 | 3300005578 | Ga0068854_100196964 | Ga0068854_1001969642 | 214 |
| 229 | 3300005614 | Ga0068856_100385193 | Ga0068856_1003851933 | 214 |
| 230 | 3300005616 | Ga0068852_100094789 | Ga0068852_1000947893 | 214 |
| 231 | 3300005616 | Ga0068852_100143997 | Ga0068852_1001439972 | 214 |
| 232 | 3300005616 | Ga0068852_100367051 | Ga0068852_1003670512 | 214 |
| 233 | 3300005616 | Ga0068852_100744796 | Ga0068852_1007447961 | 214 |
| 234 | 3300005617 | Ga0068859_100021050 | Ga0068859_1000210507 | 214 |
| 235 | 3300005617 | Ga0068859_100032817 | Ga0068859_1000328174 | 214 |
| 236 | 3300005617 | Ga0068859_100047523 | Ga0068859_1000475232 | 214 |
| 237 | 3300005617 | Ga0068859_100277182 | Ga0068859_1002771822 | 214 |
| 238 | 3300005617 | Ga0068859_100497615 | Ga0068859_1004976151 | 214 |
| 239 | 3300005618 | Ga0068864_100007000 | Ga0068864_1000070008 | 214 |
| 240 | 3300005618 | Ga0068864_100013799 | Ga0068864_1000137996 | 214 |
| 241 | 3300005618 | Ga0068864_100017006 | Ga0068864_1000170063 | 214 |
| 242 | 3300005618 | Ga0068864_100030338 | Ga0068864_1000303383 | 214 |
| 243 | 3300005618 | Ga0068864_100112585 | Ga0068864_1001125853 | 214 |
| 244 | 3300005618 | Ga0068864_100150762 | Ga0068864_1001507622 | 214 |
| 245 | 3300005618 | Ga0068864_100162138 | Ga0068864_1001621382 | 214 |
| 246 | 3300005718 | Ga0068866_10144134 | Ga0068866_101441342 | 214 |
| 247 | 3300005719 | Ga0068861_100008249 | Ga0068861_1000082495 | 214 |
| 248 | 3300005719 | Ga0068861_101086946 | Ga0068861_1010869461 | 214 |
| 249 | 3300005834 | Ga0068851_10034023 | Ga0068851_100340233 | 214 |
| 250 | 3300005834 | Ga0068851_10156310 | Ga0068851_101563101 | 214 |
| 251 | 3300005840 | Ga0068870_10010587 | Ga0068870_100105875 | 214 |
| 252 | 3300005840 | Ga0068870_10026063 | Ga0068870_100260633 | 214 |
| 253 | 3300005841 | Ga0068863_100004520 | Ga0068863_1000045208 | 214 |
| 254 | 3300005841 | Ga0068863_100029214 | Ga0068863_1000292141 | 214 |
| 255 | 3300005841 | Ga0068863_100081959 | Ga0068863_1000819593 | 214 |
| 256 | 3300005841 | Ga0068863_100140676 | Ga0068863_1001406763 | 214 |
| 257 | 3300005841 | Ga0068863_100315848 | Ga0068863_1003158482 | 214 |
| 258 | 3300005841 | Ga0068863_100405879 | Ga0068863_1004058791 | 214 |
| 259 | 3300005842 | Ga0068858_100001512 | Ga0068858_1000015128 | 214 |
| 260 | 3300005842 | Ga0068858_100017339 | Ga0068858_1000173396 | 214 |
| 261 | 3300005842 | Ga0068858_100062769 | Ga0068858_1000627692 | 214 |
| 262 | 3300005842 | Ga0068858_100556786 | Ga0068858_1005567861 | 214 |
| 263 | 3300005843 | Ga0068860_100009821 | Ga0068860_1000098217 | 214 |
| 264 | 3300005843 | Ga0068860_100060843 | Ga0068860_1000608434 | 214 |
| 265 | 3300005843 | Ga0068860_100166484 | Ga0068860_1001664842 | 214 |
| 266 | 3300005843 | Ga0068860_100258732 | Ga0068860_1002587322 | 214 |
| 267 | 3300005843 | Ga0068860_100327688 | Ga0068860_1003276882 | 214 |
| 268 | 3300005844 | Ga0068862_101171056 | Ga0068862_1011710561 | 214 |
| 269 | 3300006163 | Ga0070715_10068794 | Ga0070715_100687942 | 214 |
| 270 | 3300006173 | Ga0070716_100134074 | Ga0070716_1001340742 | 214 |
| 271 | 3300006237 | Ga0097621_100000118 | Ga0097621_10000011833 | 214 |
| 272 | 3300006237 | Ga0097621_100008450 | Ga0097621_1000084508 | 214 |
| 273 | 3300006237 | Ga0097621_100013072 | Ga0097621_1000130727 | 214 |
| 274 | 3300006237 | Ga0097621_100062601 | Ga0097621_1000626012 | 214 |
| 275 | 3300006237 | Ga0097621_100067320 | Ga0097621_1000673203 | 214 |
| 276 | 3300006358 | Ga0068871_100002078 | Ga0068871_10000207812 | 214 |
| 277 | 3300006358 | Ga0068871_100004602 | Ga0068871_1000046029 | 214 |
| 278 | 3300006358 | Ga0068871_100008550 | Ga0068871_1000085507 | 214 |
| 279 | 3300006358 | Ga0068871_100042168 | Ga0068871_1000421684 | 214 |
| 280 | 3300006358 | Ga0068871_100111340 | Ga0068871_1001113403 | 214 |
| 281 | 3300006358 | Ga0068871_100558475 | Ga0068871_1005584752 | 214 |
| 282 | 3300006871 | Ga0075434_100334330 | Ga0075434_1003343302 | 214 |
| 283 | 3300006881 | Ga0068865_100004341 | Ga0068865_1000043414 | 214 |
| 284 | 3300006881 | Ga0068865_100208063 | Ga0068865_1002080632 | 214 |
| 285 | 3300006881 | Ga0068865_100506559 | Ga0068865_1005065592 | 214 |
| 286 | 3300006931 | Ga0097620_100021048 | Ga0097620_1000210482 | 214 |
| 287 | 3300006931 | Ga0097620_100032818 | Ga0097620_1000328182 | 214 |
| 288 | 3300006931 | Ga0097620_100047525 | Ga0097620_1000475252 | 214 |
| 289 | 3300006931 | Ga0097620_100277184 | Ga0097620_1002771842 | 214 |
| 290 | 3300006931 | Ga0097620_100497611 | Ga0097620_1004976111 | 214 |
| 291 | 3300007076 | Ga0075435_100596107 | Ga0075435_1005961072 | 214 |
| 292 | 3300009011 | Ga0105251_10221810 | Ga0105251_102218102 | 214 |
| 293 | 3300009093 | Ga0105240_10091298 | Ga0105240_100912984 | 214 |
| 294 | 3300009093 | Ga0105240_10141802 | Ga0105240_101418022 | 214 |
| 295 | 3300009093 | Ga0105240_10172116 | Ga0105240_101721161 | 214 |
| 296 | 3300009093 | Ga0105240_10327262 | Ga0105240_103272622 | 214 |
| 297 | 3300009093 | Ga0105240_10492096 | Ga0105240_104920962 | 214 |
| 298 | 3300009094 | Ga0111539_10011540 | Ga0111539_100115406 | 214 |
| 299 | 3300009094 | Ga0111539_11289095 | Ga0111539_112890951 | 214 |
| 300 | 3300009098 | Ga0105245_10105819 | Ga0105245_101058191 | 214 |
| 301 | 3300009101 | Ga0105247_10103967 | Ga0105247_101039672 | 214 |
| 302 | 3300009148 | Ga0105243_10000043 | Ga0105243_1000004315 | 214 |
| 303 | 3300009148 | Ga0105243_10000471 | Ga0105243_1000047138 | 214 |
| 304 | 3300009148 | Ga0105243_10254725 | Ga0105243_102547252 | 214 |
| 305 | 3300009148 | Ga0105243_10360534 | Ga0105243_103605342 | 214 |
| 306 | 3300009174 | Ga0105241_10097710 | Ga0105241_100977102 | 214 |
| 307 | 3300009174 | Ga0105241_10591351 | Ga0105241_105913511 | 214 |
| 308 | 3300009176 | Ga0105242_10002571 | Ga0105242_100025715 | 214 |
| 309 | 3300009176 | Ga0105242_10033243 | Ga0105242_100332435 | 214 |
| 310 | 3300009176 | Ga0105242_10786708 | Ga0105242_107867081 | 214 |
| 311 | 3300009177 | Ga0105248_10007403 | Ga0105248_100074036 | 214 |
| 312 | 3300009177 | Ga0105248_10046955 | Ga0105248_100469554 | 214 |
| 313 | 3300009177 | Ga0105248_10112484 | Ga0105248_101124842 | 214 |
| 314 | 3300009177 | Ga0105248_10705530 | Ga0105248_107055301 | 214 |
| 315 | 3300009177 | Ga0105248_10789651 | Ga0105248_107896511 | 214 |
| 316 | 3300009545 | Ga0105237_10008005 | Ga0105237_100080058 | 214 |
| 317 | 3300009545 | Ga0105237_10064235 | Ga0105237_100642354 | 214 |
| 318 | 3300009551 | Ga0105238_10040835 | Ga0105238_100408352 | 214 |
| 319 | 3300009551 | Ga0105238_10087548 | Ga0105238_100875482 | 214 |
| 320 | 3300009553 | Ga0105249_10004261 | Ga0105249_1000426110 | 214 |
| 321 | 3300009553 | Ga0105249_10012725 | Ga0105249_100127252 | 214 |
| 322 | 3300009553 | Ga0105249_10016984 | Ga0105249_100169846 | 214 |
| 323 | 3300009553 | Ga0105249_10018030 | Ga0105249_100180304 | 214 |
| 324 | 3300009553 | Ga0105249_10981098 | Ga0105249_109810982 | 214 |
| 325 | 3300010375 | Ga0105239_10007361 | Ga0105239_100073617 | 214 |
| 326 | 3300010375 | Ga0105239_10027880 | Ga0105239_100278804 | 214 |
| 327 | 3300010375 | Ga0105239_10093905 | Ga0105239_100939052 | 214 |
| 328 | 3300010375 | Ga0105239_10226412 | Ga0105239_102264121 | 214 |
| 329 | 3300011119 | Ga0105246_10054873 | Ga0105246_100548732 | 214 |
| 330 | 3300011119 | Ga0105246_10318941 | Ga0105246_103189412 | 214 |
| 331 | 3300013100 | Ga0157373_10045686 | Ga0157373_100456862 | 214 |
| 332 | 3300013100 | Ga0157373_10144437 | Ga0157373_101444371 | 214 |
| 333 | 3300013102 | Ga0157371_10001559 | Ga0157371_100015597 | 214 |
| 334 | 3300013102 | Ga0157371_10072212 | Ga0157371_100722122 | 214 |
| 335 | 3300013102 | Ga0157371_10223246 | Ga0157371_102232462 | 214 |
| 336 | 3300013104 | Ga0157370_10002236 | Ga0157370_100022362 | 214 |
| 337 | 3300013104 | Ga0157370_10002888 | Ga0157370_1000288813 | 214 |
| 338 | 3300013104 | Ga0157370_10124926 | Ga0157370_101249262 | 214 |
| 339 | 3300013105 | Ga0157369_10003002 | Ga0157369_1000300224 | 214 |
| 340 | 3300013105 | Ga0157369_10116156 | Ga0157369_101161562 | 214 |
| 341 | 3300013105 | Ga0157369_10202772 | Ga0157369_102027721 | 214 |
| 342 | 3300013296 | Ga0157374_10000015 | Ga0157374_1000001514 | 214 |
| 343 | 3300013296 | Ga0157374_10000074 | Ga0157374_1000007491 | 214 |
| 344 | 3300013296 | Ga0157374_10012937 | Ga0157374_100129372 | 214 |
| 345 | 3300013296 | Ga0157374_10029637 | Ga0157374_100296375 | 214 |
| 346 | 3300013296 | Ga0157374_10142976 | Ga0157374_101429762 | 214 |
| 347 | 3300013296 | Ga0157374_10163280 | Ga0157374_101632802 | 214 |
| 348 | 3300013296 | Ga0157374_10548155 | Ga0157374_105481552 | 214 |
| 349 | 3300013297 | Ga0157378_10005674 | Ga0157378_100056747 | 214 |
| 350 | 3300013297 | Ga0157378_10009176 | Ga0157378_100091761 | 214 |
| 351 | 3300013297 | Ga0157378_10029744 | Ga0157378_100297442 | 214 |
| 352 | 3300013297 | Ga0157378_10198282 | Ga0157378_101982822 | 214 |
| 353 | 3300013297 | Ga0157378_10245695 | Ga0157378_102456952 | 214 |
| 354 | 3300013297 | Ga0157378_10580255 | Ga0157378_105802552 | 214 |
| 355 | 3300013297 | Ga0157378_10731065 | Ga0157378_107310651 | 214 |
| 356 | 3300013306 | Ga0163162_10000029 | Ga0163162_1000002953 | 214 |
| 357 | 3300013306 | Ga0163162_10000086 | Ga0163162_1000008639 | 214 |
| 358 | 3300013306 | Ga0163162_10004131 | Ga0163162_100041316 | 214 |
| 359 | 3300013306 | Ga0163162_10004603 | Ga0163162_100046034 | 214 |
| 360 | 3300013306 | Ga0163162_10197211 | Ga0163162_101972111 | 214 |
| 361 | 3300013306 | Ga0163162_10355334 | Ga0163162_103553342 | 214 |
| 362 | 3300013306 | Ga0163162_10620865 | Ga0163162_106208651 | 214 |
| 363 | 3300013307 | Ga0157372_10070798 | Ga0157372_100707982 | 214 |
| 364 | 3300013307 | Ga0157372_10802269 | Ga0157372_108022691 | 214 |
| 365 | 3300013308 | Ga0157375_10000042 | Ga0157375_10000042108 | 214 |
| 366 | 3300013308 | Ga0157375_10000115 | Ga0157375_1000011539 | 214 |
| 367 | 3300013308 | Ga0157375_10000174 | Ga0157375_1000017447 | 214 |
| 368 | 3300013308 | Ga0157375_10078815 | Ga0157375_100788153 | 214 |
| 369 | 3300013308 | Ga0157375_10118381 | Ga0157375_101183813 | 214 |
| 370 | 3300013308 | Ga0157375_10181851 | Ga0157375_101818512 | 214 |
| 371 | 3300013308 | Ga0157375_10208349 | Ga0157375_102083492 | 214 |
| 372 | 3300013308 | Ga0157375_10305831 | Ga0157375_103058311 | 214 |
| 373 | 3300013308 | Ga0157375_10454684 | Ga0157375_104546842 | 214 |
| 374 | 3300013308 | Ga0157375_11464420 | Ga0157375_114644201 | 214 |
| 375 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008887 | 214 |
| 376 | 3300014325 | Ga0163163_10000174 | Ga0163163_1000017461 | 214 |
| 377 | 3300014325 | Ga0163163_10000244 | Ga0163163_1000024439 | 214 |
| 378 | 3300014325 | Ga0163163_10145144 | Ga0163163_101451443 | 214 |
| 379 | 3300014325 | Ga0163163_10247930 | Ga0163163_102479302 | 214 |
| 380 | 3300014325 | Ga0163163_11006258 | Ga0163163_110062581 | 214 |
| 381 | 3300014326 | Ga0157380_10000378 | Ga0157380_1000037815 | 214 |
| 382 | 3300014326 | Ga0157380_10040272 | Ga0157380_100402721 | 214 |
| 383 | 3300014326 | Ga0157380_10081061 | Ga0157380_100810611 | 214 |
| 384 | 3300014326 | Ga0157380_10187389 | Ga0157380_101873891 | 214 |
| 385 | 3300014326 | Ga0157380_10378584 | Ga0157380_103785842 | 214 |
| 386 | 3300014326 | Ga0157380_10828521 | Ga0157380_108285211 | 214 |
| 387 | 3300014745 | Ga0157377_10012000 | Ga0157377_100120002 | 214 |
| 388 | 3300014745 | Ga0157377_10014162 | Ga0157377_100141623 | 214 |
| 389 | 3300014745 | Ga0157377_10021205 | Ga0157377_100212054 | 214 |
| 390 | 3300014968 | Ga0157379_10000080 | Ga0157379_1000008013 | 214 |
| 391 | 3300014968 | Ga0157379_10013554 | Ga0157379_100135542 | 214 |
| 392 | 3300014968 | Ga0157379_10057820 | Ga0157379_100578204 | 214 |
| 393 | 3300014968 | Ga0157379_10188762 | Ga0157379_101887622 | 214 |
| 394 | 3300014969 | Ga0157376_10000429 | Ga0157376_1000042919 | 214 |
| 395 | 3300014969 | Ga0157376_10000521 | Ga0157376_100005219 | 214 |
| 396 | 3300014969 | Ga0157376_10029340 | Ga0157376_100293403 | 214 |
| 397 | 3300014969 | Ga0157376_10141024 | Ga0157376_101410241 | 214 |
| 398 | 3300014969 | Ga0157376_10307915 | Ga0157376_103079152 | 214 |
| 399 | 3300014969 | Ga0157376_10460497 | Ga0157376_104604972 | 214 |
| 400 | 3300017792 | Ga0163161_10000888 | Ga0163161_1000088821 | 214 |
| 401 | 3300017792 | Ga0163161_10001507 | Ga0163161_100015076 | 214 |
| 402 | 3300017792 | Ga0163161_10003749 | Ga0163161_100037497 | 214 |
| 403 | 3300017792 | Ga0163161_10008155 | Ga0163161_100081558 | 214 |
| 404 | 3300017792 | Ga0163161_10009144 | Ga0163161_100091443 | 214 |
| 405 | 3300017792 | Ga0163161_10038599 | Ga0163161_100385994 | 214 |
| 406 | 3300017792 | Ga0163161_10144238 | Ga0163161_101442382 | 214 |
| 407 | 3300017792 | Ga0163161_10177114 | Ga0163161_101771142 | 214 |
| 408 | 3300017792 | Ga0163161_10289236 | Ga0163161_102892362 | 214 |
| 409 | 3300025291 | Ga0209675_1000077 | Ga0209675_1000077121 | 214 |
| 410 | 3300025315 | Ga0207697_10049958 | Ga0207697_100499582 | 214 |
| 411 | 3300025728 | Ga0207655_1000013 | Ga0207655_1000013590 | 214 |
| 412 | 3300025893 | Ga0207682_10191120 | Ga0207682_101911201 | 214 |
| 413 | 3300025899 | Ga0207642_10025259 | Ga0207642_100252592 | 214 |
| 414 | 3300025899 | Ga0207642_10305716 | Ga0207642_103057161 | 214 |
| 415 | 3300025903 | Ga0207680_10000657 | Ga0207680_100006577 | 214 |
| 416 | 3300025903 | Ga0207680_10308407 | Ga0207680_103084072 | 214 |
| 417 | 3300025904 | Ga0207647_10004968 | Ga0207647_100049688 | 214 |
| 418 | 3300025904 | Ga0207647_10094133 | Ga0207647_100941332 | 214 |
| 419 | 3300025907 | Ga0207645_10002924 | Ga0207645_1000292412 | 214 |
| 420 | 3300025907 | Ga0207645_10016615 | Ga0207645_100166152 | 214 |
| 421 | 3300025907 | Ga0207645_10027548 | Ga0207645_100275481 | 214 |
| 422 | 3300025907 | Ga0207645_10134884 | Ga0207645_101348841 | 214 |
| 423 | 3300025908 | Ga0207643_10006094 | Ga0207643_100060943 | 214 |
| 424 | 3300025909 | Ga0207705_10001116 | Ga0207705_1000111614 | 214 |
| 425 | 3300025912 | Ga0207707_10069257 | Ga0207707_100692573 | 214 |
| 426 | 3300025913 | Ga0207695_10000102 | Ga0207695_10000102115 | 214 |
| 427 | 3300025913 | Ga0207695_10029925 | Ga0207695_100299257 | 214 |
| 428 | 3300025913 | Ga0207695_10130932 | Ga0207695_101309322 | 214 |
| 429 | 3300025914 | Ga0207671_10000468 | Ga0207671_100004685 | 214 |
| 430 | 3300025914 | Ga0207671_10033270 | Ga0207671_100332702 | 214 |
| 431 | 3300025918 | Ga0207662_10025036 | Ga0207662_100250363 | 214 |
| 432 | 3300025919 | Ga0207657_10124646 | Ga0207657_101246462 | 214 |
| 433 | 3300025919 | Ga0207657_10247420 | Ga0207657_102474202 | 214 |
| 434 | 3300025920 | Ga0207649_10147537 | Ga0207649_101475372 | 214 |
| 435 | 3300025923 | Ga0207681_10192606 | Ga0207681_101926062 | 214 |
| 436 | 3300025923 | Ga0207681_10448642 | Ga0207681_104486422 | 214 |
| 437 | 3300025924 | Ga0207694_10279482 | Ga0207694_102794822 | 214 |
| 438 | 3300025924 | Ga0207694_10738189 | Ga0207694_107381891 | 214 |
| 439 | 3300025925 | Ga0207650_10018943 | Ga0207650_100189432 | 214 |
| 440 | 3300025925 | Ga0207650_10125668 | Ga0207650_101256682 | 214 |
| 441 | 3300025925 | Ga0207650_10150508 | Ga0207650_101505081 | 214 |
| 442 | 3300025925 | Ga0207650_10407797 | Ga0207650_104077972 | 214 |
| 443 | 3300025925 | Ga0207650_10583021 | Ga0207650_105830211 | 214 |
| 444 | 3300025926 | Ga0207659_10020002 | Ga0207659_100200023 | 214 |
| 445 | 3300025926 | Ga0207659_10454406 | Ga0207659_104544062 | 214 |
| 446 | 3300025927 | Ga0207687_10127317 | Ga0207687_101273172 | 214 |
| 447 | 3300025931 | Ga0207644_10107109 | Ga0207644_101071092 | 214 |
| 448 | 3300025932 | Ga0207690_10051840 | Ga0207690_100518402 | 214 |
| 449 | 3300025932 | Ga0207690_10166548 | Ga0207690_101665481 | 214 |
| 450 | 3300025933 | Ga0207706_10008032 | Ga0207706_100080327 | 214 |
| 451 | 3300025933 | Ga0207706_10010943 | Ga0207706_100109436 | 214 |
| 452 | 3300025933 | Ga0207706_10012549 | Ga0207706_100125493 | 214 |
| 453 | 3300025933 | Ga0207706_10070196 | Ga0207706_100701962 | 214 |
| 454 | 3300025933 | Ga0207706_10075734 | Ga0207706_100757342 | 214 |
| 455 | 3300025934 | Ga0207686_10011930 | Ga0207686_100119306 | 214 |
| 456 | 3300025934 | Ga0207686_10018560 | Ga0207686_100185605 | 214 |
| 457 | 3300025935 | Ga0207709_10000021 | Ga0207709_10000021296 | 214 |
| 458 | 3300025935 | Ga0207709_10000161 | Ga0207709_1000016143 | 214 |
| 459 | 3300025936 | Ga0207670_10012853 | Ga0207670_100128534 | 214 |
| 460 | 3300025936 | Ga0207670_10072521 | Ga0207670_100725213 | 214 |
| 461 | 3300025936 | Ga0207670_10166974 | Ga0207670_101669742 | 214 |
| 462 | 3300025936 | Ga0207670_10459536 | Ga0207670_104595362 | 214 |
| 463 | 3300025937 | Ga0207669_10065247 | Ga0207669_100652471 | 214 |
| 464 | 3300025938 | Ga0207704_10007511 | Ga0207704_100075114 | 214 |
| 465 | 3300025938 | Ga0207704_10055534 | Ga0207704_100555342 | 214 |
| 466 | 3300025938 | Ga0207704_10684314 | Ga0207704_106843141 | 214 |
| 467 | 3300025938 | Ga0207704_10897420 | Ga0207704_108974201 | 214 |
| 468 | 3300025940 | Ga0207691_10000004 | Ga0207691_1000000453 | 214 |
| 469 | 3300025940 | Ga0207691_10035545 | Ga0207691_100355458 | 214 |
| 470 | 3300025940 | Ga0207691_10090583 | Ga0207691_100905831 | 214 |
| 471 | 3300025940 | Ga0207691_10136519 | Ga0207691_101365192 | 214 |
| 472 | 3300025940 | Ga0207691_10419484 | Ga0207691_104194841 | 214 |
| 473 | 3300025941 | Ga0207711_10257699 | Ga0207711_102576992 | 214 |
| 474 | 3300025942 | Ga0207689_10007281 | Ga0207689_100072814 | 214 |
| 475 | 3300025942 | Ga0207689_10011219 | Ga0207689_100112194 | 214 |
| 476 | 3300025942 | Ga0207689_10016209 | Ga0207689_100162096 | 214 |
| 477 | 3300025942 | Ga0207689_10030376 | Ga0207689_100303764 | 214 |
| 478 | 3300025942 | Ga0207689_10088090 | Ga0207689_100880902 | 214 |
| 479 | 3300025944 | Ga0207661_10001545 | Ga0207661_1000154513 | 214 |
| 480 | 3300025944 | Ga0207661_10004190 | Ga0207661_100041904 | 214 |
| 481 | 3300025944 | Ga0207661_10057427 | Ga0207661_100574272 | 214 |
| 482 | 3300025944 | Ga0207661_10134542 | Ga0207661_101345422 | 214 |
| 483 | 3300025945 | Ga0207679_10001022 | Ga0207679_1000102214 | 214 |
| 484 | 3300025945 | Ga0207679_10011099 | Ga0207679_100110993 | 214 |
| 485 | 3300025945 | Ga0207679_10021679 | Ga0207679_100216794 | 214 |
| 486 | 3300025945 | Ga0207679_10080698 | Ga0207679_100806982 | 214 |
| 487 | 3300025945 | Ga0207679_10096051 | Ga0207679_100960512 | 214 |
| 488 | 3300025945 | Ga0207679_10530757 | Ga0207679_105307571 | 214 |
| 489 | 3300025949 | Ga0207667_10027774 | Ga0207667_100277744 | 214 |
| 490 | 3300025949 | Ga0207667_10030844 | Ga0207667_100308444 | 214 |
| 491 | 3300025949 | Ga0207667_10710302 | Ga0207667_107103021 | 214 |
| 492 | 3300025960 | Ga0207651_10001790 | Ga0207651_100017907 | 214 |
| 493 | 3300025960 | Ga0207651_10099712 | Ga0207651_100997121 | 214 |
| 494 | 3300025960 | Ga0207651_10318984 | Ga0207651_103189842 | 214 |
| 495 | 3300025960 | Ga0207651_10448637 | Ga0207651_104486372 | 214 |
| 496 | 3300025960 | Ga0207651_10769714 | Ga0207651_107697141 | 214 |
| 497 | 3300025961 | Ga0207712_10007623 | Ga0207712_100076232 | 214 |
| 498 | 3300025961 | Ga0207712_10012756 | Ga0207712_100127565 | 214 |
| 499 | 3300025961 | Ga0207712_10013338 | Ga0207712_100133386 | 214 |
| 500 | 3300025961 | Ga0207712_10140974 | Ga0207712_101409742 | 214 |
| 501 | 3300025961 | Ga0207712_10261826 | Ga0207712_102618262 | 214 |
| 502 | 3300025961 | Ga0207712_10673409 | Ga0207712_106734092 | 214 |
| 503 | 3300025972 | Ga0207668_10001201 | Ga0207668_100012016 | 214 |
| 504 | 3300025972 | Ga0207668_10097826 | Ga0207668_100978262 | 214 |
| 505 | 3300025972 | Ga0207668_10110395 | Ga0207668_101103952 | 214 |
| 506 | 3300025972 | Ga0207668_10194964 | Ga0207668_101949642 | 214 |
| 507 | 3300025981 | Ga0207640_10106514 | Ga0207640_101065142 | 214 |
| 508 | 3300025981 | Ga0207640_10257043 | Ga0207640_102570433 | 214 |
| 509 | 3300025986 | Ga0207658_10000059 | Ga0207658_1000005988 | 214 |
| 510 | 3300025986 | Ga0207658_10005894 | Ga0207658_100058947 | 214 |
| 511 | 3300025986 | Ga0207658_10050997 | Ga0207658_100509973 | 214 |
| 512 | 3300025986 | Ga0207658_10313673 | Ga0207658_103136733 | 214 |
| 513 | 3300026023 | Ga0207677_10002598 | Ga0207677_100025982 | 214 |
| 514 | 3300026023 | Ga0207677_10021177 | Ga0207677_100211772 | 214 |
| 515 | 3300026023 | Ga0207677_10054179 | Ga0207677_100541793 | 214 |
| 516 | 3300026023 | Ga0207677_10131600 | Ga0207677_101316002 | 214 |
| 517 | 3300026023 | Ga0207677_10277844 | Ga0207677_102778442 | 214 |
| 518 | 3300026035 | Ga0207703_10003800 | Ga0207703_100038004 | 214 |
| 519 | 3300026035 | Ga0207703_10088458 | Ga0207703_100884582 | 214 |
| 520 | 3300026035 | Ga0207703_10158786 | Ga0207703_101587861 | 214 |
| 521 | 3300026035 | Ga0207703_10617325 | Ga0207703_106173251 | 214 |
| 522 | 3300026041 | Ga0207639_10009648 | Ga0207639_100096482 | 214 |
| 523 | 3300026041 | Ga0207639_10034590 | Ga0207639_100345904 | 214 |
| 524 | 3300026041 | Ga0207639_10062961 | Ga0207639_100629613 | 214 |
| 525 | 3300026088 | Ga0207641_10000416 | Ga0207641_100004169 | 214 |
| 526 | 3300026088 | Ga0207641_10002750 | Ga0207641_1000275010 | 214 |
| 527 | 3300026088 | Ga0207641_10096221 | Ga0207641_100962212 | 214 |
| 528 | 3300026088 | Ga0207641_10309349 | Ga0207641_103093492 | 214 |
| 529 | 3300026088 | Ga0207641_10346500 | Ga0207641_103465002 | 214 |
| 530 | 3300026088 | Ga0207641_10853016 | Ga0207641_108530161 | 214 |
| 531 | 3300026088 | Ga0207641_10916999 | Ga0207641_109169991 | 214 |
| 532 | 3300026089 | Ga0207648_10025200 | Ga0207648_100252001 | 214 |
| 533 | 3300026089 | Ga0207648_10026318 | Ga0207648_100263182 | 214 |
| 534 | 3300026089 | Ga0207648_10027541 | Ga0207648_100275416 | 214 |
| 535 | 3300026089 | Ga0207648_10062661 | Ga0207648_100626615 | 214 |
| 536 | 3300026089 | Ga0207648_10112573 | Ga0207648_101125733 | 214 |
| 537 | 3300026089 | Ga0207648_10269578 | Ga0207648_102695782 | 214 |
| 538 | 3300026089 | Ga0207648_10312426 | Ga0207648_103124262 | 214 |
| 539 | 3300026095 | Ga0207676_10002009 | Ga0207676_1000200912 | 214 |
| 540 | 3300026095 | Ga0207676_10005115 | Ga0207676_100051153 | 214 |
| 541 | 3300026095 | Ga0207676_10006355 | Ga0207676_100063555 | 214 |
| 542 | 3300026095 | Ga0207676_10020266 | Ga0207676_100202663 | 214 |
| 543 | 3300026095 | Ga0207676_10077769 | Ga0207676_100777693 | 214 |
| 544 | 3300026095 | Ga0207676_10126836 | Ga0207676_101268362 | 214 |
| 545 | 3300026095 | Ga0207676_10633249 | Ga0207676_106332491 | 214 |
| 546 | 3300026116 | Ga0207674_10002088 | Ga0207674_1000208821 | 214 |
| 547 | 3300026116 | Ga0207674_10005225 | Ga0207674_1000522518 | 214 |
| 548 | 3300026116 | Ga0207674_10040453 | Ga0207674_100404535 | 214 |
| 549 | 3300026116 | Ga0207674_10146288 | Ga0207674_101462883 | 214 |
| 550 | 3300026116 | Ga0207674_10296804 | Ga0207674_102968042 | 214 |
| 551 | 3300026118 | Ga0207675_100005095 | Ga0207675_10000509512 | 214 |
| 552 | 3300026118 | Ga0207675_100090596 | Ga0207675_1000905962 | 214 |
| 553 | 3300026118 | Ga0207675_100094080 | Ga0207675_1000940802 | 214 |
| 554 | 3300026118 | Ga0207675_101264295 | Ga0207675_1012642951 | 214 |
| 555 | 3300026121 | Ga0207683_10037634 | Ga0207683_100376343 | 214 |
| 556 | 3300026121 | Ga0207683_10046789 | Ga0207683_100467892 | 214 |
| 557 | 3300026121 | Ga0207683_10100558 | Ga0207683_101005583 | 214 |
| 558 | 3300026121 | Ga0207683_10863981 | Ga0207683_108639811 | 214 |
| 559 | 3300026121 | Ga0207683_11104728 | Ga0207683_111047281 | 214 |
| 560 | 3300026142 | Ga0207698_10010669 | Ga0207698_100106692 | 214 |
| 561 | 3300026142 | Ga0207698_10071522 | Ga0207698_100715222 | 214 |
| 562 | 3300026142 | Ga0207698_10501130 | Ga0207698_105011301 | 214 |
| 563 | 3300026142 | Ga0207698_11014294 | Ga0207698_110142941 | 214 |
| 564 | 3300027907 | Ga0207428_10112757 | Ga0207428_101127573 | 214 |
| 565 | 3300027907 | Ga0207428_10410913 | Ga0207428_104109132 | 214 |
| 566 | 3300028379 | Ga0268266_10006335 | Ga0268266_100063353 | 214 |
| 567 | 3300028380 | Ga0268265_10094979 | Ga0268265_100949792 | 214 |
| 568 | 3300028381 | Ga0268264_10006876 | Ga0268264_100068763 | 214 |
| 569 | 3300028381 | Ga0268264_10015827 | Ga0268264_100158277 | 214 |
| 570 | 3300028381 | Ga0268264_10247792 | Ga0268264_102477922 | 214 |
| 571 | 3300028381 | Ga0268264_10250648 | Ga0268264_102506481 | 214 |
| 572 | 3300028381 | Ga0268264_10727426 | Ga0268264_107274262 | 214 |
| 573 | 3300028577 | Ga0265318_10045050 | Ga0265318_100450502 | 214 |
| 574 | 3300028794 | Ga0307515_10000078 | Ga0307515_1000007815 | 214 |
| 575 | 3300028794 | Ga0307515_10131954 | Ga0307515_101319541 | 214 |
| 576 | 3300031242 | Ga0265329_10023836 | Ga0265329_100238362 | 214 |
| 577 | 3300031250 | Ga0265331_10013215 | Ga0265331_100132152 | 214 |
| 578 | 3300031251 | Ga0265327_10000338 | Ga0265327_1000033845 | 214 |
| 579 | 3300031251 | Ga0265327_10112822 | Ga0265327_101128221 | 214 |
| 580 | 3300031344 | Ga0265316_10505380 | Ga0265316_105053801 | 214 |
| 581 | 3300031456 | Ga0307513_10352768 | Ga0307513_103527682 | 214 |
| 582 | 3300031507 | Ga0307509_10034214 | Ga0307509_100342143 | 214 |
| 583 | 3300031507 | Ga0307509_10082146 | Ga0307509_100821461 | 214 |
| 584 | 3300031507 | Ga0307509_10111461 | Ga0307509_101114613 | 214 |
| 585 | 3300031507 | Ga0307509_10305470 | Ga0307509_103054702 | 214 |
| 586 | 3300031548 | Ga0307408_100000517 | Ga0307408_10000051729 | 214 |
| 587 | 3300031616 | Ga0307508_10001710 | Ga0307508_1000171011 | 214 |
| 588 | 3300031711 | Ga0265314_10018173 | Ga0265314_100181737 | 214 |
| 589 | 3300031730 | Ga0307516_10000665 | Ga0307516_1000066514 | 214 |
| 590 | 3300031911 | Ga0307412_10000096 | Ga0307412_1000009671 | 214 |
| 591 | 3300031911 | Ga0307412_10000389 | Ga0307412_1000038927 | 214 |
| 592 | 3300031911 | Ga0307412_10007996 | Ga0307412_100079964 | 214 |
| 593 | 3300032004 | Ga0307414_10000004 | Ga0307414_1000000473 | 214 |
| 594 | 3300032004 | Ga0307414_10134392 | Ga0307414_101343922 | 214 |
| 595 | 3300033179 | Ga0307507_10044361 | Ga0307507_100443612 | 214 |
| 596 | 3300035111 | Ga0373923_0023938 | Ga0373923_0023938_1590_2240 | 214 |
| 597 | 3300035170 | Ga0373943_0203036 | Ga0373943_0203036_395_1045 | 214 |
| 598 | 3300035172 | Ga0373955_0002985 | Ga0373955_0002985_1994_2710 | 214 |
| 599 | 3300035692 | Ga0373935_0399189 | Ga0373935_0399189_134_784 | 214 |
| 600 | 3300035724 | Ga0373933_0033852 | Ga0373933_0033852_857_1507 | 214 |
| 601 | 3300035724 | Ga0373933_0262603 | Ga0373933_0262603_91_741 | 214 |
| 602 | 3300036401 | Ga0373937_0119669 | Ga0373937_0119669_1521_2171 | 214 |
| 603 | 3300036401 | Ga0373937_0127172 | Ga0373937_0127172_486_1136 | 214 |
| 604 | 3300037068 | Ga0373925_0307908 | Ga0373925_0307908_494_1144 | 214 |
| 605 | 3300039437 | Ga0436365_1285242 | Ga0436365_1285242_844_1494 | 214 |
| 606 | 3300041404 | Ga0439436_0005435 | Ga0439436_0005435_3125_3775 | 214 |
| 607 | 3300041406 | Ga0439439_0027259 | Ga0439439_0027259_144_794 | 214 |
| 608 | 3300041486 | Ga0451807_2281288 | Ga0451807_2281288_530_1180 | 214 |
| 609 | 3300041496 | Ga0451839_0948395 | Ga0451839_0948395_39_689 | 214 |
| 610 | 3300041511 | Ga0451855_1570704 | Ga0451855_1570704_572_1222 | 214 |
| 611 | 3300042004 | Ga0439445_0000575 | Ga0439445_0000575_4784_5437 | 214 |
| 612 | 3300042014 | Ga0439457_003008 | Ga0439457_003008_2394_3044 | 214 |
| 613 | 3300042015 | Ga0439462_0004845 | Ga0439462_0004845_1545_2195 | 214 |
| 614 | 3300042435 | Ga0439434_0112614 | Ga0439434_0112614_214_864 | 214 |
| 615 | 3300044656 | Ga0466969_0000152 | Ga0466969_0000152_21324_21974 | 214 |
| 616 | 3300044656 | Ga0466969_0136195 | Ga0466969_0136195_290_940 | 214 |
| 617 | 3300044658 | Ga0466972_0010553 | Ga0466972_0010553_1812_2462 | 214 |
| 618 | 3300044684 | Ga0466966_0000567 | Ga0466966_0000567_12349_12999 | 214 |
| 619 | 3300044693 | Ga0466961_0430216 | Ga0466961_0430216_102_752 | 214 |
| 620 | 3300044706 | Ga0466964_0058152 | Ga0466964_0058152_717_1367 | 214 |
| 621 | 3300044712 | Ga0453684_0089052 | Ga0453684_0089052_557_1207 | 214 |
| 622 | 3300044712 | Ga0453684_0188039 | Ga0453684_0188039_221_871 | 214 |
| 623 | 3300044719 | Ga0466971_0117009 | Ga0466971_0117009_325_975 | 214 |
| 624 | 3300044735 | Ga0466968_0192069 | Ga0466968_0192069_138_788 | 214 |
| 625 | 3300044842 | Ga0466957_0005078 | Ga0466957_0005078_5116_5766 | 214 |
| 626 | 3300044901 | Ga0466960_0427038 | Ga0466960_0427038_29_679 | 214 |
| 627 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_27304_27954 | 214 |
| 628 | 3300046453 | Ga0495627_000219 | Ga0495627_000219_59384_60037 | 214 |
| 629 | 3300046454 | Ga0495592_0079131 | Ga0495592_0079131_1269_1919 | 214 |
| 630 | 3300046457 | Ga0495590_0001941 | Ga0495590_0001941_743_1393 | 214 |
| 631 | 3300046459 | Ga0495629_0028307 | Ga0495629_0028307_1963_2613 | 214 |
| 632 | 3300046462 | Ga0495651_0537990 | Ga0495651_0537990_63_713 | 214 |
| 633 | 3300046463 | Ga0495653_0045247 | Ga0495653_0045247_37_687 | 214 |
| 634 | 3300046474 | Ga0495605_0071591 | Ga0495605_0071591_794_1438 | 214 |
| 635 | 3300046500 | Ga0495596_0000647 | Ga0495596_0000647_11200_11850 | 214 |
| 636 | 3300046507 | Ga0495606_0002853 | Ga0495606_0002853_4088_4738 | 214 |
| 637 | 3300046507 | Ga0495606_0010801 | Ga0495606_0010801_438_1088 | 214 |
| 638 | 3300046514 | Ga0495618_0033387 | Ga0495618_0033387_1096_1812 | 214 |
| 639 | 3300046516 | Ga0495628_0008008 | Ga0495628_0008008_2324_2974 | 214 |
| 640 | 3300046517 | Ga0495630_0007375 | Ga0495630_0007375_497_1147 | 214 |
| 641 | 3300046519 | Ga0495632_0000601 | Ga0495632_0000601_27232_27885 | 214 |
| 642 | 3300046522 | Ga0495643_0035860 | Ga0495643_0035860_280_933 | 214 |
| 643 | 3300046524 | Ga0495648_0005568 | Ga0495648_0005568_8089_8739 | 214 |
| 644 | 3300046525 | Ga0495663_0000105 | Ga0495663_0000105_21301_21951 | 214 |
| 645 | 3300046525 | Ga0495663_0005212 | Ga0495663_0005212_1623_2273 | 214 |
| 646 | 3300046529 | Ga0495652_0120404 | Ga0495652_0120404_566_1216 | 214 |
| 647 | 3300046530 | Ga0495654_0000006 | Ga0495654_0000006_17056_17709 | 214 |
| 648 | 3300046531 | Ga0495665_0082512 | Ga0495665_0082512_691_1341 | 214 |
| 649 | 3300046533 | Ga0495640_0150605 | Ga0495640_0150605_402_1052 | 214 |
| 650 | 3300046536 | Ga0495587_0006727 | Ga0495587_0006727_6087_6737 | 214 |
| 651 | 3300046536 | Ga0495587_0114052 | Ga0495587_0114052_180_830 | 214 |
| 652 | 3300046537 | Ga0495598_0009457 | Ga0495598_0009457_722_1372 | 214 |
| 653 | 3300046538 | Ga0495609_0000017 | Ga0495609_0000017_78247_78897 | 214 |
| 654 | 3300046539 | Ga0495621_0021996 | Ga0495621_0021996_695_1345 | 214 |
| 655 | 3300046539 | Ga0495621_0033075 | Ga0495621_0033075_336_986 | 214 |
| 656 | 3300046539 | Ga0495621_0111701 | Ga0495621_0111701_287_967 | 214 |
| 657 | 3300046558 | Ga0495633_0000037 | Ga0495633_0000037_17261_17914 | 214 |
| 658 | 3300046558 | Ga0495633_0002549 | Ga0495633_0002549_1462_2115 | 214 |
| 659 | 3300046616 | Ga0495668_0008836 | Ga0495668_0008836_1240_1890 | 214 |
| 660 | 3300046648 | Ga0495611_0057401 | Ga0495611_0057401_26_676 | 214 |
| 661 | 3300046660 | Ga0495625_0232174 | Ga0495625_0232174_517_1167 | 214 |
| 662 | 3300046665 | Ga0495661_0003215 | Ga0495661_0003215_3790_4434 | 214 |
| 663 | 3300046678 | Ga0495599_0158960 | Ga0495599_0158960_281_931 | 214 |
| 664 | 3300046683 | Ga0495658_0209545 | Ga0495658_0209545_330_980 | 214 |
| 665 | 3300046689 | Ga0495613_0106828 | Ga0495613_0106828_546_1196 | 214 |
| 666 | 3300046809 | Ga0495600_0023886 | Ga0495600_0023886_2675_3325 | 214 |
| 667 | 3300047317 | Ga0495604_0104009 | Ga0495604_0104009_1191_1841 | 214 |
| 668 | 3300047319 | Ga0495674_0042827 | Ga0495674_0042827_2375_3025 | 214 |
| 669 | 3300047319 | Ga0495674_0184469 | Ga0495674_0184469_233_883 | 214 |
| 670 | 3300047444 | Ga0495675_0400516 | Ga0495675_0400516_33_683 | 214 |
| 671 | 3300047471 | Ga0495684_0062929 | Ga0495684_0062929_1521_2171 | 214 |
| 672 | 3300047472 | Ga0495686_0000414 | Ga0495686_0000414_63900_64550 | 214 |
| 673 | 3300048903 | Ga0496100_0085564 | Ga0496100_0085564_1235_1885 | 214 |
| 674 | 3300048909 | Ga0496106_0193839 | Ga0496106_0193839_750_1400 | 214 |
| 675 | 3300048910 | Ga0496107_0279946 | Ga0496107_0279946_567_1217 | 214 |
| 676 | 3300048910 | Ga0496107_0765422 | Ga0496107_0765422_22_672 | 214 |
| 677 | 3300048912 | Ga0496109_0017189 | Ga0496109_0017189_907_1557 | 214 |
| 678 | 3300048917 | Ga0496114_0115964 | Ga0496114_0115964_408_1058 | 214 |
| 679 | 3300048918 | Ga0496115_0074175 | Ga0496115_0074175_1529_2173 | 214 |
| 680 | 3300048919 | Ga0496116_0000006 | Ga0496116_0000006_332_982 | 214 |
| 681 | 3300048919 | Ga0496116_0046869 | Ga0496116_0046869_1293_1940 | 214 |
| 682 | 3300048920 | Ga0496117_0002735 | Ga0496117_0002735_4216_4863 | 214 |
| 683 | 3300048921 | Ga0496118_0305931 | Ga0496118_0305931_120_767 | 214 |
| 684 | 3300048925 | Ga0496122_0000229 | Ga0496122_0000229_42273_42923 | 214 |
| 685 | 3300048925 | Ga0496122_0000397 | Ga0496122_0000397_45536_46186 | 214 |
| 686 | 3300048925 | Ga0496122_0002499 | Ga0496122_0002499_4639_5289 | 214 |
| 687 | 3300048926 | Ga0496123_0003892 | Ga0496123_0003892_9412_10062 | 214 |
| 688 | 3300048926 | Ga0496123_0006638 | Ga0496123_0006638_9387_10037 | 214 |
| 689 | 3300048928 | Ga0496125_0001071 | Ga0496125_0001071_22475_23125 | 214 |
| 690 | 3300048928 | Ga0496125_0110625 | Ga0496125_0110625_267_914 | 214 |
| 691 | 3300048929 | Ga0496126_0001395 | Ga0496126_0001395_8028_8678 | 214 |
| 692 | 3300049516 | Ga0501293_002230 | Ga0501293_002230_90_740 | 214 |
| 693 | 3300049519 | Ga0501296_023011 | Ga0501296_023011_123_773 | 214 |
| 694 | 3300049520 | Ga0501297_003781 | Ga0501297_003781_377_1027 | 214 |
| 695 | 3300049569 | Ga0501032_0088594 | Ga0501032_0088594_544_1194 | 214 |
| 696 | 3300049570 | Ga0501033_0508324 | Ga0501033_0508324_77_727 | 214 |
| 697 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_216718_217368 | 214 |
| 698 | 3300049571 | Ga0501034_0004933 | Ga0501034_0004933_12637_13326 | 214 |
| 699 | 3300049571 | Ga0501034_0120580 | Ga0501034_0120580_1948_2598 | 214 |
| 700 | 3300049572 | Ga0501036_0120599 | Ga0501036_0120599_140_829 | 214 |
| 701 | 3300049579 | Ga0501043_0473433 | Ga0501043_0473433_88_738 | 214 |
| 702 | 3300049580 | Ga0501046_0103890 | Ga0501046_0103890_25_675 | 214 |
| 703 | 3300049581 | Ga0501047_0195837 | Ga0501047_0195837_741_1391 | 214 |
| 704 | 3300049581 | Ga0501047_0359744 | Ga0501047_0359744_235_885 | 214 |
| 705 | 3300049581 | Ga0501047_0380161 | Ga0501047_0380161_573_1223 | 214 |
| 706 | 3300049582 | Ga0501048_0194390 | Ga0501048_0194390_332_982 | 214 |
| 707 | 3300049584 | Ga0501068_0005707 | Ga0501068_0005707_2776_3426 | 214 |
| 708 | 3300049589 | Ga0501073_0094009 | Ga0501073_0094009_442_1092 | 214 |
| 709 | 3300049590 | Ga0501074_0135693 | Ga0501074_0135693_493_1143 | 214 |
| 710 | 3300049651 | Ga0501201_001434 | Ga0501201_001434_715_1365 | 214 |
| 711 | 3300049652 | Ga0501202_000359 | Ga0501202_000359_5544_6194 | 214 |
| 712 | 3300049660 | Ga0501216_002848 | Ga0501216_002848_965_1615 | 214 |
| 713 | 3300049660 | Ga0501216_003468 | Ga0501216_003468_957_1607 | 214 |
| 714 | 3300049661 | Ga0501217_000190 | Ga0501217_000190_968_1618 | 214 |
| 715 | 3300049661 | Ga0501217_006657 | Ga0501217_006657_496_1146 | 214 |
| 716 | 3300049662 | Ga0501222_000546 | Ga0501222_000546_2295_2945 | 214 |
| 717 | 3300049663 | Ga0501223_001006 | Ga0501223_001006_5027_5677 | 214 |
| 718 | 3300049663 | Ga0501223_007708 | Ga0501223_007708_1123_1773 | 214 |
| 719 | 3300049664 | Ga0501224_001719 | Ga0501224_001719_262_912 | 214 |
| 720 | 3300049666 | Ga0501228_002191 | Ga0501228_002191_668_1318 | 214 |
| 721 | 3300049669 | Ga0501235_004964 | Ga0501235_004964_381_1031 | 214 |
| 722 | 3300049673 | Ga0501240_000690 | Ga0501240_000690_217_867 | 214 |
| 723 | 3300049675 | Ga0501243_002611 | Ga0501243_002611_133_783 | 214 |
| 724 | 3300049681 | Ga0501251_003437 | Ga0501251_003437_54_704 | 214 |
| 725 | 3300049683 | Ga0501253_004133 | Ga0501253_004133_1115_1765 | 214 |
| 726 | 3300049688 | Ga0501259_000656 | Ga0501259_000656_4037_4687 | 214 |
| 727 | 3300049704 | Ga0501221_000013 | Ga0501221_000013_11831_12481 | 214 |
| 728 | 3300049705 | Ga0501225_0003389 | Ga0501225_0003389_2070_2720 | 214 |
| 729 | 3300049707 | Ga0501234_000394 | Ga0501234_000394_1509_2159 | 214 |
| 730 | 3300049708 | Ga0501245_000600 | Ga0501245_000600_3200_3850 | 214 |
| 731 | 3300049708 | Ga0501245_010467 | Ga0501245_010467_545_1195 | 214 |
| 732 | 3300049741 | Ga0501079_0225516 | Ga0501079_0225516_183_833 | 214 |
| 733 | 3300049744 | Ga0501083_0089499 | Ga0501083_0089499_1036_1686 | 214 |
| 734 | 3300049744 | Ga0501083_0105612 | Ga0501083_0105612_915_1565 | 214 |
| 735 | 3300049758 | Ga0501241_020851 | Ga0501241_020851_78_728 | 214 |
| 736 | 3300049764 | Ga0501267_000649 | Ga0501267_000649_262_912 | 214 |
| 737 | 3300049822 | Ga0501035_0074759 | Ga0501035_0074759_2186_2836 | 214 |
| 738 | 3300049822 | Ga0501035_0150406 | Ga0501035_0150406_192_881 | 214 |
| 739 | 3300049822 | Ga0501035_0161255 | Ga0501035_0161255_817_1467 | 214 |
| 740 | 3300049823 | Ga0501044_0087396 | Ga0501044_0087396_1002_1652 | 214 |
| 741 | 3300049823 | Ga0501044_0093319 | Ga0501044_0093319_739_1428 | 214 |
| 742 | 3300049823 | Ga0501044_0109831 | Ga0501044_0109831_221_871 | 214 |
| 743 | 3300049823 | Ga0501044_0124127 | Ga0501044_0124127_99_788 | 214 |
| 744 | 3300049823 | Ga0501044_0333409 | Ga0501044_0333409_391_1041 | 214 |
| 745 | 3300049851 | Ga0501212_000331 | Ga0501212_000331_1753_2403 | 214 |
| 746 | 3300050511 | nmdc:mga08y16_518020_c1 | nmdc:mga08y16_518020_c1_472_1122 | 214 |
| 747 | 3300050512 | nmdc:mga0n895_476600_c1 | nmdc:mga0n895_476600_c1_265_915 | 214 |
| 748 | 3300053092 | Ga0500583_0000009 | Ga0500583_0000009_155263_155913 | 214 |
| 749 | 3300053092 | Ga0500583_0019316 | Ga0500583_0019316_1931_2581 | 214 |
| 750 | 3300053093 | Ga0500651_0305007 | Ga0500651_0305007_59_709 | 214 |
| 751 | 3300053118 | Ga0500594_0113772 | Ga0500594_0113772_10_660 | 214 |
| 752 | 3300053130 | Ga0500642_0005680 | Ga0500642_0005680_3286_3936 | 214 |
| 753 | 3300053136 | Ga0500559_0029770 | Ga0500559_0029770_428_1078 | 214 |
| 754 | 3300053136 | Ga0500559_0125128 | Ga0500559_0125128_452_1102 | 214 |
| 755 | 3300053146 | Ga0500588_0001992 | Ga0500588_0001992_777_1427 | 214 |
| 756 | 3300053153 | Ga0500616_0006723 | Ga0500616_0006723_1294_1944 | 214 |
| 757 | 3300053156 | Ga0500622_0002834 | Ga0500622_0002834_1142_1792 | 214 |
| 758 | 3300053156 | Ga0500622_0037129 | Ga0500622_0037129_170_820 | 214 |
| 759 | 3300053156 | Ga0500622_0101421 | Ga0500622_0101421_328_978 | 214 |
| 760 | 3300053156 | Ga0500622_0128548 | Ga0500622_0128548_337_987 | 214 |
| 761 | 3300053178 | Ga0500637_0171897 | Ga0500637_0171897_420_1070 | 214 |
| 762 | 3300054114 | Ga0501084_0366934 | Ga0501084_0366934_466_1116 | 214 |
| 763 | 3300060353 | Ga0501082_0154692 | Ga0501082_0154692_54_704 | 214 |
| 764 | 3300061719 | Ga0466962_0092153 | Ga0466962_0092153_421_1071 | 214 |
| 765 | iso_pu_bacteria | 2839989709 | 2839992815 | 214 |
| 766 | iso_pu_bacteria | 2984572630 | 2984573205 | 214 |
| 767 | iso_pu_bacteria | 2984606641 | 2984610658 | 214 |
| 768 | 2162886007 | SwRhRL2b_contig_1635683 | SwRhRL2b_0497.00004990 | 215 |
| 769 | 3300001979 | JGI24740J21852_10002363 | JGI24740J21852_100023635 | 215 |
| 770 | 3300001979 | JGI24740J21852_10006066 | JGI24740J21852_100060664 | 215 |
| 771 | 3300003203 | JGI25406J46586_10001770 | JGI25406J46586_1000177011 | 215 |
| 772 | 3300003320 | rootH2_10095483 | rootH2_100954832 | 215 |
| 773 | 3300003320 | rootH2_10109685 | rootH2_101096851 | 215 |
| 774 | 3300003322 | rootL2_10063816 | rootL2_100638164 | 215 |
| 775 | 3300003323 | rootH1_10039994 | rootH1_100399944 | 215 |
| 776 | 3300003354 | JGI25160J50197_1000852 | JGI25160J50197_10008528 | 215 |
| 777 | 3300003794 | Ga0055531_10000115 | Ga0055531_1000011549 | 215 |
| 778 | 3300005262 | Ga0065165_1010249 | Ga0065165_10102495 | 215 |
| 779 | 3300005327 | Ga0070658_10220966 | Ga0070658_102209662 | 215 |
| 780 | 3300005329 | Ga0070683_100008602 | Ga0070683_1000086022 | 215 |
| 781 | 3300005331 | Ga0070670_100036355 | Ga0070670_1000363554 | 215 |
| 782 | 3300005331 | Ga0070670_100907355 | Ga0070670_1009073551 | 215 |
| 783 | 3300005335 | Ga0070666_10020565 | Ga0070666_100205652 | 215 |
| 784 | 3300005340 | Ga0070689_100434389 | Ga0070689_1004343892 | 215 |
| 785 | 3300005344 | Ga0070661_100009332 | Ga0070661_1000093321 | 215 |
| 786 | 3300005354 | Ga0070675_100117374 | Ga0070675_1001173742 | 215 |
| 787 | 3300005354 | Ga0070675_100520910 | Ga0070675_1005209101 | 215 |
| 788 | 3300005365 | Ga0070688_100222132 | Ga0070688_1002221322 | 215 |
| 789 | 3300005366 | Ga0070659_100004124 | Ga0070659_1000041242 | 215 |
| 790 | 3300005438 | Ga0070701_10208116 | Ga0070701_102081161 | 215 |
| 791 | 3300005455 | Ga0070663_100409489 | Ga0070663_1004094892 | 215 |
| 792 | 3300005457 | Ga0070662_100078679 | Ga0070662_1000786792 | 215 |
| 793 | 3300005459 | Ga0068867_100245665 | Ga0068867_1002456652 | 215 |
| 794 | 3300005459 | Ga0068867_100281240 | Ga0068867_1002812402 | 215 |
| 795 | 3300005466 | Ga0070685_10010889 | Ga0070685_100108893 | 215 |
| 796 | 3300005466 | Ga0070685_10063704 | Ga0070685_100637042 | 215 |
| 797 | 3300005530 | Ga0070679_100189034 | Ga0070679_1001890343 | 215 |
| 798 | 3300005530 | Ga0070679_100237816 | Ga0070679_1002378161 | 215 |
| 799 | 3300005535 | Ga0070684_100020041 | Ga0070684_1000200414 | 215 |
| 800 | 3300005535 | Ga0070684_100242305 | Ga0070684_1002423052 | 215 |
| 801 | 3300005539 | Ga0068853_100008021 | Ga0068853_1000080212 | 215 |
| 802 | 3300005563 | Ga0068855_100070405 | Ga0068855_1000704052 | 215 |
| 803 | 3300005577 | Ga0068857_100052373 | Ga0068857_1000523732 | 215 |
| 804 | 3300005614 | Ga0068856_100013283 | Ga0068856_1000132832 | 215 |
| 805 | 3300005616 | Ga0068852_100089148 | Ga0068852_1000891482 | 215 |
| 806 | 3300005616 | Ga0068852_100137786 | Ga0068852_1001377862 | 215 |
| 807 | 3300005618 | Ga0068864_100221186 | Ga0068864_1002211862 | 215 |
| 808 | 3300005618 | Ga0068864_100356698 | Ga0068864_1003566982 | 215 |
| 809 | 3300005843 | Ga0068860_100328343 | Ga0068860_1003283432 | 215 |
| 810 | 3300005843 | Ga0068860_100612197 | Ga0068860_1006121972 | 215 |
| 811 | 3300005844 | Ga0068862_101183361 | Ga0068862_1011833611 | 215 |
| 812 | 3300005985 | Ga0081539_10003031 | Ga0081539_1000303112 | 215 |
| 813 | 3300006195 | Ga0075366_10246641 | Ga0075366_102466412 | 215 |
| 814 | 3300009176 | Ga0105242_10160382 | Ga0105242_101603822 | 215 |
| 815 | 3300009176 | Ga0105242_10320408 | Ga0105242_103204082 | 215 |
| 816 | 3300009545 | Ga0105237_10003065 | Ga0105237_1000306511 | 215 |
| 817 | 3300011119 | Ga0105246_10352988 | Ga0105246_103529881 | 215 |
| 818 | 3300013100 | Ga0157373_10093372 | Ga0157373_100933723 | 215 |
| 819 | 3300013100 | Ga0157373_10259770 | Ga0157373_102597702 | 215 |
| 820 | 3300013102 | Ga0157371_10041420 | Ga0157371_100414202 | 215 |
| 821 | 3300013105 | Ga0157369_10058863 | Ga0157369_100588634 | 215 |
| 822 | 3300013105 | Ga0157369_10069399 | Ga0157369_100693993 | 215 |
| 823 | 3300013296 | Ga0157374_10014871 | Ga0157374_100148713 | 215 |
| 824 | 3300013296 | Ga0157374_10017378 | Ga0157374_100173783 | 215 |
| 825 | 3300013297 | Ga0157378_10013430 | Ga0157378_100134305 | 215 |
| 826 | 3300013297 | Ga0157378_10075578 | Ga0157378_100755782 | 215 |
| 827 | 3300013306 | Ga0163162_10807736 | Ga0163162_108077362 | 215 |
| 828 | 3300013307 | Ga0157372_10106229 | Ga0157372_101062292 | 215 |
| 829 | 3300013307 | Ga0157372_10139972 | Ga0157372_101399722 | 215 |
| 830 | 3300013307 | Ga0157372_10597830 | Ga0157372_105978302 | 215 |
| 831 | 3300013307 | Ga0157372_10923679 | Ga0157372_109236792 | 215 |
| 832 | 3300013308 | Ga0157375_10798836 | Ga0157375_107988362 | 215 |
| 833 | 3300014325 | Ga0163163_10440651 | Ga0163163_104406512 | 215 |
| 834 | 3300014325 | Ga0163163_10664681 | Ga0163163_106646812 | 215 |
| 835 | 3300014325 | Ga0163163_10699592 | Ga0163163_106995922 | 215 |
| 836 | 3300014326 | Ga0157380_10006646 | Ga0157380_100066462 | 215 |
| 837 | 3300014326 | Ga0157380_10093003 | Ga0157380_100930033 | 215 |
| 838 | 3300014969 | Ga0157376_10190638 | Ga0157376_101906382 | 215 |
| 839 | 3300017792 | Ga0163161_10141137 | Ga0163161_101411372 | 215 |
| 840 | 3300021384 | Ga0213876_10001099 | Ga0213876_1000109913 | 215 |
| 841 | 3300021384 | Ga0213876_10049238 | Ga0213876_100492381 | 215 |
| 842 | 3300025208 | Ga0209436_100993 | Ga0209436_1009933 | 215 |
| 843 | 3300025208 | Ga0209436_103150 | Ga0209436_1031502 | 215 |
| 844 | 3300025242 | Ga0209258_100032 | Ga0209258_10003288 | 215 |
| 845 | 3300025254 | Ga0209148_1000223 | Ga0209148_100022338 | 215 |
| 846 | 3300025284 | Ga0209130_1000921 | Ga0209130_10009216 | 215 |
| 847 | 3300025302 | Ga0207426_1000023 | Ga0207426_100002399 | 215 |
| 848 | 3300025302 | Ga0207426_1000660 | Ga0207426_100066036 | 215 |
| 849 | 3300025304 | Ga0209257_1000128 | Ga0209257_1000128139 | 215 |
| 850 | 3300025904 | Ga0207647_10051468 | Ga0207647_100514682 | 215 |
| 851 | 3300025909 | Ga0207705_10564271 | Ga0207705_105642711 | 215 |
| 852 | 3300025914 | Ga0207671_10068007 | Ga0207671_100680073 | 215 |
| 853 | 3300025917 | Ga0207660_10633999 | Ga0207660_106339992 | 215 |
| 854 | 3300025918 | Ga0207662_10116436 | Ga0207662_101164362 | 215 |
| 855 | 3300025919 | Ga0207657_10015786 | Ga0207657_100157864 | 215 |
| 856 | 3300025920 | Ga0207649_10055435 | Ga0207649_100554352 | 215 |
| 857 | 3300025921 | Ga0207652_10491483 | Ga0207652_104914832 | 215 |
| 858 | 3300025923 | Ga0207681_10039258 | Ga0207681_100392582 | 215 |
| 859 | 3300025931 | Ga0207644_10441847 | Ga0207644_104418471 | 215 |
| 860 | 3300025933 | Ga0207706_10013744 | Ga0207706_100137446 | 215 |
| 861 | 3300025934 | Ga0207686_10405055 | Ga0207686_104050551 | 215 |
| 862 | 3300025936 | Ga0207670_10433465 | Ga0207670_104334651 | 215 |
| 863 | 3300025939 | Ga0207665_10153835 | Ga0207665_101538352 | 215 |
| 864 | 3300025942 | Ga0207689_10170321 | Ga0207689_101703212 | 215 |
| 865 | 3300025944 | Ga0207661_10042201 | Ga0207661_100422012 | 215 |
| 866 | 3300025945 | Ga0207679_10005167 | Ga0207679_100051672 | 215 |
| 867 | 3300025981 | Ga0207640_10065684 | Ga0207640_100656842 | 215 |
| 868 | 3300025981 | Ga0207640_10627914 | Ga0207640_106279141 | 215 |
| 869 | 3300026035 | Ga0207703_10784318 | Ga0207703_107843182 | 215 |
| 870 | 3300026041 | Ga0207639_10062364 | Ga0207639_100623642 | 215 |
| 871 | 3300026041 | Ga0207639_10299287 | Ga0207639_102992872 | 215 |
| 872 | 3300026067 | Ga0207678_10120280 | Ga0207678_101202802 | 215 |
| 873 | 3300026089 | Ga0207648_10007533 | Ga0207648_100075336 | 215 |
| 874 | 3300026089 | Ga0207648_10187170 | Ga0207648_101871701 | 215 |
| 875 | 3300026095 | Ga0207676_10180756 | Ga0207676_101807563 | 215 |
| 876 | 3300026116 | Ga0207674_10054338 | Ga0207674_100543382 | 215 |
| 877 | 3300026118 | Ga0207675_100748370 | Ga0207675_1007483701 | 215 |
| 878 | 3300026142 | Ga0207698_10170744 | Ga0207698_101707442 | 215 |
| 879 | 3300026142 | Ga0207698_10356392 | Ga0207698_103563922 | 215 |
| 880 | 3300026142 | Ga0207698_10700201 | Ga0207698_107002011 | 215 |
| 881 | 3300028381 | Ga0268264_10035714 | Ga0268264_100357141 | 215 |
| 882 | 3300028381 | Ga0268264_10408330 | Ga0268264_104083302 | 215 |
| 883 | 3300028577 | Ga0265318_10035597 | Ga0265318_100355973 | 215 |
| 884 | 3300028653 | Ga0265323_10069694 | Ga0265323_100696942 | 215 |
| 885 | 3300028794 | Ga0307515_10140321 | Ga0307515_101403211 | 215 |
| 886 | 3300031251 | Ga0265327_10018384 | Ga0265327_100183843 | 215 |
| 887 | 3300031251 | Ga0265327_10043261 | Ga0265327_100432613 | 215 |
| 888 | 3300031548 | Ga0307408_100000170 | Ga0307408_10000017028 | 215 |
| 889 | 3300031727 | Ga0316576_10092644 | Ga0316576_100926442 | 215 |
| 890 | 3300031727 | Ga0316576_10104670 | Ga0316576_101046702 | 215 |
| 891 | 3300032005 | Ga0307411_10014850 | Ga0307411_100148505 | 215 |
| 892 | 3300036401 | Ga0373937_0214646 | Ga0373937_0214646_234_881 | 215 |
| 893 | 3300039437 | Ga0436365_0504388 | Ga0436365_0504388_212_865 | 215 |
| 894 | 3300039437 | Ga0436365_0701023 | Ga0436365_0701023_1550_2203 | 215 |
| 895 | 3300039437 | Ga0436365_0888373 | Ga0436365_0888373_4165_4818 | 215 |
| 896 | 3300039437 | Ga0436365_1207402 | Ga0436365_1207402_2055_2708 | 215 |
| 897 | 3300039437 | Ga0436365_1591745 | Ga0436365_1591745_13522_14175 | 215 |
| 898 | 3300042876 | Ga0451577_0000279 | Ga0451577_0000279_55343_56026 | 215 |
| 899 | 3300042876 | Ga0451577_0014708 | Ga0451577_0014708_3882_4544 | 215 |
| 900 | 3300042876 | Ga0451577_0029042 | Ga0451577_0029042_1589_2251 | 215 |
| 901 | 3300042876 | Ga0451577_0076278 | Ga0451577_0076278_1848_2498 | 215 |
| 902 | 3300042876 | Ga0451577_0164192 | Ga0451577_0164192_1080_1742 | 215 |
| 903 | 3300042876 | Ga0451577_0207196 | Ga0451577_0207196_1021_1683 | 215 |
| 904 | 3300042876 | Ga0451577_0265742 | Ga0451577_0265742_335_1018 | 215 |
| 905 | 3300042876 | Ga0451577_0321281 | Ga0451577_0321281_510_1163 | 215 |
| 906 | 3300042876 | Ga0451577_0335192 | Ga0451577_0335192_695_1357 | 215 |
| 907 | 3300042876 | Ga0451577_0515992 | Ga0451577_0515992_48_710 | 215 |
| 908 | 3300044673 | Ga0453683_0000031 | Ga0453683_0000031_200554_201237 | 215 |
| 909 | 3300044673 | Ga0453683_0000190 | Ga0453683_0000190_51982_52644 | 215 |
| 910 | 3300044673 | Ga0453683_0000238 | Ga0453683_0000238_51123_51785 | 215 |
| 911 | 3300044673 | Ga0453683_0001799 | Ga0453683_0001799_12528_13190 | 215 |
| 912 | 3300044673 | Ga0453683_0014745 | Ga0453683_0014745_2307_2960 | 215 |
| 913 | 3300044673 | Ga0453683_0019154 | Ga0453683_0019154_2622_3284 | 215 |
| 914 | 3300044673 | Ga0453683_0105006 | Ga0453683_0105006_1036_1698 | 215 |
| 915 | 3300044673 | Ga0453683_0354738 | Ga0453683_0354738_185_847 | 215 |
| 916 | 3300044712 | Ga0453684_0000161 | Ga0453684_0000161_32719_33381 | 215 |
| 917 | 3300044712 | Ga0453684_0000213 | Ga0453684_0000213_141487_142149 | 215 |
| 918 | 3300044712 | Ga0453684_0000225 | Ga0453684_0000225_225197_225859 | 215 |
| 919 | 3300044712 | Ga0453684_0000929 | Ga0453684_0000929_55343_56026 | 215 |
| 920 | 3300044712 | Ga0453684_0001226 | Ga0453684_0001226_6177_6839 | 215 |
| 921 | 3300044712 | Ga0453684_0002475 | Ga0453684_0002475_35774_36424 | 215 |
| 922 | 3300044712 | Ga0453684_0007656 | Ga0453684_0007656_8775_9521 | 215 |
| 923 | 3300044712 | Ga0453684_0011479 | Ga0453684_0011479_3460_4110 | 215 |
| 924 | 3300044712 | Ga0453684_0041744 | Ga0453684_0041744_252_914 | 215 |
| 925 | 3300044712 | Ga0453684_0051343 | Ga0453684_0051343_1999_2661 | 215 |
| 926 | 3300044712 | Ga0453684_0091408 | Ga0453684_0091408_690_1352 | 215 |
| 927 | 3300044712 | Ga0453684_0098471 | Ga0453684_0098471_1954_2616 | 215 |
| 928 | 3300044712 | Ga0453684_0343859 | Ga0453684_0343859_12_695 | 215 |
| 929 | 3300044712 | Ga0453684_0558655 | Ga0453684_0558655_237_887 | 215 |
| 930 | 3300044735 | Ga0466968_0102946 | Ga0466968_0102946_27_680 | 215 |
| 931 | 3300044765 | Ga0466970_0107980 | Ga0466970_0107980_836_1489 | 215 |
| 932 | 3300045051 | Ga0451576_0000012 | Ga0451576_0000012_277331_277978 | 215 |
| 933 | 3300045051 | Ga0451576_0000059 | Ga0451576_0000059_264795_265457 | 215 |
| 934 | 3300045051 | Ga0451576_0000414 | Ga0451576_0000414_55343_56026 | 215 |
| 935 | 3300045051 | Ga0451576_0000729 | Ga0451576_0000729_35846_36508 | 215 |
| 936 | 3300045051 | Ga0451576_0000948 | Ga0451576_0000948_47601_48263 | 215 |
| 937 | 3300045051 | Ga0451576_0011923 | Ga0451576_0011923_4411_5073 | 215 |
| 938 | 3300045051 | Ga0451576_0017125 | Ga0451576_0017125_1734_2396 | 215 |
| 939 | 3300045051 | Ga0451576_0020992 | Ga0451576_0020992_3175_3858 | 215 |
| 940 | 3300045051 | Ga0451576_0191966 | Ga0451576_0191966_521_1204 | 215 |
| 941 | 3300045051 | Ga0451576_0238236 | Ga0451576_0238236_87_749 | 215 |
| 942 | 3300045051 | Ga0451576_0811336 | Ga0451576_0811336_107_769 | 215 |
| 943 | 3300046533 | Ga0495640_0164852 | Ga0495640_0164852_260_907 | 215 |
| 944 | 3300046642 | Ga0495634_0027915 | Ga0495634_0027915_509_1156 | 215 |
| 945 | 3300048927 | Ga0496124_0113677 | Ga0496124_0113677_470_1123 | 215 |
| 946 | 3300049570 | Ga0501033_0124084 | Ga0501033_0124084_89_742 | 215 |
| 947 | 3300049586 | Ga0501070_0412788 | Ga0501070_0412788_78_731 | 215 |
| 948 | 3300049589 | Ga0501073_0096255 | Ga0501073_0096255_775_1428 | 215 |
| 949 | 3300049649 | Ga0501198_003624 | Ga0501198_003624_927_1574 | 215 |
| 950 | 3300049742 | Ga0501080_0628152 | Ga0501080_0628152_138_791 | 215 |
| 951 | 3300049822 | Ga0501035_0496559 | Ga0501035_0496559_288_941 | 215 |
| 952 | 3300053088 | Ga0500644_0089806 | Ga0500644_0089806_248_997 | 215 |
| 953 | 3300053092 | Ga0500583_0015550 | Ga0500583_0015550_270_947 | 215 |
| 954 | 3300053093 | Ga0500651_0104709 | Ga0500651_0104709_223_900 | 215 |
| 955 | 3300053108 | Ga0500562_000035 | Ga0500562_000035_1190_1939 | 215 |
| 956 | 3300053109 | Ga0500569_000056 | Ga0500569_000056_15956_16633 | 215 |
| 957 | 3300053142 | Ga0500577_0001778 | Ga0500577_0001778_3963_4640 | 215 |
| 958 | 3300053153 | Ga0500616_0084767 | Ga0500616_0084767_447_1124 | 215 |
| 959 | 3300053153 | Ga0500616_0136258 | Ga0500616_0136258_454_1107 | 215 |
| 960 | 3300053156 | Ga0500622_0001619 | Ga0500622_0001619_10108_10761 | 215 |
| 961 | 3300053730 | Ga0500645_065109 | Ga0500645_065109_97_750 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o5o-assembly1.cif.gz_B | crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution | 0.8833 | 2 | 214 |
| 2e55-assembly1.cif.gz_D | structure of aq2163 protein from aquifex aeolicus | 0.8832 | 1 | 211 |
| 1v9s-assembly1.cif.gz_C | crystal structure of tt0130 protein from thermus thermophilus hb8 | 0.8757 | 2 | 214 |
| 6wn8-assembly1.cif.gz_D | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.875 | 2 | 214 |
| 6wn8-assembly3.cif.gz_I | 2.70 angstrom resolution crystal structure of uracil phosphoribosyl transferase from klebsiella pneumoniae | 0.874 | 2 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e55D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8832 | 1 | 211 | 3.40.50.2020 |
| af_Q2FWE6_1_209_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8773 | 2 | 214 | 3.40.50.2020 |
| af_Q5ANN6_315_525_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8759 | 2 | 190 | 3.40.50.2020 |
| 5e38B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8668 | 3 | 211 | 3.40.50.2020 |
| af_Q2FWE6_1_209_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8616 | 2 | 214 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350YYJ4-F1-model_v4 | Uracil phosphoribosyltransferase | 0.979 | 2 | 187 |
GO:0016757
|
| AF-A0A6L4ZC58-F1-model_v4 | Uracil phosphoribosyltransferase | 0.978 | 1 | 161 |
|
| AF-A0A661Y0E1-F1-model_v4 | Uracil phosphoribosyltransferase | 0.9679 | 3 | 92 |
GO:0016757
|
| AF-A0A6L4ZC58-F1-model_v4 | Uracil phosphoribosyltransferase | 0.9604 | 1 | 161 |
|
| AF-A0A350YYJ4-F1-model_v4 | Uracil phosphoribosyltransferase | 0.9587 | 2 | 187 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar