F486863
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 961 | 484 | 913 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10444222|Ga0105239_104442222 |
| Length | 307 |
| Sequence | VNVSQSNRGASLVHERALGKPGVDGATGPKLFFTRPVEASVAHRPPPAAGDSPMTDRLAGKTAFITAAGQGIGRATAEAFVREGARVVATDINAQSLAELARATGCETRRLDVTDASAVLAASIEANAKGTVNVLFNAAGFVHHGTILECDEVAFDFSIDLNVRAMYRVTRAFLPPMLKAGGGSIINVASAASSIKGVPNRFVYTGTKAAVIGMTKSIAADFITRGVRCNAICPGTVESPSLRQRIDAQAKTSGQTVADIEAAFVARQPMGRIGTAAEIAALAVYLASDESAFTTGTTHVIDGGWSM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 3 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 6 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 7 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 8 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 9 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 10 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 11 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 12 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 13 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 14 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 15 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 16 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 17 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 18 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 19 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 20 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 21 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 22 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 23 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 24 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 27 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 28 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 29 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 30 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 31 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 32 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 33 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 34 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 35 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 36 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 37 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 40 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 41 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 115 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 116 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 117 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 118 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 119 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 120 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 121 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 122 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 177 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 266 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 268 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 269 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 270 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 271 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 272 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 273 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 274 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 275 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 276 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 280 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 282 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 300 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 301 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 305 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 306 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 307 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 308 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 309 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 312 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 313 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 314 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 415 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 416 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 417 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 428 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 457 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 458 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 461 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 462 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 463 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 464 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 471 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 472 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 476 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 479 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 480 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 481 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 482 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 483 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 484 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.59 |
| Metatranscriptomes | 0.42 |
| Isolates | 4.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.93 |
| Nodule | 0.52 |
| Rhizoplane | 3.64 |
| Rhizosphere | 75.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1052005 | 2162886007 | Bacteria | 2716 |
| 2 | JGI24740J21852_10000445 | 3300001979 | Bacteria | 17693 |
| 3 | JGI25162J39368_1000067 | 3300002737 | Bacteria | 129813 |
| 4 | JGI25163J39215_1000114 | 3300002771 | Bacteria | 33694 |
| 5 | JGI25164J39214_1000039 | 3300002772 | Bacteria | 129437 |
| 6 | JGI25406J46586_10016018 | 3300003203 | Bacteria | 3140 |
| 7 | JGI25406J46586_10026364 | 3300003203 | Bacteria | 2241 |
| 8 | JGI25153J46596_10033239 | 3300003215 | Bacteria | 1706 |
| 9 | rootH1_10009674 | 3300003323 | Bacteria | 20975 |
| 10 | Ga0055538_1000052 | 3300003751 | Bacteria | 129813 |
| 11 | Ga0055539_1000077 | 3300003752 | Bacteria | 129445 |
| 12 | Ga0055539_1000100 | 3300003752 | Bacteria | 100406 |
| 13 | Ga0055533_1000083 | 3300003756 | Bacteria | 129813 |
| 14 | Ga0055533_1006178 | 3300003756 | Bacteria | 1803 |
| 15 | Ga0055533_1007660 | 3300003756 | Bacteria | 1445 |
| 16 | Ga0055532_1000127 | 3300003758 | Bacteria | 75964 |
| 17 | Ga0055525_1000110 | 3300003759 | Bacteria | 129813 |
| 18 | Ga0055525_1000487 | 3300003759 | Bacteria | 20653 |
| 19 | Ga0055527_1001540 | 3300003760 | Bacteria | 4705 |
| 20 | Ga0055535_1000140 | 3300003761 | Bacteria | 75964 |
| 21 | Ga0055526_1005610 | 3300003771 | Bacteria | 7145 |
| 22 | Ga0055536_1000057 | 3300003781 | Bacteria | 104652 |
| 23 | Ga0055530_10002520 | 3300003791 | Bacteria | 11694 |
| 24 | Ga0055531_10000053 | 3300003794 | Bacteria | 124623 |
| 25 | Ga0055531_10000224 | 3300003794 | Bacteria | 62709 |
| 26 | Ga0055531_10001089 | 3300003794 | Bacteria | 21336 |
| 27 | Ga0055531_10002666 | 3300003794 | Bacteria | 11771 |
| 28 | Ga0055531_10007156 | 3300003794 | Bacteria | 6152 |
| 29 | Ga0055541_1000054 | 3300003841 | Bacteria | 129813 |
| 30 | Ga0055541_1010003 | 3300003841 | Bacteria | 1445 |
| 31 | Ga0055541_1011678 | 3300003841 | Bacteria | 1281 |
| 32 | Ga0058692_1000054 | 3300003856 | Bacteria | 106871 |
| 33 | Ga0065165_1000660 | 3300005262 | Bacteria | 49811 |
| 34 | Ga0065704_10000086 | 3300005289 | Bacteria | 27230 |
| 35 | Ga0070658_10323291 | 3300005327 | Bacteria | 1317 |
| 36 | Ga0070676_10002823 | 3300005328 | Bacteria | 8978 |
| 37 | Ga0070676_10015199 | 3300005328 | Bacteria | 4244 |
| 38 | Ga0070670_100000709 | 3300005331 | Bacteria | 25835 |
| 39 | Ga0070670_100733791 | 3300005331 | Bacteria | 889 |
| 40 | Ga0068869_100001193 | 3300005334 | Bacteria | 15258 |
| 41 | Ga0068869_100014797 | 3300005334 | Bacteria | 5219 |
| 42 | Ga0068869_100149052 | 3300005334 | Bacteria | 1813 |
| 43 | Ga0070666_10001793 | 3300005335 | Bacteria | 13078 |
| 44 | Ga0070666_10238456 | 3300005335 | Bacteria | 1286 |
| 45 | Ga0070680_100004336 | 3300005336 | Bacteria | 10668 |
| 46 | Ga0070682_100067114 | 3300005337 | Bacteria | 2284 |
| 47 | Ga0068868_100000185 | 3300005338 | Bacteria | 41542 |
| 48 | Ga0068868_100012143 | 3300005338 | Bacteria | 6289 |
| 49 | Ga0070660_100003037 | 3300005339 | Bacteria | 11554 |
| 50 | Ga0070660_100005623 | 3300005339 | Bacteria | 8689 |
| 51 | Ga0070660_100084247 | 3300005339 | Bacteria | 2498 |
| 52 | Ga0070689_100010833 | 3300005340 | Bacteria | 6516 |
| 53 | Ga0070691_10105692 | 3300005341 | Bacteria | 1403 |
| 54 | Ga0070687_100024370 | 3300005343 | Bacteria | 2888 |
| 55 | Ga0070661_100000119 | 3300005344 | Bacteria | 65829 |
| 56 | Ga0070668_100029171 | 3300005347 | Bacteria | 4190 |
| 57 | Ga0070668_100077972 | 3300005347 | Bacteria | 2590 |
| 58 | Ga0070668_100127176 | 3300005347 | Bacteria | 2042 |
| 59 | Ga0070668_100196590 | 3300005347 | Bacteria | 1654 |
| 60 | Ga0070669_100023411 | 3300005353 | Bacteria | 4423 |
| 61 | Ga0070669_100029773 | 3300005353 | Bacteria | 3938 |
| 62 | Ga0070669_100623658 | 3300005353 | Bacteria | 905 |
| 63 | Ga0070675_100001427 | 3300005354 | Bacteria | 17552 |
| 64 | Ga0070675_100002466 | 3300005354 | Bacteria | 13837 |
| 65 | Ga0070671_100009724 | 3300005355 | Bacteria | 7724 |
| 66 | Ga0070671_100015468 | 3300005355 | Bacteria | 6165 |
| 67 | Ga0070673_100002536 | 3300005364 | Bacteria | 11150 |
| 68 | Ga0070673_100143386 | 3300005364 | Bacteria | 2017 |
| 69 | Ga0070688_100223244 | 3300005365 | Bacteria | 1329 |
| 70 | Ga0070659_100021337 | 3300005366 | Bacteria | 4932 |
| 71 | Ga0070659_100471499 | 3300005366 | Bacteria | 1067 |
| 72 | Ga0070667_100006541 | 3300005367 | Bacteria | 9687 |
| 73 | Ga0070667_100020821 | 3300005367 | Bacteria | 5447 |
| 74 | Ga0070667_100077412 | 3300005367 | Bacteria | 2840 |
| 75 | Ga0070667_100168469 | 3300005367 | Bacteria | 1932 |
| 76 | Ga0070667_100273872 | 3300005367 | Bacteria | 1514 |
| 77 | Ga0070709_10036865 | 3300005434 | Bacteria | 2983 |
| 78 | Ga0070709_10184226 | 3300005434 | Bacteria | 1468 |
| 79 | Ga0070714_100034759 | 3300005435 | Bacteria | 4221 |
| 80 | Ga0070713_100017602 | 3300005436 | Bacteria | 5409 |
| 81 | Ga0070713_100144293 | 3300005436 | Bacteria | 2111 |
| 82 | Ga0070710_10255288 | 3300005437 | Bacteria | 1128 |
| 83 | Ga0070701_10116317 | 3300005438 | Bacteria | 1501 |
| 84 | Ga0070711_100030764 | 3300005439 | Bacteria | 3557 |
| 85 | Ga0070700_100243235 | 3300005441 | Bacteria | 1287 |
| 86 | Ga0070708_100013868 | 3300005445 | Bacteria | 6619 |
| 87 | Ga0070663_100000035 | 3300005455 | Bacteria | 66161 |
| 88 | Ga0070663_100020341 | 3300005455 | Bacteria | 4393 |
| 89 | Ga0070663_100115861 | 3300005455 | Bacteria | 2019 |
| 90 | Ga0070662_100003027 | 3300005457 | Bacteria | 10453 |
| 91 | Ga0070662_100007037 | 3300005457 | Bacteria | 7278 |
| 92 | Ga0070662_100155742 | 3300005457 | Bacteria | 1783 |
| 93 | Ga0070681_10101502 | 3300005458 | Bacteria | 2822 |
| 94 | Ga0070681_10109271 | 3300005458 | Bacteria | 2706 |
| 95 | Ga0070681_10109983 | 3300005458 | Bacteria | 2695 |
| 96 | Ga0068867_100030151 | 3300005459 | Bacteria | 3912 |
| 97 | Ga0068867_100352825 | 3300005459 | Bacteria | 1228 |
| 98 | Ga0070706_100001937 | 3300005467 | Bacteria | 21337 |
| 99 | Ga0070706_100048699 | 3300005467 | Bacteria | 3911 |
| 100 | Ga0070707_100176391 | 3300005468 | Bacteria | 2083 |
| 101 | Ga0070698_100180024 | 3300005471 | Bacteria | 2052 |
| 102 | Ga0070699_100089170 | 3300005518 | Bacteria | 2694 |
| 103 | Ga0070679_100081200 | 3300005530 | Bacteria | 3231 |
| 104 | Ga0070684_100018963 | 3300005535 | Bacteria | 5681 |
| 105 | Ga0070697_100000588 | 3300005536 | Bacteria | 27480 |
| 106 | Ga0070697_100081899 | 3300005536 | Bacteria | 2660 |
| 107 | Ga0068853_100009939 | 3300005539 | Bacteria | 7683 |
| 108 | Ga0068853_100029693 | 3300005539 | Bacteria | 4611 |
| 109 | Ga0068853_100189365 | 3300005539 | Bacteria | 1869 |
| 110 | Ga0068853_100333581 | 3300005539 | Bacteria | 1408 |
| 111 | Ga0070672_100015407 | 3300005543 | Bacteria | 5441 |
| 112 | Ga0070672_100117142 | 3300005543 | Bacteria | 2177 |
| 113 | Ga0070672_100221402 | 3300005543 | Bacteria | 1587 |
| 114 | Ga0070672_100310739 | 3300005543 | Bacteria | 1338 |
| 115 | Ga0070686_100038490 | 3300005544 | Bacteria | 2973 |
| 116 | Ga0070693_100145147 | 3300005547 | Bacteria | 1498 |
| 117 | Ga0070693_100193944 | 3300005547 | Bacteria | 1315 |
| 118 | Ga0070665_100033725 | 3300005548 | Bacteria | 5150 |
| 119 | Ga0070665_100712021 | 3300005548 | Bacteria | 1017 |
| 120 | Ga0068855_100011273 | 3300005563 | Bacteria | 10796 |
| 121 | Ga0068855_100023793 | 3300005563 | Bacteria | 7337 |
| 122 | Ga0068855_100025726 | 3300005563 | Bacteria | 7038 |
| 123 | Ga0068855_100111463 | 3300005563 | Bacteria | 3141 |
| 124 | Ga0068855_100200920 | 3300005563 | Bacteria | 2244 |
| 125 | Ga0068855_100505891 | 3300005563 | Bacteria | 1312 |
| 126 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 127 | Ga0070664_100111815 | 3300005564 | Bacteria | 2384 |
| 128 | Ga0070664_100160719 | 3300005564 | Bacteria | 1987 |
| 129 | Ga0068857_100144683 | 3300005577 | Bacteria | 2150 |
| 130 | Ga0068854_100012088 | 3300005578 | Bacteria | 5645 |
| 131 | Ga0068854_100066061 | 3300005578 | Bacteria | 2631 |
| 132 | Ga0068854_100199823 | 3300005578 | Bacteria | 1571 |
| 133 | Ga0068856_100000862 | 3300005614 | Bacteria | 32543 |
| 134 | Ga0068856_100033738 | 3300005614 | Bacteria | 5013 |
| 135 | Ga0068856_100065349 | 3300005614 | Bacteria | 3595 |
| 136 | Ga0068856_100150441 | 3300005614 | Bacteria | 2337 |
| 137 | Ga0068856_100441686 | 3300005614 | Bacteria | 1322 |
| 138 | Ga0070702_100013026 | 3300005615 | Bacteria | 4188 |
| 139 | Ga0068852_100023260 | 3300005616 | Bacteria | 4985 |
| 140 | Ga0068859_100000211 | 3300005617 | Bacteria | 58042 |
| 141 | Ga0068859_100001283 | 3300005617 | Bacteria | 25657 |
| 142 | Ga0068859_100474436 | 3300005617 | Bacteria | 1347 |
| 143 | Ga0068864_100001050 | 3300005618 | Bacteria | 23192 |
| 144 | Ga0068864_100014858 | 3300005618 | Bacteria | 6469 |
| 145 | Ga0068861_100000536 | 3300005719 | Bacteria | 22261 |
| 146 | Ga0068861_100106030 | 3300005719 | Bacteria | 2244 |
| 147 | Ga0068851_10078654 | 3300005834 | Bacteria | 1718 |
| 148 | Ga0068863_100003996 | 3300005841 | Bacteria | 14561 |
| 149 | Ga0068863_100004913 | 3300005841 | Bacteria | 13173 |
| 150 | Ga0068863_100087518 | 3300005841 | Bacteria | 2951 |
| 151 | Ga0068863_100939432 | 3300005841 | Bacteria | 866 |
| 152 | Ga0068858_100000885 | 3300005842 | Bacteria | 31082 |
| 153 | Ga0068858_100005568 | 3300005842 | Bacteria | 12322 |
| 154 | Ga0068858_100057021 | 3300005842 | Bacteria | 3610 |
| 155 | Ga0068858_100758041 | 3300005842 | Bacteria | 946 |
| 156 | Ga0068860_100004169 | 3300005843 | Bacteria | 14821 |
| 157 | Ga0068860_100046824 | 3300005843 | Bacteria | 4123 |
| 158 | Ga0068860_100067502 | 3300005843 | Bacteria | 3398 |
| 159 | Ga0068860_100114978 | 3300005843 | Bacteria | 2573 |
| 160 | Ga0068860_100140715 | 3300005843 | Bacteria | 2319 |
| 161 | Ga0068862_100038274 | 3300005844 | Bacteria | 4067 |
| 162 | Ga0068862_100138508 | 3300005844 | Bacteria | 2159 |
| 163 | Ga0081538_10003998 | 3300005981 | Bacteria | 13729 |
| 164 | Ga0081540_1002396 | 3300005983 | Bacteria | 15290 |
| 165 | Ga0081539_10000283 | 3300005985 | Bacteria | 114603 |
| 166 | Ga0081539_10136948 | 3300005985 | Bacteria | 1194 |
| 167 | Ga0070717_10002258 | 3300006028 | Bacteria | 13509 |
| 168 | Ga0070717_10326679 | 3300006028 | Bacteria | 1368 |
| 169 | Ga0070715_10002299 | 3300006163 | Bacteria | 5826 |
| 170 | Ga0070716_100074489 | 3300006173 | Bacteria | 2006 |
| 171 | Ga0075362_10021179 | 3300006177 | Bacteria | 2724 |
| 172 | Ga0075366_10013029 | 3300006195 | Bacteria | 4728 |
| 173 | Ga0097621_100028263 | 3300006237 | Bacteria | 4420 |
| 174 | Ga0097621_100066237 | 3300006237 | Bacteria | 2974 |
| 175 | Ga0075370_10028358 | 3300006353 | Bacteria | 3111 |
| 176 | Ga0075370_10081948 | 3300006353 | Bacteria | 1855 |
| 177 | Ga0068871_100007888 | 3300006358 | Bacteria | 7634 |
| 178 | Ga0075428_100017228 | 3300006844 | Bacteria | 7984 |
| 179 | Ga0075433_10549133 | 3300006852 | Bacteria | 1016 |
| 180 | Ga0075429_100002684 | 3300006880 | Bacteria | 14979 |
| 181 | Ga0068865_100269152 | 3300006881 | Bacteria | 1352 |
| 182 | Ga0097620_100000211 | 3300006931 | Bacteria | 58042 |
| 183 | Ga0097620_100001283 | 3300006931 | Bacteria | 25657 |
| 184 | Ga0097620_100474396 | 3300006931 | Bacteria | 1347 |
| 185 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 186 | Ga0099826_10198776 | 3300006948 | Bacteria | 1099 |
| 187 | Ga0075435_100365409 | 3300007076 | Bacteria | 1238 |
| 188 | Ga0075435_100578635 | 3300007076 | Bacteria | 973 |
| 189 | Ga0105251_10000362 | 3300009011 | Bacteria | 44619 |
| 190 | Ga0105244_10000008 | 3300009036 | Bacteria | 302297 |
| 191 | Ga0105244_10000945 | 3300009036 | Bacteria | 24406 |
| 192 | Ga0105250_10001925 | 3300009092 | Bacteria | 10771 |
| 193 | Ga0105250_10003540 | 3300009092 | Bacteria | 7356 |
| 194 | Ga0105240_10008279 | 3300009093 | Bacteria | 14885 |
| 195 | Ga0105240_10091079 | 3300009093 | Bacteria | 3726 |
| 196 | Ga0105240_10106207 | 3300009093 | Bacteria | 3406 |
| 197 | Ga0105240_10316268 | 3300009093 | Bacteria | 1781 |
| 198 | Ga0105247_10000260 | 3300009101 | Bacteria | 48812 |
| 199 | Ga0114129_10202440 | 3300009147 | Bacteria | 2688 |
| 200 | Ga0105243_10017212 | 3300009148 | Bacteria | 5467 |
| 201 | Ga0105243_10138716 | 3300009148 | Bacteria | 2072 |
| 202 | Ga0105243_10243103 | 3300009148 | Bacteria | 1603 |
| 203 | Ga0105241_10014103 | 3300009174 | Bacteria | 5856 |
| 204 | Ga0105241_10076924 | 3300009174 | Bacteria | 2604 |
| 205 | Ga0105241_10707230 | 3300009174 | Bacteria | 920 |
| 206 | Ga0105248_10001076 | 3300009177 | Bacteria | 30156 |
| 207 | Ga0105248_10029339 | 3300009177 | Bacteria | 6137 |
| 208 | Ga0105248_10057587 | 3300009177 | Bacteria | 4363 |
| 209 | Ga0105248_10097431 | 3300009177 | Bacteria | 3313 |
| 210 | Ga0105248_10114596 | 3300009177 | Bacteria | 3040 |
| 211 | Ga0105248_10170182 | 3300009177 | Bacteria | 2455 |
| 212 | Ga0105237_10000080 | 3300009545 | Bacteria | 127788 |
| 213 | Ga0105237_10158940 | 3300009545 | Bacteria | 2257 |
| 214 | Ga0105237_10420200 | 3300009545 | Bacteria | 1342 |
| 215 | Ga0105238_10000711 | 3300009551 | Bacteria | 34783 |
| 216 | Ga0105238_10076954 | 3300009551 | Bacteria | 3329 |
| 217 | Ga0105238_10158745 | 3300009551 | Bacteria | 2237 |
| 218 | Ga0105249_10020152 | 3300009553 | Bacteria | 5958 |
| 219 | Ga0105249_10036077 | 3300009553 | Bacteria | 4485 |
| 220 | Ga0105148_100701 | 3300009978 | Bacteria | 2596 |
| 221 | Ga0105239_10000116 | 3300010375 | Bacteria | 112811 |
| 222 | Ga0105239_10039116 | 3300010375 | Bacteria | 5196 |
| 223 | Ga0105239_10230802 | 3300010375 | Bacteria | 2076 |
| 224 | Ga0105239_10444222 | 3300010375 | Bacteria | 1471 |
| 225 | Ga0157373_10002177 | 3300013100 | Bacteria | 14840 |
| 226 | Ga0157373_10019006 | 3300013100 | Bacteria | 5001 |
| 227 | Ga0157373_10147087 | 3300013100 | Bacteria | 1657 |
| 228 | Ga0157371_10000075 | 3300013102 | Bacteria | 162328 |
| 229 | Ga0157371_10000413 | 3300013102 | Bacteria | 52929 |
| 230 | Ga0157371_10009934 | 3300013102 | Bacteria | 7450 |
| 231 | Ga0157370_10000216 | 3300013104 | Bacteria | 73339 |
| 232 | Ga0157370_10000456 | 3300013104 | Bacteria | 51071 |
| 233 | Ga0157370_10228371 | 3300013104 | Bacteria | 1723 |
| 234 | Ga0157369_10002006 | 3300013105 | Bacteria | 24529 |
| 235 | Ga0157369_10150479 | 3300013105 | Bacteria | 2460 |
| 236 | Ga0157369_10180215 | 3300013105 | Bacteria | 2223 |
| 237 | Ga0157374_10008777 | 3300013296 | Bacteria | 8650 |
| 238 | Ga0157374_10021504 | 3300013296 | Bacteria | 5742 |
| 239 | Ga0157378_10481226 | 3300013297 | Bacteria | 1237 |
| 240 | Ga0157378_10573406 | 3300013297 | Bacteria | 1137 |
| 241 | Ga0157378_10577245 | 3300013297 | Bacteria | 1133 |
| 242 | Ga0163162_10010707 | 3300013306 | Bacteria | 8921 |
| 243 | Ga0163162_10013948 | 3300013306 | Bacteria | 7853 |
| 244 | Ga0163162_10096375 | 3300013306 | Bacteria | 3046 |
| 245 | Ga0163162_10213186 | 3300013306 | Bacteria | 2061 |
| 246 | Ga0157372_10000142 | 3300013307 | Bacteria | 79172 |
| 247 | Ga0157372_10029443 | 3300013307 | Bacteria | 5996 |
| 248 | Ga0157372_10302668 | 3300013307 | Bacteria | 1860 |
| 249 | Ga0157372_10331267 | 3300013307 | Bacteria | 1773 |
| 250 | Ga0157375_10016333 | 3300013308 | Bacteria | 6664 |
| 251 | Ga0157375_10052050 | 3300013308 | Bacteria | 4024 |
| 252 | Ga0157375_10058917 | 3300013308 | Bacteria | 3802 |
| 253 | Ga0157375_10157456 | 3300013308 | Bacteria | 2411 |
| 254 | Ga0157375_10168640 | 3300013308 | Bacteria | 2336 |
| 255 | Ga0163163_10012602 | 3300014325 | Bacteria | 7710 |
| 256 | Ga0163163_10049693 | 3300014325 | Bacteria | 4127 |
| 257 | Ga0163163_10056883 | 3300014325 | Bacteria | 3866 |
| 258 | Ga0157380_10143005 | 3300014326 | Bacteria | 2058 |
| 259 | Ga0182008_10136985 | 3300014497 | Bacteria | 1223 |
| 260 | Ga0157377_10003314 | 3300014745 | Bacteria | 7276 |
| 261 | Ga0157379_10002653 | 3300014968 | Bacteria | 15057 |
| 262 | Ga0157379_10007683 | 3300014968 | Bacteria | 9335 |
| 263 | Ga0157379_10008236 | 3300014968 | Bacteria | 9052 |
| 264 | Ga0157379_10305251 | 3300014968 | Bacteria | 1451 |
| 265 | Ga0157376_10008707 | 3300014969 | Bacteria | 7336 |
| 266 | Ga0157376_10104576 | 3300014969 | Bacteria | 2481 |
| 267 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 268 | Ga0182006_1002877 | 3300015261 | Bacteria | 9147 |
| 269 | Ga0182006_1005567 | 3300015261 | Bacteria | 5984 |
| 270 | Ga0182007_10000018 | 3300015262 | Bacteria | 198916 |
| 271 | Ga0182007_10043830 | 3300015262 | Bacteria | 1485 |
| 272 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 273 | Ga0182005_1070727 | 3300015265 | Bacteria | 958 |
| 274 | Ga0163161_10013883 | 3300017792 | Bacteria | 5611 |
| 275 | Ga0163161_10076178 | 3300017792 | Bacteria | 2462 |
| 276 | Ga0163161_10101262 | 3300017792 | Bacteria | 2145 |
| 277 | Ga0206351_10994603 | 3300020077 | Bacteria | 3530 |
| 278 | Ga0206353_11620780 | 3300020082 | Bacteria | 1085 |
| 279 | Ga0154015_1049643 | 3300020610 | Bacteria | 16414 |
| 280 | Ga0213872_10103861 | 3300021361 | Bacteria | 1265 |
| 281 | Ga0213875_10003695 | 3300021388 | Bacteria | 8629 |
| 282 | Ga0213875_10009808 | 3300021388 | Bacteria | 4829 |
| 283 | Ga0213875_10027371 | 3300021388 | Bacteria | 2712 |
| 284 | Ga0209760_100070 | 3300025207 | Bacteria | 83162 |
| 285 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 286 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 287 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 288 | Ga0209566_102220 | 3300025225 | Bacteria | 3824 |
| 289 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 290 | Ga0209674_110949 | 3300025226 | Bacteria | 945 |
| 291 | Ga0209672_100818 | 3300025228 | Bacteria | 14658 |
| 292 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 293 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 294 | Ga0209563_105221 | 3300025230 | Bacteria | 2381 |
| 295 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 296 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 297 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 298 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 299 | Ga0209759_1003202 | 3300025256 | Bacteria | 6636 |
| 300 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 301 | Ga0209233_1000890 | 3300025261 | Bacteria | 13052 |
| 302 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 303 | Ga0209676_1000031 | 3300025292 | Bacteria | 478976 |
| 304 | Ga0209564_1001441 | 3300025295 | Bacteria | 24287 |
| 305 | Ga0209564_1002205 | 3300025295 | Bacteria | 16256 |
| 306 | Ga0209564_1017308 | 3300025295 | Bacteria | 2817 |
| 307 | Ga0209758_1000571 | 3300025297 | Bacteria | 57774 |
| 308 | Ga0209758_1006173 | 3300025297 | Bacteria | 8771 |
| 309 | Ga0209050_1000087 | 3300025298 | Bacteria | 261460 |
| 310 | Ga0209050_1006975 | 3300025298 | Bacteria | 6507 |
| 311 | Ga0209050_1011531 | 3300025298 | Bacteria | 4172 |
| 312 | Ga0209050_1021417 | 3300025298 | Bacteria | 2357 |
| 313 | Ga0209256_1000694 | 3300025299 | Bacteria | 44757 |
| 314 | Ga0209257_1000050 | 3300025304 | Bacteria | 439325 |
| 315 | Ga0209257_1000326 | 3300025304 | Bacteria | 99865 |
| 316 | Ga0209257_1000687 | 3300025304 | Bacteria | 52593 |
| 317 | Ga0207656_10054712 | 3300025321 | Bacteria | 1735 |
| 318 | Ga0207696_1000658 | 3300025711 | Bacteria | 24673 |
| 319 | Ga0207655_1000243 | 3300025728 | Bacteria | 89023 |
| 320 | Ga0207655_1001135 | 3300025728 | Bacteria | 25953 |
| 321 | Ga0207713_1000429 | 3300025735 | Bacteria | 44408 |
| 322 | Ga0207682_10023171 | 3300025893 | Bacteria | 2451 |
| 323 | Ga0207682_10044908 | 3300025893 | Bacteria | 1812 |
| 324 | Ga0207692_10009267 | 3300025898 | Bacteria | 4104 |
| 325 | Ga0207642_10144607 | 3300025899 | Bacteria | 1258 |
| 326 | Ga0207710_10000322 | 3300025900 | Bacteria | 36632 |
| 327 | Ga0207688_10089558 | 3300025901 | Bacteria | 1765 |
| 328 | Ga0207680_10000931 | 3300025903 | Bacteria | 13816 |
| 329 | Ga0207680_10204005 | 3300025903 | Bacteria | 1349 |
| 330 | Ga0207680_10221954 | 3300025903 | Bacteria | 1296 |
| 331 | Ga0207685_10001062 | 3300025905 | Bacteria | 5399 |
| 332 | Ga0207699_10086395 | 3300025906 | Bacteria | 1959 |
| 333 | Ga0207645_10001374 | 3300025907 | Bacteria | 19987 |
| 334 | Ga0207645_10235203 | 3300025907 | Bacteria | 1210 |
| 335 | Ga0207643_10257413 | 3300025908 | Bacteria | 1077 |
| 336 | Ga0207705_10000808 | 3300025909 | Bacteria | 25747 |
| 337 | Ga0207684_10005804 | 3300025910 | Bacteria | 11319 |
| 338 | Ga0207684_10041500 | 3300025910 | Bacteria | 3901 |
| 339 | Ga0207707_10059522 | 3300025912 | Bacteria | 3323 |
| 340 | Ga0207695_10002210 | 3300025913 | Bacteria | 29273 |
| 341 | Ga0207695_10076632 | 3300025913 | Bacteria | 3399 |
| 342 | Ga0207671_10024475 | 3300025914 | Bacteria | 4540 |
| 343 | Ga0207671_10085457 | 3300025914 | Bacteria | 2371 |
| 344 | Ga0207671_10181187 | 3300025914 | Bacteria | 1639 |
| 345 | Ga0207693_10018603 | 3300025915 | Bacteria | 5531 |
| 346 | Ga0207663_10049902 | 3300025916 | Bacteria | 2598 |
| 347 | Ga0207660_10002960 | 3300025917 | Bacteria | 11108 |
| 348 | Ga0207662_10053058 | 3300025918 | Bacteria | 2414 |
| 349 | Ga0207657_10003643 | 3300025919 | Bacteria | 16405 |
| 350 | Ga0207657_10024958 | 3300025919 | Bacteria | 5523 |
| 351 | Ga0207657_10186931 | 3300025919 | Bacteria | 1673 |
| 352 | Ga0207649_10004096 | 3300025920 | Bacteria | 7935 |
| 353 | Ga0207649_10200860 | 3300025920 | Bacteria | 1408 |
| 354 | Ga0207652_10068958 | 3300025921 | Bacteria | 3069 |
| 355 | Ga0207646_10251807 | 3300025922 | Bacteria | 1596 |
| 356 | Ga0207681_10071819 | 3300025923 | Bacteria | 2415 |
| 357 | Ga0207681_10083286 | 3300025923 | Bacteria | 2263 |
| 358 | Ga0207681_10378178 | 3300025923 | Bacteria | 1139 |
| 359 | Ga0207694_10015010 | 3300025924 | Bacteria | 5841 |
| 360 | Ga0207694_10061975 | 3300025924 | Bacteria | 2911 |
| 361 | Ga0207650_10000841 | 3300025925 | Bacteria | 23285 |
| 362 | Ga0207650_10337765 | 3300025925 | Bacteria | 1237 |
| 363 | Ga0207659_10004208 | 3300025926 | Bacteria | 8690 |
| 364 | Ga0207659_10007353 | 3300025926 | Bacteria | 6770 |
| 365 | Ga0207700_10310842 | 3300025928 | Bacteria | 1363 |
| 366 | Ga0207664_10205838 | 3300025929 | Bacteria | 1700 |
| 367 | Ga0207644_10000635 | 3300025931 | Bacteria | 22259 |
| 368 | Ga0207644_10018202 | 3300025931 | Bacteria | 4750 |
| 369 | Ga0207690_10015082 | 3300025932 | Bacteria | 4678 |
| 370 | Ga0207690_10088566 | 3300025932 | Bacteria | 2181 |
| 371 | Ga0207690_10243710 | 3300025932 | Bacteria | 1385 |
| 372 | Ga0207706_10006012 | 3300025933 | Bacteria | 11288 |
| 373 | Ga0207706_10007598 | 3300025933 | Bacteria | 10028 |
| 374 | Ga0207706_10172123 | 3300025933 | Bacteria | 1902 |
| 375 | Ga0207706_10263616 | 3300025933 | Bacteria | 1504 |
| 376 | Ga0207686_10397110 | 3300025934 | Bacteria | 1049 |
| 377 | Ga0207709_10003779 | 3300025935 | Bacteria | 8899 |
| 378 | Ga0207709_10036106 | 3300025935 | Bacteria | 2927 |
| 379 | Ga0207709_10234604 | 3300025935 | Bacteria | 1331 |
| 380 | Ga0207670_10009447 | 3300025936 | Bacteria | 5565 |
| 381 | Ga0207704_10312482 | 3300025938 | Bacteria | 1209 |
| 382 | Ga0207665_10044072 | 3300025939 | Bacteria | 2985 |
| 383 | Ga0207665_10066712 | 3300025939 | Bacteria | 2449 |
| 384 | Ga0207691_10046267 | 3300025940 | Bacteria | 3999 |
| 385 | Ga0207691_10272737 | 3300025940 | Bacteria | 1456 |
| 386 | Ga0207711_10007617 | 3300025941 | Bacteria | 9056 |
| 387 | Ga0207711_10017006 | 3300025941 | Bacteria | 6040 |
| 388 | Ga0207711_10052692 | 3300025941 | Bacteria | 3488 |
| 389 | Ga0207711_10111481 | 3300025941 | Bacteria | 2434 |
| 390 | Ga0207711_10112369 | 3300025941 | Bacteria | 2424 |
| 391 | Ga0207711_10300554 | 3300025941 | Bacteria | 1480 |
| 392 | Ga0207689_10000851 | 3300025942 | Bacteria | 29408 |
| 393 | Ga0207689_10083483 | 3300025942 | Bacteria | 2626 |
| 394 | Ga0207689_10334793 | 3300025942 | Bacteria | 1257 |
| 395 | Ga0207661_10186763 | 3300025944 | Bacteria | 1814 |
| 396 | Ga0207679_10080361 | 3300025945 | Bacteria | 2489 |
| 397 | Ga0207667_10001534 | 3300025949 | Bacteria | 29037 |
| 398 | Ga0207667_10020346 | 3300025949 | Bacteria | 7386 |
| 399 | Ga0207667_10088391 | 3300025949 | Bacteria | 3205 |
| 400 | Ga0207667_10290172 | 3300025949 | Bacteria | 1671 |
| 401 | Ga0207667_10342249 | 3300025949 | Bacteria | 1526 |
| 402 | Ga0207651_10005276 | 3300025960 | Bacteria | 6611 |
| 403 | Ga0207651_10234740 | 3300025960 | Bacteria | 1491 |
| 404 | Ga0207668_10017458 | 3300025972 | Bacteria | 4497 |
| 405 | Ga0207668_10171495 | 3300025972 | Bacteria | 1702 |
| 406 | Ga0207668_10225366 | 3300025972 | Bacteria | 1508 |
| 407 | Ga0207640_10008428 | 3300025981 | Bacteria | 5727 |
| 408 | Ga0207658_10005671 | 3300025986 | Bacteria | 8539 |
| 409 | Ga0207658_10044094 | 3300025986 | Bacteria | 3246 |
| 410 | Ga0207658_10078687 | 3300025986 | Bacteria | 2520 |
| 411 | Ga0207677_10002592 | 3300026023 | Bacteria | 9508 |
| 412 | Ga0207677_10004596 | 3300026023 | Bacteria | 7425 |
| 413 | Ga0207703_10001221 | 3300026035 | Bacteria | 24024 |
| 414 | Ga0207703_10002171 | 3300026035 | Bacteria | 17238 |
| 415 | Ga0207639_10032577 | 3300026041 | Bacteria | 3838 |
| 416 | Ga0207639_10033688 | 3300026041 | Bacteria | 3781 |
| 417 | Ga0207639_10370530 | 3300026041 | Bacteria | 1284 |
| 418 | Ga0207678_10002602 | 3300026067 | Bacteria | 16443 |
| 419 | Ga0207678_10005562 | 3300026067 | Bacteria | 11263 |
| 420 | Ga0207678_10014518 | 3300026067 | Bacteria | 6927 |
| 421 | Ga0207678_10275414 | 3300026067 | Bacteria | 1444 |
| 422 | Ga0207702_10000024 | 3300026078 | Bacteria | 187719 |
| 423 | Ga0207702_10025016 | 3300026078 | Bacteria | 4952 |
| 424 | Ga0207702_10037987 | 3300026078 | Bacteria | 4033 |
| 425 | Ga0207702_10218662 | 3300026078 | Bacteria | 1775 |
| 426 | Ga0207641_10007137 | 3300026088 | Bacteria | 9329 |
| 427 | Ga0207641_10015891 | 3300026088 | Bacteria | 6164 |
| 428 | Ga0207641_10025598 | 3300026088 | Bacteria | 4864 |
| 429 | Ga0207641_10059408 | 3300026088 | Bacteria | 3256 |
| 430 | Ga0207641_10119471 | 3300026088 | Bacteria | 2349 |
| 431 | Ga0207648_10055361 | 3300026089 | Bacteria | 3463 |
| 432 | Ga0207676_10001143 | 3300026095 | Bacteria | 19992 |
| 433 | Ga0207676_10002759 | 3300026095 | Bacteria | 12489 |
| 434 | Ga0207674_10111134 | 3300026116 | Bacteria | 2715 |
| 435 | Ga0207674_10244119 | 3300026116 | Bacteria | 1743 |
| 436 | Ga0207675_100000246 | 3300026118 | Bacteria | 51719 |
| 437 | Ga0207675_100160268 | 3300026118 | Bacteria | 2145 |
| 438 | Ga0207683_10075611 | 3300026121 | Bacteria | 2981 |
| 439 | Ga0207698_10002713 | 3300026142 | Bacteria | 10536 |
| 440 | Ga0207698_10036635 | 3300026142 | Bacteria | 3603 |
| 441 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 442 | Ga0209371_1000087 | 3300027312 | Bacteria | 175021 |
| 443 | Ga0209371_1000116 | 3300027312 | Bacteria | 135524 |
| 444 | Ga0268266_10035428 | 3300028379 | Bacteria | 4245 |
| 445 | Ga0268266_10052323 | 3300028379 | Bacteria | 3507 |
| 446 | Ga0268266_10113246 | 3300028379 | Bacteria | 2406 |
| 447 | Ga0268265_10111626 | 3300028380 | Bacteria | 2233 |
| 448 | Ga0268265_10179993 | 3300028380 | Bacteria | 1815 |
| 449 | Ga0268265_10350948 | 3300028380 | Bacteria | 1347 |
| 450 | Ga0268264_10061418 | 3300028381 | Bacteria | 3152 |
| 451 | Ga0268264_10067513 | 3300028381 | Bacteria | 3019 |
| 452 | Ga0268264_10128469 | 3300028381 | Bacteria | 2243 |
| 453 | Ga0268264_10486547 | 3300028381 | Bacteria | 1201 |
| 454 | Ga0307515_10012849 | 3300028794 | Bacteria | 15712 |
| 455 | Ga0307515_10067859 | 3300028794 | Bacteria | 4911 |
| 456 | Ga0307515_10110744 | 3300028794 | Bacteria | 3210 |
| 457 | Ga0268256_1000099 | 3300030500 | Bacteria | 135508 |
| 458 | Ga0268256_1000101 | 3300030500 | Bacteria | 130956 |
| 459 | Ga0268256_1006276 | 3300030500 | Bacteria | 4456 |
| 460 | Ga0268256_1041207 | 3300030500 | Bacteria | 1033 |
| 461 | Ga0307511_10064784 | 3300030521 | Bacteria | 2743 |
| 462 | Ga0316177_1054551 | 3300030731 | Bacteria | 2281 |
| 463 | Ga0314311_1206614 | 3300030733 | Bacteria | 1486 |
| 464 | Ga0316180_1095940 | 3300030736 | Bacteria | 1465 |
| 465 | Ga0265325_10005021 | 3300031241 | Bacteria | 8233 |
| 466 | Ga0265340_10097310 | 3300031247 | Bacteria | 1370 |
| 467 | Ga0265316_10116177 | 3300031344 | Bacteria | 2023 |
| 468 | Ga0307513_10195563 | 3300031456 | Bacteria | 1869 |
| 469 | Ga0307513_10287954 | 3300031456 | Bacteria | 1416 |
| 470 | Ga0307513_10318280 | 3300031456 | Bacteria | 1315 |
| 471 | Ga0307508_10000165 | 3300031616 | Bacteria | 79729 |
| 472 | Ga0307516_10002914 | 3300031730 | Bacteria | 22412 |
| 473 | Ga0307406_10689436 | 3300031901 | Bacteria | 852 |
| 474 | Ga0307412_10029815 | 3300031911 | Bacteria | 3428 |
| 475 | Ga0307412_10071852 | 3300031911 | Bacteria | 2363 |
| 476 | Ga0307412_10269163 | 3300031911 | Bacteria | 1332 |
| 477 | Ga0307414_10233223 | 3300032004 | Bacteria | 1519 |
| 478 | Ga0373930_0039127 | 3300034816 | Bacteria | 1004 |
| 479 | Ga0373926_0098907 | 3300035083 | Bacteria | 1089 |
| 480 | Ga0373960_0058618 | 3300035121 | Bacteria | 1162 |
| 481 | Ga0373931_0003648 | 3300035691 | Bacteria | 6956 |
| 482 | Ga0373935_0035714 | 3300035692 | Bacteria | 3103 |
| 483 | Ga0373927_0072545 | 3300035695 | Bacteria | 2228 |
| 484 | Ga0373933_0098457 | 3300035724 | Bacteria | 1812 |
| 485 | Ga0373933_0149437 | 3300035724 | Bacteria | 1479 |
| 486 | Ga0373947_0049489 | 3300035725 | Bacteria | 2524 |
| 487 | Ga0373947_0070779 | 3300035725 | Bacteria | 2138 |
| 488 | Ga0373947_0238841 | 3300035725 | Bacteria | 1199 |
| 489 | Ga0373937_0005178 | 3300036401 | Bacteria | 11125 |
| 490 | Ga0373937_0071547 | 3300036401 | Bacteria | 3198 |
| 491 | Ga0373925_0017299 | 3300037068 | Bacteria | 5224 |
| 492 | Ga0373925_0343357 | 3300037068 | Bacteria | 1211 |
| 493 | Ga0395899_0017047 | 3300037312 | Bacteria | 5535 |
| 494 | Ga0395899_0118360 | 3300037312 | Bacteria | 1899 |
| 495 | Ga0395899_0339022 | 3300037312 | Bacteria | 1008 |
| 496 | Ga0395900_0000998 | 3300037418 | Bacteria | 36734 |
| 497 | Ga0395900_0001932 | 3300037418 | Bacteria | 23486 |
| 498 | Ga0395900_0023039 | 3300037418 | Bacteria | 6373 |
| 499 | Ga0395900_0097106 | 3300037418 | Bacteria | 3027 |
| 500 | Ga0395900_0106418 | 3300037418 | Bacteria | 2881 |
| 501 | Ga0395900_0127341 | 3300037418 | Bacteria | 2611 |
| 502 | Ga0395900_0187762 | 3300037418 | Bacteria | 2097 |
| 503 | Ga0395900_0389204 | 3300037418 | Bacteria | 1360 |
| 504 | Ga0395898_0005979 | 3300037466 | Bacteria | 13068 |
| 505 | Ga0395898_0028249 | 3300037466 | Bacteria | 5625 |
| 506 | Ga0395898_0093348 | 3300037466 | Bacteria | 2892 |
| 507 | Ga0395905_0025506 | 3300037471 | Bacteria | 5574 |
| 508 | Ga0395905_0242263 | 3300037471 | Bacteria | 1685 |
| 509 | Ga0436364_0089680 | 3300037853 | Bacteria | 6044 |
| 510 | Ga0436364_1507036 | 3300037853 | Bacteria | 16747 |
| 511 | Ga0395901_0062422 | 3300038443 | Bacteria | 3877 |
| 512 | Ga0395901_0130199 | 3300038443 | Bacteria | 2644 |
| 513 | Ga0395901_0174947 | 3300038443 | Bacteria | 2251 |
| 514 | Ga0436360_1229390 | 3300039438 | Bacteria | 1418 |
| 515 | Ga0436360_1340739 | 3300039438 | Bacteria | 991 |
| 516 | Ga0436361_0206609 | 3300039447 | Bacteria | 1297 |
| 517 | Ga0436361_0860283 | 3300039447 | Bacteria | 9735 |
| 518 | Ga0436363_0089415 | 3300039450 | Bacteria | 951 |
| 519 | Ga0436363_0134441 | 3300039450 | Bacteria | 1365 |
| 520 | Ga0436363_1009265 | 3300039450 | Bacteria | 1170 |
| 521 | Ga0436363_1058409 | 3300039450 | Bacteria | 2462 |
| 522 | Ga0439436_0041758 | 3300041404 | Bacteria | 1312 |
| 523 | Ga0439436_0082755 | 3300041404 | Bacteria | 893 |
| 524 | Ga0439438_000018 | 3300041405 | Bacteria | 123959 |
| 525 | Ga0439447_002351 | 3300041407 | Bacteria | 6910 |
| 526 | Ga0439465_0000047 | 3300041413 | Bacteria | 25399 |
| 527 | Ga0451853_2911252 | 3300041512 | Bacteria | 1718 |
| 528 | Ga0439445_0024486 | 3300042004 | Bacteria | 1535 |
| 529 | Ga0439432_004844 | 3300042006 | Bacteria | 4881 |
| 530 | Ga0439432_005417 | 3300042006 | Bacteria | 4598 |
| 531 | Ga0439432_081759 | 3300042006 | Bacteria | 978 |
| 532 | Ga0439449_0000733 | 3300042007 | Bacteria | 12592 |
| 533 | Ga0439449_0086835 | 3300042007 | Bacteria | 1154 |
| 534 | Ga0439457_054364 | 3300042014 | Bacteria | 902 |
| 535 | Ga0439435_0051950 | 3300042436 | Bacteria | 1176 |
| 536 | Ga0466986_0050906 | 3300044650 | Bacteria | 2861 |
| 537 | Ga0466972_0000383 | 3300044658 | Bacteria | 23678 |
| 538 | Ga0466972_0003321 | 3300044658 | Bacteria | 7977 |
| 539 | Ga0466972_0008642 | 3300044658 | Bacteria | 5107 |
| 540 | Ga0466972_0069548 | 3300044658 | Bacteria | 1681 |
| 541 | Ga0466977_0341413 | 3300044666 | Bacteria | 889 |
| 542 | Ga0466978_0004514 | 3300044671 | Bacteria | 6688 |
| 543 | Ga0466982_0078684 | 3300044672 | Bacteria | 2040 |
| 544 | Ga0466965_0002658 | 3300044683 | Bacteria | 7650 |
| 545 | Ga0466965_0004602 | 3300044683 | Bacteria | 6142 |
| 546 | Ga0466966_0011654 | 3300044684 | Bacteria | 5828 |
| 547 | Ga0466966_0015152 | 3300044684 | Bacteria | 5100 |
| 548 | Ga0466966_0032955 | 3300044684 | Bacteria | 3354 |
| 549 | Ga0466966_0095977 | 3300044684 | Bacteria | 1836 |
| 550 | Ga0466966_0219617 | 3300044684 | Bacteria | 1148 |
| 551 | Ga0466961_0000435 | 3300044693 | Bacteria | 26633 |
| 552 | Ga0466961_0001155 | 3300044693 | Bacteria | 16227 |
| 553 | Ga0466961_0006348 | 3300044693 | Bacteria | 7509 |
| 554 | Ga0466961_0008481 | 3300044693 | Bacteria | 6546 |
| 555 | Ga0466961_0020151 | 3300044693 | Bacteria | 4292 |
| 556 | Ga0466961_0050122 | 3300044693 | Bacteria | 2667 |
| 557 | Ga0466961_0235301 | 3300044693 | Bacteria | 1127 |
| 558 | Ga0466963_0023494 | 3300044694 | Bacteria | 3916 |
| 559 | Ga0466963_0194140 | 3300044694 | Bacteria | 1419 |
| 560 | Ga0466964_0001045 | 3300044706 | Bacteria | 9227 |
| 561 | Ga0466964_0004022 | 3300044706 | Bacteria | 5404 |
| 562 | Ga0466971_0004162 | 3300044719 | Bacteria | 6233 |
| 563 | Ga0466971_0082607 | 3300044719 | Bacteria | 1466 |
| 564 | Ga0466971_0104013 | 3300044719 | Bacteria | 1306 |
| 565 | Ga0466971_0132501 | 3300044719 | Bacteria | 1158 |
| 566 | Ga0466968_0009639 | 3300044735 | Bacteria | 3718 |
| 567 | Ga0466970_0000271 | 3300044765 | Bacteria | 25244 |
| 568 | Ga0466970_0001247 | 3300044765 | Bacteria | 12327 |
| 569 | Ga0466970_0054294 | 3300044765 | Bacteria | 2140 |
| 570 | Ga0466970_0139850 | 3300044765 | Bacteria | 1333 |
| 571 | Ga0466970_0181355 | 3300044765 | Bacteria | 1168 |
| 572 | Ga0466957_0029076 | 3300044842 | Bacteria | 3293 |
| 573 | Ga0466957_0514796 | 3300044842 | Bacteria | 831 |
| 574 | Ga0466960_0005076 | 3300044901 | Bacteria | 5201 |
| 575 | Ga0466960_0005296 | 3300044901 | Bacteria | 5100 |
| 576 | Ga0466959_0002163 | 3300045049 | Bacteria | 12484 |
| 577 | Ga0466959_0005857 | 3300045049 | Bacteria | 8460 |
| 578 | Ga0466959_0006181 | 3300045049 | Bacteria | 8274 |
| 579 | Ga0451576_0216002 | 3300045051 | Bacteria | 2002 |
| 580 | Ga0451576_0265590 | 3300045051 | Bacteria | 1794 |
| 581 | Ga0466967_0047916 | 3300045976 | Bacteria | 3728 |
| 582 | Ga0466967_0052121 | 3300045976 | Bacteria | 3589 |
| 583 | Ga0495627_026793 | 3300046453 | Bacteria | 1855 |
| 584 | Ga0495627_051776 | 3300046453 | Bacteria | 1233 |
| 585 | Ga0495592_0227265 | 3300046454 | Bacteria | 1244 |
| 586 | Ga0495603_0306290 | 3300046455 | Bacteria | 912 |
| 587 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 588 | Ga0495590_0000446 | 3300046457 | Bacteria | 20449 |
| 589 | Ga0495591_021603 | 3300046458 | Bacteria | 2096 |
| 590 | Ga0495629_0001013 | 3300046459 | Bacteria | 22585 |
| 591 | Ga0495629_0183271 | 3300046459 | Bacteria | 1451 |
| 592 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 593 | Ga0495638_0004543 | 3300046460 | Bacteria | 10509 |
| 594 | Ga0495638_0006039 | 3300046460 | Bacteria | 8862 |
| 595 | Ga0495638_0007246 | 3300046460 | Bacteria | 7973 |
| 596 | Ga0495638_0008496 | 3300046460 | Bacteria | 7278 |
| 597 | Ga0495638_0011962 | 3300046460 | Bacteria | 5966 |
| 598 | Ga0495638_0059967 | 3300046460 | Bacteria | 2354 |
| 599 | Ga0495651_0087398 | 3300046462 | Bacteria | 2344 |
| 600 | Ga0495653_0001187 | 3300046463 | Bacteria | 20147 |
| 601 | Ga0495653_0159087 | 3300046463 | Bacteria | 1570 |
| 602 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 603 | Ga0495650_0000020 | 3300046471 | Bacteria | 533839 |
| 604 | Ga0495650_0000102 | 3300046471 | Bacteria | 211007 |
| 605 | Ga0495650_0000207 | 3300046471 | Bacteria | 127568 |
| 606 | Ga0495650_0001635 | 3300046471 | Bacteria | 20815 |
| 607 | Ga0495650_0002031 | 3300046471 | Bacteria | 17703 |
| 608 | Ga0495650_0013152 | 3300046471 | Bacteria | 4397 |
| 609 | Ga0495650_0152662 | 3300046471 | Bacteria | 828 |
| 610 | Ga0495580_0004501 | 3300046472 | Bacteria | 11707 |
| 611 | Ga0495580_0006470 | 3300046472 | Bacteria | 9535 |
| 612 | Ga0495582_0012292 | 3300046473 | Bacteria | 4715 |
| 613 | Ga0495605_0001958 | 3300046474 | Bacteria | 13065 |
| 614 | Ga0495639_0009356 | 3300046475 | Bacteria | 4203 |
| 615 | Ga0495662_0175723 | 3300046476 | Bacteria | 1055 |
| 616 | Ga0495664_0274766 | 3300046477 | Bacteria | 1018 |
| 617 | Ga0495584_0051005 | 3300046491 | Bacteria | 2084 |
| 618 | Ga0495585_0000162 | 3300046492 | Bacteria | 71606 |
| 619 | Ga0495585_0003423 | 3300046492 | Bacteria | 10727 |
| 620 | Ga0495585_0036768 | 3300046492 | Bacteria | 2759 |
| 621 | Ga0495585_0040404 | 3300046492 | Bacteria | 2619 |
| 622 | Ga0495585_0208285 | 3300046492 | Bacteria | 992 |
| 623 | Ga0495596_0000901 | 3300046500 | Bacteria | 17803 |
| 624 | Ga0495596_0009485 | 3300046500 | Bacteria | 4280 |
| 625 | Ga0495607_0002244 | 3300046501 | Bacteria | 15952 |
| 626 | Ga0495607_0018615 | 3300046501 | Bacteria | 4424 |
| 627 | Ga0495583_0000688 | 3300046506 | Bacteria | 43737 |
| 628 | Ga0495606_0029044 | 3300046507 | Bacteria | 3889 |
| 629 | Ga0495606_0215386 | 3300046507 | Bacteria | 1085 |
| 630 | Ga0495610_0000140 | 3300046512 | Bacteria | 80219 |
| 631 | Ga0495610_0001225 | 3300046512 | Bacteria | 23072 |
| 632 | Ga0495610_0003718 | 3300046512 | Bacteria | 11678 |
| 633 | Ga0495616_0000162 | 3300046513 | Bacteria | 58625 |
| 634 | Ga0495616_0000385 | 3300046513 | Bacteria | 34392 |
| 635 | Ga0495616_0000460 | 3300046513 | Bacteria | 30949 |
| 636 | Ga0495616_0051387 | 3300046513 | Bacteria | 2056 |
| 637 | Ga0495620_0012624 | 3300046515 | Bacteria | 4354 |
| 638 | Ga0495628_0116921 | 3300046516 | Bacteria | 2048 |
| 639 | Ga0495631_0001800 | 3300046518 | Bacteria | 12672 |
| 640 | Ga0495631_0005262 | 3300046518 | Bacteria | 6803 |
| 641 | Ga0495631_0130860 | 3300046518 | Bacteria | 1078 |
| 642 | Ga0495632_0004035 | 3300046519 | Bacteria | 10133 |
| 643 | Ga0495632_0006806 | 3300046519 | Bacteria | 7295 |
| 644 | Ga0495632_0007389 | 3300046519 | Bacteria | 6907 |
| 645 | Ga0495632_0094912 | 3300046519 | Bacteria | 1410 |
| 646 | Ga0495637_0045406 | 3300046520 | Bacteria | 1864 |
| 647 | Ga0495637_0097923 | 3300046520 | Bacteria | 1150 |
| 648 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 649 | Ga0495643_0070207 | 3300046522 | Bacteria | 1840 |
| 650 | Ga0495643_0084456 | 3300046522 | Bacteria | 1647 |
| 651 | Ga0495644_0039900 | 3300046523 | Bacteria | 1770 |
| 652 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 653 | Ga0495648_0000075 | 3300046524 | Bacteria | 129579 |
| 654 | Ga0495648_0000887 | 3300046524 | Bacteria | 31432 |
| 655 | Ga0495648_0004007 | 3300046524 | Bacteria | 12728 |
| 656 | Ga0495648_0036871 | 3300046524 | Bacteria | 3147 |
| 657 | Ga0495648_0040093 | 3300046524 | Bacteria | 2973 |
| 658 | Ga0495663_0000222 | 3300046525 | Bacteria | 22657 |
| 659 | Ga0495663_0005417 | 3300046525 | Bacteria | 3537 |
| 660 | Ga0495642_0002072 | 3300046528 | Bacteria | 8304 |
| 661 | Ga0495642_0007140 | 3300046528 | Bacteria | 4286 |
| 662 | Ga0495642_0025740 | 3300046528 | Bacteria | 2333 |
| 663 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 664 | Ga0495654_0000109 | 3300046530 | Bacteria | 93356 |
| 665 | Ga0495654_0000218 | 3300046530 | Bacteria | 53756 |
| 666 | Ga0495654_0047253 | 3300046530 | Bacteria | 2116 |
| 667 | Ga0495665_0011572 | 3300046531 | Bacteria | 4777 |
| 668 | Ga0495586_0013837 | 3300046535 | Bacteria | 4281 |
| 669 | Ga0495598_0033145 | 3300046537 | Bacteria | 1464 |
| 670 | Ga0495609_0004395 | 3300046538 | Bacteria | 7732 |
| 671 | Ga0495597_0000080 | 3300046542 | Bacteria | 84504 |
| 672 | Ga0495597_0052070 | 3300046542 | Bacteria | 1803 |
| 673 | Ga0495645_0001014 | 3300046543 | Bacteria | 19105 |
| 674 | Ga0495645_0071486 | 3300046543 | Bacteria | 2502 |
| 675 | Ga0495622_0000126 | 3300046557 | Bacteria | 66247 |
| 676 | Ga0495622_0000483 | 3300046557 | Bacteria | 25083 |
| 677 | Ga0495633_0000399 | 3300046558 | Bacteria | 45392 |
| 678 | Ga0495633_0004029 | 3300046558 | Bacteria | 9504 |
| 679 | Ga0495633_0004878 | 3300046558 | Bacteria | 8389 |
| 680 | Ga0495633_0055548 | 3300046558 | Bacteria | 1862 |
| 681 | Ga0495667_0072015 | 3300046559 | Bacteria | 2253 |
| 682 | Ga0495656_0037535 | 3300046615 | Bacteria | 2002 |
| 683 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 684 | Ga0495668_0005752 | 3300046616 | Bacteria | 8287 |
| 685 | Ga0495668_0008054 | 3300046616 | Bacteria | 6636 |
| 686 | Ga0495668_0014770 | 3300046616 | Bacteria | 4572 |
| 687 | Ga0495668_0174661 | 3300046616 | Bacteria | 1177 |
| 688 | Ga0495668_0353418 | 3300046616 | Bacteria | 806 |
| 689 | Ga0495611_0016943 | 3300046648 | Bacteria | 3115 |
| 690 | Ga0495611_0044664 | 3300046648 | Bacteria | 1982 |
| 691 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 692 | Ga0495625_0001046 | 3300046660 | Bacteria | 36303 |
| 693 | Ga0495625_0004348 | 3300046660 | Bacteria | 13457 |
| 694 | Ga0495625_0026687 | 3300046660 | Bacteria | 4360 |
| 695 | Ga0495625_0169128 | 3300046660 | Bacteria | 1460 |
| 696 | Ga0495625_0181193 | 3300046660 | Bacteria | 1400 |
| 697 | Ga0495625_0185330 | 3300046660 | Bacteria | 1381 |
| 698 | Ga0495625_0233445 | 3300046660 | Bacteria | 1200 |
| 699 | Ga0495588_0014191 | 3300046674 | Bacteria | 3810 |
| 700 | Ga0495658_0063585 | 3300046683 | Bacteria | 2124 |
| 701 | Ga0495658_0430122 | 3300046683 | Bacteria | 842 |
| 702 | Ga0495669_0040677 | 3300046684 | Bacteria | 2062 |
| 703 | Ga0495613_0048684 | 3300046689 | Bacteria | 3130 |
| 704 | Ga0495624_0089967 | 3300046690 | Bacteria | 1894 |
| 705 | Ga0495670_0037656 | 3300046691 | Bacteria | 2411 |
| 706 | Ga0495671_0086563 | 3300046692 | Bacteria | 1535 |
| 707 | Ga0495649_0001590 | 3300046694 | Bacteria | 16990 |
| 708 | Ga0495649_0007521 | 3300046694 | Bacteria | 6628 |
| 709 | Ga0495649_0107798 | 3300046694 | Bacteria | 1478 |
| 710 | Ga0495589_0001219 | 3300046794 | Bacteria | 15288 |
| 711 | Ga0495589_0013071 | 3300046794 | Bacteria | 4288 |
| 712 | Ga0495589_0018900 | 3300046794 | Bacteria | 3534 |
| 713 | Ga0495589_0117340 | 3300046794 | Bacteria | 1282 |
| 714 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 715 | Ga0495660_0055576 | 3300046810 | Bacteria | 2142 |
| 716 | Ga0495660_0140348 | 3300046810 | Bacteria | 1203 |
| 717 | Ga0495581_0000534 | 3300047315 | Bacteria | 19544 |
| 718 | Ga0495581_0264524 | 3300047315 | Bacteria | 1006 |
| 719 | Ga0495604_0257653 | 3300047317 | Bacteria | 1187 |
| 720 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 721 | Ga0495672_0004568 | 3300047320 | Bacteria | 11254 |
| 722 | Ga0495672_0012193 | 3300047320 | Bacteria | 6012 |
| 723 | Ga0495672_0075902 | 3300047320 | Bacteria | 1889 |
| 724 | Ga0495676_0046612 | 3300047321 | Bacteria | 3515 |
| 725 | Ga0495680_0011827 | 3300047322 | Bacteria | 7707 |
| 726 | Ga0495680_0258390 | 3300047322 | Bacteria | 1232 |
| 727 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 728 | Ga0495683_0002629 | 3300047323 | Bacteria | 10733 |
| 729 | Ga0495683_0092087 | 3300047323 | Bacteria | 1467 |
| 730 | Ga0495683_0100117 | 3300047323 | Bacteria | 1394 |
| 731 | Ga0495683_0197899 | 3300047323 | Bacteria | 908 |
| 732 | Ga0495687_039117 | 3300047443 | Bacteria | 2101 |
| 733 | Ga0495675_0062087 | 3300047444 | Bacteria | 2366 |
| 734 | Ga0495677_0140514 | 3300047445 | Bacteria | 927 |
| 735 | Ga0495679_005443 | 3300047446 | Bacteria | 5644 |
| 736 | Ga0495679_006754 | 3300047446 | Bacteria | 4890 |
| 737 | Ga0495673_0000139 | 3300047469 | Bacteria | 130652 |
| 738 | Ga0495673_0000204 | 3300047469 | Bacteria | 89887 |
| 739 | Ga0495673_0000296 | 3300047469 | Bacteria | 66691 |
| 740 | Ga0495673_0000381 | 3300047469 | Bacteria | 52869 |
| 741 | Ga0495673_0001382 | 3300047469 | Bacteria | 19531 |
| 742 | Ga0495673_0001490 | 3300047469 | Bacteria | 18517 |
| 743 | Ga0495681_0032686 | 3300047470 | Bacteria | 2616 |
| 744 | Ga0495681_0038896 | 3300047470 | Bacteria | 2327 |
| 745 | Ga0495684_0249350 | 3300047471 | Bacteria | 1292 |
| 746 | Ga0495684_0424912 | 3300047471 | Bacteria | 928 |
| 747 | Ga0495686_0000932 | 3300047472 | Bacteria | 36370 |
| 748 | Ga0495686_0001131 | 3300047472 | Bacteria | 31525 |
| 749 | Ga0495686_0078903 | 3300047472 | Bacteria | 2014 |
| 750 | Ga0495626_0000985 | 3300048091 | Bacteria | 24528 |
| 751 | Ga0495626_0011297 | 3300048091 | Bacteria | 4728 |
| 752 | Ga0495626_0037972 | 3300048091 | Bacteria | 2286 |
| 753 | Ga0495626_0113074 | 3300048091 | Bacteria | 1174 |
| 754 | Ga0496100_0007795 | 3300048903 | Bacteria | 5939 |
| 755 | Ga0496100_0187892 | 3300048903 | Bacteria | 1498 |
| 756 | Ga0496101_0008396 | 3300048904 | Bacteria | 6749 |
| 757 | Ga0496101_0214875 | 3300048904 | Bacteria | 1491 |
| 758 | Ga0496102_0012755 | 3300048905 | Bacteria | 7277 |
| 759 | Ga0496102_0095663 | 3300048905 | Bacteria | 2753 |
| 760 | Ga0496102_0162264 | 3300048905 | Bacteria | 2102 |
| 761 | Ga0496104_0001453 | 3300048907 | Bacteria | 20471 |
| 762 | Ga0496104_0043071 | 3300048907 | Bacteria | 4239 |
| 763 | Ga0496104_0103788 | 3300048907 | Bacteria | 2723 |
| 764 | Ga0496104_0168388 | 3300048907 | Bacteria | 2101 |
| 765 | Ga0496105_0017664 | 3300048908 | Bacteria | 5723 |
| 766 | Ga0496105_0182466 | 3300048908 | Bacteria | 1718 |
| 767 | Ga0496106_0005946 | 3300048909 | Bacteria | 9010 |
| 768 | Ga0496106_0061377 | 3300048909 | Bacteria | 2852 |
| 769 | Ga0496107_0047588 | 3300048910 | Bacteria | 3088 |
| 770 | Ga0496107_0138529 | 3300048910 | Bacteria | 1798 |
| 771 | Ga0496107_0157598 | 3300048910 | Bacteria | 1681 |
| 772 | Ga0496108_0052815 | 3300048911 | Bacteria | 3407 |
| 773 | Ga0496109_0026177 | 3300048912 | Bacteria | 5200 |
| 774 | Ga0496109_0231886 | 3300048912 | Bacteria | 1737 |
| 775 | Ga0496110_0061421 | 3300048913 | Bacteria | 3316 |
| 776 | Ga0496112_0069091 | 3300048915 | Bacteria | 3490 |
| 777 | Ga0496112_0069093 | 3300048915 | Bacteria | 3490 |
| 778 | Ga0496112_0234241 | 3300048915 | Bacteria | 1790 |
| 779 | Ga0496113_0009831 | 3300048916 | Bacteria | 6296 |
| 780 | Ga0496113_0369185 | 3300048916 | Bacteria | 1152 |
| 781 | Ga0496114_0003425 | 3300048917 | Bacteria | 12174 |
| 782 | Ga0496114_0221129 | 3300048917 | Bacteria | 1662 |
| 783 | Ga0496114_0591727 | 3300048917 | Bacteria | 978 |
| 784 | Ga0496115_0004888 | 3300048918 | Bacteria | 9729 |
| 785 | Ga0496115_0009776 | 3300048918 | Bacteria | 7144 |
| 786 | Ga0496115_0023113 | 3300048918 | Bacteria | 4823 |
| 787 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 788 | Ga0496116_0048918 | 3300048919 | Bacteria | 2832 |
| 789 | Ga0496116_0070363 | 3300048919 | Bacteria | 2221 |
| 790 | Ga0496116_0111707 | 3300048919 | Bacteria | 1604 |
| 791 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 792 | Ga0496117_0010209 | 3300048920 | Bacteria | 8605 |
| 793 | Ga0496117_0043729 | 3300048920 | Bacteria | 3253 |
| 794 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 795 | Ga0496118_0002115 | 3300048921 | Bacteria | 27830 |
| 796 | Ga0496118_0003691 | 3300048921 | Bacteria | 18973 |
| 797 | Ga0496118_0039064 | 3300048921 | Bacteria | 3793 |
| 798 | Ga0496118_0041244 | 3300048921 | Bacteria | 3657 |
| 799 | Ga0496118_0114485 | 3300048921 | Bacteria | 1778 |
| 800 | Ga0496119_0005112 | 3300048922 | Bacteria | 12723 |
| 801 | Ga0496119_0040496 | 3300048922 | Bacteria | 2979 |
| 802 | Ga0496120_0002102 | 3300048923 | Bacteria | 21316 |
| 803 | Ga0496120_0004002 | 3300048923 | Bacteria | 12809 |
| 804 | Ga0496121_0002051 | 3300048924 | Bacteria | 31889 |
| 805 | Ga0496121_0002266 | 3300048924 | Bacteria | 29939 |
| 806 | Ga0496121_0004661 | 3300048924 | Bacteria | 18211 |
| 807 | Ga0496121_0118184 | 3300048924 | Bacteria | 2007 |
| 808 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 809 | Ga0496122_0000049 | 3300048925 | Bacteria | 268493 |
| 810 | Ga0496122_0003675 | 3300048925 | Bacteria | 19902 |
| 811 | Ga0496123_0000042 | 3300048926 | Bacteria | 254481 |
| 812 | Ga0496123_0000061 | 3300048926 | Bacteria | 220856 |
| 813 | Ga0496123_0002948 | 3300048926 | Bacteria | 19877 |
| 814 | Ga0496124_0000084 | 3300048927 | Bacteria | 204993 |
| 815 | Ga0496124_0003222 | 3300048927 | Bacteria | 20166 |
| 816 | Ga0496124_0011365 | 3300048927 | Bacteria | 8903 |
| 817 | Ga0496124_0218820 | 3300048927 | Bacteria | 1434 |
| 818 | Ga0496125_0000071 | 3300048928 | Bacteria | 243580 |
| 819 | Ga0496125_0002526 | 3300048928 | Bacteria | 23616 |
| 820 | Ga0496125_0003276 | 3300048928 | Bacteria | 19912 |
| 821 | Ga0496125_0012791 | 3300048928 | Bacteria | 8296 |
| 822 | Ga0496125_0089187 | 3300048928 | Bacteria | 2320 |
| 823 | Ga0496126_0002615 | 3300048929 | Bacteria | 23994 |
| 824 | Ga0496126_0078412 | 3300048929 | Bacteria | 2927 |
| 825 | Ga0495678_001063 | 3300049459 | Bacteria | 23279 |
| 826 | Ga0495678_001782 | 3300049459 | Bacteria | 15920 |
| 827 | Ga0495678_007026 | 3300049459 | Bacteria | 5900 |
| 828 | Ga0495682_0000017 | 3300049460 | Bacteria | 233333 |
| 829 | Ga0501292_003979 | 3300049515 | Bacteria | 2001 |
| 830 | Ga0501031_0245443 | 3300049568 | Bacteria | 1164 |
| 831 | Ga0501032_0029712 | 3300049569 | Bacteria | 3749 |
| 832 | Ga0501032_0066054 | 3300049569 | Bacteria | 2418 |
| 833 | Ga0501032_0238738 | 3300049569 | Bacteria | 1181 |
| 834 | Ga0501033_0000347 | 3300049570 | Bacteria | 44046 |
| 835 | Ga0501034_0003664 | 3300049571 | Bacteria | 17373 |
| 836 | Ga0501034_0298752 | 3300049571 | Bacteria | 1547 |
| 837 | Ga0501036_0677602 | 3300049572 | Bacteria | 853 |
| 838 | Ga0501037_0041992 | 3300049573 | Bacteria | 3362 |
| 839 | Ga0501038_0142624 | 3300049574 | Bacteria | 1959 |
| 840 | Ga0501039_0519036 | 3300049575 | Bacteria | 935 |
| 841 | Ga0501042_0170219 | 3300049578 | Bacteria | 1572 |
| 842 | Ga0501042_0404438 | 3300049578 | Bacteria | 989 |
| 843 | Ga0501043_0000012 | 3300049579 | Bacteria | 188907 |
| 844 | Ga0501043_0192051 | 3300049579 | Bacteria | 1587 |
| 845 | Ga0501043_0204213 | 3300049579 | Bacteria | 1533 |
| 846 | Ga0501043_0276561 | 3300049579 | Bacteria | 1288 |
| 847 | Ga0501046_0000030 | 3300049580 | Bacteria | 187803 |
| 848 | Ga0501046_0068046 | 3300049580 | Bacteria | 2772 |
| 849 | Ga0501047_0000049 | 3300049581 | Bacteria | 162513 |
| 850 | Ga0501047_0036949 | 3300049581 | Bacteria | 4721 |
| 851 | Ga0501048_0000489 | 3300049582 | Bacteria | 27704 |
| 852 | Ga0501074_0338117 | 3300049590 | Bacteria | 1069 |
| 853 | Ga0501076_0472752 | 3300049592 | Bacteria | 1033 |
| 854 | Ga0501225_0001420 | 3300049705 | Bacteria | 7480 |
| 855 | Ga0501079_0519090 | 3300049741 | Bacteria | 937 |
| 856 | Ga0501035_0009229 | 3300049822 | Bacteria | 9172 |
| 857 | Ga0501035_0076485 | 3300049822 | Bacteria | 2960 |
| 858 | Ga0501035_0243236 | 3300049822 | Bacteria | 1530 |
| 859 | Ga0501035_0499453 | 3300049822 | Bacteria | 1001 |
| 860 | Ga0501045_0028055 | 3300049824 | Bacteria | 4059 |
| 861 | nmdc:mga03683_30766_c1 | 3300050489 | Bacteria | 2149 |
| 862 | nmdc:mga0k408_177583_c1 | 3300050493 | Bacteria | 1270 |
| 863 | nmdc:mga0k408_66252_c1 | 3300050493 | Bacteria | 2104 |
| 864 | nmdc:mga06z11_237095_c1 | 3300050494 | Bacteria | 1070 |
| 865 | nmdc:mga05p37_327008_c1 | 3300050507 | Bacteria | 1812 |
| 866 | nmdc:mga05p37_358905_c1 | 3300050507 | Bacteria | 1714 |
| 867 | nmdc:mga09592_16638_c1 | 3300050508 | Bacteria | 6019 |
| 868 | nmdc:mga0n895_135888_c1 | 3300050512 | Bacteria | 2485 |
| 869 | nmdc:mga08x19_316610_c1 | 3300050514 | Bacteria | 1085 |
| 870 | nmdc:mga0a205_250823_c1 | 3300050515 | Bacteria | 1649 |
| 871 | nmdc:mga0sz30_33874_c1 | 3300050516 | Bacteria | 2124 |
| 872 | Ga0500635_0004059 | 3300053080 | Bacteria | 3740 |
| 873 | Ga0500578_0000410 | 3300053086 | Bacteria | 52417 |
| 874 | Ga0500578_0199438 | 3300053086 | Bacteria | 1225 |
| 875 | Ga0500643_007338 | 3300053087 | Bacteria | 4466 |
| 876 | Ga0500644_0000005 | 3300053088 | Bacteria | 164966 |
| 877 | Ga0500644_0000154 | 3300053088 | Bacteria | 42962 |
| 878 | Ga0500644_0000245 | 3300053088 | Bacteria | 30821 |
| 879 | Ga0500644_0001693 | 3300053088 | Bacteria | 5747 |
| 880 | Ga0500644_0091665 | 3300053088 | Bacteria | 1138 |
| 881 | Ga0500555_057413 | 3300053103 | Bacteria | 1053 |
| 882 | Ga0500562_000208 | 3300053108 | Bacteria | 15909 |
| 883 | Ga0500594_0000040 | 3300053118 | Bacteria | 42492 |
| 884 | Ga0500594_0000116 | 3300053118 | Bacteria | 22601 |
| 885 | Ga0500608_000004 | 3300053122 | Bacteria | 108109 |
| 886 | Ga0500608_000030 | 3300053122 | Bacteria | 66677 |
| 887 | Ga0500618_000145 | 3300053125 | Bacteria | 58724 |
| 888 | Ga0500618_001635 | 3300053125 | Bacteria | 9657 |
| 889 | Ga0500658_0018052 | 3300053134 | Bacteria | 2641 |
| 890 | Ga0500658_0253443 | 3300053134 | Bacteria | 809 |
| 891 | Ga0500559_0000007 | 3300053136 | Bacteria | 226236 |
| 892 | Ga0500559_0038802 | 3300053136 | Bacteria | 2070 |
| 893 | Ga0500559_0210212 | 3300053136 | Bacteria | 918 |
| 894 | Ga0500564_000013 | 3300053138 | Bacteria | 54100 |
| 895 | Ga0500564_000064 | 3300053138 | Bacteria | 28288 |
| 896 | Ga0500564_000231 | 3300053138 | Bacteria | 15524 |
| 897 | Ga0500568_0009425 | 3300053139 | Bacteria | 4642 |
| 898 | Ga0500577_0000585 | 3300053142 | Bacteria | 9396 |
| 899 | Ga0500577_0125023 | 3300053142 | Bacteria | 1073 |
| 900 | Ga0500590_024655 | 3300053148 | Bacteria | 3122 |
| 901 | Ga0500622_0000261 | 3300053156 | Bacteria | 53821 |
| 902 | Ga0500622_0000865 | 3300053156 | Bacteria | 25784 |
| 903 | Ga0500622_0016413 | 3300053156 | Bacteria | 3958 |
| 904 | Ga0500627_0000181 | 3300053158 | Bacteria | 18431 |
| 905 | Ga0500634_0005909 | 3300053161 | Bacteria | 5867 |
| 906 | Ga0500645_001952 | 3300053730 | Bacteria | 9769 |
| 907 | Ga0500645_006464 | 3300053730 | Bacteria | 4179 |
| 908 | Ga0500609_000047 | 3300053731 | Bacteria | 16050 |
| 909 | Ga0587067_030828 | 3300059640 | Bacteria | 988 |
| 910 | Ga0501082_0509560 | 3300060353 | Bacteria | 1052 |
| 911 | Ga0466962_0005043 | 3300061719 | Bacteria | 6351 |
| 912 | Ga0466962_0012718 | 3300061719 | Bacteria | 4049 |
| 913 | Ga0466962_0060604 | 3300061719 | Bacteria | 1806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0017047 | Ga0395899_0017047_1836_2576 | 212 |
| 2 | 3300035724 | Ga0373933_0149437 | Ga0373933_0149437_302_1108 | 213 |
| 3 | 3300036401 | Ga0373937_0005178 | Ga0373937_0005178_5690_6496 | 213 |
| 4 | 3300046454 | Ga0495592_0227265 | Ga0495592_0227265_243_1049 | 213 |
| 5 | 3300046543 | Ga0495645_0071486 | Ga0495645_0071486_104_910 | 213 |
| 6 | 3300047322 | Ga0495680_0011827 | Ga0495680_0011827_2601_3407 | 213 |
| 7 | 3300005614 | Ga0068856_100150441 | Ga0068856_1001504412 | 214 |
| 8 | 3300025929 | Ga0207664_10205838 | Ga0207664_102058382 | 214 |
| 9 | 3300025935 | Ga0207709_10003779 | Ga0207709_1000377910 | 214 |
| 10 | 3300026078 | Ga0207702_10218662 | Ga0207702_102186622 | 214 |
| 11 | 3300049568 | Ga0501031_0245443 | Ga0501031_0245443_26_676 | 214 |
| 12 | 3300013297 | Ga0157378_10481226 | Ga0157378_104812262 | 215 |
| 13 | 3300014325 | Ga0163163_10056883 | Ga0163163_100568832 | 215 |
| 14 | 3300037418 | Ga0395900_0106418 | Ga0395900_0106418_865_1605 | 215 |
| 15 | 3300037466 | Ga0395898_0028249 | Ga0395898_0028249_3484_4224 | 215 |
| 16 | 3300035725 | Ga0373947_0049489 | Ga0373947_0049489_11_817 | 216 |
| 17 | 3300046462 | Ga0495651_0087398 | Ga0495651_0087398_732_1538 | 216 |
| 18 | 3300046463 | Ga0495653_0159087 | Ga0495653_0159087_647_1453 | 216 |
| 19 | 3300047471 | Ga0495684_0249350 | Ga0495684_0249350_301_1107 | 216 |
| 20 | 3300048922 | Ga0496119_0005112 | Ga0496119_0005112_1750_2496 | 216 |
| 21 | 3300048923 | Ga0496120_0004002 | Ga0496120_0004002_10051_10797 | 216 |
| 22 | 3300048927 | Ga0496124_0003222 | Ga0496124_0003222_9209_9955 | 216 |
| 23 | 3300003856 | Ga0058692_1000054 | Ga0058692_100005443 | 217 |
| 24 | 3300027312 | Ga0209371_1000116 | Ga0209371_100011653 | 217 |
| 25 | 3300030500 | Ga0268256_1000099 | Ga0268256_100009971 | 217 |
| 26 | 3300005366 | Ga0070659_100471499 | Ga0070659_1004714992 | 218 |
| 27 | 3300009011 | Ga0105251_10000362 | Ga0105251_1000036244 | 218 |
| 28 | 3300025735 | Ga0207713_1000429 | Ga0207713_100042943 | 218 |
| 29 | 3300031911 | Ga0307412_10269163 | Ga0307412_102691632 | 218 |
| 30 | 3300005457 | Ga0070662_100003027 | Ga0070662_1000030274 | 219 |
| 31 | 3300005563 | Ga0068855_100023793 | Ga0068855_1000237933 | 219 |
| 32 | 3300013100 | Ga0157373_10019006 | Ga0157373_100190062 | 219 |
| 33 | 3300025933 | Ga0207706_10006012 | Ga0207706_100060125 | 219 |
| 34 | 3300025949 | Ga0207667_10020346 | Ga0207667_100203464 | 219 |
| 35 | 3300046525 | Ga0495663_0005417 | Ga0495663_0005417_60_740 | 221 |
| 36 | 3300005436 | Ga0070713_100017602 | Ga0070713_1000176024 | 223 |
| 37 | 3300006028 | Ga0070717_10326679 | Ga0070717_103266792 | 223 |
| 38 | 3300009148 | Ga0105243_10138716 | Ga0105243_101387162 | 225 |
| 39 | 3300048925 | Ga0496122_0000049 | Ga0496122_0000049_39496_40242 | 225 |
| 40 | 3300048926 | Ga0496123_0000042 | Ga0496123_0000042_214240_214986 | 225 |
| 41 | 3300005331 | Ga0070670_100000709 | Ga0070670_1000007099 | 227 |
| 42 | 3300025925 | Ga0207650_10000841 | Ga0207650_100008418 | 227 |
| 43 | 3300048921 | Ga0496118_0041244 | Ga0496118_0041244_2227_2973 | 227 |
| 44 | 3300005841 | Ga0068863_100939432 | Ga0068863_1009394321 | 229 |
| 45 | 3300048091 | Ga0495626_0113074 | Ga0495626_0113074_67_816 | 229 |
| 46 | 3300035083 | Ga0373926_0098907 | Ga0373926_0098907_86_835 | 232 |
| 47 | 3300035692 | Ga0373935_0035714 | Ga0373935_0035714_1121_1870 | 232 |
| 48 | 3300035695 | Ga0373927_0072545 | Ga0373927_0072545_1081_1830 | 232 |
| 49 | 3300035724 | Ga0373933_0098457 | Ga0373933_0098457_636_1385 | 232 |
| 50 | 3300035725 | Ga0373947_0070779 | Ga0373947_0070779_36_785 | 232 |
| 51 | 3300036401 | Ga0373937_0071547 | Ga0373937_0071547_349_1098 | 232 |
| 52 | 3300037068 | Ga0373925_0343357 | Ga0373925_0343357_267_1016 | 232 |
| 53 | 3300046459 | Ga0495629_0183271 | Ga0495629_0183271_667_1416 | 232 |
| 54 | 3300046477 | Ga0495664_0274766 | Ga0495664_0274766_10_759 | 232 |
| 55 | 3300046683 | Ga0495658_0430122 | Ga0495658_0430122_74_823 | 232 |
| 56 | 3300049705 | Ga0501225_0001420 | Ga0501225_0001420_587_1306 | 232 |
| 57 | 3300005842 | Ga0068858_100758041 | Ga0068858_1007580411 | 233 |
| 58 | 3300007076 | Ga0075435_100365409 | Ga0075435_1003654092 | 233 |
| 59 | 3300049569 | Ga0501032_0066054 | Ga0501032_0066054_893_1681 | 233 |
| 60 | 3300049578 | Ga0501042_0404438 | Ga0501042_0404438_182_970 | 233 |
| 61 | 3300049579 | Ga0501043_0000012 | Ga0501043_0000012_27242_28030 | 233 |
| 62 | 3300049580 | Ga0501046_0000030 | Ga0501046_0000030_27214_28002 | 233 |
| 63 | 3300049581 | Ga0501047_0000049 | Ga0501047_0000049_1911_2699 | 233 |
| 64 | 3300049582 | Ga0501048_0000489 | Ga0501048_0000489_3123_3911 | 233 |
| 65 | 3300049824 | Ga0501045_0028055 | Ga0501045_0028055_1063_1851 | 233 |
| 66 | 3300037068 | Ga0373925_0017299 | Ga0373925_0017299_4444_5193 | 234 |
| 67 | 3300047317 | Ga0495604_0257653 | Ga0495604_0257653_34_783 | 234 |
| 68 | 3300049572 | Ga0501036_0677602 | Ga0501036_0677602_66_800 | 236 |
| 69 | iso_pu_bacteria | 2582581280 | 2585153536 | 237 |
| 70 | iso_pu_bacteria | 2582581293 | 2585197340 | 237 |
| 71 | iso_pu_bacteria | 2643221552 | 2643780236 | 237 |
| 72 | iso_pu_bacteria | 2643221584 | 2643928569 | 237 |
| 73 | iso_pu_bacteria | 2791355091 | 2792622457 | 237 |
| 74 | iso_pu_bacteria | 2818991435 | 2819540027 | 237 |
| 75 | iso_pu_bacteria | 2818991454 | 2819648973 | 237 |
| 76 | iso_pu_bacteria | 2818991457 | 2819661585 | 237 |
| 77 | iso_pu_bacteria | 2852684882 | 2852688174 | 237 |
| 78 | iso_pu_bacteria | 2919130084 | 2919134492 | 237 |
| 79 | iso_pu_bacteria | 2929195423 | 2929199596 | 237 |
| 80 | iso_pu_bacteria | 8021622325 | 8021623426 | 237 |
| 81 | iso_pu_bacteria | 8021626552 | 8021629241 | 237 |
| 82 | iso_pu_bacteria | 8021648035 | 8021648714 | 237 |
| 83 | 3300039447 | Ga0436361_0206609 | Ga0436361_0206609_174_920 | 238 |
| 84 | 3300046453 | Ga0495627_026793 | Ga0495627_026793_458_1201 | 238 |
| 85 | 3300046558 | Ga0495633_0004878 | Ga0495633_0004878_2166_2909 | 238 |
| 86 | 3300053161 | Ga0500634_0005909 | Ga0500634_0005909_533_1276 | 238 |
| 87 | iso_pu_bacteria | 2582581280 | 2585153296 | 238 |
| 88 | iso_pu_bacteria | 2582581293 | 2585196985 | 238 |
| 89 | iso_pu_bacteria | 2643221552 | 2643778924 | 238 |
| 90 | iso_pu_bacteria | 2643221584 | 2643930556 | 238 |
| 91 | iso_pu_bacteria | 2818991435 | 2819539227 | 238 |
| 92 | iso_pu_bacteria | 2818991454 | 2819648258 | 238 |
| 93 | iso_pu_bacteria | 2849560528 | 2849562955 | 238 |
| 94 | iso_pu_bacteria | 2849573788 | 2849573931 | 238 |
| 95 | iso_pu_bacteria | 2851153111 | 2851155571 | 238 |
| 96 | iso_pu_bacteria | 2857504554 | 2857509004 | 238 |
| 97 | iso_pu_bacteria | 2898329390 | 2898333672 | 238 |
| 98 | iso_pu_bacteria | 8054302542 | 8054303003 | 238 |
| 99 | 3300003215 | JGI25153J46596_10033239 | JGI25153J46596_100332391 | 239 |
| 100 | 3300003794 | Ga0055531_10007156 | Ga0055531_100071562 | 239 |
| 101 | 3300005355 | Ga0070671_100009724 | Ga0070671_1000097245 | 239 |
| 102 | 3300005367 | Ga0070667_100006541 | Ga0070667_1000065415 | 239 |
| 103 | 3300005544 | Ga0070686_100038490 | Ga0070686_1000384902 | 239 |
| 104 | 3300005548 | Ga0070665_100033725 | Ga0070665_1000337254 | 239 |
| 105 | 3300005617 | Ga0068859_100000211 | Ga0068859_10000021132 | 239 |
| 106 | 3300005841 | Ga0068863_100003996 | Ga0068863_1000039967 | 239 |
| 107 | 3300005842 | Ga0068858_100005568 | Ga0068858_1000055684 | 239 |
| 108 | 3300005843 | Ga0068860_100004169 | Ga0068860_10000416911 | 239 |
| 109 | 3300006353 | Ga0075370_10081948 | Ga0075370_100819481 | 239 |
| 110 | 3300006931 | Ga0097620_100000211 | Ga0097620_10000021132 | 239 |
| 111 | 3300006948 | Ga0099826_10198776 | Ga0099826_101987762 | 239 |
| 112 | 3300009092 | Ga0105250_10003540 | Ga0105250_100035402 | 239 |
| 113 | 3300009101 | Ga0105247_10000260 | Ga0105247_1000026014 | 239 |
| 114 | 3300009174 | Ga0105241_10076924 | Ga0105241_100769243 | 239 |
| 115 | 3300009177 | Ga0105248_10001076 | Ga0105248_100010767 | 239 |
| 116 | 3300009553 | Ga0105249_10020152 | Ga0105249_100201524 | 239 |
| 117 | 3300009978 | Ga0105148_100701 | Ga0105148_1007012 | 239 |
| 118 | 3300013306 | Ga0163162_10096375 | Ga0163162_100963752 | 239 |
| 119 | 3300014325 | Ga0163163_10049693 | Ga0163163_100496932 | 239 |
| 120 | 3300014968 | Ga0157379_10007683 | Ga0157379_100076833 | 239 |
| 121 | 3300025230 | Ga0209563_105221 | Ga0209563_1052212 | 239 |
| 122 | 3300025297 | Ga0209758_1000571 | Ga0209758_100057142 | 239 |
| 123 | 3300025298 | Ga0209050_1021417 | Ga0209050_10214172 | 239 |
| 124 | 3300025304 | Ga0209257_1000687 | Ga0209257_100068714 | 239 |
| 125 | 3300025900 | Ga0207710_10000322 | Ga0207710_1000032229 | 239 |
| 126 | 3300025914 | Ga0207671_10085457 | Ga0207671_100854572 | 239 |
| 127 | 3300025931 | Ga0207644_10018202 | Ga0207644_100182024 | 239 |
| 128 | 3300025941 | Ga0207711_10052692 | Ga0207711_100526923 | 239 |
| 129 | 3300025986 | Ga0207658_10044094 | Ga0207658_100440943 | 239 |
| 130 | 3300026035 | Ga0207703_10002171 | Ga0207703_1000217111 | 239 |
| 131 | 3300026088 | Ga0207641_10007137 | Ga0207641_100071376 | 239 |
| 132 | 3300028379 | Ga0268266_10035428 | Ga0268266_100354282 | 239 |
| 133 | 3300028381 | Ga0268264_10128469 | Ga0268264_101284692 | 239 |
| 134 | 3300030733 | Ga0314311_1206614 | Ga0314311_12066142 | 239 |
| 135 | 3300031456 | Ga0307513_10287954 | Ga0307513_102879541 | 239 |
| 136 | 3300037418 | Ga0395900_0127341 | Ga0395900_0127341_235_981 | 239 |
| 137 | 3300037418 | Ga0395900_0187762 | Ga0395900_0187762_654_1400 | 239 |
| 138 | 3300037466 | Ga0395898_0005979 | Ga0395898_0005979_1917_2663 | 239 |
| 139 | 3300037471 | Ga0395905_0242263 | Ga0395905_0242263_786_1532 | 239 |
| 140 | 3300038443 | Ga0395901_0174947 | Ga0395901_0174947_655_1401 | 239 |
| 141 | 3300041413 | Ga0439465_0000047 | Ga0439465_0000047_1754_2515 | 239 |
| 142 | 3300042004 | Ga0439445_0024486 | Ga0439445_0024486_460_1221 | 239 |
| 143 | 3300042007 | Ga0439449_0000733 | Ga0439449_0000733_4004_4765 | 239 |
| 144 | 3300042014 | Ga0439457_054364 | Ga0439457_054364_122_868 | 239 |
| 145 | 3300044693 | Ga0466961_0020151 | Ga0466961_0020151_3330_4076 | 239 |
| 146 | 3300044693 | Ga0466961_0050122 | Ga0466961_0050122_909_1649 | 239 |
| 147 | 3300044694 | Ga0466963_0194140 | Ga0466963_0194140_335_1081 | 239 |
| 148 | 3300044719 | Ga0466971_0132501 | Ga0466971_0132501_227_973 | 239 |
| 149 | 3300044842 | Ga0466957_0514796 | Ga0466957_0514796_50_796 | 239 |
| 150 | 3300045049 | Ga0466959_0005857 | Ga0466959_0005857_68_814 | 239 |
| 151 | 3300046471 | Ga0495650_0152662 | Ga0495650_0152662_66_791 | 239 |
| 152 | 3300046513 | Ga0495616_0051387 | Ga0495616_0051387_143_889 | 239 |
| 153 | 3300046524 | Ga0495648_0000075 | Ga0495648_0000075_61111_61836 | 239 |
| 154 | 3300046525 | Ga0495663_0000222 | Ga0495663_0000222_16686_17432 | 239 |
| 155 | 3300046530 | Ga0495654_0047253 | Ga0495654_0047253_689_1435 | 239 |
| 156 | 3300046616 | Ga0495668_0014770 | Ga0495668_0014770_488_1213 | 239 |
| 157 | 3300046810 | Ga0495660_0055576 | Ga0495660_0055576_1088_1813 | 239 |
| 158 | 3300046810 | Ga0495660_0140348 | Ga0495660_0140348_226_951 | 239 |
| 159 | 3300047469 | Ga0495673_0000139 | Ga0495673_0000139_41509_42234 | 239 |
| 160 | 3300047469 | Ga0495673_0001382 | Ga0495673_0001382_5296_6021 | 239 |
| 161 | 3300048905 | Ga0496102_0162264 | Ga0496102_0162264_326_1072 | 239 |
| 162 | 3300048915 | Ga0496112_0069093 | Ga0496112_0069093_1964_2710 | 239 |
| 163 | 3300048924 | Ga0496121_0002051 | Ga0496121_0002051_28497_29243 | 239 |
| 164 | 3300048928 | Ga0496125_0012791 | Ga0496125_0012791_2950_3696 | 239 |
| 165 | 3300049570 | Ga0501033_0000347 | Ga0501033_0000347_35496_36245 | 239 |
| 166 | 3300049571 | Ga0501034_0003664 | Ga0501034_0003664_5235_5960 | 239 |
| 167 | 3300049571 | Ga0501034_0298752 | Ga0501034_0298752_594_1319 | 239 |
| 168 | 3300049579 | Ga0501043_0192051 | Ga0501043_0192051_484_1209 | 239 |
| 169 | 3300049822 | Ga0501035_0499453 | Ga0501035_0499453_165_890 | 239 |
| 170 | 3300050494 | nmdc:mga06z11_237095_c1 | nmdc:mga06z11_237095_c1_281_1027 | 239 |
| 171 | 3300053088 | Ga0500644_0000005 | Ga0500644_0000005_57609_58334 | 239 |
| 172 | 3300053134 | Ga0500658_0253443 | Ga0500658_0253443_36_782 | 239 |
| 173 | 3300053138 | Ga0500564_000013 | Ga0500564_000013_19408_20133 | 239 |
| 174 | 3300053142 | Ga0500577_0000585 | Ga0500577_0000585_6306_7031 | 239 |
| 175 | 3300053142 | Ga0500577_0125023 | Ga0500577_0125023_55_801 | 239 |
| 176 | iso_pu_bacteria | 2582581279 | 2585149037 | 239 |
| 177 | iso_pu_bacteria | 2747842501 | 2748017759 | 239 |
| 178 | 3300003781 | Ga0055536_1000057 | Ga0055536_100005775 | 240 |
| 179 | 3300003791 | Ga0055530_10002520 | Ga0055530_100025206 | 240 |
| 180 | 3300003794 | Ga0055531_10000053 | Ga0055531_10000053102 | 240 |
| 181 | 3300003794 | Ga0055531_10000224 | Ga0055531_1000022462 | 240 |
| 182 | 3300003794 | Ga0055531_10001089 | Ga0055531_1000108910 | 240 |
| 183 | 3300003794 | Ga0055531_10002666 | Ga0055531_100026665 | 240 |
| 184 | 3300005262 | Ga0065165_1000660 | Ga0065165_100066011 | 240 |
| 185 | 3300005981 | Ga0081538_10003998 | Ga0081538_100039987 | 240 |
| 186 | 3300006353 | Ga0075370_10028358 | Ga0075370_100283584 | 240 |
| 187 | 3300025292 | Ga0209676_1000031 | Ga0209676_1000031211 | 240 |
| 188 | 3300025295 | Ga0209564_1001441 | Ga0209564_100144120 | 240 |
| 189 | 3300025297 | Ga0209758_1006173 | Ga0209758_10061735 | 240 |
| 190 | 3300025298 | Ga0209050_1000087 | Ga0209050_100008761 | 240 |
| 191 | 3300025298 | Ga0209050_1011531 | Ga0209050_10115313 | 240 |
| 192 | 3300025299 | Ga0209256_1000694 | Ga0209256_100069419 | 240 |
| 193 | 3300025304 | Ga0209257_1000050 | Ga0209257_1000050219 | 240 |
| 194 | 3300025304 | Ga0209257_1000326 | Ga0209257_100032628 | 240 |
| 195 | 3300028794 | Ga0307515_10012849 | Ga0307515_1001284913 | 240 |
| 196 | 3300028794 | Ga0307515_10067859 | Ga0307515_100678593 | 240 |
| 197 | 3300028794 | Ga0307515_10110744 | Ga0307515_101107443 | 240 |
| 198 | 3300042436 | Ga0439435_0051950 | Ga0439435_0051950_429_1157 | 240 |
| 199 | 3300046457 | Ga0495590_0000446 | Ga0495590_0000446_11449_12177 | 240 |
| 200 | 3300046460 | Ga0495638_0008496 | Ga0495638_0008496_4719_5447 | 240 |
| 201 | 3300046460 | Ga0495638_0059967 | Ga0495638_0059967_1139_1867 | 240 |
| 202 | 3300046471 | Ga0495650_0000020 | Ga0495650_0000020_31963_32691 | 240 |
| 203 | 3300046471 | Ga0495650_0000207 | Ga0495650_0000207_59611_60339 | 240 |
| 204 | 3300046512 | Ga0495610_0000140 | Ga0495610_0000140_22370_23098 | 240 |
| 205 | 3300046512 | Ga0495610_0001225 | Ga0495610_0001225_9320_10048 | 240 |
| 206 | 3300046512 | Ga0495610_0003718 | Ga0495610_0003718_10568_11296 | 240 |
| 207 | 3300046513 | Ga0495616_0000385 | Ga0495616_0000385_8824_9552 | 240 |
| 208 | 3300046513 | Ga0495616_0000460 | Ga0495616_0000460_16319_17047 | 240 |
| 209 | 3300046515 | Ga0495620_0012624 | Ga0495620_0012624_55_783 | 240 |
| 210 | 3300046518 | Ga0495631_0001800 | Ga0495631_0001800_3187_3915 | 240 |
| 211 | 3300046518 | Ga0495631_0005262 | Ga0495631_0005262_668_1396 | 240 |
| 212 | 3300046519 | Ga0495632_0007389 | Ga0495632_0007389_4202_4930 | 240 |
| 213 | 3300046519 | Ga0495632_0094912 | Ga0495632_0094912_312_1040 | 240 |
| 214 | 3300046520 | Ga0495637_0045406 | Ga0495637_0045406_166_894 | 240 |
| 215 | 3300046522 | Ga0495643_0070207 | Ga0495643_0070207_423_1151 | 240 |
| 216 | 3300046523 | Ga0495644_0039900 | Ga0495644_0039900_518_1246 | 240 |
| 217 | 3300046524 | Ga0495648_0000887 | Ga0495648_0000887_4910_5638 | 240 |
| 218 | 3300046524 | Ga0495648_0004007 | Ga0495648_0004007_11511_12239 | 240 |
| 219 | 3300046524 | Ga0495648_0036871 | Ga0495648_0036871_2366_3094 | 240 |
| 220 | 3300046530 | Ga0495654_0000016 | Ga0495654_0000016_245717_246445 | 240 |
| 221 | 3300046530 | Ga0495654_0000109 | Ga0495654_0000109_92542_93270 | 240 |
| 222 | 3300046558 | Ga0495633_0055548 | Ga0495633_0055548_971_1699 | 240 |
| 223 | 3300046616 | Ga0495668_0005752 | Ga0495668_0005752_813_1541 | 240 |
| 224 | 3300046660 | Ga0495625_0001046 | Ga0495625_0001046_10203_10931 | 240 |
| 225 | 3300046660 | Ga0495625_0004348 | Ga0495625_0004348_12670_13398 | 240 |
| 226 | 3300046660 | Ga0495625_0169128 | Ga0495625_0169128_361_1089 | 240 |
| 227 | 3300046660 | Ga0495625_0181193 | Ga0495625_0181193_136_864 | 240 |
| 228 | 3300046660 | Ga0495625_0185330 | Ga0495625_0185330_293_1021 | 240 |
| 229 | 3300046660 | Ga0495625_0233445 | Ga0495625_0233445_331_1059 | 240 |
| 230 | 3300046692 | Ga0495671_0086563 | Ga0495671_0086563_67_795 | 240 |
| 231 | 3300046794 | Ga0495589_0018900 | Ga0495589_0018900_1349_2077 | 240 |
| 232 | 3300047320 | Ga0495672_0004568 | Ga0495672_0004568_10395_11123 | 240 |
| 233 | 3300047320 | Ga0495672_0012193 | Ga0495672_0012193_520_1248 | 240 |
| 234 | 3300047323 | Ga0495683_0092087 | Ga0495683_0092087_634_1362 | 240 |
| 235 | 3300047469 | Ga0495673_0000204 | Ga0495673_0000204_33454_34182 | 240 |
| 236 | 3300047469 | Ga0495673_0000296 | Ga0495673_0000296_65441_66169 | 240 |
| 237 | 3300047469 | Ga0495673_0000381 | Ga0495673_0000381_27770_28498 | 240 |
| 238 | 3300047469 | Ga0495673_0001490 | Ga0495673_0001490_15591_16319 | 240 |
| 239 | 3300047470 | Ga0495681_0038896 | Ga0495681_0038896_632_1360 | 240 |
| 240 | 3300047472 | Ga0495686_0000932 | Ga0495686_0000932_2492_3220 | 240 |
| 241 | 3300047472 | Ga0495686_0001131 | Ga0495686_0001131_749_1477 | 240 |
| 242 | 3300048927 | Ga0496124_0011365 | Ga0496124_0011365_5177_5905 | 240 |
| 243 | 3300048929 | Ga0496126_0078412 | Ga0496126_0078412_2180_2908 | 240 |
| 244 | 3300049459 | Ga0495678_001063 | Ga0495678_001063_12454_13182 | 240 |
| 245 | 3300049459 | Ga0495678_001782 | Ga0495678_001782_13881_14609 | 240 |
| 246 | 3300050516 | nmdc:mga0sz30_33874_c1 | nmdc:mga0sz30_33874_c1_44_772 | 240 |
| 247 | 3300053080 | Ga0500635_0004059 | Ga0500635_0004059_2474_3202 | 240 |
| 248 | 3300053086 | Ga0500578_0000410 | Ga0500578_0000410_9367_10095 | 240 |
| 249 | 3300053088 | Ga0500644_0000154 | Ga0500644_0000154_21765_22493 | 240 |
| 250 | 3300053088 | Ga0500644_0000245 | Ga0500644_0000245_14737_15465 | 240 |
| 251 | 3300053088 | Ga0500644_0001693 | Ga0500644_0001693_4618_5346 | 240 |
| 252 | 3300053088 | Ga0500644_0091665 | Ga0500644_0091665_53_781 | 240 |
| 253 | 3300053103 | Ga0500555_057413 | Ga0500555_057413_226_954 | 240 |
| 254 | 3300053108 | Ga0500562_000208 | Ga0500562_000208_3610_4338 | 240 |
| 255 | 3300053118 | Ga0500594_0000040 | Ga0500594_0000040_40498_41226 | 240 |
| 256 | 3300053118 | Ga0500594_0000116 | Ga0500594_0000116_18795_19523 | 240 |
| 257 | 3300053122 | Ga0500608_000004 | Ga0500608_000004_49477_50205 | 240 |
| 258 | 3300053125 | Ga0500618_000145 | Ga0500618_000145_16376_17104 | 240 |
| 259 | 3300053136 | Ga0500559_0000007 | Ga0500559_0000007_173211_173939 | 240 |
| 260 | 3300053136 | Ga0500559_0038802 | Ga0500559_0038802_354_1082 | 240 |
| 261 | 3300053136 | Ga0500559_0210212 | Ga0500559_0210212_26_754 | 240 |
| 262 | 3300053138 | Ga0500564_000064 | Ga0500564_000064_12245_12973 | 240 |
| 263 | 3300053138 | Ga0500564_000231 | Ga0500564_000231_7490_8218 | 240 |
| 264 | 3300053156 | Ga0500622_0000261 | Ga0500622_0000261_41151_41879 | 240 |
| 265 | 3300053156 | Ga0500622_0000865 | Ga0500622_0000865_16020_16748 | 240 |
| 266 | 3300053156 | Ga0500622_0016413 | Ga0500622_0016413_188_916 | 240 |
| 267 | 3300053158 | Ga0500627_0000181 | Ga0500627_0000181_16948_17676 | 240 |
| 268 | 3300053730 | Ga0500645_001952 | Ga0500645_001952_3448_4176 | 240 |
| 269 | 3300053731 | Ga0500609_000047 | Ga0500609_000047_835_1563 | 240 |
| 270 | 3300003323 | rootH1_10009674 | rootH1_100096742 | 241 |
| 271 | 3300005328 | Ga0070676_10015199 | Ga0070676_100151991 | 241 |
| 272 | 3300005337 | Ga0070682_100067114 | Ga0070682_1000671142 | 241 |
| 273 | 3300005339 | Ga0070660_100003037 | Ga0070660_1000030377 | 241 |
| 274 | 3300005347 | Ga0070668_100127176 | Ga0070668_1001271762 | 241 |
| 275 | 3300005365 | Ga0070688_100223244 | Ga0070688_1002232442 | 241 |
| 276 | 3300005434 | Ga0070709_10036865 | Ga0070709_100368653 | 241 |
| 277 | 3300005445 | Ga0070708_100013868 | Ga0070708_1000138682 | 241 |
| 278 | 3300005459 | Ga0068867_100352825 | Ga0068867_1003528251 | 241 |
| 279 | 3300005467 | Ga0070706_100001937 | Ga0070706_10000193711 | 241 |
| 280 | 3300005536 | Ga0070697_100000588 | Ga0070697_10000058815 | 241 |
| 281 | 3300005543 | Ga0070672_100310739 | Ga0070672_1003107392 | 241 |
| 282 | 3300005563 | Ga0068855_100111463 | Ga0068855_1001114633 | 241 |
| 283 | 3300005563 | Ga0068855_100200920 | Ga0068855_1002009202 | 241 |
| 284 | 3300005843 | Ga0068860_100114978 | Ga0068860_1001149781 | 241 |
| 285 | 3300005843 | Ga0068860_100140715 | Ga0068860_1001407152 | 241 |
| 286 | 3300006173 | Ga0070716_100074489 | Ga0070716_1000744892 | 241 |
| 287 | 3300006844 | Ga0075428_100017228 | Ga0075428_10001722810 | 241 |
| 288 | 3300009093 | Ga0105240_10008279 | Ga0105240_100082797 | 241 |
| 289 | 3300009174 | Ga0105241_10014103 | Ga0105241_100141031 | 241 |
| 290 | 3300009177 | Ga0105248_10057587 | Ga0105248_100575875 | 241 |
| 291 | 3300009545 | Ga0105237_10420200 | Ga0105237_104202001 | 241 |
| 292 | 3300010375 | Ga0105239_10039116 | Ga0105239_100391163 | 241 |
| 293 | 3300010375 | Ga0105239_10230802 | Ga0105239_102308022 | 241 |
| 294 | 3300013297 | Ga0157378_10573406 | Ga0157378_105734061 | 241 |
| 295 | 3300013297 | Ga0157378_10577245 | Ga0157378_105772452 | 241 |
| 296 | 3300013308 | Ga0157375_10168640 | Ga0157375_101686403 | 241 |
| 297 | 3300025261 | Ga0209233_1000026 | Ga0209233_1000026296 | 241 |
| 298 | 3300025295 | Ga0209564_1017308 | Ga0209564_10173084 | 241 |
| 299 | 3300025906 | Ga0207699_10086395 | Ga0207699_100863952 | 241 |
| 300 | 3300025907 | Ga0207645_10235203 | Ga0207645_102352032 | 241 |
| 301 | 3300025910 | Ga0207684_10005804 | Ga0207684_100058047 | 241 |
| 302 | 3300025919 | Ga0207657_10003643 | Ga0207657_100036433 | 241 |
| 303 | 3300025932 | Ga0207690_10243710 | Ga0207690_102437102 | 241 |
| 304 | 3300025939 | Ga0207665_10066712 | Ga0207665_100667122 | 241 |
| 305 | 3300025949 | Ga0207667_10088391 | Ga0207667_100883913 | 241 |
| 306 | 3300025949 | Ga0207667_10342249 | Ga0207667_103422492 | 241 |
| 307 | 3300025972 | Ga0207668_10171495 | Ga0207668_101714952 | 241 |
| 308 | 3300028380 | Ga0268265_10111626 | Ga0268265_101116263 | 241 |
| 309 | 3300028380 | Ga0268265_10350948 | Ga0268265_103509482 | 241 |
| 310 | 3300030521 | Ga0307511_10064784 | Ga0307511_100647842 | 241 |
| 311 | 3300031616 | Ga0307508_10000165 | Ga0307508_1000016572 | 241 |
| 312 | 3300037312 | Ga0395899_0118360 | Ga0395899_0118360_369_1109 | 241 |
| 313 | 3300037418 | Ga0395900_0389204 | Ga0395900_0389204_241_981 | 241 |
| 314 | 3300037466 | Ga0395898_0093348 | Ga0395898_0093348_578_1318 | 241 |
| 315 | 3300037471 | Ga0395905_0025506 | Ga0395905_0025506_974_1714 | 241 |
| 316 | 3300038443 | Ga0395901_0062422 | Ga0395901_0062422_578_1318 | 241 |
| 317 | 3300046460 | Ga0495638_0004543 | Ga0495638_0004543_9473_10216 | 241 |
| 318 | 3300046460 | Ga0495638_0006039 | Ga0495638_0006039_7870_8619 | 241 |
| 319 | 3300046472 | Ga0495580_0006470 | Ga0495580_0006470_7351_8094 | 241 |
| 320 | 3300046492 | Ga0495585_0040404 | Ga0495585_0040404_201_932 | 241 |
| 321 | 3300046513 | Ga0495616_0000162 | Ga0495616_0000162_51575_52318 | 241 |
| 322 | 3300046519 | Ga0495632_0004035 | Ga0495632_0004035_254_997 | 241 |
| 323 | 3300046616 | Ga0495668_0008054 | Ga0495668_0008054_1419_2162 | 241 |
| 324 | 3300047472 | Ga0495686_0078903 | Ga0495686_0078903_377_1126 | 241 |
| 325 | 3300048907 | Ga0496104_0168388 | Ga0496104_0168388_550_1293 | 241 |
| 326 | 3300048915 | Ga0496112_0234241 | Ga0496112_0234241_142_885 | 241 |
| 327 | 3300050493 | nmdc:mga0k408_177583_c1 | nmdc:mga0k408_177583_c1_375_1127 | 241 |
| 328 | 3300053122 | Ga0500608_000030 | Ga0500608_000030_19845_20600 | 241 |
| 329 | iso_pu_bacteria | 2643221695 | 2644529309 | 241 |
| 330 | 3300001979 | JGI24740J21852_10000445 | JGI24740J21852_1000044516 | 242 |
| 331 | 3300003756 | Ga0055533_1006178 | Ga0055533_10061782 | 242 |
| 332 | 3300003758 | Ga0055532_1000127 | Ga0055532_10001277 | 242 |
| 333 | 3300003760 | Ga0055527_1001540 | Ga0055527_10015404 | 242 |
| 334 | 3300003761 | Ga0055535_1000140 | Ga0055535_10001407 | 242 |
| 335 | 3300003841 | Ga0055541_1011678 | Ga0055541_10116782 | 242 |
| 336 | 3300005344 | Ga0070661_100000119 | Ga0070661_10000011943 | 242 |
| 337 | 3300005455 | Ga0070663_100000035 | Ga0070663_10000003551 | 242 |
| 338 | 3300005564 | Ga0070664_100000008 | Ga0070664_100000008169 | 242 |
| 339 | 3300005578 | Ga0068854_100012088 | Ga0068854_1000120881 | 242 |
| 340 | 3300005614 | Ga0068856_100000862 | Ga0068856_10000086229 | 242 |
| 341 | 3300006946 | Ga0079104_1000003 | Ga0079104_1000003342 | 242 |
| 342 | 3300009093 | Ga0105240_10316268 | Ga0105240_103162682 | 242 |
| 343 | 3300013102 | Ga0157371_10000413 | Ga0157371_1000041348 | 242 |
| 344 | 3300013104 | Ga0157370_10000456 | Ga0157370_1000045647 | 242 |
| 345 | 3300013105 | Ga0157369_10002006 | Ga0157369_100020065 | 242 |
| 346 | 3300013307 | Ga0157372_10000142 | Ga0157372_100001427 | 242 |
| 347 | 3300014497 | Ga0182008_10136985 | Ga0182008_101369852 | 242 |
| 348 | 3300015261 | Ga0182006_1002877 | Ga0182006_10028777 | 242 |
| 349 | 3300015261 | Ga0182006_1005567 | Ga0182006_10055672 | 242 |
| 350 | 3300015262 | Ga0182007_10043830 | Ga0182007_100438302 | 242 |
| 351 | 3300020077 | Ga0206351_10994603 | Ga0206351_109946034 | 242 |
| 352 | 3300020610 | Ga0154015_1049643 | Ga0154015_104964311 | 242 |
| 353 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021949 | 242 |
| 354 | 3300025225 | Ga0209566_102220 | Ga0209566_1022201 | 242 |
| 355 | 3300025226 | Ga0209674_110949 | Ga0209674_1109491 | 242 |
| 356 | 3300025228 | Ga0209672_100818 | Ga0209672_1008189 | 242 |
| 357 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021420 | 242 |
| 358 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021420 | 242 |
| 359 | 3300025256 | Ga0209759_1003202 | Ga0209759_10032027 | 242 |
| 360 | 3300025272 | Ga0209455_1000021 | Ga0209455_10000217 | 242 |
| 361 | 3300025913 | Ga0207695_10002210 | Ga0207695_100022104 | 242 |
| 362 | 3300025920 | Ga0207649_10004096 | Ga0207649_100040963 | 242 |
| 363 | 3300025981 | Ga0207640_10008428 | Ga0207640_100084281 | 242 |
| 364 | 3300026067 | Ga0207678_10002602 | Ga0207678_100026027 | 242 |
| 365 | 3300026078 | Ga0207702_10000024 | Ga0207702_10000024115 | 242 |
| 366 | 3300026116 | Ga0207674_10111134 | Ga0207674_101111342 | 242 |
| 367 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021555 | 242 |
| 368 | 3300037418 | Ga0395900_0001932 | Ga0395900_0001932_8431_9180 | 242 |
| 369 | 3300044650 | Ga0466986_0050906 | Ga0466986_0050906_1115_1864 | 242 |
| 370 | 3300044658 | Ga0466972_0008642 | Ga0466972_0008642_4265_5014 | 242 |
| 371 | 3300044683 | Ga0466965_0002658 | Ga0466965_0002658_2025_2774 | 242 |
| 372 | 3300044684 | Ga0466966_0219617 | Ga0466966_0219617_152_901 | 242 |
| 373 | 3300044693 | Ga0466961_0000435 | Ga0466961_0000435_21249_21998 | 242 |
| 374 | 3300044706 | Ga0466964_0001045 | Ga0466964_0001045_5600_6349 | 242 |
| 375 | 3300044719 | Ga0466971_0104013 | Ga0466971_0104013_366_1115 | 242 |
| 376 | 3300044765 | Ga0466970_0000271 | Ga0466970_0000271_19998_20747 | 242 |
| 377 | 3300044901 | Ga0466960_0005296 | Ga0466960_0005296_3428_4177 | 242 |
| 378 | 3300045049 | Ga0466959_0002163 | Ga0466959_0002163_6859_7608 | 242 |
| 379 | 3300045976 | Ga0466967_0052121 | Ga0466967_0052121_995_1744 | 242 |
| 380 | 3300046453 | Ga0495627_051776 | Ga0495627_051776_383_1123 | 242 |
| 381 | 3300048919 | Ga0496116_0111707 | Ga0496116_0111707_151_900 | 242 |
| 382 | 3300048925 | Ga0496122_0003675 | Ga0496122_0003675_4749_5498 | 242 |
| 383 | 3300048926 | Ga0496123_0002948 | Ga0496123_0002948_4756_5505 | 242 |
| 384 | 3300048928 | Ga0496125_0002526 | Ga0496125_0002526_14178_14927 | 242 |
| 385 | 3300048928 | Ga0496125_0003276 | Ga0496125_0003276_4753_5502 | 242 |
| 386 | 3300053087 | Ga0500643_007338 | Ga0500643_007338_1720_2460 | 242 |
| 387 | 3300053139 | Ga0500568_0009425 | Ga0500568_0009425_438_1178 | 242 |
| 388 | iso_pu_bacteria | 2585427591 | 2585827023 | 242 |
| 389 | iso_pu_bacteria | 2585427592 | 2585833077 | 242 |
| 390 | iso_pu_bacteria | 2667528173 | 2671107887 | 242 |
| 391 | iso_pu_bacteria | 2848297114 | 2848297854 | 242 |
| 392 | iso_pu_bacteria | 2904474040 | 2904476902 | 242 |
| 393 | iso_pu_bacteria | 2919150387 | 2919153071 | 242 |
| 394 | iso_pu_bacteria | 2927143783 | 2927147032 | 242 |
| 395 | iso_pu_bacteria | 8054849141 | 8054851161 | 242 |
| 396 | iso_pu_bacteria | 8057304971 | 8057306935 | 242 |
| 397 | 3300003771 | Ga0055526_1005610 | Ga0055526_10056103 | 243 |
| 398 | 3300005539 | Ga0068853_100009939 | Ga0068853_1000099398 | 243 |
| 399 | 3300005548 | Ga0070665_100712021 | Ga0070665_1007120211 | 243 |
| 400 | 3300005563 | Ga0068855_100505891 | Ga0068855_1005058912 | 243 |
| 401 | 3300009093 | Ga0105240_10106207 | Ga0105240_101062072 | 243 |
| 402 | 3300009545 | Ga0105237_10000080 | Ga0105237_1000008049 | 243 |
| 403 | 3300009551 | Ga0105238_10000711 | Ga0105238_100007112 | 243 |
| 404 | 3300010375 | Ga0105239_10000116 | Ga0105239_1000011659 | 243 |
| 405 | 3300025295 | Ga0209564_1002205 | Ga0209564_100220513 | 243 |
| 406 | 3300025913 | Ga0207695_10076632 | Ga0207695_100766322 | 243 |
| 407 | 3300025914 | Ga0207671_10024475 | Ga0207671_100244755 | 243 |
| 408 | 3300025924 | Ga0207694_10015010 | Ga0207694_100150103 | 243 |
| 409 | 3300025949 | Ga0207667_10290172 | Ga0207667_102901721 | 243 |
| 410 | 3300026041 | Ga0207639_10032577 | Ga0207639_100325772 | 243 |
| 411 | 3300028379 | Ga0268266_10113246 | Ga0268266_101132463 | 243 |
| 412 | 3300032004 | Ga0307414_10233223 | Ga0307414_102332232 | 243 |
| 413 | 3300041404 | Ga0439436_0041758 | Ga0439436_0041758_299_1060 | 243 |
| 414 | 3300042006 | Ga0439432_005417 | Ga0439432_005417_2733_3494 | 243 |
| 415 | 3300042006 | Ga0439432_081759 | Ga0439432_081759_44_805 | 243 |
| 416 | 3300042007 | Ga0439449_0086835 | Ga0439449_0086835_172_933 | 243 |
| 417 | 3300049579 | Ga0501043_0276561 | Ga0501043_0276561_134_877 | 243 |
| 418 | 3300049822 | Ga0501035_0243236 | Ga0501035_0243236_190_933 | 243 |
| 419 | 3300053148 | Ga0500590_024655 | Ga0500590_024655_209_964 | 243 |
| 420 | iso_pu_bacteria | 2515154123 | 2515689166 | 243 |
| 421 | iso_pu_bacteria | 2842775625 | 2842779708 | 243 |
| 422 | iso_pu_bacteria | 2894772417 | 2894775492 | 243 |
| 423 | iso_pu_bacteria | 2900577576 | 2900581596 | 243 |
| 424 | iso_pu_bacteria | 2928058823 | 2928063797 | 243 |
| 425 | iso_pu_bacteria | 3007315729 | 3007316961 | 243 |
| 426 | 3300003752 | Ga0055539_1000100 | Ga0055539_100010090 | 244 |
| 427 | 3300003756 | Ga0055533_1007660 | Ga0055533_10076602 | 244 |
| 428 | 3300003759 | Ga0055525_1000487 | Ga0055525_10004877 | 244 |
| 429 | 3300003841 | Ga0055541_1010003 | Ga0055541_10100032 | 244 |
| 430 | 3300005467 | Ga0070706_100048699 | Ga0070706_1000486992 | 244 |
| 431 | 3300021388 | Ga0213875_10009808 | Ga0213875_100098085 | 244 |
| 432 | 3300025910 | Ga0207684_10041500 | Ga0207684_100415003 | 244 |
| 433 | 3300037853 | Ga0436364_1507036 | Ga0436364_1507036_3041_3787 | 244 |
| 434 | 3300041404 | Ga0439436_0082755 | Ga0439436_0082755_117_881 | 244 |
| 435 | 3300046616 | Ga0495668_0174661 | Ga0495668_0174661_302_1045 | 244 |
| 436 | 3300047322 | Ga0495680_0258390 | Ga0495680_0258390_346_1092 | 244 |
| 437 | 3300047470 | Ga0495681_0032686 | Ga0495681_0032686_1087_1878 | 244 |
| 438 | 3300048091 | Ga0495626_0000985 | Ga0495626_0000985_11188_11931 | 244 |
| 439 | 3300048921 | Ga0496118_0114485 | Ga0496118_0114485_235_1026 | 244 |
| 440 | 3300049575 | Ga0501039_0519036 | Ga0501039_0519036_50_796 | 244 |
| 441 | 3300053134 | Ga0500658_0018052 | Ga0500658_0018052_1265_2056 | 244 |
| 442 | 3300059640 | Ga0587067_030828 | Ga0587067_030828_148_939 | 244 |
| 443 | iso_pu_bacteria | 2600255292 | 2601669510 | 244 |
| 444 | iso_pu_bacteria | 2643221654 | 2644303810 | 244 |
| 445 | iso_pu_bacteria | 2857547612 | 2857549630 | 244 |
| 446 | iso_pu_bacteria | 2885383462 | 2885388422 | 244 |
| 447 | 3300003203 | JGI25406J46586_10016018 | JGI25406J46586_100160181 | 245 |
| 448 | 3300003203 | JGI25406J46586_10026364 | JGI25406J46586_100263642 | 245 |
| 449 | 3300005347 | Ga0070668_100196590 | Ga0070668_1001965902 | 245 |
| 450 | 3300005353 | Ga0070669_100623658 | Ga0070669_1006236581 | 245 |
| 451 | 3300005366 | Ga0070659_100021337 | Ga0070659_1000213372 | 245 |
| 452 | 3300005367 | Ga0070667_100273872 | Ga0070667_1002738721 | 245 |
| 453 | 3300005434 | Ga0070709_10184226 | Ga0070709_101842262 | 245 |
| 454 | 3300005435 | Ga0070714_100034759 | Ga0070714_1000347593 | 245 |
| 455 | 3300005436 | Ga0070713_100144293 | Ga0070713_1001442932 | 245 |
| 456 | 3300005437 | Ga0070710_10255288 | Ga0070710_102552881 | 245 |
| 457 | 3300005439 | Ga0070711_100030764 | Ga0070711_1000307642 | 245 |
| 458 | 3300005441 | Ga0070700_100243235 | Ga0070700_1002432352 | 245 |
| 459 | 3300005455 | Ga0070663_100115861 | Ga0070663_1001158612 | 245 |
| 460 | 3300005458 | Ga0070681_10109983 | Ga0070681_101099832 | 245 |
| 461 | 3300005563 | Ga0068855_100011273 | Ga0068855_1000112736 | 245 |
| 462 | 3300005578 | Ga0068854_100199823 | Ga0068854_1001998232 | 245 |
| 463 | 3300005983 | Ga0081540_1002396 | Ga0081540_100239612 | 245 |
| 464 | 3300005985 | Ga0081539_10000283 | Ga0081539_1000028339 | 245 |
| 465 | 3300005985 | Ga0081539_10136948 | Ga0081539_101369481 | 245 |
| 466 | 3300006028 | Ga0070717_10002258 | Ga0070717_100022581 | 245 |
| 467 | 3300006163 | Ga0070715_10002299 | Ga0070715_100022994 | 245 |
| 468 | 3300006852 | Ga0075433_10549133 | Ga0075433_105491331 | 245 |
| 469 | 3300009093 | Ga0105240_10091079 | Ga0105240_100910793 | 245 |
| 470 | 3300009147 | Ga0114129_10202440 | Ga0114129_102024402 | 245 |
| 471 | 3300009177 | Ga0105248_10097431 | Ga0105248_100974312 | 245 |
| 472 | 3300013104 | Ga0157370_10000216 | Ga0157370_1000021662 | 245 |
| 473 | 3300013104 | Ga0157370_10228371 | Ga0157370_102283711 | 245 |
| 474 | 3300013306 | Ga0163162_10010707 | Ga0163162_100107072 | 245 |
| 475 | 3300013308 | Ga0157375_10058917 | Ga0157375_100589173 | 245 |
| 476 | 3300020082 | Ga0206353_11620780 | Ga0206353_116207801 | 245 |
| 477 | 3300021361 | Ga0213872_10103861 | Ga0213872_101038611 | 245 |
| 478 | 3300021388 | Ga0213875_10003695 | Ga0213875_100036957 | 245 |
| 479 | 3300021388 | Ga0213875_10027371 | Ga0213875_100273713 | 245 |
| 480 | 3300025898 | Ga0207692_10009267 | Ga0207692_100092674 | 245 |
| 481 | 3300025905 | Ga0207685_10001062 | Ga0207685_100010622 | 245 |
| 482 | 3300025909 | Ga0207705_10000808 | Ga0207705_1000080810 | 245 |
| 483 | 3300025915 | Ga0207693_10018603 | Ga0207693_100186032 | 245 |
| 484 | 3300025916 | Ga0207663_10049902 | Ga0207663_100499023 | 245 |
| 485 | 3300025919 | Ga0207657_10186931 | Ga0207657_101869312 | 245 |
| 486 | 3300025928 | Ga0207700_10310842 | Ga0207700_103108422 | 245 |
| 487 | 3300025932 | Ga0207690_10088566 | Ga0207690_100885662 | 245 |
| 488 | 3300025934 | Ga0207686_10397110 | Ga0207686_103971101 | 245 |
| 489 | 3300025939 | Ga0207665_10044072 | Ga0207665_100440723 | 245 |
| 490 | 3300025941 | Ga0207711_10111481 | Ga0207711_101114812 | 245 |
| 491 | 3300025949 | Ga0207667_10001534 | Ga0207667_1000153416 | 245 |
| 492 | 3300025972 | Ga0207668_10225366 | Ga0207668_102253662 | 245 |
| 493 | 3300026067 | Ga0207678_10014518 | Ga0207678_100145184 | 245 |
| 494 | 3300026067 | Ga0207678_10275414 | Ga0207678_102754142 | 245 |
| 495 | 3300028379 | Ga0268266_10052323 | Ga0268266_100523234 | 245 |
| 496 | 3300030500 | Ga0268256_1006276 | Ga0268256_10062763 | 245 |
| 497 | 3300031247 | Ga0265340_10097310 | Ga0265340_100973102 | 245 |
| 498 | 3300031344 | Ga0265316_10116177 | Ga0265316_101161772 | 245 |
| 499 | 3300037312 | Ga0395899_0339022 | Ga0395899_0339022_45_818 | 245 |
| 500 | 3300037418 | Ga0395900_0000998 | Ga0395900_0000998_22173_22949 | 245 |
| 501 | 3300037418 | Ga0395900_0097106 | Ga0395900_0097106_1827_2603 | 245 |
| 502 | 3300037853 | Ga0436364_0089680 | Ga0436364_0089680_3884_4633 | 245 |
| 503 | 3300039438 | Ga0436360_1340739 | Ga0436360_1340739_118_873 | 245 |
| 504 | 3300039447 | Ga0436361_0860283 | Ga0436361_0860283_8627_9370 | 245 |
| 505 | 3300039450 | Ga0436363_0089415 | Ga0436363_0089415_40_789 | 245 |
| 506 | 3300039450 | Ga0436363_1009265 | Ga0436363_1009265_276_1067 | 245 |
| 507 | 3300044658 | Ga0466972_0003321 | Ga0466972_0003321_1499_2257 | 245 |
| 508 | 3300044658 | Ga0466972_0069548 | Ga0466972_0069548_297_1073 | 245 |
| 509 | 3300044666 | Ga0466977_0341413 | Ga0466977_0341413_96_854 | 245 |
| 510 | 3300044671 | Ga0466978_0004514 | Ga0466978_0004514_4351_5109 | 245 |
| 511 | 3300044672 | Ga0466982_0078684 | Ga0466982_0078684_1045_1803 | 245 |
| 512 | 3300044683 | Ga0466965_0004602 | Ga0466965_0004602_3258_4001 | 245 |
| 513 | 3300044684 | Ga0466966_0011654 | Ga0466966_0011654_4900_5676 | 245 |
| 514 | 3300044684 | Ga0466966_0015152 | Ga0466966_0015152_1975_2718 | 245 |
| 515 | 3300044684 | Ga0466966_0095977 | Ga0466966_0095977_315_1091 | 245 |
| 516 | 3300044693 | Ga0466961_0001155 | Ga0466961_0001155_7581_8339 | 245 |
| 517 | 3300044693 | Ga0466961_0006348 | Ga0466961_0006348_176_952 | 245 |
| 518 | 3300044693 | Ga0466961_0008481 | Ga0466961_0008481_3662_4405 | 245 |
| 519 | 3300044693 | Ga0466961_0235301 | Ga0466961_0235301_153_929 | 245 |
| 520 | 3300044694 | Ga0466963_0023494 | Ga0466963_0023494_2323_3099 | 245 |
| 521 | 3300044706 | Ga0466964_0004022 | Ga0466964_0004022_2442_3200 | 245 |
| 522 | 3300044719 | Ga0466971_0004162 | Ga0466971_0004162_1490_2266 | 245 |
| 523 | 3300044735 | Ga0466968_0009639 | Ga0466968_0009639_2602_3360 | 245 |
| 524 | 3300044765 | Ga0466970_0001247 | Ga0466970_0001247_7731_8489 | 245 |
| 525 | 3300044765 | Ga0466970_0139850 | Ga0466970_0139850_26_769 | 245 |
| 526 | 3300044765 | Ga0466970_0181355 | Ga0466970_0181355_188_964 | 245 |
| 527 | 3300044842 | Ga0466957_0029076 | Ga0466957_0029076_97_855 | 245 |
| 528 | 3300044901 | Ga0466960_0005076 | Ga0466960_0005076_2927_3685 | 245 |
| 529 | 3300045049 | Ga0466959_0006181 | Ga0466959_0006181_339_1115 | 245 |
| 530 | 3300045051 | Ga0451576_0265590 | Ga0451576_0265590_112_867 | 245 |
| 531 | 3300045976 | Ga0466967_0047916 | Ga0466967_0047916_1032_1790 | 245 |
| 532 | 3300046458 | Ga0495591_021603 | Ga0495591_021603_662_1405 | 245 |
| 533 | 3300046459 | Ga0495629_0001013 | Ga0495629_0001013_18005_18748 | 245 |
| 534 | 3300046460 | Ga0495638_0007246 | Ga0495638_0007246_3377_4120 | 245 |
| 535 | 3300046471 | Ga0495650_0001635 | Ga0495650_0001635_3551_4294 | 245 |
| 536 | 3300046471 | Ga0495650_0013152 | Ga0495650_0013152_401_1144 | 245 |
| 537 | 3300046472 | Ga0495580_0004501 | Ga0495580_0004501_2177_2920 | 245 |
| 538 | 3300046473 | Ga0495582_0012292 | Ga0495582_0012292_1462_2205 | 245 |
| 539 | 3300046474 | Ga0495605_0001958 | Ga0495605_0001958_3454_4197 | 245 |
| 540 | 3300046476 | Ga0495662_0175723 | Ga0495662_0175723_19_762 | 245 |
| 541 | 3300046491 | Ga0495584_0051005 | Ga0495584_0051005_1268_2011 | 245 |
| 542 | 3300046492 | Ga0495585_0003423 | Ga0495585_0003423_1282_2025 | 245 |
| 543 | 3300046492 | Ga0495585_0208285 | Ga0495585_0208285_131_874 | 245 |
| 544 | 3300046501 | Ga0495607_0018615 | Ga0495607_0018615_1996_2739 | 245 |
| 545 | 3300046507 | Ga0495606_0029044 | Ga0495606_0029044_305_1081 | 245 |
| 546 | 3300046516 | Ga0495628_0116921 | Ga0495628_0116921_637_1380 | 245 |
| 547 | 3300046520 | Ga0495637_0097923 | Ga0495637_0097923_370_1128 | 245 |
| 548 | 3300046524 | Ga0495648_0040093 | Ga0495648_0040093_1119_1862 | 245 |
| 549 | 3300046528 | Ga0495642_0002072 | Ga0495642_0002072_3456_4199 | 245 |
| 550 | 3300046528 | Ga0495642_0007140 | Ga0495642_0007140_2964_3707 | 245 |
| 551 | 3300046531 | Ga0495665_0011572 | Ga0495665_0011572_3532_4275 | 245 |
| 552 | 3300046535 | Ga0495586_0013837 | Ga0495586_0013837_2471_3214 | 245 |
| 553 | 3300046542 | Ga0495597_0052070 | Ga0495597_0052070_267_1010 | 245 |
| 554 | 3300046543 | Ga0495645_0001014 | Ga0495645_0001014_3548_4291 | 245 |
| 555 | 3300046557 | Ga0495622_0000126 | Ga0495622_0000126_13258_14001 | 245 |
| 556 | 3300046559 | Ga0495667_0072015 | Ga0495667_0072015_1198_1941 | 245 |
| 557 | 3300046615 | Ga0495656_0037535 | Ga0495656_0037535_660_1403 | 245 |
| 558 | 3300046648 | Ga0495611_0044664 | Ga0495611_0044664_1162_1905 | 245 |
| 559 | 3300046674 | Ga0495588_0014191 | Ga0495588_0014191_1811_2554 | 245 |
| 560 | 3300046684 | Ga0495669_0040677 | Ga0495669_0040677_597_1340 | 245 |
| 561 | 3300046689 | Ga0495613_0048684 | Ga0495613_0048684_1551_2294 | 245 |
| 562 | 3300046690 | Ga0495624_0089967 | Ga0495624_0089967_666_1409 | 245 |
| 563 | 3300046691 | Ga0495670_0037656 | Ga0495670_0037656_155_898 | 245 |
| 564 | 3300046694 | Ga0495649_0007521 | Ga0495649_0007521_1146_1922 | 245 |
| 565 | 3300046794 | Ga0495589_0001219 | Ga0495589_0001219_3415_4158 | 245 |
| 566 | 3300046794 | Ga0495589_0013071 | Ga0495589_0013071_775_1518 | 245 |
| 567 | 3300047315 | Ga0495581_0000534 | Ga0495581_0000534_14857_15600 | 245 |
| 568 | 3300047320 | Ga0495672_0075902 | Ga0495672_0075902_638_1381 | 245 |
| 569 | 3300047323 | Ga0495683_0002629 | Ga0495683_0002629_526_1302 | 245 |
| 570 | 3300047323 | Ga0495683_0197899 | Ga0495683_0197899_17_760 | 245 |
| 571 | 3300047443 | Ga0495687_039117 | Ga0495687_039117_890_1633 | 245 |
| 572 | 3300047444 | Ga0495675_0062087 | Ga0495675_0062087_1316_2059 | 245 |
| 573 | 3300047445 | Ga0495677_0140514 | Ga0495677_0140514_107_850 | 245 |
| 574 | 3300047446 | Ga0495679_005443 | Ga0495679_005443_4540_5283 | 245 |
| 575 | 3300047446 | Ga0495679_006754 | Ga0495679_006754_2685_3428 | 245 |
| 576 | 3300047471 | Ga0495684_0424912 | Ga0495684_0424912_78_821 | 245 |
| 577 | 3300048091 | Ga0495626_0037972 | Ga0495626_0037972_612_1355 | 245 |
| 578 | 3300048903 | Ga0496100_0187892 | Ga0496100_0187892_77_835 | 245 |
| 579 | 3300048904 | Ga0496101_0008396 | Ga0496101_0008396_4395_5138 | 245 |
| 580 | 3300048905 | Ga0496102_0012755 | Ga0496102_0012755_3934_4677 | 245 |
| 581 | 3300048907 | Ga0496104_0103788 | Ga0496104_0103788_1740_2483 | 245 |
| 582 | 3300048908 | Ga0496105_0017664 | Ga0496105_0017664_1744_2502 | 245 |
| 583 | 3300048908 | Ga0496105_0182466 | Ga0496105_0182466_785_1528 | 245 |
| 584 | 3300048910 | Ga0496107_0047588 | Ga0496107_0047588_1000_1743 | 245 |
| 585 | 3300048910 | Ga0496107_0157598 | Ga0496107_0157598_179_922 | 245 |
| 586 | 3300048917 | Ga0496114_0003425 | Ga0496114_0003425_3513_4256 | 245 |
| 587 | 3300048918 | Ga0496115_0004888 | Ga0496115_0004888_4759_5517 | 245 |
| 588 | 3300048918 | Ga0496115_0023113 | Ga0496115_0023113_2335_3078 | 245 |
| 589 | 3300048920 | Ga0496117_0010209 | Ga0496117_0010209_2830_3600 | 245 |
| 590 | 3300048921 | Ga0496118_0039064 | Ga0496118_0039064_2222_2992 | 245 |
| 591 | 3300048922 | Ga0496119_0040496 | Ga0496119_0040496_1103_1873 | 245 |
| 592 | 3300049569 | Ga0501032_0029712 | Ga0501032_0029712_199_1008 | 245 |
| 593 | 3300049574 | Ga0501038_0142624 | Ga0501038_0142624_1052_1798 | 245 |
| 594 | 3300049578 | Ga0501042_0170219 | Ga0501042_0170219_255_1013 | 245 |
| 595 | 3300049580 | Ga0501046_0068046 | Ga0501046_0068046_975_1721 | 245 |
| 596 | 3300049590 | Ga0501074_0338117 | Ga0501074_0338117_196_954 | 245 |
| 597 | 3300049592 | Ga0501076_0472752 | Ga0501076_0472752_91_849 | 245 |
| 598 | 3300049741 | Ga0501079_0519090 | Ga0501079_0519090_30_788 | 245 |
| 599 | 3300049822 | Ga0501035_0009229 | Ga0501035_0009229_119_865 | 245 |
| 600 | 3300050507 | nmdc:mga05p37_327008_c1 | nmdc:mga05p37_327008_c1_676_1434 | 245 |
| 601 | 3300050512 | nmdc:mga0n895_135888_c1 | nmdc:mga0n895_135888_c1_1340_2098 | 245 |
| 602 | 3300050514 | nmdc:mga08x19_316610_c1 | nmdc:mga08x19_316610_c1_89_847 | 245 |
| 603 | 3300050515 | nmdc:mga0a205_250823_c1 | nmdc:mga0a205_250823_c1_749_1507 | 245 |
| 604 | 3300060353 | Ga0501082_0509560 | Ga0501082_0509560_209_970 | 245 |
| 605 | 3300061719 | Ga0466962_0005043 | Ga0466962_0005043_1679_2455 | 245 |
| 606 | 3300061719 | Ga0466962_0012718 | Ga0466962_0012718_391_1149 | 245 |
| 607 | 2162886007 | SwRhRL2b_contig_1052005 | SwRhRL2b_0838.00005150 | 246 |
| 608 | 3300002737 | JGI25162J39368_1000067 | JGI25162J39368_1000067111 | 246 |
| 609 | 3300002771 | JGI25163J39215_1000114 | JGI25163J39215_100011420 | 246 |
| 610 | 3300002772 | JGI25164J39214_1000039 | JGI25164J39214_100003928 | 246 |
| 611 | 3300003751 | Ga0055538_1000052 | Ga0055538_100005228 | 246 |
| 612 | 3300003752 | Ga0055539_1000077 | Ga0055539_100007728 | 246 |
| 613 | 3300003756 | Ga0055533_1000083 | Ga0055533_100008328 | 246 |
| 614 | 3300003759 | Ga0055525_1000110 | Ga0055525_100011028 | 246 |
| 615 | 3300003841 | Ga0055541_1000054 | Ga0055541_100005428 | 246 |
| 616 | 3300005289 | Ga0065704_10000086 | Ga0065704_1000008611 | 246 |
| 617 | 3300005327 | Ga0070658_10323291 | Ga0070658_103232912 | 246 |
| 618 | 3300005328 | Ga0070676_10002823 | Ga0070676_100028235 | 246 |
| 619 | 3300005331 | Ga0070670_100733791 | Ga0070670_1007337911 | 246 |
| 620 | 3300005334 | Ga0068869_100001193 | Ga0068869_1000011934 | 246 |
| 621 | 3300005334 | Ga0068869_100014797 | Ga0068869_1000147973 | 246 |
| 622 | 3300005334 | Ga0068869_100149052 | Ga0068869_1001490522 | 246 |
| 623 | 3300005335 | Ga0070666_10001793 | Ga0070666_100017934 | 246 |
| 624 | 3300005335 | Ga0070666_10238456 | Ga0070666_102384562 | 246 |
| 625 | 3300005336 | Ga0070680_100004336 | Ga0070680_1000043363 | 246 |
| 626 | 3300005338 | Ga0068868_100000185 | Ga0068868_1000001853 | 246 |
| 627 | 3300005338 | Ga0068868_100012143 | Ga0068868_1000121433 | 246 |
| 628 | 3300005339 | Ga0070660_100005623 | Ga0070660_1000056236 | 246 |
| 629 | 3300005339 | Ga0070660_100084247 | Ga0070660_1000842472 | 246 |
| 630 | 3300005340 | Ga0070689_100010833 | Ga0070689_1000108333 | 246 |
| 631 | 3300005341 | Ga0070691_10105692 | Ga0070691_101056922 | 246 |
| 632 | 3300005343 | Ga0070687_100024370 | Ga0070687_1000243703 | 246 |
| 633 | 3300005347 | Ga0070668_100029171 | Ga0070668_1000291711 | 246 |
| 634 | 3300005347 | Ga0070668_100077972 | Ga0070668_1000779722 | 246 |
| 635 | 3300005353 | Ga0070669_100023411 | Ga0070669_1000234112 | 246 |
| 636 | 3300005353 | Ga0070669_100029773 | Ga0070669_1000297733 | 246 |
| 637 | 3300005354 | Ga0070675_100001427 | Ga0070675_1000014273 | 246 |
| 638 | 3300005354 | Ga0070675_100002466 | Ga0070675_1000024663 | 246 |
| 639 | 3300005355 | Ga0070671_100015468 | Ga0070671_1000154683 | 246 |
| 640 | 3300005364 | Ga0070673_100002536 | Ga0070673_1000025364 | 246 |
| 641 | 3300005364 | Ga0070673_100143386 | Ga0070673_1001433862 | 246 |
| 642 | 3300005367 | Ga0070667_100020821 | Ga0070667_1000208212 | 246 |
| 643 | 3300005367 | Ga0070667_100077412 | Ga0070667_1000774123 | 246 |
| 644 | 3300005367 | Ga0070667_100168469 | Ga0070667_1001684692 | 246 |
| 645 | 3300005438 | Ga0070701_10116317 | Ga0070701_101163172 | 246 |
| 646 | 3300005455 | Ga0070663_100020341 | Ga0070663_1000203413 | 246 |
| 647 | 3300005457 | Ga0070662_100007037 | Ga0070662_1000070372 | 246 |
| 648 | 3300005457 | Ga0070662_100155742 | Ga0070662_1001557422 | 246 |
| 649 | 3300005458 | Ga0070681_10101502 | Ga0070681_101015023 | 246 |
| 650 | 3300005458 | Ga0070681_10109271 | Ga0070681_101092711 | 246 |
| 651 | 3300005459 | Ga0068867_100030151 | Ga0068867_1000301511 | 246 |
| 652 | 3300005468 | Ga0070707_100176391 | Ga0070707_1001763912 | 246 |
| 653 | 3300005471 | Ga0070698_100180024 | Ga0070698_1001800242 | 246 |
| 654 | 3300005518 | Ga0070699_100089170 | Ga0070699_1000891703 | 246 |
| 655 | 3300005530 | Ga0070679_100081200 | Ga0070679_1000812002 | 246 |
| 656 | 3300005535 | Ga0070684_100018963 | Ga0070684_1000189633 | 246 |
| 657 | 3300005536 | Ga0070697_100081899 | Ga0070697_1000818992 | 246 |
| 658 | 3300005539 | Ga0068853_100029693 | Ga0068853_1000296933 | 246 |
| 659 | 3300005539 | Ga0068853_100189365 | Ga0068853_1001893652 | 246 |
| 660 | 3300005539 | Ga0068853_100333581 | Ga0068853_1003335812 | 246 |
| 661 | 3300005543 | Ga0070672_100015407 | Ga0070672_1000154074 | 246 |
| 662 | 3300005543 | Ga0070672_100117142 | Ga0070672_1001171422 | 246 |
| 663 | 3300005543 | Ga0070672_100221402 | Ga0070672_1002214021 | 246 |
| 664 | 3300005547 | Ga0070693_100145147 | Ga0070693_1001451471 | 246 |
| 665 | 3300005547 | Ga0070693_100193944 | Ga0070693_1001939441 | 246 |
| 666 | 3300005563 | Ga0068855_100025726 | Ga0068855_1000257264 | 246 |
| 667 | 3300005564 | Ga0070664_100111815 | Ga0070664_1001118152 | 246 |
| 668 | 3300005564 | Ga0070664_100160719 | Ga0070664_1001607193 | 246 |
| 669 | 3300005577 | Ga0068857_100144683 | Ga0068857_1001446832 | 246 |
| 670 | 3300005578 | Ga0068854_100066061 | Ga0068854_1000660612 | 246 |
| 671 | 3300005614 | Ga0068856_100033738 | Ga0068856_1000337384 | 246 |
| 672 | 3300005614 | Ga0068856_100065349 | Ga0068856_1000653492 | 246 |
| 673 | 3300005614 | Ga0068856_100441686 | Ga0068856_1004416862 | 246 |
| 674 | 3300005615 | Ga0070702_100013026 | Ga0070702_1000130263 | 246 |
| 675 | 3300005616 | Ga0068852_100023260 | Ga0068852_1000232603 | 246 |
| 676 | 3300005617 | Ga0068859_100001283 | Ga0068859_1000012838 | 246 |
| 677 | 3300005617 | Ga0068859_100474436 | Ga0068859_1004744362 | 246 |
| 678 | 3300005618 | Ga0068864_100001050 | Ga0068864_1000010509 | 246 |
| 679 | 3300005618 | Ga0068864_100014858 | Ga0068864_1000148584 | 246 |
| 680 | 3300005719 | Ga0068861_100000536 | Ga0068861_10000053612 | 246 |
| 681 | 3300005719 | Ga0068861_100106030 | Ga0068861_1001060303 | 246 |
| 682 | 3300005834 | Ga0068851_10078654 | Ga0068851_100786542 | 246 |
| 683 | 3300005841 | Ga0068863_100004913 | Ga0068863_1000049133 | 246 |
| 684 | 3300005841 | Ga0068863_100087518 | Ga0068863_1000875182 | 246 |
| 685 | 3300005842 | Ga0068858_100000885 | Ga0068858_10000088519 | 246 |
| 686 | 3300005842 | Ga0068858_100057021 | Ga0068858_1000570212 | 246 |
| 687 | 3300005843 | Ga0068860_100046824 | Ga0068860_1000468244 | 246 |
| 688 | 3300005843 | Ga0068860_100067502 | Ga0068860_1000675023 | 246 |
| 689 | 3300005844 | Ga0068862_100038274 | Ga0068862_1000382743 | 246 |
| 690 | 3300005844 | Ga0068862_100138508 | Ga0068862_1001385082 | 246 |
| 691 | 3300006177 | Ga0075362_10021179 | Ga0075362_100211793 | 246 |
| 692 | 3300006195 | Ga0075366_10013029 | Ga0075366_100130292 | 246 |
| 693 | 3300006237 | Ga0097621_100028263 | Ga0097621_1000282632 | 246 |
| 694 | 3300006237 | Ga0097621_100066237 | Ga0097621_1000662372 | 246 |
| 695 | 3300006358 | Ga0068871_100007888 | Ga0068871_1000078884 | 246 |
| 696 | 3300006880 | Ga0075429_100002684 | Ga0075429_1000026843 | 246 |
| 697 | 3300006881 | Ga0068865_100269152 | Ga0068865_1002691522 | 246 |
| 698 | 3300006931 | Ga0097620_100001283 | Ga0097620_1000012838 | 246 |
| 699 | 3300006931 | Ga0097620_100474396 | Ga0097620_1004743962 | 246 |
| 700 | 3300007076 | Ga0075435_100578635 | Ga0075435_1005786351 | 246 |
| 701 | 3300009036 | Ga0105244_10000008 | Ga0105244_1000000827 | 246 |
| 702 | 3300009036 | Ga0105244_10000945 | Ga0105244_1000094522 | 246 |
| 703 | 3300009092 | Ga0105250_10001925 | Ga0105250_100019258 | 246 |
| 704 | 3300009148 | Ga0105243_10017212 | Ga0105243_100172125 | 246 |
| 705 | 3300009148 | Ga0105243_10243103 | Ga0105243_102431032 | 246 |
| 706 | 3300009174 | Ga0105241_10707230 | Ga0105241_107072301 | 246 |
| 707 | 3300009177 | Ga0105248_10029339 | Ga0105248_100293397 | 246 |
| 708 | 3300009177 | Ga0105248_10114596 | Ga0105248_101145962 | 246 |
| 709 | 3300009177 | Ga0105248_10170182 | Ga0105248_101701821 | 246 |
| 710 | 3300009545 | Ga0105237_10158940 | Ga0105237_101589402 | 246 |
| 711 | 3300009551 | Ga0105238_10076954 | Ga0105238_100769543 | 246 |
| 712 | 3300009551 | Ga0105238_10158745 | Ga0105238_101587451 | 246 |
| 713 | 3300009553 | Ga0105249_10036077 | Ga0105249_100360773 | 246 |
| 714 | 3300010375 | Ga0105239_10444222 | Ga0105239_104442222 | 246 |
| 715 | 3300013100 | Ga0157373_10002177 | Ga0157373_1000217713 | 246 |
| 716 | 3300013100 | Ga0157373_10147087 | Ga0157373_101470872 | 246 |
| 717 | 3300013102 | Ga0157371_10000075 | Ga0157371_1000007520 | 246 |
| 718 | 3300013102 | Ga0157371_10009934 | Ga0157371_100099343 | 246 |
| 719 | 3300013105 | Ga0157369_10150479 | Ga0157369_101504792 | 246 |
| 720 | 3300013105 | Ga0157369_10180215 | Ga0157369_101802152 | 246 |
| 721 | 3300013296 | Ga0157374_10008777 | Ga0157374_100087775 | 246 |
| 722 | 3300013296 | Ga0157374_10021504 | Ga0157374_100215047 | 246 |
| 723 | 3300013306 | Ga0163162_10013948 | Ga0163162_100139485 | 246 |
| 724 | 3300013306 | Ga0163162_10213186 | Ga0163162_102131861 | 246 |
| 725 | 3300013307 | Ga0157372_10029443 | Ga0157372_100294432 | 246 |
| 726 | 3300013307 | Ga0157372_10302668 | Ga0157372_103026682 | 246 |
| 727 | 3300013307 | Ga0157372_10331267 | Ga0157372_103312672 | 246 |
| 728 | 3300013308 | Ga0157375_10016333 | Ga0157375_100163334 | 246 |
| 729 | 3300013308 | Ga0157375_10052050 | Ga0157375_100520503 | 246 |
| 730 | 3300013308 | Ga0157375_10157456 | Ga0157375_101574562 | 246 |
| 731 | 3300014325 | Ga0163163_10012602 | Ga0163163_100126024 | 246 |
| 732 | 3300014326 | Ga0157380_10143005 | Ga0157380_101430052 | 246 |
| 733 | 3300014745 | Ga0157377_10003314 | Ga0157377_100033142 | 246 |
| 734 | 3300014968 | Ga0157379_10002653 | Ga0157379_100026532 | 246 |
| 735 | 3300014968 | Ga0157379_10008236 | Ga0157379_100082367 | 246 |
| 736 | 3300014968 | Ga0157379_10305251 | Ga0157379_103052512 | 246 |
| 737 | 3300014969 | Ga0157376_10008707 | Ga0157376_100087075 | 246 |
| 738 | 3300014969 | Ga0157376_10104576 | Ga0157376_101045762 | 246 |
| 739 | 3300015261 | Ga0182006_1000004 | Ga0182006_1000004346 | 246 |
| 740 | 3300015262 | Ga0182007_10000018 | Ga0182007_1000001825 | 246 |
| 741 | 3300015265 | Ga0182005_1000011 | Ga0182005_100001135 | 246 |
| 742 | 3300015265 | Ga0182005_1070727 | Ga0182005_10707271 | 246 |
| 743 | 3300017792 | Ga0163161_10013883 | Ga0163161_100138832 | 246 |
| 744 | 3300017792 | Ga0163161_10076178 | Ga0163161_100761783 | 246 |
| 745 | 3300017792 | Ga0163161_10101262 | Ga0163161_101012622 | 246 |
| 746 | 3300025207 | Ga0209760_100070 | Ga0209760_10007015 | 246 |
| 747 | 3300025224 | Ga0209784_100012 | Ga0209784_100012471 | 246 |
| 748 | 3300025225 | Ga0209566_100010 | Ga0209566_100010471 | 246 |
| 749 | 3300025226 | Ga0209674_100023 | Ga0209674_100023471 | 246 |
| 750 | 3300025230 | Ga0209563_100027 | Ga0209563_100027471 | 246 |
| 751 | 3300025231 | Ga0207427_100017 | Ga0207427_100017471 | 246 |
| 752 | 3300025233 | Ga0209437_100029 | Ga0209437_100029471 | 246 |
| 753 | 3300025253 | Ga0209677_100014 | Ga0209677_100014471 | 246 |
| 754 | 3300025261 | Ga0209233_1000890 | Ga0209233_10008907 | 246 |
| 755 | 3300025298 | Ga0209050_1006975 | Ga0209050_10069757 | 246 |
| 756 | 3300025321 | Ga0207656_10054712 | Ga0207656_100547122 | 246 |
| 757 | 3300025711 | Ga0207696_1000658 | Ga0207696_10006585 | 246 |
| 758 | 3300025728 | Ga0207655_1000243 | Ga0207655_100024356 | 246 |
| 759 | 3300025728 | Ga0207655_1001135 | Ga0207655_100113526 | 246 |
| 760 | 3300025893 | Ga0207682_10023171 | Ga0207682_100231712 | 246 |
| 761 | 3300025893 | Ga0207682_10044908 | Ga0207682_100449082 | 246 |
| 762 | 3300025899 | Ga0207642_10144607 | Ga0207642_101446072 | 246 |
| 763 | 3300025901 | Ga0207688_10089558 | Ga0207688_100895582 | 246 |
| 764 | 3300025903 | Ga0207680_10000931 | Ga0207680_1000093111 | 246 |
| 765 | 3300025903 | Ga0207680_10204005 | Ga0207680_102040052 | 246 |
| 766 | 3300025903 | Ga0207680_10221954 | Ga0207680_102219541 | 246 |
| 767 | 3300025907 | Ga0207645_10001374 | Ga0207645_100013743 | 246 |
| 768 | 3300025908 | Ga0207643_10257413 | Ga0207643_102574131 | 246 |
| 769 | 3300025912 | Ga0207707_10059522 | Ga0207707_100595222 | 246 |
| 770 | 3300025914 | Ga0207671_10181187 | Ga0207671_101811872 | 246 |
| 771 | 3300025917 | Ga0207660_10002960 | Ga0207660_100029605 | 246 |
| 772 | 3300025918 | Ga0207662_10053058 | Ga0207662_100530582 | 246 |
| 773 | 3300025919 | Ga0207657_10024958 | Ga0207657_100249583 | 246 |
| 774 | 3300025920 | Ga0207649_10200860 | Ga0207649_102008602 | 246 |
| 775 | 3300025921 | Ga0207652_10068958 | Ga0207652_100689583 | 246 |
| 776 | 3300025922 | Ga0207646_10251807 | Ga0207646_102518071 | 246 |
| 777 | 3300025923 | Ga0207681_10071819 | Ga0207681_100718192 | 246 |
| 778 | 3300025923 | Ga0207681_10083286 | Ga0207681_100832862 | 246 |
| 779 | 3300025923 | Ga0207681_10378178 | Ga0207681_103781782 | 246 |
| 780 | 3300025924 | Ga0207694_10061975 | Ga0207694_100619752 | 246 |
| 781 | 3300025925 | Ga0207650_10337765 | Ga0207650_103377652 | 246 |
| 782 | 3300025926 | Ga0207659_10004208 | Ga0207659_100042083 | 246 |
| 783 | 3300025926 | Ga0207659_10007353 | Ga0207659_100073538 | 246 |
| 784 | 3300025931 | Ga0207644_10000635 | Ga0207644_100006354 | 246 |
| 785 | 3300025932 | Ga0207690_10015082 | Ga0207690_100150823 | 246 |
| 786 | 3300025933 | Ga0207706_10007598 | Ga0207706_100075983 | 246 |
| 787 | 3300025933 | Ga0207706_10172123 | Ga0207706_101721232 | 246 |
| 788 | 3300025933 | Ga0207706_10263616 | Ga0207706_102636161 | 246 |
| 789 | 3300025935 | Ga0207709_10036106 | Ga0207709_100361062 | 246 |
| 790 | 3300025935 | Ga0207709_10234604 | Ga0207709_102346042 | 246 |
| 791 | 3300025936 | Ga0207670_10009447 | Ga0207670_100094472 | 246 |
| 792 | 3300025938 | Ga0207704_10312482 | Ga0207704_103124822 | 246 |
| 793 | 3300025940 | Ga0207691_10046267 | Ga0207691_100462673 | 246 |
| 794 | 3300025940 | Ga0207691_10272737 | Ga0207691_102727372 | 246 |
| 795 | 3300025941 | Ga0207711_10007617 | Ga0207711_100076172 | 246 |
| 796 | 3300025941 | Ga0207711_10017006 | Ga0207711_100170062 | 246 |
| 797 | 3300025941 | Ga0207711_10112369 | Ga0207711_101123692 | 246 |
| 798 | 3300025941 | Ga0207711_10300554 | Ga0207711_103005542 | 246 |
| 799 | 3300025942 | Ga0207689_10000851 | Ga0207689_1000085124 | 246 |
| 800 | 3300025942 | Ga0207689_10083483 | Ga0207689_100834833 | 246 |
| 801 | 3300025942 | Ga0207689_10334793 | Ga0207689_103347931 | 246 |
| 802 | 3300025944 | Ga0207661_10186763 | Ga0207661_101867631 | 246 |
| 803 | 3300025945 | Ga0207679_10080361 | Ga0207679_100803613 | 246 |
| 804 | 3300025960 | Ga0207651_10005276 | Ga0207651_100052764 | 246 |
| 805 | 3300025960 | Ga0207651_10234740 | Ga0207651_102347402 | 246 |
| 806 | 3300025972 | Ga0207668_10017458 | Ga0207668_100174582 | 246 |
| 807 | 3300025986 | Ga0207658_10005671 | Ga0207658_1000567110 | 246 |
| 808 | 3300025986 | Ga0207658_10078687 | Ga0207658_100786872 | 246 |
| 809 | 3300026023 | Ga0207677_10002592 | Ga0207677_100025923 | 246 |
| 810 | 3300026023 | Ga0207677_10004596 | Ga0207677_100045963 | 246 |
| 811 | 3300026035 | Ga0207703_10001221 | Ga0207703_100012216 | 246 |
| 812 | 3300026041 | Ga0207639_10033688 | Ga0207639_100336882 | 246 |
| 813 | 3300026041 | Ga0207639_10370530 | Ga0207639_103705302 | 246 |
| 814 | 3300026067 | Ga0207678_10005562 | Ga0207678_100055623 | 246 |
| 815 | 3300026078 | Ga0207702_10025016 | Ga0207702_100250162 | 246 |
| 816 | 3300026078 | Ga0207702_10037987 | Ga0207702_100379871 | 246 |
| 817 | 3300026088 | Ga0207641_10015891 | Ga0207641_100158913 | 246 |
| 818 | 3300026088 | Ga0207641_10025598 | Ga0207641_100255982 | 246 |
| 819 | 3300026088 | Ga0207641_10059408 | Ga0207641_100594084 | 246 |
| 820 | 3300026088 | Ga0207641_10119471 | Ga0207641_101194712 | 246 |
| 821 | 3300026089 | Ga0207648_10055361 | Ga0207648_100553613 | 246 |
| 822 | 3300026095 | Ga0207676_10001143 | Ga0207676_1000114315 | 246 |
| 823 | 3300026095 | Ga0207676_10002759 | Ga0207676_100027593 | 246 |
| 824 | 3300026116 | Ga0207674_10244119 | Ga0207674_102441192 | 246 |
| 825 | 3300026118 | Ga0207675_100000246 | Ga0207675_10000024633 | 246 |
| 826 | 3300026118 | Ga0207675_100160268 | Ga0207675_1001602682 | 246 |
| 827 | 3300026121 | Ga0207683_10075611 | Ga0207683_100756113 | 246 |
| 828 | 3300026142 | Ga0207698_10002713 | Ga0207698_1000271310 | 246 |
| 829 | 3300026142 | Ga0207698_10036635 | Ga0207698_100366353 | 246 |
| 830 | 3300027312 | Ga0209371_1000087 | Ga0209371_100008722 | 246 |
| 831 | 3300028380 | Ga0268265_10179993 | Ga0268265_101799932 | 246 |
| 832 | 3300028381 | Ga0268264_10061418 | Ga0268264_100614183 | 246 |
| 833 | 3300028381 | Ga0268264_10067513 | Ga0268264_100675132 | 246 |
| 834 | 3300028381 | Ga0268264_10486547 | Ga0268264_104865472 | 246 |
| 835 | 3300030500 | Ga0268256_1000101 | Ga0268256_100010122 | 246 |
| 836 | 3300030500 | Ga0268256_1041207 | Ga0268256_10412072 | 246 |
| 837 | 3300030731 | Ga0316177_1054551 | Ga0316177_10545513 | 246 |
| 838 | 3300030736 | Ga0316180_1095940 | Ga0316180_10959403 | 246 |
| 839 | 3300031241 | Ga0265325_10005021 | Ga0265325_100050214 | 246 |
| 840 | 3300031456 | Ga0307513_10195563 | Ga0307513_101955632 | 246 |
| 841 | 3300031456 | Ga0307513_10318280 | Ga0307513_103182802 | 246 |
| 842 | 3300031730 | Ga0307516_10002914 | Ga0307516_100029146 | 246 |
| 843 | 3300031901 | Ga0307406_10689436 | Ga0307406_106894361 | 246 |
| 844 | 3300031911 | Ga0307412_10029815 | Ga0307412_100298153 | 246 |
| 845 | 3300031911 | Ga0307412_10071852 | Ga0307412_100718523 | 246 |
| 846 | 3300034816 | Ga0373930_0039127 | Ga0373930_0039127_121_885 | 246 |
| 847 | 3300035121 | Ga0373960_0058618 | Ga0373960_0058618_32_796 | 246 |
| 848 | 3300035691 | Ga0373931_0003648 | Ga0373931_0003648_4585_5349 | 246 |
| 849 | 3300035725 | Ga0373947_0238841 | Ga0373947_0238841_187_951 | 246 |
| 850 | 3300037418 | Ga0395900_0023039 | Ga0395900_0023039_4275_5081 | 246 |
| 851 | 3300038443 | Ga0395901_0130199 | Ga0395901_0130199_728_1534 | 246 |
| 852 | 3300039438 | Ga0436360_1229390 | Ga0436360_1229390_244_999 | 246 |
| 853 | 3300039450 | Ga0436363_0134441 | Ga0436363_0134441_42_806 | 246 |
| 854 | 3300039450 | Ga0436363_1058409 | Ga0436363_1058409_347_1111 | 246 |
| 855 | 3300041405 | Ga0439438_000018 | Ga0439438_000018_24378_25118 | 246 |
| 856 | 3300041407 | Ga0439447_002351 | Ga0439447_002351_3716_4456 | 246 |
| 857 | 3300041512 | Ga0451853_2911252 | Ga0451853_2911252_609_1616 | 246 |
| 858 | 3300042006 | Ga0439432_004844 | Ga0439432_004844_1028_1768 | 246 |
| 859 | 3300044658 | Ga0466972_0000383 | Ga0466972_0000383_6000_6758 | 246 |
| 860 | 3300044684 | Ga0466966_0032955 | Ga0466966_0032955_38_808 | 246 |
| 861 | 3300044719 | Ga0466971_0082607 | Ga0466971_0082607_196_966 | 246 |
| 862 | 3300044765 | Ga0466970_0054294 | Ga0466970_0054294_916_1686 | 246 |
| 863 | 3300045051 | Ga0451576_0216002 | Ga0451576_0216002_393_1157 | 246 |
| 864 | 3300046455 | Ga0495603_0306290 | Ga0495603_0306290_142_882 | 246 |
| 865 | 3300046457 | Ga0495590_0000016 | Ga0495590_0000016_125859_126605 | 246 |
| 866 | 3300046460 | Ga0495638_0000057 | Ga0495638_0000057_68607_69353 | 246 |
| 867 | 3300046460 | Ga0495638_0011962 | Ga0495638_0011962_4624_5370 | 246 |
| 868 | 3300046463 | Ga0495653_0001187 | Ga0495653_0001187_17682_18422 | 246 |
| 869 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_644831_645571 | 246 |
| 870 | 3300046471 | Ga0495650_0000102 | Ga0495650_0000102_58081_58821 | 246 |
| 871 | 3300046471 | Ga0495650_0002031 | Ga0495650_0002031_4989_5735 | 246 |
| 872 | 3300046475 | Ga0495639_0009356 | Ga0495639_0009356_2250_2996 | 246 |
| 873 | 3300046492 | Ga0495585_0000162 | Ga0495585_0000162_65579_66346 | 246 |
| 874 | 3300046492 | Ga0495585_0036768 | Ga0495585_0036768_1775_2521 | 246 |
| 875 | 3300046500 | Ga0495596_0000901 | Ga0495596_0000901_15861_16628 | 246 |
| 876 | 3300046500 | Ga0495596_0009485 | Ga0495596_0009485_2646_3392 | 246 |
| 877 | 3300046501 | Ga0495607_0002244 | Ga0495607_0002244_11762_12502 | 246 |
| 878 | 3300046506 | Ga0495583_0000688 | Ga0495583_0000688_18772_19518 | 246 |
| 879 | 3300046507 | Ga0495606_0215386 | Ga0495606_0215386_247_987 | 246 |
| 880 | 3300046518 | Ga0495631_0130860 | Ga0495631_0130860_108_848 | 246 |
| 881 | 3300046519 | Ga0495632_0006806 | Ga0495632_0006806_4555_5301 | 246 |
| 882 | 3300046522 | Ga0495643_0000236 | Ga0495643_0000236_42190_42936 | 246 |
| 883 | 3300046522 | Ga0495643_0084456 | Ga0495643_0084456_460_1206 | 246 |
| 884 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_465796_466542 | 246 |
| 885 | 3300046528 | Ga0495642_0025740 | Ga0495642_0025740_78_824 | 246 |
| 886 | 3300046530 | Ga0495654_0000218 | Ga0495654_0000218_42623_43363 | 246 |
| 887 | 3300046537 | Ga0495598_0033145 | Ga0495598_0033145_466_1230 | 246 |
| 888 | 3300046538 | Ga0495609_0004395 | Ga0495609_0004395_6402_7148 | 246 |
| 889 | 3300046542 | Ga0495597_0000080 | Ga0495597_0000080_70900_71646 | 246 |
| 890 | 3300046557 | Ga0495622_0000483 | Ga0495622_0000483_18155_18901 | 246 |
| 891 | 3300046558 | Ga0495633_0000399 | Ga0495633_0000399_26052_26798 | 246 |
| 892 | 3300046558 | Ga0495633_0004029 | Ga0495633_0004029_220_987 | 246 |
| 893 | 3300046616 | Ga0495668_0000132 | Ga0495668_0000132_68621_69367 | 246 |
| 894 | 3300046616 | Ga0495668_0353418 | Ga0495668_0353418_38_784 | 246 |
| 895 | 3300046648 | Ga0495611_0016943 | Ga0495611_0016943_949_1695 | 246 |
| 896 | 3300046660 | Ga0495625_0000177 | Ga0495625_0000177_25938_26684 | 246 |
| 897 | 3300046660 | Ga0495625_0026687 | Ga0495625_0026687_762_1508 | 246 |
| 898 | 3300046683 | Ga0495658_0063585 | Ga0495658_0063585_22_786 | 246 |
| 899 | 3300046694 | Ga0495649_0001590 | Ga0495649_0001590_5979_6719 | 246 |
| 900 | 3300046694 | Ga0495649_0107798 | Ga0495649_0107798_428_1174 | 246 |
| 901 | 3300046794 | Ga0495589_0117340 | Ga0495589_0117340_326_1072 | 246 |
| 902 | 3300046810 | Ga0495660_0000006 | Ga0495660_0000006_457404_458144 | 246 |
| 903 | 3300047315 | Ga0495581_0264524 | Ga0495581_0264524_173_928 | 246 |
| 904 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_42717_43457 | 246 |
| 905 | 3300047321 | Ga0495676_0046612 | Ga0495676_0046612_1195_1935 | 246 |
| 906 | 3300047323 | Ga0495683_0000072 | Ga0495683_0000072_34838_35605 | 246 |
| 907 | 3300047323 | Ga0495683_0100117 | Ga0495683_0100117_297_1043 | 246 |
| 908 | 3300048091 | Ga0495626_0011297 | Ga0495626_0011297_583_1329 | 246 |
| 909 | 3300048903 | Ga0496100_0007795 | Ga0496100_0007795_2404_3168 | 246 |
| 910 | 3300048904 | Ga0496101_0214875 | Ga0496101_0214875_337_1101 | 246 |
| 911 | 3300048905 | Ga0496102_0095663 | Ga0496102_0095663_554_1318 | 246 |
| 912 | 3300048907 | Ga0496104_0001453 | Ga0496104_0001453_13972_14712 | 246 |
| 913 | 3300048907 | Ga0496104_0043071 | Ga0496104_0043071_1402_2166 | 246 |
| 914 | 3300048909 | Ga0496106_0005946 | Ga0496106_0005946_6034_6798 | 246 |
| 915 | 3300048909 | Ga0496106_0061377 | Ga0496106_0061377_1400_2155 | 246 |
| 916 | 3300048910 | Ga0496107_0138529 | Ga0496107_0138529_609_1373 | 246 |
| 917 | 3300048911 | Ga0496108_0052815 | Ga0496108_0052815_329_1093 | 246 |
| 918 | 3300048912 | Ga0496109_0026177 | Ga0496109_0026177_1480_2244 | 246 |
| 919 | 3300048912 | Ga0496109_0231886 | Ga0496109_0231886_644_1408 | 246 |
| 920 | 3300048913 | Ga0496110_0061421 | Ga0496110_0061421_1716_2480 | 246 |
| 921 | 3300048915 | Ga0496112_0069091 | Ga0496112_0069091_575_1339 | 246 |
| 922 | 3300048916 | Ga0496113_0009831 | Ga0496113_0009831_879_1643 | 246 |
| 923 | 3300048916 | Ga0496113_0369185 | Ga0496113_0369185_27_797 | 246 |
| 924 | 3300048917 | Ga0496114_0221129 | Ga0496114_0221129_593_1357 | 246 |
| 925 | 3300048917 | Ga0496114_0591727 | Ga0496114_0591727_70_834 | 246 |
| 926 | 3300048918 | Ga0496115_0009776 | Ga0496115_0009776_4153_4917 | 246 |
| 927 | 3300048919 | Ga0496116_0000020 | Ga0496116_0000020_473367_474107 | 246 |
| 928 | 3300048919 | Ga0496116_0048918 | Ga0496116_0048918_28_774 | 246 |
| 929 | 3300048919 | Ga0496116_0070363 | Ga0496116_0070363_552_1307 | 246 |
| 930 | 3300048920 | Ga0496117_0000011 | Ga0496117_0000011_386987_387742 | 246 |
| 931 | 3300048920 | Ga0496117_0043729 | Ga0496117_0043729_527_1267 | 246 |
| 932 | 3300048921 | Ga0496118_0000010 | Ga0496118_0000010_223189_223944 | 246 |
| 933 | 3300048921 | Ga0496118_0002115 | Ga0496118_0002115_14237_14977 | 246 |
| 934 | 3300048921 | Ga0496118_0003691 | Ga0496118_0003691_3703_4443 | 246 |
| 935 | 3300048923 | Ga0496120_0002102 | Ga0496120_0002102_19386_20126 | 246 |
| 936 | 3300048924 | Ga0496121_0002266 | Ga0496121_0002266_14116_14871 | 246 |
| 937 | 3300048924 | Ga0496121_0004661 | Ga0496121_0004661_5718_6473 | 246 |
| 938 | 3300048924 | Ga0496121_0118184 | Ga0496121_0118184_1210_1965 | 246 |
| 939 | 3300048925 | Ga0496122_0000010 | Ga0496122_0000010_173848_174588 | 246 |
| 940 | 3300048926 | Ga0496123_0000061 | Ga0496123_0000061_42090_42830 | 246 |
| 941 | 3300048927 | Ga0496124_0000084 | Ga0496124_0000084_29775_30515 | 246 |
| 942 | 3300048927 | Ga0496124_0218820 | Ga0496124_0218820_387_1133 | 246 |
| 943 | 3300048928 | Ga0496125_0000071 | Ga0496125_0000071_42639_43379 | 246 |
| 944 | 3300048928 | Ga0496125_0089187 | Ga0496125_0089187_74_829 | 246 |
| 945 | 3300048929 | Ga0496126_0002615 | Ga0496126_0002615_16742_17482 | 246 |
| 946 | 3300049459 | Ga0495678_007026 | Ga0495678_007026_2289_3035 | 246 |
| 947 | 3300049460 | Ga0495682_0000017 | Ga0495682_0000017_189852_190592 | 246 |
| 948 | 3300049515 | Ga0501292_003979 | Ga0501292_003979_1156_1911 | 246 |
| 949 | 3300049569 | Ga0501032_0238738 | Ga0501032_0238738_94_840 | 246 |
| 950 | 3300049573 | Ga0501037_0041992 | Ga0501037_0041992_1726_2472 | 246 |
| 951 | 3300049579 | Ga0501043_0204213 | Ga0501043_0204213_162_908 | 246 |
| 952 | 3300049581 | Ga0501047_0036949 | Ga0501047_0036949_1760_2506 | 246 |
| 953 | 3300049822 | Ga0501035_0076485 | Ga0501035_0076485_1979_2725 | 246 |
| 954 | 3300050489 | nmdc:mga03683_30766_c1 | nmdc:mga03683_30766_c1_668_1423 | 246 |
| 955 | 3300050493 | nmdc:mga0k408_66252_c1 | nmdc:mga0k408_66252_c1_317_1072 | 246 |
| 956 | 3300050507 | nmdc:mga05p37_358905_c1 | nmdc:mga05p37_358905_c1_401_1189 | 246 |
| 957 | 3300050508 | nmdc:mga09592_16638_c1 | nmdc:mga09592_16638_c1_2849_3604 | 246 |
| 958 | 3300053086 | Ga0500578_0199438 | Ga0500578_0199438_221_976 | 246 |
| 959 | 3300053125 | Ga0500618_001635 | Ga0500618_001635_2946_3686 | 246 |
| 960 | 3300053730 | Ga0500645_006464 | Ga0500645_006464_1268_2023 | 246 |
| 961 | 3300061719 | Ga0466962_0060604 | Ga0466962_0060604_275_1045 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yqz-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9756 | 1 | 246 |
| 4yqz-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9715 | 1 | 246 |
| 4yqz-assembly1.cif.gz_D | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9652 | 1 | 246 |
| 4yqz-assembly1.cif.gz_D | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9612 | 1 | 246 |
| 6zzq-assembly1.cif.gz_A | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate | 0.9576 | 3 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4yqzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9743 | 2 | 244 | 3.40.50.720 |
| 4yqzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9659 | 2 | 244 | 3.40.50.720 |
| 2ag5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9573 | 1 | 246 | 3.40.50.720 |
| 2ag5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9535 | 1 | 246 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9504 | 79 | 179 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7L3BNC6-F1-model_v4 | Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) | 0.9974 | 48 | 174 |
GO:0003858
GO:0005737 GO:0019290 |
| AF-A0A0Q0X477-F1-model_v4 | Oxidoreductase | 0.9926 | 66 | 246 |
GO:0016491
|
| AF-A0A7L2JCT2-F1-model_v4 | Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) | 0.9904 | 3 | 170 |
GO:0003858
GO:0005737 GO:0019290 |
| AF-A0A3B3DAU7-F1-model_v4 | Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) | 0.9901 | 3 | 187 |
GO:0003858
GO:0005737 GO:0019290 GO:0042168 GO:0042541 GO:0043249 |
| AF-S9XYG3-F1-model_v4 | deleted | 0.99 | 3 | 172 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar