F486863

General Info

Members Datasets Scaffolds Average Seq Length
961 484 913 248

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10444222|Ga0105239_104442222
Length 307
Sequence VNVSQSNRGASLVHERALGKPGVDGATGPKLFFTRPVEASVAHRPPPAAGDSPMTDRLAGKTAFITAAGQGIGRATAEAFVREGARVVATDINAQSLAELARATGCETRRLDVTDASAVLAASIEANAKGTVNVLFNAAGFVHHGTILECDEVAFDFSIDLNVRAMYRVTRAFLPPMLKAGGGSIINVASAASSIKGVPNRFVYTGTKAAVIGMTKSIAADFITRGVRCNAICPGTVESPSLRQRIDAQAKTSGQTVADIEAAFVARQPMGRIGTAAEIAALAVYLASDESAFTTGTTHVIDGGWSM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
7 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
8 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
14 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
15 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
16 2818991435 Caulobacter henricii 536 Isolate Unclassified
17 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
18 2818991457 Xanthomonas translucens 569 Isolate Unclassified
19 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
20 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
27 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
28 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
31 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
32 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
33 2919150387 Rahnella aceris 1817 Isolate Unclassified
34 2927143783 Rahnella sp. 2050 Isolate Unclassified
35 2928058823 Ralstonia sp. 1138 Isolate Unclassified
36 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
37 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
41 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
46 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
71 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
82 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
125 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
266 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
267 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
268 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
269 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
270 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
271 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
272 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
273 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
274 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
275 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
276 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
281 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
301 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
305 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
308 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
309 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
312 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
313 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
314 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
331 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
365 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
384 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
394 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
395 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
396 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
415 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
426 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
427 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
428 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
457 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
458 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
461 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
462 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
463 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
464 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
465 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
471 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
472 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
473 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
476 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
478 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
479 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
480 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
481 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
482 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
483 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
484 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.59
Metatranscriptomes 0.42
Isolates 4.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0.52
Rhizoplane 3.64
Rhizosphere 75.96
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1052005 2162886007 Bacteria 2716
2 JGI24740J21852_10000445 3300001979 Bacteria 17693
3 JGI25162J39368_1000067 3300002737 Bacteria 129813
4 JGI25163J39215_1000114 3300002771 Bacteria 33694
5 JGI25164J39214_1000039 3300002772 Bacteria 129437
6 JGI25406J46586_10016018 3300003203 Bacteria 3140
7 JGI25406J46586_10026364 3300003203 Bacteria 2241
8 JGI25153J46596_10033239 3300003215 Bacteria 1706
9 rootH1_10009674 3300003323 Bacteria 20975
10 Ga0055538_1000052 3300003751 Bacteria 129813
11 Ga0055539_1000077 3300003752 Bacteria 129445
12 Ga0055539_1000100 3300003752 Bacteria 100406
13 Ga0055533_1000083 3300003756 Bacteria 129813
14 Ga0055533_1006178 3300003756 Bacteria 1803
15 Ga0055533_1007660 3300003756 Bacteria 1445
16 Ga0055532_1000127 3300003758 Bacteria 75964
17 Ga0055525_1000110 3300003759 Bacteria 129813
18 Ga0055525_1000487 3300003759 Bacteria 20653
19 Ga0055527_1001540 3300003760 Bacteria 4705
20 Ga0055535_1000140 3300003761 Bacteria 75964
21 Ga0055526_1005610 3300003771 Bacteria 7145
22 Ga0055536_1000057 3300003781 Bacteria 104652
23 Ga0055530_10002520 3300003791 Bacteria 11694
24 Ga0055531_10000053 3300003794 Bacteria 124623
25 Ga0055531_10000224 3300003794 Bacteria 62709
26 Ga0055531_10001089 3300003794 Bacteria 21336
27 Ga0055531_10002666 3300003794 Bacteria 11771
28 Ga0055531_10007156 3300003794 Bacteria 6152
29 Ga0055541_1000054 3300003841 Bacteria 129813
30 Ga0055541_1010003 3300003841 Bacteria 1445
31 Ga0055541_1011678 3300003841 Bacteria 1281
32 Ga0058692_1000054 3300003856 Bacteria 106871
33 Ga0065165_1000660 3300005262 Bacteria 49811
34 Ga0065704_10000086 3300005289 Bacteria 27230
35 Ga0070658_10323291 3300005327 Bacteria 1317
36 Ga0070676_10002823 3300005328 Bacteria 8978
37 Ga0070676_10015199 3300005328 Bacteria 4244
38 Ga0070670_100000709 3300005331 Bacteria 25835
39 Ga0070670_100733791 3300005331 Bacteria 889
40 Ga0068869_100001193 3300005334 Bacteria 15258
41 Ga0068869_100014797 3300005334 Bacteria 5219
42 Ga0068869_100149052 3300005334 Bacteria 1813
43 Ga0070666_10001793 3300005335 Bacteria 13078
44 Ga0070666_10238456 3300005335 Bacteria 1286
45 Ga0070680_100004336 3300005336 Bacteria 10668
46 Ga0070682_100067114 3300005337 Bacteria 2284
47 Ga0068868_100000185 3300005338 Bacteria 41542
48 Ga0068868_100012143 3300005338 Bacteria 6289
49 Ga0070660_100003037 3300005339 Bacteria 11554
50 Ga0070660_100005623 3300005339 Bacteria 8689
51 Ga0070660_100084247 3300005339 Bacteria 2498
52 Ga0070689_100010833 3300005340 Bacteria 6516
53 Ga0070691_10105692 3300005341 Bacteria 1403
54 Ga0070687_100024370 3300005343 Bacteria 2888
55 Ga0070661_100000119 3300005344 Bacteria 65829
56 Ga0070668_100029171 3300005347 Bacteria 4190
57 Ga0070668_100077972 3300005347 Bacteria 2590
58 Ga0070668_100127176 3300005347 Bacteria 2042
59 Ga0070668_100196590 3300005347 Bacteria 1654
60 Ga0070669_100023411 3300005353 Bacteria 4423
61 Ga0070669_100029773 3300005353 Bacteria 3938
62 Ga0070669_100623658 3300005353 Bacteria 905
63 Ga0070675_100001427 3300005354 Bacteria 17552
64 Ga0070675_100002466 3300005354 Bacteria 13837
65 Ga0070671_100009724 3300005355 Bacteria 7724
66 Ga0070671_100015468 3300005355 Bacteria 6165
67 Ga0070673_100002536 3300005364 Bacteria 11150
68 Ga0070673_100143386 3300005364 Bacteria 2017
69 Ga0070688_100223244 3300005365 Bacteria 1329
70 Ga0070659_100021337 3300005366 Bacteria 4932
71 Ga0070659_100471499 3300005366 Bacteria 1067
72 Ga0070667_100006541 3300005367 Bacteria 9687
73 Ga0070667_100020821 3300005367 Bacteria 5447
74 Ga0070667_100077412 3300005367 Bacteria 2840
75 Ga0070667_100168469 3300005367 Bacteria 1932
76 Ga0070667_100273872 3300005367 Bacteria 1514
77 Ga0070709_10036865 3300005434 Bacteria 2983
78 Ga0070709_10184226 3300005434 Bacteria 1468
79 Ga0070714_100034759 3300005435 Bacteria 4221
80 Ga0070713_100017602 3300005436 Bacteria 5409
81 Ga0070713_100144293 3300005436 Bacteria 2111
82 Ga0070710_10255288 3300005437 Bacteria 1128
83 Ga0070701_10116317 3300005438 Bacteria 1501
84 Ga0070711_100030764 3300005439 Bacteria 3557
85 Ga0070700_100243235 3300005441 Bacteria 1287
86 Ga0070708_100013868 3300005445 Bacteria 6619
87 Ga0070663_100000035 3300005455 Bacteria 66161
88 Ga0070663_100020341 3300005455 Bacteria 4393
89 Ga0070663_100115861 3300005455 Bacteria 2019
90 Ga0070662_100003027 3300005457 Bacteria 10453
91 Ga0070662_100007037 3300005457 Bacteria 7278
92 Ga0070662_100155742 3300005457 Bacteria 1783
93 Ga0070681_10101502 3300005458 Bacteria 2822
94 Ga0070681_10109271 3300005458 Bacteria 2706
95 Ga0070681_10109983 3300005458 Bacteria 2695
96 Ga0068867_100030151 3300005459 Bacteria 3912
97 Ga0068867_100352825 3300005459 Bacteria 1228
98 Ga0070706_100001937 3300005467 Bacteria 21337
99 Ga0070706_100048699 3300005467 Bacteria 3911
100 Ga0070707_100176391 3300005468 Bacteria 2083
101 Ga0070698_100180024 3300005471 Bacteria 2052
102 Ga0070699_100089170 3300005518 Bacteria 2694
103 Ga0070679_100081200 3300005530 Bacteria 3231
104 Ga0070684_100018963 3300005535 Bacteria 5681
105 Ga0070697_100000588 3300005536 Bacteria 27480
106 Ga0070697_100081899 3300005536 Bacteria 2660
107 Ga0068853_100009939 3300005539 Bacteria 7683
108 Ga0068853_100029693 3300005539 Bacteria 4611
109 Ga0068853_100189365 3300005539 Bacteria 1869
110 Ga0068853_100333581 3300005539 Bacteria 1408
111 Ga0070672_100015407 3300005543 Bacteria 5441
112 Ga0070672_100117142 3300005543 Bacteria 2177
113 Ga0070672_100221402 3300005543 Bacteria 1587
114 Ga0070672_100310739 3300005543 Bacteria 1338
115 Ga0070686_100038490 3300005544 Bacteria 2973
116 Ga0070693_100145147 3300005547 Bacteria 1498
117 Ga0070693_100193944 3300005547 Bacteria 1315
118 Ga0070665_100033725 3300005548 Bacteria 5150
119 Ga0070665_100712021 3300005548 Bacteria 1017
120 Ga0068855_100011273 3300005563 Bacteria 10796
121 Ga0068855_100023793 3300005563 Bacteria 7337
122 Ga0068855_100025726 3300005563 Bacteria 7038
123 Ga0068855_100111463 3300005563 Bacteria 3141
124 Ga0068855_100200920 3300005563 Bacteria 2244
125 Ga0068855_100505891 3300005563 Bacteria 1312
126 Ga0070664_100000008 3300005564 Bacteria 173734
127 Ga0070664_100111815 3300005564 Bacteria 2384
128 Ga0070664_100160719 3300005564 Bacteria 1987
129 Ga0068857_100144683 3300005577 Bacteria 2150
130 Ga0068854_100012088 3300005578 Bacteria 5645
131 Ga0068854_100066061 3300005578 Bacteria 2631
132 Ga0068854_100199823 3300005578 Bacteria 1571
133 Ga0068856_100000862 3300005614 Bacteria 32543
134 Ga0068856_100033738 3300005614 Bacteria 5013
135 Ga0068856_100065349 3300005614 Bacteria 3595
136 Ga0068856_100150441 3300005614 Bacteria 2337
137 Ga0068856_100441686 3300005614 Bacteria 1322
138 Ga0070702_100013026 3300005615 Bacteria 4188
139 Ga0068852_100023260 3300005616 Bacteria 4985
140 Ga0068859_100000211 3300005617 Bacteria 58042
141 Ga0068859_100001283 3300005617 Bacteria 25657
142 Ga0068859_100474436 3300005617 Bacteria 1347
143 Ga0068864_100001050 3300005618 Bacteria 23192
144 Ga0068864_100014858 3300005618 Bacteria 6469
145 Ga0068861_100000536 3300005719 Bacteria 22261
146 Ga0068861_100106030 3300005719 Bacteria 2244
147 Ga0068851_10078654 3300005834 Bacteria 1718
148 Ga0068863_100003996 3300005841 Bacteria 14561
149 Ga0068863_100004913 3300005841 Bacteria 13173
150 Ga0068863_100087518 3300005841 Bacteria 2951
151 Ga0068863_100939432 3300005841 Bacteria 866
152 Ga0068858_100000885 3300005842 Bacteria 31082
153 Ga0068858_100005568 3300005842 Bacteria 12322
154 Ga0068858_100057021 3300005842 Bacteria 3610
155 Ga0068858_100758041 3300005842 Bacteria 946
156 Ga0068860_100004169 3300005843 Bacteria 14821
157 Ga0068860_100046824 3300005843 Bacteria 4123
158 Ga0068860_100067502 3300005843 Bacteria 3398
159 Ga0068860_100114978 3300005843 Bacteria 2573
160 Ga0068860_100140715 3300005843 Bacteria 2319
161 Ga0068862_100038274 3300005844 Bacteria 4067
162 Ga0068862_100138508 3300005844 Bacteria 2159
163 Ga0081538_10003998 3300005981 Bacteria 13729
164 Ga0081540_1002396 3300005983 Bacteria 15290
165 Ga0081539_10000283 3300005985 Bacteria 114603
166 Ga0081539_10136948 3300005985 Bacteria 1194
167 Ga0070717_10002258 3300006028 Bacteria 13509
168 Ga0070717_10326679 3300006028 Bacteria 1368
169 Ga0070715_10002299 3300006163 Bacteria 5826
170 Ga0070716_100074489 3300006173 Bacteria 2006
171 Ga0075362_10021179 3300006177 Bacteria 2724
172 Ga0075366_10013029 3300006195 Bacteria 4728
173 Ga0097621_100028263 3300006237 Bacteria 4420
174 Ga0097621_100066237 3300006237 Bacteria 2974
175 Ga0075370_10028358 3300006353 Bacteria 3111
176 Ga0075370_10081948 3300006353 Bacteria 1855
177 Ga0068871_100007888 3300006358 Bacteria 7634
178 Ga0075428_100017228 3300006844 Bacteria 7984
179 Ga0075433_10549133 3300006852 Bacteria 1016
180 Ga0075429_100002684 3300006880 Bacteria 14979
181 Ga0068865_100269152 3300006881 Bacteria 1352
182 Ga0097620_100000211 3300006931 Bacteria 58042
183 Ga0097620_100001283 3300006931 Bacteria 25657
184 Ga0097620_100474396 3300006931 Bacteria 1347
185 Ga0079104_1000003 3300006946 Bacteria 468966
186 Ga0099826_10198776 3300006948 Bacteria 1099
187 Ga0075435_100365409 3300007076 Bacteria 1238
188 Ga0075435_100578635 3300007076 Bacteria 973
189 Ga0105251_10000362 3300009011 Bacteria 44619
190 Ga0105244_10000008 3300009036 Bacteria 302297
191 Ga0105244_10000945 3300009036 Bacteria 24406
192 Ga0105250_10001925 3300009092 Bacteria 10771
193 Ga0105250_10003540 3300009092 Bacteria 7356
194 Ga0105240_10008279 3300009093 Bacteria 14885
195 Ga0105240_10091079 3300009093 Bacteria 3726
196 Ga0105240_10106207 3300009093 Bacteria 3406
197 Ga0105240_10316268 3300009093 Bacteria 1781
198 Ga0105247_10000260 3300009101 Bacteria 48812
199 Ga0114129_10202440 3300009147 Bacteria 2688
200 Ga0105243_10017212 3300009148 Bacteria 5467
201 Ga0105243_10138716 3300009148 Bacteria 2072
202 Ga0105243_10243103 3300009148 Bacteria 1603
203 Ga0105241_10014103 3300009174 Bacteria 5856
204 Ga0105241_10076924 3300009174 Bacteria 2604
205 Ga0105241_10707230 3300009174 Bacteria 920
206 Ga0105248_10001076 3300009177 Bacteria 30156
207 Ga0105248_10029339 3300009177 Bacteria 6137
208 Ga0105248_10057587 3300009177 Bacteria 4363
209 Ga0105248_10097431 3300009177 Bacteria 3313
210 Ga0105248_10114596 3300009177 Bacteria 3040
211 Ga0105248_10170182 3300009177 Bacteria 2455
212 Ga0105237_10000080 3300009545 Bacteria 127788
213 Ga0105237_10158940 3300009545 Bacteria 2257
214 Ga0105237_10420200 3300009545 Bacteria 1342
215 Ga0105238_10000711 3300009551 Bacteria 34783
216 Ga0105238_10076954 3300009551 Bacteria 3329
217 Ga0105238_10158745 3300009551 Bacteria 2237
218 Ga0105249_10020152 3300009553 Bacteria 5958
219 Ga0105249_10036077 3300009553 Bacteria 4485
220 Ga0105148_100701 3300009978 Bacteria 2596
221 Ga0105239_10000116 3300010375 Bacteria 112811
222 Ga0105239_10039116 3300010375 Bacteria 5196
223 Ga0105239_10230802 3300010375 Bacteria 2076
224 Ga0105239_10444222 3300010375 Bacteria 1471
225 Ga0157373_10002177 3300013100 Bacteria 14840
226 Ga0157373_10019006 3300013100 Bacteria 5001
227 Ga0157373_10147087 3300013100 Bacteria 1657
228 Ga0157371_10000075 3300013102 Bacteria 162328
229 Ga0157371_10000413 3300013102 Bacteria 52929
230 Ga0157371_10009934 3300013102 Bacteria 7450
231 Ga0157370_10000216 3300013104 Bacteria 73339
232 Ga0157370_10000456 3300013104 Bacteria 51071
233 Ga0157370_10228371 3300013104 Bacteria 1723
234 Ga0157369_10002006 3300013105 Bacteria 24529
235 Ga0157369_10150479 3300013105 Bacteria 2460
236 Ga0157369_10180215 3300013105 Bacteria 2223
237 Ga0157374_10008777 3300013296 Bacteria 8650
238 Ga0157374_10021504 3300013296 Bacteria 5742
239 Ga0157378_10481226 3300013297 Bacteria 1237
240 Ga0157378_10573406 3300013297 Bacteria 1137
241 Ga0157378_10577245 3300013297 Bacteria 1133
242 Ga0163162_10010707 3300013306 Bacteria 8921
243 Ga0163162_10013948 3300013306 Bacteria 7853
244 Ga0163162_10096375 3300013306 Bacteria 3046
245 Ga0163162_10213186 3300013306 Bacteria 2061
246 Ga0157372_10000142 3300013307 Bacteria 79172
247 Ga0157372_10029443 3300013307 Bacteria 5996
248 Ga0157372_10302668 3300013307 Bacteria 1860
249 Ga0157372_10331267 3300013307 Bacteria 1773
250 Ga0157375_10016333 3300013308 Bacteria 6664
251 Ga0157375_10052050 3300013308 Bacteria 4024
252 Ga0157375_10058917 3300013308 Bacteria 3802
253 Ga0157375_10157456 3300013308 Bacteria 2411
254 Ga0157375_10168640 3300013308 Bacteria 2336
255 Ga0163163_10012602 3300014325 Bacteria 7710
256 Ga0163163_10049693 3300014325 Bacteria 4127
257 Ga0163163_10056883 3300014325 Bacteria 3866
258 Ga0157380_10143005 3300014326 Bacteria 2058
259 Ga0182008_10136985 3300014497 Bacteria 1223
260 Ga0157377_10003314 3300014745 Bacteria 7276
261 Ga0157379_10002653 3300014968 Bacteria 15057
262 Ga0157379_10007683 3300014968 Bacteria 9335
263 Ga0157379_10008236 3300014968 Bacteria 9052
264 Ga0157379_10305251 3300014968 Bacteria 1451
265 Ga0157376_10008707 3300014969 Bacteria 7336
266 Ga0157376_10104576 3300014969 Bacteria 2481
267 Ga0182006_1000004 3300015261 Bacteria 622190
268 Ga0182006_1002877 3300015261 Bacteria 9147
269 Ga0182006_1005567 3300015261 Bacteria 5984
270 Ga0182007_10000018 3300015262 Bacteria 198916
271 Ga0182007_10043830 3300015262 Bacteria 1485
272 Ga0182005_1000011 3300015265 Bacteria 420605
273 Ga0182005_1070727 3300015265 Bacteria 958
274 Ga0163161_10013883 3300017792 Bacteria 5611
275 Ga0163161_10076178 3300017792 Bacteria 2462
276 Ga0163161_10101262 3300017792 Bacteria 2145
277 Ga0206351_10994603 3300020077 Bacteria 3530
278 Ga0206353_11620780 3300020082 Bacteria 1085
279 Ga0154015_1049643 3300020610 Bacteria 16414
280 Ga0213872_10103861 3300021361 Bacteria 1265
281 Ga0213875_10003695 3300021388 Bacteria 8629
282 Ga0213875_10009808 3300021388 Bacteria 4829
283 Ga0213875_10027371 3300021388 Bacteria 2712
284 Ga0209760_100070 3300025207 Bacteria 83162
285 Ga0209784_100012 3300025224 Bacteria 535823
286 Ga0209566_100002 3300025225 Bacteria 2614868
287 Ga0209566_100010 3300025225 Bacteria 535823
288 Ga0209566_102220 3300025225 Bacteria 3824
289 Ga0209674_100023 3300025226 Bacteria 535823
290 Ga0209674_110949 3300025226 Bacteria 945
291 Ga0209672_100818 3300025228 Bacteria 14658
292 Ga0209147_100002 3300025229 Bacteria 2158988
293 Ga0209563_100027 3300025230 Bacteria 535823
294 Ga0209563_105221 3300025230 Bacteria 2381
295 Ga0207427_100017 3300025231 Bacteria 535823
296 Ga0209437_100029 3300025233 Bacteria 535823
297 Ga0209258_100002 3300025242 Bacteria 2158988
298 Ga0209677_100014 3300025253 Bacteria 535823
299 Ga0209759_1003202 3300025256 Bacteria 6636
300 Ga0209233_1000026 3300025261 Bacteria 678466
301 Ga0209233_1000890 3300025261 Bacteria 13052
302 Ga0209455_1000021 3300025272 Bacteria 699993
303 Ga0209676_1000031 3300025292 Bacteria 478976
304 Ga0209564_1001441 3300025295 Bacteria 24287
305 Ga0209564_1002205 3300025295 Bacteria 16256
306 Ga0209564_1017308 3300025295 Bacteria 2817
307 Ga0209758_1000571 3300025297 Bacteria 57774
308 Ga0209758_1006173 3300025297 Bacteria 8771
309 Ga0209050_1000087 3300025298 Bacteria 261460
310 Ga0209050_1006975 3300025298 Bacteria 6507
311 Ga0209050_1011531 3300025298 Bacteria 4172
312 Ga0209050_1021417 3300025298 Bacteria 2357
313 Ga0209256_1000694 3300025299 Bacteria 44757
314 Ga0209257_1000050 3300025304 Bacteria 439325
315 Ga0209257_1000326 3300025304 Bacteria 99865
316 Ga0209257_1000687 3300025304 Bacteria 52593
317 Ga0207656_10054712 3300025321 Bacteria 1735
318 Ga0207696_1000658 3300025711 Bacteria 24673
319 Ga0207655_1000243 3300025728 Bacteria 89023
320 Ga0207655_1001135 3300025728 Bacteria 25953
321 Ga0207713_1000429 3300025735 Bacteria 44408
322 Ga0207682_10023171 3300025893 Bacteria 2451
323 Ga0207682_10044908 3300025893 Bacteria 1812
324 Ga0207692_10009267 3300025898 Bacteria 4104
325 Ga0207642_10144607 3300025899 Bacteria 1258
326 Ga0207710_10000322 3300025900 Bacteria 36632
327 Ga0207688_10089558 3300025901 Bacteria 1765
328 Ga0207680_10000931 3300025903 Bacteria 13816
329 Ga0207680_10204005 3300025903 Bacteria 1349
330 Ga0207680_10221954 3300025903 Bacteria 1296
331 Ga0207685_10001062 3300025905 Bacteria 5399
332 Ga0207699_10086395 3300025906 Bacteria 1959
333 Ga0207645_10001374 3300025907 Bacteria 19987
334 Ga0207645_10235203 3300025907 Bacteria 1210
335 Ga0207643_10257413 3300025908 Bacteria 1077
336 Ga0207705_10000808 3300025909 Bacteria 25747
337 Ga0207684_10005804 3300025910 Bacteria 11319
338 Ga0207684_10041500 3300025910 Bacteria 3901
339 Ga0207707_10059522 3300025912 Bacteria 3323
340 Ga0207695_10002210 3300025913 Bacteria 29273
341 Ga0207695_10076632 3300025913 Bacteria 3399
342 Ga0207671_10024475 3300025914 Bacteria 4540
343 Ga0207671_10085457 3300025914 Bacteria 2371
344 Ga0207671_10181187 3300025914 Bacteria 1639
345 Ga0207693_10018603 3300025915 Bacteria 5531
346 Ga0207663_10049902 3300025916 Bacteria 2598
347 Ga0207660_10002960 3300025917 Bacteria 11108
348 Ga0207662_10053058 3300025918 Bacteria 2414
349 Ga0207657_10003643 3300025919 Bacteria 16405
350 Ga0207657_10024958 3300025919 Bacteria 5523
351 Ga0207657_10186931 3300025919 Bacteria 1673
352 Ga0207649_10004096 3300025920 Bacteria 7935
353 Ga0207649_10200860 3300025920 Bacteria 1408
354 Ga0207652_10068958 3300025921 Bacteria 3069
355 Ga0207646_10251807 3300025922 Bacteria 1596
356 Ga0207681_10071819 3300025923 Bacteria 2415
357 Ga0207681_10083286 3300025923 Bacteria 2263
358 Ga0207681_10378178 3300025923 Bacteria 1139
359 Ga0207694_10015010 3300025924 Bacteria 5841
360 Ga0207694_10061975 3300025924 Bacteria 2911
361 Ga0207650_10000841 3300025925 Bacteria 23285
362 Ga0207650_10337765 3300025925 Bacteria 1237
363 Ga0207659_10004208 3300025926 Bacteria 8690
364 Ga0207659_10007353 3300025926 Bacteria 6770
365 Ga0207700_10310842 3300025928 Bacteria 1363
366 Ga0207664_10205838 3300025929 Bacteria 1700
367 Ga0207644_10000635 3300025931 Bacteria 22259
368 Ga0207644_10018202 3300025931 Bacteria 4750
369 Ga0207690_10015082 3300025932 Bacteria 4678
370 Ga0207690_10088566 3300025932 Bacteria 2181
371 Ga0207690_10243710 3300025932 Bacteria 1385
372 Ga0207706_10006012 3300025933 Bacteria 11288
373 Ga0207706_10007598 3300025933 Bacteria 10028
374 Ga0207706_10172123 3300025933 Bacteria 1902
375 Ga0207706_10263616 3300025933 Bacteria 1504
376 Ga0207686_10397110 3300025934 Bacteria 1049
377 Ga0207709_10003779 3300025935 Bacteria 8899
378 Ga0207709_10036106 3300025935 Bacteria 2927
379 Ga0207709_10234604 3300025935 Bacteria 1331
380 Ga0207670_10009447 3300025936 Bacteria 5565
381 Ga0207704_10312482 3300025938 Bacteria 1209
382 Ga0207665_10044072 3300025939 Bacteria 2985
383 Ga0207665_10066712 3300025939 Bacteria 2449
384 Ga0207691_10046267 3300025940 Bacteria 3999
385 Ga0207691_10272737 3300025940 Bacteria 1456
386 Ga0207711_10007617 3300025941 Bacteria 9056
387 Ga0207711_10017006 3300025941 Bacteria 6040
388 Ga0207711_10052692 3300025941 Bacteria 3488
389 Ga0207711_10111481 3300025941 Bacteria 2434
390 Ga0207711_10112369 3300025941 Bacteria 2424
391 Ga0207711_10300554 3300025941 Bacteria 1480
392 Ga0207689_10000851 3300025942 Bacteria 29408
393 Ga0207689_10083483 3300025942 Bacteria 2626
394 Ga0207689_10334793 3300025942 Bacteria 1257
395 Ga0207661_10186763 3300025944 Bacteria 1814
396 Ga0207679_10080361 3300025945 Bacteria 2489
397 Ga0207667_10001534 3300025949 Bacteria 29037
398 Ga0207667_10020346 3300025949 Bacteria 7386
399 Ga0207667_10088391 3300025949 Bacteria 3205
400 Ga0207667_10290172 3300025949 Bacteria 1671
401 Ga0207667_10342249 3300025949 Bacteria 1526
402 Ga0207651_10005276 3300025960 Bacteria 6611
403 Ga0207651_10234740 3300025960 Bacteria 1491
404 Ga0207668_10017458 3300025972 Bacteria 4497
405 Ga0207668_10171495 3300025972 Bacteria 1702
406 Ga0207668_10225366 3300025972 Bacteria 1508
407 Ga0207640_10008428 3300025981 Bacteria 5727
408 Ga0207658_10005671 3300025986 Bacteria 8539
409 Ga0207658_10044094 3300025986 Bacteria 3246
410 Ga0207658_10078687 3300025986 Bacteria 2520
411 Ga0207677_10002592 3300026023 Bacteria 9508
412 Ga0207677_10004596 3300026023 Bacteria 7425
413 Ga0207703_10001221 3300026035 Bacteria 24024
414 Ga0207703_10002171 3300026035 Bacteria 17238
415 Ga0207639_10032577 3300026041 Bacteria 3838
416 Ga0207639_10033688 3300026041 Bacteria 3781
417 Ga0207639_10370530 3300026041 Bacteria 1284
418 Ga0207678_10002602 3300026067 Bacteria 16443
419 Ga0207678_10005562 3300026067 Bacteria 11263
420 Ga0207678_10014518 3300026067 Bacteria 6927
421 Ga0207678_10275414 3300026067 Bacteria 1444
422 Ga0207702_10000024 3300026078 Bacteria 187719
423 Ga0207702_10025016 3300026078 Bacteria 4952
424 Ga0207702_10037987 3300026078 Bacteria 4033
425 Ga0207702_10218662 3300026078 Bacteria 1775
426 Ga0207641_10007137 3300026088 Bacteria 9329
427 Ga0207641_10015891 3300026088 Bacteria 6164
428 Ga0207641_10025598 3300026088 Bacteria 4864
429 Ga0207641_10059408 3300026088 Bacteria 3256
430 Ga0207641_10119471 3300026088 Bacteria 2349
431 Ga0207648_10055361 3300026089 Bacteria 3463
432 Ga0207676_10001143 3300026095 Bacteria 19992
433 Ga0207676_10002759 3300026095 Bacteria 12489
434 Ga0207674_10111134 3300026116 Bacteria 2715
435 Ga0207674_10244119 3300026116 Bacteria 1743
436 Ga0207675_100000246 3300026118 Bacteria 51719
437 Ga0207675_100160268 3300026118 Bacteria 2145
438 Ga0207683_10075611 3300026121 Bacteria 2981
439 Ga0207698_10002713 3300026142 Bacteria 10536
440 Ga0207698_10036635 3300026142 Bacteria 3603
441 Ga0209281_1000002 3300027111 Bacteria 1924012
442 Ga0209371_1000087 3300027312 Bacteria 175021
443 Ga0209371_1000116 3300027312 Bacteria 135524
444 Ga0268266_10035428 3300028379 Bacteria 4245
445 Ga0268266_10052323 3300028379 Bacteria 3507
446 Ga0268266_10113246 3300028379 Bacteria 2406
447 Ga0268265_10111626 3300028380 Bacteria 2233
448 Ga0268265_10179993 3300028380 Bacteria 1815
449 Ga0268265_10350948 3300028380 Bacteria 1347
450 Ga0268264_10061418 3300028381 Bacteria 3152
451 Ga0268264_10067513 3300028381 Bacteria 3019
452 Ga0268264_10128469 3300028381 Bacteria 2243
453 Ga0268264_10486547 3300028381 Bacteria 1201
454 Ga0307515_10012849 3300028794 Bacteria 15712
455 Ga0307515_10067859 3300028794 Bacteria 4911
456 Ga0307515_10110744 3300028794 Bacteria 3210
457 Ga0268256_1000099 3300030500 Bacteria 135508
458 Ga0268256_1000101 3300030500 Bacteria 130956
459 Ga0268256_1006276 3300030500 Bacteria 4456
460 Ga0268256_1041207 3300030500 Bacteria 1033
461 Ga0307511_10064784 3300030521 Bacteria 2743
462 Ga0316177_1054551 3300030731 Bacteria 2281
463 Ga0314311_1206614 3300030733 Bacteria 1486
464 Ga0316180_1095940 3300030736 Bacteria 1465
465 Ga0265325_10005021 3300031241 Bacteria 8233
466 Ga0265340_10097310 3300031247 Bacteria 1370
467 Ga0265316_10116177 3300031344 Bacteria 2023
468 Ga0307513_10195563 3300031456 Bacteria 1869
469 Ga0307513_10287954 3300031456 Bacteria 1416
470 Ga0307513_10318280 3300031456 Bacteria 1315
471 Ga0307508_10000165 3300031616 Bacteria 79729
472 Ga0307516_10002914 3300031730 Bacteria 22412
473 Ga0307406_10689436 3300031901 Bacteria 852
474 Ga0307412_10029815 3300031911 Bacteria 3428
475 Ga0307412_10071852 3300031911 Bacteria 2363
476 Ga0307412_10269163 3300031911 Bacteria 1332
477 Ga0307414_10233223 3300032004 Bacteria 1519
478 Ga0373930_0039127 3300034816 Bacteria 1004
479 Ga0373926_0098907 3300035083 Bacteria 1089
480 Ga0373960_0058618 3300035121 Bacteria 1162
481 Ga0373931_0003648 3300035691 Bacteria 6956
482 Ga0373935_0035714 3300035692 Bacteria 3103
483 Ga0373927_0072545 3300035695 Bacteria 2228
484 Ga0373933_0098457 3300035724 Bacteria 1812
485 Ga0373933_0149437 3300035724 Bacteria 1479
486 Ga0373947_0049489 3300035725 Bacteria 2524
487 Ga0373947_0070779 3300035725 Bacteria 2138
488 Ga0373947_0238841 3300035725 Bacteria 1199
489 Ga0373937_0005178 3300036401 Bacteria 11125
490 Ga0373937_0071547 3300036401 Bacteria 3198
491 Ga0373925_0017299 3300037068 Bacteria 5224
492 Ga0373925_0343357 3300037068 Bacteria 1211
493 Ga0395899_0017047 3300037312 Bacteria 5535
494 Ga0395899_0118360 3300037312 Bacteria 1899
495 Ga0395899_0339022 3300037312 Bacteria 1008
496 Ga0395900_0000998 3300037418 Bacteria 36734
497 Ga0395900_0001932 3300037418 Bacteria 23486
498 Ga0395900_0023039 3300037418 Bacteria 6373
499 Ga0395900_0097106 3300037418 Bacteria 3027
500 Ga0395900_0106418 3300037418 Bacteria 2881
501 Ga0395900_0127341 3300037418 Bacteria 2611
502 Ga0395900_0187762 3300037418 Bacteria 2097
503 Ga0395900_0389204 3300037418 Bacteria 1360
504 Ga0395898_0005979 3300037466 Bacteria 13068
505 Ga0395898_0028249 3300037466 Bacteria 5625
506 Ga0395898_0093348 3300037466 Bacteria 2892
507 Ga0395905_0025506 3300037471 Bacteria 5574
508 Ga0395905_0242263 3300037471 Bacteria 1685
509 Ga0436364_0089680 3300037853 Bacteria 6044
510 Ga0436364_1507036 3300037853 Bacteria 16747
511 Ga0395901_0062422 3300038443 Bacteria 3877
512 Ga0395901_0130199 3300038443 Bacteria 2644
513 Ga0395901_0174947 3300038443 Bacteria 2251
514 Ga0436360_1229390 3300039438 Bacteria 1418
515 Ga0436360_1340739 3300039438 Bacteria 991
516 Ga0436361_0206609 3300039447 Bacteria 1297
517 Ga0436361_0860283 3300039447 Bacteria 9735
518 Ga0436363_0089415 3300039450 Bacteria 951
519 Ga0436363_0134441 3300039450 Bacteria 1365
520 Ga0436363_1009265 3300039450 Bacteria 1170
521 Ga0436363_1058409 3300039450 Bacteria 2462
522 Ga0439436_0041758 3300041404 Bacteria 1312
523 Ga0439436_0082755 3300041404 Bacteria 893
524 Ga0439438_000018 3300041405 Bacteria 123959
525 Ga0439447_002351 3300041407 Bacteria 6910
526 Ga0439465_0000047 3300041413 Bacteria 25399
527 Ga0451853_2911252 3300041512 Bacteria 1718
528 Ga0439445_0024486 3300042004 Bacteria 1535
529 Ga0439432_004844 3300042006 Bacteria 4881
530 Ga0439432_005417 3300042006 Bacteria 4598
531 Ga0439432_081759 3300042006 Bacteria 978
532 Ga0439449_0000733 3300042007 Bacteria 12592
533 Ga0439449_0086835 3300042007 Bacteria 1154
534 Ga0439457_054364 3300042014 Bacteria 902
535 Ga0439435_0051950 3300042436 Bacteria 1176
536 Ga0466986_0050906 3300044650 Bacteria 2861
537 Ga0466972_0000383 3300044658 Bacteria 23678
538 Ga0466972_0003321 3300044658 Bacteria 7977
539 Ga0466972_0008642 3300044658 Bacteria 5107
540 Ga0466972_0069548 3300044658 Bacteria 1681
541 Ga0466977_0341413 3300044666 Bacteria 889
542 Ga0466978_0004514 3300044671 Bacteria 6688
543 Ga0466982_0078684 3300044672 Bacteria 2040
544 Ga0466965_0002658 3300044683 Bacteria 7650
545 Ga0466965_0004602 3300044683 Bacteria 6142
546 Ga0466966_0011654 3300044684 Bacteria 5828
547 Ga0466966_0015152 3300044684 Bacteria 5100
548 Ga0466966_0032955 3300044684 Bacteria 3354
549 Ga0466966_0095977 3300044684 Bacteria 1836
550 Ga0466966_0219617 3300044684 Bacteria 1148
551 Ga0466961_0000435 3300044693 Bacteria 26633
552 Ga0466961_0001155 3300044693 Bacteria 16227
553 Ga0466961_0006348 3300044693 Bacteria 7509
554 Ga0466961_0008481 3300044693 Bacteria 6546
555 Ga0466961_0020151 3300044693 Bacteria 4292
556 Ga0466961_0050122 3300044693 Bacteria 2667
557 Ga0466961_0235301 3300044693 Bacteria 1127
558 Ga0466963_0023494 3300044694 Bacteria 3916
559 Ga0466963_0194140 3300044694 Bacteria 1419
560 Ga0466964_0001045 3300044706 Bacteria 9227
561 Ga0466964_0004022 3300044706 Bacteria 5404
562 Ga0466971_0004162 3300044719 Bacteria 6233
563 Ga0466971_0082607 3300044719 Bacteria 1466
564 Ga0466971_0104013 3300044719 Bacteria 1306
565 Ga0466971_0132501 3300044719 Bacteria 1158
566 Ga0466968_0009639 3300044735 Bacteria 3718
567 Ga0466970_0000271 3300044765 Bacteria 25244
568 Ga0466970_0001247 3300044765 Bacteria 12327
569 Ga0466970_0054294 3300044765 Bacteria 2140
570 Ga0466970_0139850 3300044765 Bacteria 1333
571 Ga0466970_0181355 3300044765 Bacteria 1168
572 Ga0466957_0029076 3300044842 Bacteria 3293
573 Ga0466957_0514796 3300044842 Bacteria 831
574 Ga0466960_0005076 3300044901 Bacteria 5201
575 Ga0466960_0005296 3300044901 Bacteria 5100
576 Ga0466959_0002163 3300045049 Bacteria 12484
577 Ga0466959_0005857 3300045049 Bacteria 8460
578 Ga0466959_0006181 3300045049 Bacteria 8274
579 Ga0451576_0216002 3300045051 Bacteria 2002
580 Ga0451576_0265590 3300045051 Bacteria 1794
581 Ga0466967_0047916 3300045976 Bacteria 3728
582 Ga0466967_0052121 3300045976 Bacteria 3589
583 Ga0495627_026793 3300046453 Bacteria 1855
584 Ga0495627_051776 3300046453 Bacteria 1233
585 Ga0495592_0227265 3300046454 Bacteria 1244
586 Ga0495603_0306290 3300046455 Bacteria 912
587 Ga0495590_0000016 3300046457 Bacteria 225874
588 Ga0495590_0000446 3300046457 Bacteria 20449
589 Ga0495591_021603 3300046458 Bacteria 2096
590 Ga0495629_0001013 3300046459 Bacteria 22585
591 Ga0495629_0183271 3300046459 Bacteria 1451
592 Ga0495638_0000057 3300046460 Bacteria 193690
593 Ga0495638_0004543 3300046460 Bacteria 10509
594 Ga0495638_0006039 3300046460 Bacteria 8862
595 Ga0495638_0007246 3300046460 Bacteria 7973
596 Ga0495638_0008496 3300046460 Bacteria 7278
597 Ga0495638_0011962 3300046460 Bacteria 5966
598 Ga0495638_0059967 3300046460 Bacteria 2354
599 Ga0495651_0087398 3300046462 Bacteria 2344
600 Ga0495653_0001187 3300046463 Bacteria 20147
601 Ga0495653_0159087 3300046463 Bacteria 1570
602 Ga0495650_0000008 3300046471 Bacteria 688246
603 Ga0495650_0000020 3300046471 Bacteria 533839
604 Ga0495650_0000102 3300046471 Bacteria 211007
605 Ga0495650_0000207 3300046471 Bacteria 127568
606 Ga0495650_0001635 3300046471 Bacteria 20815
607 Ga0495650_0002031 3300046471 Bacteria 17703
608 Ga0495650_0013152 3300046471 Bacteria 4397
609 Ga0495650_0152662 3300046471 Bacteria 828
610 Ga0495580_0004501 3300046472 Bacteria 11707
611 Ga0495580_0006470 3300046472 Bacteria 9535
612 Ga0495582_0012292 3300046473 Bacteria 4715
613 Ga0495605_0001958 3300046474 Bacteria 13065
614 Ga0495639_0009356 3300046475 Bacteria 4203
615 Ga0495662_0175723 3300046476 Bacteria 1055
616 Ga0495664_0274766 3300046477 Bacteria 1018
617 Ga0495584_0051005 3300046491 Bacteria 2084
618 Ga0495585_0000162 3300046492 Bacteria 71606
619 Ga0495585_0003423 3300046492 Bacteria 10727
620 Ga0495585_0036768 3300046492 Bacteria 2759
621 Ga0495585_0040404 3300046492 Bacteria 2619
622 Ga0495585_0208285 3300046492 Bacteria 992
623 Ga0495596_0000901 3300046500 Bacteria 17803
624 Ga0495596_0009485 3300046500 Bacteria 4280
625 Ga0495607_0002244 3300046501 Bacteria 15952
626 Ga0495607_0018615 3300046501 Bacteria 4424
627 Ga0495583_0000688 3300046506 Bacteria 43737
628 Ga0495606_0029044 3300046507 Bacteria 3889
629 Ga0495606_0215386 3300046507 Bacteria 1085
630 Ga0495610_0000140 3300046512 Bacteria 80219
631 Ga0495610_0001225 3300046512 Bacteria 23072
632 Ga0495610_0003718 3300046512 Bacteria 11678
633 Ga0495616_0000162 3300046513 Bacteria 58625
634 Ga0495616_0000385 3300046513 Bacteria 34392
635 Ga0495616_0000460 3300046513 Bacteria 30949
636 Ga0495616_0051387 3300046513 Bacteria 2056
637 Ga0495620_0012624 3300046515 Bacteria 4354
638 Ga0495628_0116921 3300046516 Bacteria 2048
639 Ga0495631_0001800 3300046518 Bacteria 12672
640 Ga0495631_0005262 3300046518 Bacteria 6803
641 Ga0495631_0130860 3300046518 Bacteria 1078
642 Ga0495632_0004035 3300046519 Bacteria 10133
643 Ga0495632_0006806 3300046519 Bacteria 7295
644 Ga0495632_0007389 3300046519 Bacteria 6907
645 Ga0495632_0094912 3300046519 Bacteria 1410
646 Ga0495637_0045406 3300046520 Bacteria 1864
647 Ga0495637_0097923 3300046520 Bacteria 1150
648 Ga0495643_0000236 3300046522 Bacteria 83225
649 Ga0495643_0070207 3300046522 Bacteria 1840
650 Ga0495643_0084456 3300046522 Bacteria 1647
651 Ga0495644_0039900 3300046523 Bacteria 1770
652 Ga0495648_0000002 3300046524 Bacteria 593972
653 Ga0495648_0000075 3300046524 Bacteria 129579
654 Ga0495648_0000887 3300046524 Bacteria 31432
655 Ga0495648_0004007 3300046524 Bacteria 12728
656 Ga0495648_0036871 3300046524 Bacteria 3147
657 Ga0495648_0040093 3300046524 Bacteria 2973
658 Ga0495663_0000222 3300046525 Bacteria 22657
659 Ga0495663_0005417 3300046525 Bacteria 3537
660 Ga0495642_0002072 3300046528 Bacteria 8304
661 Ga0495642_0007140 3300046528 Bacteria 4286
662 Ga0495642_0025740 3300046528 Bacteria 2333
663 Ga0495654_0000016 3300046530 Bacteria 306416
664 Ga0495654_0000109 3300046530 Bacteria 93356
665 Ga0495654_0000218 3300046530 Bacteria 53756
666 Ga0495654_0047253 3300046530 Bacteria 2116
667 Ga0495665_0011572 3300046531 Bacteria 4777
668 Ga0495586_0013837 3300046535 Bacteria 4281
669 Ga0495598_0033145 3300046537 Bacteria 1464
670 Ga0495609_0004395 3300046538 Bacteria 7732
671 Ga0495597_0000080 3300046542 Bacteria 84504
672 Ga0495597_0052070 3300046542 Bacteria 1803
673 Ga0495645_0001014 3300046543 Bacteria 19105
674 Ga0495645_0071486 3300046543 Bacteria 2502
675 Ga0495622_0000126 3300046557 Bacteria 66247
676 Ga0495622_0000483 3300046557 Bacteria 25083
677 Ga0495633_0000399 3300046558 Bacteria 45392
678 Ga0495633_0004029 3300046558 Bacteria 9504
679 Ga0495633_0004878 3300046558 Bacteria 8389
680 Ga0495633_0055548 3300046558 Bacteria 1862
681 Ga0495667_0072015 3300046559 Bacteria 2253
682 Ga0495656_0037535 3300046615 Bacteria 2002
683 Ga0495668_0000132 3300046616 Bacteria 112674
684 Ga0495668_0005752 3300046616 Bacteria 8287
685 Ga0495668_0008054 3300046616 Bacteria 6636
686 Ga0495668_0014770 3300046616 Bacteria 4572
687 Ga0495668_0174661 3300046616 Bacteria 1177
688 Ga0495668_0353418 3300046616 Bacteria 806
689 Ga0495611_0016943 3300046648 Bacteria 3115
690 Ga0495611_0044664 3300046648 Bacteria 1982
691 Ga0495625_0000177 3300046660 Bacteria 98918
692 Ga0495625_0001046 3300046660 Bacteria 36303
693 Ga0495625_0004348 3300046660 Bacteria 13457
694 Ga0495625_0026687 3300046660 Bacteria 4360
695 Ga0495625_0169128 3300046660 Bacteria 1460
696 Ga0495625_0181193 3300046660 Bacteria 1400
697 Ga0495625_0185330 3300046660 Bacteria 1381
698 Ga0495625_0233445 3300046660 Bacteria 1200
699 Ga0495588_0014191 3300046674 Bacteria 3810
700 Ga0495658_0063585 3300046683 Bacteria 2124
701 Ga0495658_0430122 3300046683 Bacteria 842
702 Ga0495669_0040677 3300046684 Bacteria 2062
703 Ga0495613_0048684 3300046689 Bacteria 3130
704 Ga0495624_0089967 3300046690 Bacteria 1894
705 Ga0495670_0037656 3300046691 Bacteria 2411
706 Ga0495671_0086563 3300046692 Bacteria 1535
707 Ga0495649_0001590 3300046694 Bacteria 16990
708 Ga0495649_0007521 3300046694 Bacteria 6628
709 Ga0495649_0107798 3300046694 Bacteria 1478
710 Ga0495589_0001219 3300046794 Bacteria 15288
711 Ga0495589_0013071 3300046794 Bacteria 4288
712 Ga0495589_0018900 3300046794 Bacteria 3534
713 Ga0495589_0117340 3300046794 Bacteria 1282
714 Ga0495660_0000006 3300046810 Bacteria 571713
715 Ga0495660_0055576 3300046810 Bacteria 2142
716 Ga0495660_0140348 3300046810 Bacteria 1203
717 Ga0495581_0000534 3300047315 Bacteria 19544
718 Ga0495581_0264524 3300047315 Bacteria 1006
719 Ga0495604_0257653 3300047317 Bacteria 1187
720 Ga0495672_0000003 3300047320 Bacteria 728845
721 Ga0495672_0004568 3300047320 Bacteria 11254
722 Ga0495672_0012193 3300047320 Bacteria 6012
723 Ga0495672_0075902 3300047320 Bacteria 1889
724 Ga0495676_0046612 3300047321 Bacteria 3515
725 Ga0495680_0011827 3300047322 Bacteria 7707
726 Ga0495680_0258390 3300047322 Bacteria 1232
727 Ga0495683_0000072 3300047323 Bacteria 104027
728 Ga0495683_0002629 3300047323 Bacteria 10733
729 Ga0495683_0092087 3300047323 Bacteria 1467
730 Ga0495683_0100117 3300047323 Bacteria 1394
731 Ga0495683_0197899 3300047323 Bacteria 908
732 Ga0495687_039117 3300047443 Bacteria 2101
733 Ga0495675_0062087 3300047444 Bacteria 2366
734 Ga0495677_0140514 3300047445 Bacteria 927
735 Ga0495679_005443 3300047446 Bacteria 5644
736 Ga0495679_006754 3300047446 Bacteria 4890
737 Ga0495673_0000139 3300047469 Bacteria 130652
738 Ga0495673_0000204 3300047469 Bacteria 89887
739 Ga0495673_0000296 3300047469 Bacteria 66691
740 Ga0495673_0000381 3300047469 Bacteria 52869
741 Ga0495673_0001382 3300047469 Bacteria 19531
742 Ga0495673_0001490 3300047469 Bacteria 18517
743 Ga0495681_0032686 3300047470 Bacteria 2616
744 Ga0495681_0038896 3300047470 Bacteria 2327
745 Ga0495684_0249350 3300047471 Bacteria 1292
746 Ga0495684_0424912 3300047471 Bacteria 928
747 Ga0495686_0000932 3300047472 Bacteria 36370
748 Ga0495686_0001131 3300047472 Bacteria 31525
749 Ga0495686_0078903 3300047472 Bacteria 2014
750 Ga0495626_0000985 3300048091 Bacteria 24528
751 Ga0495626_0011297 3300048091 Bacteria 4728
752 Ga0495626_0037972 3300048091 Bacteria 2286
753 Ga0495626_0113074 3300048091 Bacteria 1174
754 Ga0496100_0007795 3300048903 Bacteria 5939
755 Ga0496100_0187892 3300048903 Bacteria 1498
756 Ga0496101_0008396 3300048904 Bacteria 6749
757 Ga0496101_0214875 3300048904 Bacteria 1491
758 Ga0496102_0012755 3300048905 Bacteria 7277
759 Ga0496102_0095663 3300048905 Bacteria 2753
760 Ga0496102_0162264 3300048905 Bacteria 2102
761 Ga0496104_0001453 3300048907 Bacteria 20471
762 Ga0496104_0043071 3300048907 Bacteria 4239
763 Ga0496104_0103788 3300048907 Bacteria 2723
764 Ga0496104_0168388 3300048907 Bacteria 2101
765 Ga0496105_0017664 3300048908 Bacteria 5723
766 Ga0496105_0182466 3300048908 Bacteria 1718
767 Ga0496106_0005946 3300048909 Bacteria 9010
768 Ga0496106_0061377 3300048909 Bacteria 2852
769 Ga0496107_0047588 3300048910 Bacteria 3088
770 Ga0496107_0138529 3300048910 Bacteria 1798
771 Ga0496107_0157598 3300048910 Bacteria 1681
772 Ga0496108_0052815 3300048911 Bacteria 3407
773 Ga0496109_0026177 3300048912 Bacteria 5200
774 Ga0496109_0231886 3300048912 Bacteria 1737
775 Ga0496110_0061421 3300048913 Bacteria 3316
776 Ga0496112_0069091 3300048915 Bacteria 3490
777 Ga0496112_0069093 3300048915 Bacteria 3490
778 Ga0496112_0234241 3300048915 Bacteria 1790
779 Ga0496113_0009831 3300048916 Bacteria 6296
780 Ga0496113_0369185 3300048916 Bacteria 1152
781 Ga0496114_0003425 3300048917 Bacteria 12174
782 Ga0496114_0221129 3300048917 Bacteria 1662
783 Ga0496114_0591727 3300048917 Bacteria 978
784 Ga0496115_0004888 3300048918 Bacteria 9729
785 Ga0496115_0009776 3300048918 Bacteria 7144
786 Ga0496115_0023113 3300048918 Bacteria 4823
787 Ga0496116_0000020 3300048919 Bacteria 501307
788 Ga0496116_0048918 3300048919 Bacteria 2832
789 Ga0496116_0070363 3300048919 Bacteria 2221
790 Ga0496116_0111707 3300048919 Bacteria 1604
791 Ga0496117_0000011 3300048920 Bacteria 610930
792 Ga0496117_0010209 3300048920 Bacteria 8605
793 Ga0496117_0043729 3300048920 Bacteria 3253
794 Ga0496118_0000010 3300048921 Bacteria 610930
795 Ga0496118_0002115 3300048921 Bacteria 27830
796 Ga0496118_0003691 3300048921 Bacteria 18973
797 Ga0496118_0039064 3300048921 Bacteria 3793
798 Ga0496118_0041244 3300048921 Bacteria 3657
799 Ga0496118_0114485 3300048921 Bacteria 1778
800 Ga0496119_0005112 3300048922 Bacteria 12723
801 Ga0496119_0040496 3300048922 Bacteria 2979
802 Ga0496120_0002102 3300048923 Bacteria 21316
803 Ga0496120_0004002 3300048923 Bacteria 12809
804 Ga0496121_0002051 3300048924 Bacteria 31889
805 Ga0496121_0002266 3300048924 Bacteria 29939
806 Ga0496121_0004661 3300048924 Bacteria 18211
807 Ga0496121_0118184 3300048924 Bacteria 2007
808 Ga0496122_0000010 3300048925 Bacteria 547417
809 Ga0496122_0000049 3300048925 Bacteria 268493
810 Ga0496122_0003675 3300048925 Bacteria 19902
811 Ga0496123_0000042 3300048926 Bacteria 254481
812 Ga0496123_0000061 3300048926 Bacteria 220856
813 Ga0496123_0002948 3300048926 Bacteria 19877
814 Ga0496124_0000084 3300048927 Bacteria 204993
815 Ga0496124_0003222 3300048927 Bacteria 20166
816 Ga0496124_0011365 3300048927 Bacteria 8903
817 Ga0496124_0218820 3300048927 Bacteria 1434
818 Ga0496125_0000071 3300048928 Bacteria 243580
819 Ga0496125_0002526 3300048928 Bacteria 23616
820 Ga0496125_0003276 3300048928 Bacteria 19912
821 Ga0496125_0012791 3300048928 Bacteria 8296
822 Ga0496125_0089187 3300048928 Bacteria 2320
823 Ga0496126_0002615 3300048929 Bacteria 23994
824 Ga0496126_0078412 3300048929 Bacteria 2927
825 Ga0495678_001063 3300049459 Bacteria 23279
826 Ga0495678_001782 3300049459 Bacteria 15920
827 Ga0495678_007026 3300049459 Bacteria 5900
828 Ga0495682_0000017 3300049460 Bacteria 233333
829 Ga0501292_003979 3300049515 Bacteria 2001
830 Ga0501031_0245443 3300049568 Bacteria 1164
831 Ga0501032_0029712 3300049569 Bacteria 3749
832 Ga0501032_0066054 3300049569 Bacteria 2418
833 Ga0501032_0238738 3300049569 Bacteria 1181
834 Ga0501033_0000347 3300049570 Bacteria 44046
835 Ga0501034_0003664 3300049571 Bacteria 17373
836 Ga0501034_0298752 3300049571 Bacteria 1547
837 Ga0501036_0677602 3300049572 Bacteria 853
838 Ga0501037_0041992 3300049573 Bacteria 3362
839 Ga0501038_0142624 3300049574 Bacteria 1959
840 Ga0501039_0519036 3300049575 Bacteria 935
841 Ga0501042_0170219 3300049578 Bacteria 1572
842 Ga0501042_0404438 3300049578 Bacteria 989
843 Ga0501043_0000012 3300049579 Bacteria 188907
844 Ga0501043_0192051 3300049579 Bacteria 1587
845 Ga0501043_0204213 3300049579 Bacteria 1533
846 Ga0501043_0276561 3300049579 Bacteria 1288
847 Ga0501046_0000030 3300049580 Bacteria 187803
848 Ga0501046_0068046 3300049580 Bacteria 2772
849 Ga0501047_0000049 3300049581 Bacteria 162513
850 Ga0501047_0036949 3300049581 Bacteria 4721
851 Ga0501048_0000489 3300049582 Bacteria 27704
852 Ga0501074_0338117 3300049590 Bacteria 1069
853 Ga0501076_0472752 3300049592 Bacteria 1033
854 Ga0501225_0001420 3300049705 Bacteria 7480
855 Ga0501079_0519090 3300049741 Bacteria 937
856 Ga0501035_0009229 3300049822 Bacteria 9172
857 Ga0501035_0076485 3300049822 Bacteria 2960
858 Ga0501035_0243236 3300049822 Bacteria 1530
859 Ga0501035_0499453 3300049822 Bacteria 1001
860 Ga0501045_0028055 3300049824 Bacteria 4059
861 nmdc:mga03683_30766_c1 3300050489 Bacteria 2149
862 nmdc:mga0k408_177583_c1 3300050493 Bacteria 1270
863 nmdc:mga0k408_66252_c1 3300050493 Bacteria 2104
864 nmdc:mga06z11_237095_c1 3300050494 Bacteria 1070
865 nmdc:mga05p37_327008_c1 3300050507 Bacteria 1812
866 nmdc:mga05p37_358905_c1 3300050507 Bacteria 1714
867 nmdc:mga09592_16638_c1 3300050508 Bacteria 6019
868 nmdc:mga0n895_135888_c1 3300050512 Bacteria 2485
869 nmdc:mga08x19_316610_c1 3300050514 Bacteria 1085
870 nmdc:mga0a205_250823_c1 3300050515 Bacteria 1649
871 nmdc:mga0sz30_33874_c1 3300050516 Bacteria 2124
872 Ga0500635_0004059 3300053080 Bacteria 3740
873 Ga0500578_0000410 3300053086 Bacteria 52417
874 Ga0500578_0199438 3300053086 Bacteria 1225
875 Ga0500643_007338 3300053087 Bacteria 4466
876 Ga0500644_0000005 3300053088 Bacteria 164966
877 Ga0500644_0000154 3300053088 Bacteria 42962
878 Ga0500644_0000245 3300053088 Bacteria 30821
879 Ga0500644_0001693 3300053088 Bacteria 5747
880 Ga0500644_0091665 3300053088 Bacteria 1138
881 Ga0500555_057413 3300053103 Bacteria 1053
882 Ga0500562_000208 3300053108 Bacteria 15909
883 Ga0500594_0000040 3300053118 Bacteria 42492
884 Ga0500594_0000116 3300053118 Bacteria 22601
885 Ga0500608_000004 3300053122 Bacteria 108109
886 Ga0500608_000030 3300053122 Bacteria 66677
887 Ga0500618_000145 3300053125 Bacteria 58724
888 Ga0500618_001635 3300053125 Bacteria 9657
889 Ga0500658_0018052 3300053134 Bacteria 2641
890 Ga0500658_0253443 3300053134 Bacteria 809
891 Ga0500559_0000007 3300053136 Bacteria 226236
892 Ga0500559_0038802 3300053136 Bacteria 2070
893 Ga0500559_0210212 3300053136 Bacteria 918
894 Ga0500564_000013 3300053138 Bacteria 54100
895 Ga0500564_000064 3300053138 Bacteria 28288
896 Ga0500564_000231 3300053138 Bacteria 15524
897 Ga0500568_0009425 3300053139 Bacteria 4642
898 Ga0500577_0000585 3300053142 Bacteria 9396
899 Ga0500577_0125023 3300053142 Bacteria 1073
900 Ga0500590_024655 3300053148 Bacteria 3122
901 Ga0500622_0000261 3300053156 Bacteria 53821
902 Ga0500622_0000865 3300053156 Bacteria 25784
903 Ga0500622_0016413 3300053156 Bacteria 3958
904 Ga0500627_0000181 3300053158 Bacteria 18431
905 Ga0500634_0005909 3300053161 Bacteria 5867
906 Ga0500645_001952 3300053730 Bacteria 9769
907 Ga0500645_006464 3300053730 Bacteria 4179
908 Ga0500609_000047 3300053731 Bacteria 16050
909 Ga0587067_030828 3300059640 Bacteria 988
910 Ga0501082_0509560 3300060353 Bacteria 1052
911 Ga0466962_0005043 3300061719 Bacteria 6351
912 Ga0466962_0012718 3300061719 Bacteria 4049
913 Ga0466962_0060604 3300061719 Bacteria 1806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0017047 Ga0395899_0017047_1836_2576 212
2 3300035724 Ga0373933_0149437 Ga0373933_0149437_302_1108 213
3 3300036401 Ga0373937_0005178 Ga0373937_0005178_5690_6496 213
4 3300046454 Ga0495592_0227265 Ga0495592_0227265_243_1049 213
5 3300046543 Ga0495645_0071486 Ga0495645_0071486_104_910 213
6 3300047322 Ga0495680_0011827 Ga0495680_0011827_2601_3407 213
7 3300005614 Ga0068856_100150441 Ga0068856_1001504412 214
8 3300025929 Ga0207664_10205838 Ga0207664_102058382 214
9 3300025935 Ga0207709_10003779 Ga0207709_1000377910 214
10 3300026078 Ga0207702_10218662 Ga0207702_102186622 214
11 3300049568 Ga0501031_0245443 Ga0501031_0245443_26_676 214
12 3300013297 Ga0157378_10481226 Ga0157378_104812262 215
13 3300014325 Ga0163163_10056883 Ga0163163_100568832 215
14 3300037418 Ga0395900_0106418 Ga0395900_0106418_865_1605 215
15 3300037466 Ga0395898_0028249 Ga0395898_0028249_3484_4224 215
16 3300035725 Ga0373947_0049489 Ga0373947_0049489_11_817 216
17 3300046462 Ga0495651_0087398 Ga0495651_0087398_732_1538 216
18 3300046463 Ga0495653_0159087 Ga0495653_0159087_647_1453 216
19 3300047471 Ga0495684_0249350 Ga0495684_0249350_301_1107 216
20 3300048922 Ga0496119_0005112 Ga0496119_0005112_1750_2496 216
21 3300048923 Ga0496120_0004002 Ga0496120_0004002_10051_10797 216
22 3300048927 Ga0496124_0003222 Ga0496124_0003222_9209_9955 216
23 3300003856 Ga0058692_1000054 Ga0058692_100005443 217
24 3300027312 Ga0209371_1000116 Ga0209371_100011653 217
25 3300030500 Ga0268256_1000099 Ga0268256_100009971 217
26 3300005366 Ga0070659_100471499 Ga0070659_1004714992 218
27 3300009011 Ga0105251_10000362 Ga0105251_1000036244 218
28 3300025735 Ga0207713_1000429 Ga0207713_100042943 218
29 3300031911 Ga0307412_10269163 Ga0307412_102691632 218
30 3300005457 Ga0070662_100003027 Ga0070662_1000030274 219
31 3300005563 Ga0068855_100023793 Ga0068855_1000237933 219
32 3300013100 Ga0157373_10019006 Ga0157373_100190062 219
33 3300025933 Ga0207706_10006012 Ga0207706_100060125 219
34 3300025949 Ga0207667_10020346 Ga0207667_100203464 219
35 3300046525 Ga0495663_0005417 Ga0495663_0005417_60_740 221
36 3300005436 Ga0070713_100017602 Ga0070713_1000176024 223
37 3300006028 Ga0070717_10326679 Ga0070717_103266792 223
38 3300009148 Ga0105243_10138716 Ga0105243_101387162 225
39 3300048925 Ga0496122_0000049 Ga0496122_0000049_39496_40242 225
40 3300048926 Ga0496123_0000042 Ga0496123_0000042_214240_214986 225
41 3300005331 Ga0070670_100000709 Ga0070670_1000007099 227
42 3300025925 Ga0207650_10000841 Ga0207650_100008418 227
43 3300048921 Ga0496118_0041244 Ga0496118_0041244_2227_2973 227
44 3300005841 Ga0068863_100939432 Ga0068863_1009394321 229
45 3300048091 Ga0495626_0113074 Ga0495626_0113074_67_816 229
46 3300035083 Ga0373926_0098907 Ga0373926_0098907_86_835 232
47 3300035692 Ga0373935_0035714 Ga0373935_0035714_1121_1870 232
48 3300035695 Ga0373927_0072545 Ga0373927_0072545_1081_1830 232
49 3300035724 Ga0373933_0098457 Ga0373933_0098457_636_1385 232
50 3300035725 Ga0373947_0070779 Ga0373947_0070779_36_785 232
51 3300036401 Ga0373937_0071547 Ga0373937_0071547_349_1098 232
52 3300037068 Ga0373925_0343357 Ga0373925_0343357_267_1016 232
53 3300046459 Ga0495629_0183271 Ga0495629_0183271_667_1416 232
54 3300046477 Ga0495664_0274766 Ga0495664_0274766_10_759 232
55 3300046683 Ga0495658_0430122 Ga0495658_0430122_74_823 232
56 3300049705 Ga0501225_0001420 Ga0501225_0001420_587_1306 232
57 3300005842 Ga0068858_100758041 Ga0068858_1007580411 233
58 3300007076 Ga0075435_100365409 Ga0075435_1003654092 233
59 3300049569 Ga0501032_0066054 Ga0501032_0066054_893_1681 233
60 3300049578 Ga0501042_0404438 Ga0501042_0404438_182_970 233
61 3300049579 Ga0501043_0000012 Ga0501043_0000012_27242_28030 233
62 3300049580 Ga0501046_0000030 Ga0501046_0000030_27214_28002 233
63 3300049581 Ga0501047_0000049 Ga0501047_0000049_1911_2699 233
64 3300049582 Ga0501048_0000489 Ga0501048_0000489_3123_3911 233
65 3300049824 Ga0501045_0028055 Ga0501045_0028055_1063_1851 233
66 3300037068 Ga0373925_0017299 Ga0373925_0017299_4444_5193 234
67 3300047317 Ga0495604_0257653 Ga0495604_0257653_34_783 234
68 3300049572 Ga0501036_0677602 Ga0501036_0677602_66_800 236
69 iso_pu_bacteria 2582581280 2585153536 237
70 iso_pu_bacteria 2582581293 2585197340 237
71 iso_pu_bacteria 2643221552 2643780236 237
72 iso_pu_bacteria 2643221584 2643928569 237
73 iso_pu_bacteria 2791355091 2792622457 237
74 iso_pu_bacteria 2818991435 2819540027 237
75 iso_pu_bacteria 2818991454 2819648973 237
76 iso_pu_bacteria 2818991457 2819661585 237
77 iso_pu_bacteria 2852684882 2852688174 237
78 iso_pu_bacteria 2919130084 2919134492 237
79 iso_pu_bacteria 2929195423 2929199596 237
80 iso_pu_bacteria 8021622325 8021623426 237
81 iso_pu_bacteria 8021626552 8021629241 237
82 iso_pu_bacteria 8021648035 8021648714 237
83 3300039447 Ga0436361_0206609 Ga0436361_0206609_174_920 238
84 3300046453 Ga0495627_026793 Ga0495627_026793_458_1201 238
85 3300046558 Ga0495633_0004878 Ga0495633_0004878_2166_2909 238
86 3300053161 Ga0500634_0005909 Ga0500634_0005909_533_1276 238
87 iso_pu_bacteria 2582581280 2585153296 238
88 iso_pu_bacteria 2582581293 2585196985 238
89 iso_pu_bacteria 2643221552 2643778924 238
90 iso_pu_bacteria 2643221584 2643930556 238
91 iso_pu_bacteria 2818991435 2819539227 238
92 iso_pu_bacteria 2818991454 2819648258 238
93 iso_pu_bacteria 2849560528 2849562955 238
94 iso_pu_bacteria 2849573788 2849573931 238
95 iso_pu_bacteria 2851153111 2851155571 238
96 iso_pu_bacteria 2857504554 2857509004 238
97 iso_pu_bacteria 2898329390 2898333672 238
98 iso_pu_bacteria 8054302542 8054303003 238
99 3300003215 JGI25153J46596_10033239 JGI25153J46596_100332391 239
100 3300003794 Ga0055531_10007156 Ga0055531_100071562 239
101 3300005355 Ga0070671_100009724 Ga0070671_1000097245 239
102 3300005367 Ga0070667_100006541 Ga0070667_1000065415 239
103 3300005544 Ga0070686_100038490 Ga0070686_1000384902 239
104 3300005548 Ga0070665_100033725 Ga0070665_1000337254 239
105 3300005617 Ga0068859_100000211 Ga0068859_10000021132 239
106 3300005841 Ga0068863_100003996 Ga0068863_1000039967 239
107 3300005842 Ga0068858_100005568 Ga0068858_1000055684 239
108 3300005843 Ga0068860_100004169 Ga0068860_10000416911 239
109 3300006353 Ga0075370_10081948 Ga0075370_100819481 239
110 3300006931 Ga0097620_100000211 Ga0097620_10000021132 239
111 3300006948 Ga0099826_10198776 Ga0099826_101987762 239
112 3300009092 Ga0105250_10003540 Ga0105250_100035402 239
113 3300009101 Ga0105247_10000260 Ga0105247_1000026014 239
114 3300009174 Ga0105241_10076924 Ga0105241_100769243 239
115 3300009177 Ga0105248_10001076 Ga0105248_100010767 239
116 3300009553 Ga0105249_10020152 Ga0105249_100201524 239
117 3300009978 Ga0105148_100701 Ga0105148_1007012 239
118 3300013306 Ga0163162_10096375 Ga0163162_100963752 239
119 3300014325 Ga0163163_10049693 Ga0163163_100496932 239
120 3300014968 Ga0157379_10007683 Ga0157379_100076833 239
121 3300025230 Ga0209563_105221 Ga0209563_1052212 239
122 3300025297 Ga0209758_1000571 Ga0209758_100057142 239
123 3300025298 Ga0209050_1021417 Ga0209050_10214172 239
124 3300025304 Ga0209257_1000687 Ga0209257_100068714 239
125 3300025900 Ga0207710_10000322 Ga0207710_1000032229 239
126 3300025914 Ga0207671_10085457 Ga0207671_100854572 239
127 3300025931 Ga0207644_10018202 Ga0207644_100182024 239
128 3300025941 Ga0207711_10052692 Ga0207711_100526923 239
129 3300025986 Ga0207658_10044094 Ga0207658_100440943 239
130 3300026035 Ga0207703_10002171 Ga0207703_1000217111 239
131 3300026088 Ga0207641_10007137 Ga0207641_100071376 239
132 3300028379 Ga0268266_10035428 Ga0268266_100354282 239
133 3300028381 Ga0268264_10128469 Ga0268264_101284692 239
134 3300030733 Ga0314311_1206614 Ga0314311_12066142 239
135 3300031456 Ga0307513_10287954 Ga0307513_102879541 239
136 3300037418 Ga0395900_0127341 Ga0395900_0127341_235_981 239
137 3300037418 Ga0395900_0187762 Ga0395900_0187762_654_1400 239
138 3300037466 Ga0395898_0005979 Ga0395898_0005979_1917_2663 239
139 3300037471 Ga0395905_0242263 Ga0395905_0242263_786_1532 239
140 3300038443 Ga0395901_0174947 Ga0395901_0174947_655_1401 239
141 3300041413 Ga0439465_0000047 Ga0439465_0000047_1754_2515 239
142 3300042004 Ga0439445_0024486 Ga0439445_0024486_460_1221 239
143 3300042007 Ga0439449_0000733 Ga0439449_0000733_4004_4765 239
144 3300042014 Ga0439457_054364 Ga0439457_054364_122_868 239
145 3300044693 Ga0466961_0020151 Ga0466961_0020151_3330_4076 239
146 3300044693 Ga0466961_0050122 Ga0466961_0050122_909_1649 239
147 3300044694 Ga0466963_0194140 Ga0466963_0194140_335_1081 239
148 3300044719 Ga0466971_0132501 Ga0466971_0132501_227_973 239
149 3300044842 Ga0466957_0514796 Ga0466957_0514796_50_796 239
150 3300045049 Ga0466959_0005857 Ga0466959_0005857_68_814 239
151 3300046471 Ga0495650_0152662 Ga0495650_0152662_66_791 239
152 3300046513 Ga0495616_0051387 Ga0495616_0051387_143_889 239
153 3300046524 Ga0495648_0000075 Ga0495648_0000075_61111_61836 239
154 3300046525 Ga0495663_0000222 Ga0495663_0000222_16686_17432 239
155 3300046530 Ga0495654_0047253 Ga0495654_0047253_689_1435 239
156 3300046616 Ga0495668_0014770 Ga0495668_0014770_488_1213 239
157 3300046810 Ga0495660_0055576 Ga0495660_0055576_1088_1813 239
158 3300046810 Ga0495660_0140348 Ga0495660_0140348_226_951 239
159 3300047469 Ga0495673_0000139 Ga0495673_0000139_41509_42234 239
160 3300047469 Ga0495673_0001382 Ga0495673_0001382_5296_6021 239
161 3300048905 Ga0496102_0162264 Ga0496102_0162264_326_1072 239
162 3300048915 Ga0496112_0069093 Ga0496112_0069093_1964_2710 239
163 3300048924 Ga0496121_0002051 Ga0496121_0002051_28497_29243 239
164 3300048928 Ga0496125_0012791 Ga0496125_0012791_2950_3696 239
165 3300049570 Ga0501033_0000347 Ga0501033_0000347_35496_36245 239
166 3300049571 Ga0501034_0003664 Ga0501034_0003664_5235_5960 239
167 3300049571 Ga0501034_0298752 Ga0501034_0298752_594_1319 239
168 3300049579 Ga0501043_0192051 Ga0501043_0192051_484_1209 239
169 3300049822 Ga0501035_0499453 Ga0501035_0499453_165_890 239
170 3300050494 nmdc:mga06z11_237095_c1 nmdc:mga06z11_237095_c1_281_1027 239
171 3300053088 Ga0500644_0000005 Ga0500644_0000005_57609_58334 239
172 3300053134 Ga0500658_0253443 Ga0500658_0253443_36_782 239
173 3300053138 Ga0500564_000013 Ga0500564_000013_19408_20133 239
174 3300053142 Ga0500577_0000585 Ga0500577_0000585_6306_7031 239
175 3300053142 Ga0500577_0125023 Ga0500577_0125023_55_801 239
176 iso_pu_bacteria 2582581279 2585149037 239
177 iso_pu_bacteria 2747842501 2748017759 239
178 3300003781 Ga0055536_1000057 Ga0055536_100005775 240
179 3300003791 Ga0055530_10002520 Ga0055530_100025206 240
180 3300003794 Ga0055531_10000053 Ga0055531_10000053102 240
181 3300003794 Ga0055531_10000224 Ga0055531_1000022462 240
182 3300003794 Ga0055531_10001089 Ga0055531_1000108910 240
183 3300003794 Ga0055531_10002666 Ga0055531_100026665 240
184 3300005262 Ga0065165_1000660 Ga0065165_100066011 240
185 3300005981 Ga0081538_10003998 Ga0081538_100039987 240
186 3300006353 Ga0075370_10028358 Ga0075370_100283584 240
187 3300025292 Ga0209676_1000031 Ga0209676_1000031211 240
188 3300025295 Ga0209564_1001441 Ga0209564_100144120 240
189 3300025297 Ga0209758_1006173 Ga0209758_10061735 240
190 3300025298 Ga0209050_1000087 Ga0209050_100008761 240
191 3300025298 Ga0209050_1011531 Ga0209050_10115313 240
192 3300025299 Ga0209256_1000694 Ga0209256_100069419 240
193 3300025304 Ga0209257_1000050 Ga0209257_1000050219 240
194 3300025304 Ga0209257_1000326 Ga0209257_100032628 240
195 3300028794 Ga0307515_10012849 Ga0307515_1001284913 240
196 3300028794 Ga0307515_10067859 Ga0307515_100678593 240
197 3300028794 Ga0307515_10110744 Ga0307515_101107443 240
198 3300042436 Ga0439435_0051950 Ga0439435_0051950_429_1157 240
199 3300046457 Ga0495590_0000446 Ga0495590_0000446_11449_12177 240
200 3300046460 Ga0495638_0008496 Ga0495638_0008496_4719_5447 240
201 3300046460 Ga0495638_0059967 Ga0495638_0059967_1139_1867 240
202 3300046471 Ga0495650_0000020 Ga0495650_0000020_31963_32691 240
203 3300046471 Ga0495650_0000207 Ga0495650_0000207_59611_60339 240
204 3300046512 Ga0495610_0000140 Ga0495610_0000140_22370_23098 240
205 3300046512 Ga0495610_0001225 Ga0495610_0001225_9320_10048 240
206 3300046512 Ga0495610_0003718 Ga0495610_0003718_10568_11296 240
207 3300046513 Ga0495616_0000385 Ga0495616_0000385_8824_9552 240
208 3300046513 Ga0495616_0000460 Ga0495616_0000460_16319_17047 240
209 3300046515 Ga0495620_0012624 Ga0495620_0012624_55_783 240
210 3300046518 Ga0495631_0001800 Ga0495631_0001800_3187_3915 240
211 3300046518 Ga0495631_0005262 Ga0495631_0005262_668_1396 240
212 3300046519 Ga0495632_0007389 Ga0495632_0007389_4202_4930 240
213 3300046519 Ga0495632_0094912 Ga0495632_0094912_312_1040 240
214 3300046520 Ga0495637_0045406 Ga0495637_0045406_166_894 240
215 3300046522 Ga0495643_0070207 Ga0495643_0070207_423_1151 240
216 3300046523 Ga0495644_0039900 Ga0495644_0039900_518_1246 240
217 3300046524 Ga0495648_0000887 Ga0495648_0000887_4910_5638 240
218 3300046524 Ga0495648_0004007 Ga0495648_0004007_11511_12239 240
219 3300046524 Ga0495648_0036871 Ga0495648_0036871_2366_3094 240
220 3300046530 Ga0495654_0000016 Ga0495654_0000016_245717_246445 240
221 3300046530 Ga0495654_0000109 Ga0495654_0000109_92542_93270 240
222 3300046558 Ga0495633_0055548 Ga0495633_0055548_971_1699 240
223 3300046616 Ga0495668_0005752 Ga0495668_0005752_813_1541 240
224 3300046660 Ga0495625_0001046 Ga0495625_0001046_10203_10931 240
225 3300046660 Ga0495625_0004348 Ga0495625_0004348_12670_13398 240
226 3300046660 Ga0495625_0169128 Ga0495625_0169128_361_1089 240
227 3300046660 Ga0495625_0181193 Ga0495625_0181193_136_864 240
228 3300046660 Ga0495625_0185330 Ga0495625_0185330_293_1021 240
229 3300046660 Ga0495625_0233445 Ga0495625_0233445_331_1059 240
230 3300046692 Ga0495671_0086563 Ga0495671_0086563_67_795 240
231 3300046794 Ga0495589_0018900 Ga0495589_0018900_1349_2077 240
232 3300047320 Ga0495672_0004568 Ga0495672_0004568_10395_11123 240
233 3300047320 Ga0495672_0012193 Ga0495672_0012193_520_1248 240
234 3300047323 Ga0495683_0092087 Ga0495683_0092087_634_1362 240
235 3300047469 Ga0495673_0000204 Ga0495673_0000204_33454_34182 240
236 3300047469 Ga0495673_0000296 Ga0495673_0000296_65441_66169 240
237 3300047469 Ga0495673_0000381 Ga0495673_0000381_27770_28498 240
238 3300047469 Ga0495673_0001490 Ga0495673_0001490_15591_16319 240
239 3300047470 Ga0495681_0038896 Ga0495681_0038896_632_1360 240
240 3300047472 Ga0495686_0000932 Ga0495686_0000932_2492_3220 240
241 3300047472 Ga0495686_0001131 Ga0495686_0001131_749_1477 240
242 3300048927 Ga0496124_0011365 Ga0496124_0011365_5177_5905 240
243 3300048929 Ga0496126_0078412 Ga0496126_0078412_2180_2908 240
244 3300049459 Ga0495678_001063 Ga0495678_001063_12454_13182 240
245 3300049459 Ga0495678_001782 Ga0495678_001782_13881_14609 240
246 3300050516 nmdc:mga0sz30_33874_c1 nmdc:mga0sz30_33874_c1_44_772 240
247 3300053080 Ga0500635_0004059 Ga0500635_0004059_2474_3202 240
248 3300053086 Ga0500578_0000410 Ga0500578_0000410_9367_10095 240
249 3300053088 Ga0500644_0000154 Ga0500644_0000154_21765_22493 240
250 3300053088 Ga0500644_0000245 Ga0500644_0000245_14737_15465 240
251 3300053088 Ga0500644_0001693 Ga0500644_0001693_4618_5346 240
252 3300053088 Ga0500644_0091665 Ga0500644_0091665_53_781 240
253 3300053103 Ga0500555_057413 Ga0500555_057413_226_954 240
254 3300053108 Ga0500562_000208 Ga0500562_000208_3610_4338 240
255 3300053118 Ga0500594_0000040 Ga0500594_0000040_40498_41226 240
256 3300053118 Ga0500594_0000116 Ga0500594_0000116_18795_19523 240
257 3300053122 Ga0500608_000004 Ga0500608_000004_49477_50205 240
258 3300053125 Ga0500618_000145 Ga0500618_000145_16376_17104 240
259 3300053136 Ga0500559_0000007 Ga0500559_0000007_173211_173939 240
260 3300053136 Ga0500559_0038802 Ga0500559_0038802_354_1082 240
261 3300053136 Ga0500559_0210212 Ga0500559_0210212_26_754 240
262 3300053138 Ga0500564_000064 Ga0500564_000064_12245_12973 240
263 3300053138 Ga0500564_000231 Ga0500564_000231_7490_8218 240
264 3300053156 Ga0500622_0000261 Ga0500622_0000261_41151_41879 240
265 3300053156 Ga0500622_0000865 Ga0500622_0000865_16020_16748 240
266 3300053156 Ga0500622_0016413 Ga0500622_0016413_188_916 240
267 3300053158 Ga0500627_0000181 Ga0500627_0000181_16948_17676 240
268 3300053730 Ga0500645_001952 Ga0500645_001952_3448_4176 240
269 3300053731 Ga0500609_000047 Ga0500609_000047_835_1563 240
270 3300003323 rootH1_10009674 rootH1_100096742 241
271 3300005328 Ga0070676_10015199 Ga0070676_100151991 241
272 3300005337 Ga0070682_100067114 Ga0070682_1000671142 241
273 3300005339 Ga0070660_100003037 Ga0070660_1000030377 241
274 3300005347 Ga0070668_100127176 Ga0070668_1001271762 241
275 3300005365 Ga0070688_100223244 Ga0070688_1002232442 241
276 3300005434 Ga0070709_10036865 Ga0070709_100368653 241
277 3300005445 Ga0070708_100013868 Ga0070708_1000138682 241
278 3300005459 Ga0068867_100352825 Ga0068867_1003528251 241
279 3300005467 Ga0070706_100001937 Ga0070706_10000193711 241
280 3300005536 Ga0070697_100000588 Ga0070697_10000058815 241
281 3300005543 Ga0070672_100310739 Ga0070672_1003107392 241
282 3300005563 Ga0068855_100111463 Ga0068855_1001114633 241
283 3300005563 Ga0068855_100200920 Ga0068855_1002009202 241
284 3300005843 Ga0068860_100114978 Ga0068860_1001149781 241
285 3300005843 Ga0068860_100140715 Ga0068860_1001407152 241
286 3300006173 Ga0070716_100074489 Ga0070716_1000744892 241
287 3300006844 Ga0075428_100017228 Ga0075428_10001722810 241
288 3300009093 Ga0105240_10008279 Ga0105240_100082797 241
289 3300009174 Ga0105241_10014103 Ga0105241_100141031 241
290 3300009177 Ga0105248_10057587 Ga0105248_100575875 241
291 3300009545 Ga0105237_10420200 Ga0105237_104202001 241
292 3300010375 Ga0105239_10039116 Ga0105239_100391163 241
293 3300010375 Ga0105239_10230802 Ga0105239_102308022 241
294 3300013297 Ga0157378_10573406 Ga0157378_105734061 241
295 3300013297 Ga0157378_10577245 Ga0157378_105772452 241
296 3300013308 Ga0157375_10168640 Ga0157375_101686403 241
297 3300025261 Ga0209233_1000026 Ga0209233_1000026296 241
298 3300025295 Ga0209564_1017308 Ga0209564_10173084 241
299 3300025906 Ga0207699_10086395 Ga0207699_100863952 241
300 3300025907 Ga0207645_10235203 Ga0207645_102352032 241
301 3300025910 Ga0207684_10005804 Ga0207684_100058047 241
302 3300025919 Ga0207657_10003643 Ga0207657_100036433 241
303 3300025932 Ga0207690_10243710 Ga0207690_102437102 241
304 3300025939 Ga0207665_10066712 Ga0207665_100667122 241
305 3300025949 Ga0207667_10088391 Ga0207667_100883913 241
306 3300025949 Ga0207667_10342249 Ga0207667_103422492 241
307 3300025972 Ga0207668_10171495 Ga0207668_101714952 241
308 3300028380 Ga0268265_10111626 Ga0268265_101116263 241
309 3300028380 Ga0268265_10350948 Ga0268265_103509482 241
310 3300030521 Ga0307511_10064784 Ga0307511_100647842 241
311 3300031616 Ga0307508_10000165 Ga0307508_1000016572 241
312 3300037312 Ga0395899_0118360 Ga0395899_0118360_369_1109 241
313 3300037418 Ga0395900_0389204 Ga0395900_0389204_241_981 241
314 3300037466 Ga0395898_0093348 Ga0395898_0093348_578_1318 241
315 3300037471 Ga0395905_0025506 Ga0395905_0025506_974_1714 241
316 3300038443 Ga0395901_0062422 Ga0395901_0062422_578_1318 241
317 3300046460 Ga0495638_0004543 Ga0495638_0004543_9473_10216 241
318 3300046460 Ga0495638_0006039 Ga0495638_0006039_7870_8619 241
319 3300046472 Ga0495580_0006470 Ga0495580_0006470_7351_8094 241
320 3300046492 Ga0495585_0040404 Ga0495585_0040404_201_932 241
321 3300046513 Ga0495616_0000162 Ga0495616_0000162_51575_52318 241
322 3300046519 Ga0495632_0004035 Ga0495632_0004035_254_997 241
323 3300046616 Ga0495668_0008054 Ga0495668_0008054_1419_2162 241
324 3300047472 Ga0495686_0078903 Ga0495686_0078903_377_1126 241
325 3300048907 Ga0496104_0168388 Ga0496104_0168388_550_1293 241
326 3300048915 Ga0496112_0234241 Ga0496112_0234241_142_885 241
327 3300050493 nmdc:mga0k408_177583_c1 nmdc:mga0k408_177583_c1_375_1127 241
328 3300053122 Ga0500608_000030 Ga0500608_000030_19845_20600 241
329 iso_pu_bacteria 2643221695 2644529309 241
330 3300001979 JGI24740J21852_10000445 JGI24740J21852_1000044516 242
331 3300003756 Ga0055533_1006178 Ga0055533_10061782 242
332 3300003758 Ga0055532_1000127 Ga0055532_10001277 242
333 3300003760 Ga0055527_1001540 Ga0055527_10015404 242
334 3300003761 Ga0055535_1000140 Ga0055535_10001407 242
335 3300003841 Ga0055541_1011678 Ga0055541_10116782 242
336 3300005344 Ga0070661_100000119 Ga0070661_10000011943 242
337 3300005455 Ga0070663_100000035 Ga0070663_10000003551 242
338 3300005564 Ga0070664_100000008 Ga0070664_100000008169 242
339 3300005578 Ga0068854_100012088 Ga0068854_1000120881 242
340 3300005614 Ga0068856_100000862 Ga0068856_10000086229 242
341 3300006946 Ga0079104_1000003 Ga0079104_1000003342 242
342 3300009093 Ga0105240_10316268 Ga0105240_103162682 242
343 3300013102 Ga0157371_10000413 Ga0157371_1000041348 242
344 3300013104 Ga0157370_10000456 Ga0157370_1000045647 242
345 3300013105 Ga0157369_10002006 Ga0157369_100020065 242
346 3300013307 Ga0157372_10000142 Ga0157372_100001427 242
347 3300014497 Ga0182008_10136985 Ga0182008_101369852 242
348 3300015261 Ga0182006_1002877 Ga0182006_10028777 242
349 3300015261 Ga0182006_1005567 Ga0182006_10055672 242
350 3300015262 Ga0182007_10043830 Ga0182007_100438302 242
351 3300020077 Ga0206351_10994603 Ga0206351_109946034 242
352 3300020610 Ga0154015_1049643 Ga0154015_104964311 242
353 3300025225 Ga0209566_100002 Ga0209566_1000021949 242
354 3300025225 Ga0209566_102220 Ga0209566_1022201 242
355 3300025226 Ga0209674_110949 Ga0209674_1109491 242
356 3300025228 Ga0209672_100818 Ga0209672_1008189 242
357 3300025229 Ga0209147_100002 Ga0209147_1000021420 242
358 3300025242 Ga0209258_100002 Ga0209258_1000021420 242
359 3300025256 Ga0209759_1003202 Ga0209759_10032027 242
360 3300025272 Ga0209455_1000021 Ga0209455_10000217 242
361 3300025913 Ga0207695_10002210 Ga0207695_100022104 242
362 3300025920 Ga0207649_10004096 Ga0207649_100040963 242
363 3300025981 Ga0207640_10008428 Ga0207640_100084281 242
364 3300026067 Ga0207678_10002602 Ga0207678_100026027 242
365 3300026078 Ga0207702_10000024 Ga0207702_10000024115 242
366 3300026116 Ga0207674_10111134 Ga0207674_101111342 242
367 3300027111 Ga0209281_1000002 Ga0209281_10000021555 242
368 3300037418 Ga0395900_0001932 Ga0395900_0001932_8431_9180 242
369 3300044650 Ga0466986_0050906 Ga0466986_0050906_1115_1864 242
370 3300044658 Ga0466972_0008642 Ga0466972_0008642_4265_5014 242
371 3300044683 Ga0466965_0002658 Ga0466965_0002658_2025_2774 242
372 3300044684 Ga0466966_0219617 Ga0466966_0219617_152_901 242
373 3300044693 Ga0466961_0000435 Ga0466961_0000435_21249_21998 242
374 3300044706 Ga0466964_0001045 Ga0466964_0001045_5600_6349 242
375 3300044719 Ga0466971_0104013 Ga0466971_0104013_366_1115 242
376 3300044765 Ga0466970_0000271 Ga0466970_0000271_19998_20747 242
377 3300044901 Ga0466960_0005296 Ga0466960_0005296_3428_4177 242
378 3300045049 Ga0466959_0002163 Ga0466959_0002163_6859_7608 242
379 3300045976 Ga0466967_0052121 Ga0466967_0052121_995_1744 242
380 3300046453 Ga0495627_051776 Ga0495627_051776_383_1123 242
381 3300048919 Ga0496116_0111707 Ga0496116_0111707_151_900 242
382 3300048925 Ga0496122_0003675 Ga0496122_0003675_4749_5498 242
383 3300048926 Ga0496123_0002948 Ga0496123_0002948_4756_5505 242
384 3300048928 Ga0496125_0002526 Ga0496125_0002526_14178_14927 242
385 3300048928 Ga0496125_0003276 Ga0496125_0003276_4753_5502 242
386 3300053087 Ga0500643_007338 Ga0500643_007338_1720_2460 242
387 3300053139 Ga0500568_0009425 Ga0500568_0009425_438_1178 242
388 iso_pu_bacteria 2585427591 2585827023 242
389 iso_pu_bacteria 2585427592 2585833077 242
390 iso_pu_bacteria 2667528173 2671107887 242
391 iso_pu_bacteria 2848297114 2848297854 242
392 iso_pu_bacteria 2904474040 2904476902 242
393 iso_pu_bacteria 2919150387 2919153071 242
394 iso_pu_bacteria 2927143783 2927147032 242
395 iso_pu_bacteria 8054849141 8054851161 242
396 iso_pu_bacteria 8057304971 8057306935 242
397 3300003771 Ga0055526_1005610 Ga0055526_10056103 243
398 3300005539 Ga0068853_100009939 Ga0068853_1000099398 243
399 3300005548 Ga0070665_100712021 Ga0070665_1007120211 243
400 3300005563 Ga0068855_100505891 Ga0068855_1005058912 243
401 3300009093 Ga0105240_10106207 Ga0105240_101062072 243
402 3300009545 Ga0105237_10000080 Ga0105237_1000008049 243
403 3300009551 Ga0105238_10000711 Ga0105238_100007112 243
404 3300010375 Ga0105239_10000116 Ga0105239_1000011659 243
405 3300025295 Ga0209564_1002205 Ga0209564_100220513 243
406 3300025913 Ga0207695_10076632 Ga0207695_100766322 243
407 3300025914 Ga0207671_10024475 Ga0207671_100244755 243
408 3300025924 Ga0207694_10015010 Ga0207694_100150103 243
409 3300025949 Ga0207667_10290172 Ga0207667_102901721 243
410 3300026041 Ga0207639_10032577 Ga0207639_100325772 243
411 3300028379 Ga0268266_10113246 Ga0268266_101132463 243
412 3300032004 Ga0307414_10233223 Ga0307414_102332232 243
413 3300041404 Ga0439436_0041758 Ga0439436_0041758_299_1060 243
414 3300042006 Ga0439432_005417 Ga0439432_005417_2733_3494 243
415 3300042006 Ga0439432_081759 Ga0439432_081759_44_805 243
416 3300042007 Ga0439449_0086835 Ga0439449_0086835_172_933 243
417 3300049579 Ga0501043_0276561 Ga0501043_0276561_134_877 243
418 3300049822 Ga0501035_0243236 Ga0501035_0243236_190_933 243
419 3300053148 Ga0500590_024655 Ga0500590_024655_209_964 243
420 iso_pu_bacteria 2515154123 2515689166 243
421 iso_pu_bacteria 2842775625 2842779708 243
422 iso_pu_bacteria 2894772417 2894775492 243
423 iso_pu_bacteria 2900577576 2900581596 243
424 iso_pu_bacteria 2928058823 2928063797 243
425 iso_pu_bacteria 3007315729 3007316961 243
426 3300003752 Ga0055539_1000100 Ga0055539_100010090 244
427 3300003756 Ga0055533_1007660 Ga0055533_10076602 244
428 3300003759 Ga0055525_1000487 Ga0055525_10004877 244
429 3300003841 Ga0055541_1010003 Ga0055541_10100032 244
430 3300005467 Ga0070706_100048699 Ga0070706_1000486992 244
431 3300021388 Ga0213875_10009808 Ga0213875_100098085 244
432 3300025910 Ga0207684_10041500 Ga0207684_100415003 244
433 3300037853 Ga0436364_1507036 Ga0436364_1507036_3041_3787 244
434 3300041404 Ga0439436_0082755 Ga0439436_0082755_117_881 244
435 3300046616 Ga0495668_0174661 Ga0495668_0174661_302_1045 244
436 3300047322 Ga0495680_0258390 Ga0495680_0258390_346_1092 244
437 3300047470 Ga0495681_0032686 Ga0495681_0032686_1087_1878 244
438 3300048091 Ga0495626_0000985 Ga0495626_0000985_11188_11931 244
439 3300048921 Ga0496118_0114485 Ga0496118_0114485_235_1026 244
440 3300049575 Ga0501039_0519036 Ga0501039_0519036_50_796 244
441 3300053134 Ga0500658_0018052 Ga0500658_0018052_1265_2056 244
442 3300059640 Ga0587067_030828 Ga0587067_030828_148_939 244
443 iso_pu_bacteria 2600255292 2601669510 244
444 iso_pu_bacteria 2643221654 2644303810 244
445 iso_pu_bacteria 2857547612 2857549630 244
446 iso_pu_bacteria 2885383462 2885388422 244
447 3300003203 JGI25406J46586_10016018 JGI25406J46586_100160181 245
448 3300003203 JGI25406J46586_10026364 JGI25406J46586_100263642 245
449 3300005347 Ga0070668_100196590 Ga0070668_1001965902 245
450 3300005353 Ga0070669_100623658 Ga0070669_1006236581 245
451 3300005366 Ga0070659_100021337 Ga0070659_1000213372 245
452 3300005367 Ga0070667_100273872 Ga0070667_1002738721 245
453 3300005434 Ga0070709_10184226 Ga0070709_101842262 245
454 3300005435 Ga0070714_100034759 Ga0070714_1000347593 245
455 3300005436 Ga0070713_100144293 Ga0070713_1001442932 245
456 3300005437 Ga0070710_10255288 Ga0070710_102552881 245
457 3300005439 Ga0070711_100030764 Ga0070711_1000307642 245
458 3300005441 Ga0070700_100243235 Ga0070700_1002432352 245
459 3300005455 Ga0070663_100115861 Ga0070663_1001158612 245
460 3300005458 Ga0070681_10109983 Ga0070681_101099832 245
461 3300005563 Ga0068855_100011273 Ga0068855_1000112736 245
462 3300005578 Ga0068854_100199823 Ga0068854_1001998232 245
463 3300005983 Ga0081540_1002396 Ga0081540_100239612 245
464 3300005985 Ga0081539_10000283 Ga0081539_1000028339 245
465 3300005985 Ga0081539_10136948 Ga0081539_101369481 245
466 3300006028 Ga0070717_10002258 Ga0070717_100022581 245
467 3300006163 Ga0070715_10002299 Ga0070715_100022994 245
468 3300006852 Ga0075433_10549133 Ga0075433_105491331 245
469 3300009093 Ga0105240_10091079 Ga0105240_100910793 245
470 3300009147 Ga0114129_10202440 Ga0114129_102024402 245
471 3300009177 Ga0105248_10097431 Ga0105248_100974312 245
472 3300013104 Ga0157370_10000216 Ga0157370_1000021662 245
473 3300013104 Ga0157370_10228371 Ga0157370_102283711 245
474 3300013306 Ga0163162_10010707 Ga0163162_100107072 245
475 3300013308 Ga0157375_10058917 Ga0157375_100589173 245
476 3300020082 Ga0206353_11620780 Ga0206353_116207801 245
477 3300021361 Ga0213872_10103861 Ga0213872_101038611 245
478 3300021388 Ga0213875_10003695 Ga0213875_100036957 245
479 3300021388 Ga0213875_10027371 Ga0213875_100273713 245
480 3300025898 Ga0207692_10009267 Ga0207692_100092674 245
481 3300025905 Ga0207685_10001062 Ga0207685_100010622 245
482 3300025909 Ga0207705_10000808 Ga0207705_1000080810 245
483 3300025915 Ga0207693_10018603 Ga0207693_100186032 245
484 3300025916 Ga0207663_10049902 Ga0207663_100499023 245
485 3300025919 Ga0207657_10186931 Ga0207657_101869312 245
486 3300025928 Ga0207700_10310842 Ga0207700_103108422 245
487 3300025932 Ga0207690_10088566 Ga0207690_100885662 245
488 3300025934 Ga0207686_10397110 Ga0207686_103971101 245
489 3300025939 Ga0207665_10044072 Ga0207665_100440723 245
490 3300025941 Ga0207711_10111481 Ga0207711_101114812 245
491 3300025949 Ga0207667_10001534 Ga0207667_1000153416 245
492 3300025972 Ga0207668_10225366 Ga0207668_102253662 245
493 3300026067 Ga0207678_10014518 Ga0207678_100145184 245
494 3300026067 Ga0207678_10275414 Ga0207678_102754142 245
495 3300028379 Ga0268266_10052323 Ga0268266_100523234 245
496 3300030500 Ga0268256_1006276 Ga0268256_10062763 245
497 3300031247 Ga0265340_10097310 Ga0265340_100973102 245
498 3300031344 Ga0265316_10116177 Ga0265316_101161772 245
499 3300037312 Ga0395899_0339022 Ga0395899_0339022_45_818 245
500 3300037418 Ga0395900_0000998 Ga0395900_0000998_22173_22949 245
501 3300037418 Ga0395900_0097106 Ga0395900_0097106_1827_2603 245
502 3300037853 Ga0436364_0089680 Ga0436364_0089680_3884_4633 245
503 3300039438 Ga0436360_1340739 Ga0436360_1340739_118_873 245
504 3300039447 Ga0436361_0860283 Ga0436361_0860283_8627_9370 245
505 3300039450 Ga0436363_0089415 Ga0436363_0089415_40_789 245
506 3300039450 Ga0436363_1009265 Ga0436363_1009265_276_1067 245
507 3300044658 Ga0466972_0003321 Ga0466972_0003321_1499_2257 245
508 3300044658 Ga0466972_0069548 Ga0466972_0069548_297_1073 245
509 3300044666 Ga0466977_0341413 Ga0466977_0341413_96_854 245
510 3300044671 Ga0466978_0004514 Ga0466978_0004514_4351_5109 245
511 3300044672 Ga0466982_0078684 Ga0466982_0078684_1045_1803 245
512 3300044683 Ga0466965_0004602 Ga0466965_0004602_3258_4001 245
513 3300044684 Ga0466966_0011654 Ga0466966_0011654_4900_5676 245
514 3300044684 Ga0466966_0015152 Ga0466966_0015152_1975_2718 245
515 3300044684 Ga0466966_0095977 Ga0466966_0095977_315_1091 245
516 3300044693 Ga0466961_0001155 Ga0466961_0001155_7581_8339 245
517 3300044693 Ga0466961_0006348 Ga0466961_0006348_176_952 245
518 3300044693 Ga0466961_0008481 Ga0466961_0008481_3662_4405 245
519 3300044693 Ga0466961_0235301 Ga0466961_0235301_153_929 245
520 3300044694 Ga0466963_0023494 Ga0466963_0023494_2323_3099 245
521 3300044706 Ga0466964_0004022 Ga0466964_0004022_2442_3200 245
522 3300044719 Ga0466971_0004162 Ga0466971_0004162_1490_2266 245
523 3300044735 Ga0466968_0009639 Ga0466968_0009639_2602_3360 245
524 3300044765 Ga0466970_0001247 Ga0466970_0001247_7731_8489 245
525 3300044765 Ga0466970_0139850 Ga0466970_0139850_26_769 245
526 3300044765 Ga0466970_0181355 Ga0466970_0181355_188_964 245
527 3300044842 Ga0466957_0029076 Ga0466957_0029076_97_855 245
528 3300044901 Ga0466960_0005076 Ga0466960_0005076_2927_3685 245
529 3300045049 Ga0466959_0006181 Ga0466959_0006181_339_1115 245
530 3300045051 Ga0451576_0265590 Ga0451576_0265590_112_867 245
531 3300045976 Ga0466967_0047916 Ga0466967_0047916_1032_1790 245
532 3300046458 Ga0495591_021603 Ga0495591_021603_662_1405 245
533 3300046459 Ga0495629_0001013 Ga0495629_0001013_18005_18748 245
534 3300046460 Ga0495638_0007246 Ga0495638_0007246_3377_4120 245
535 3300046471 Ga0495650_0001635 Ga0495650_0001635_3551_4294 245
536 3300046471 Ga0495650_0013152 Ga0495650_0013152_401_1144 245
537 3300046472 Ga0495580_0004501 Ga0495580_0004501_2177_2920 245
538 3300046473 Ga0495582_0012292 Ga0495582_0012292_1462_2205 245
539 3300046474 Ga0495605_0001958 Ga0495605_0001958_3454_4197 245
540 3300046476 Ga0495662_0175723 Ga0495662_0175723_19_762 245
541 3300046491 Ga0495584_0051005 Ga0495584_0051005_1268_2011 245
542 3300046492 Ga0495585_0003423 Ga0495585_0003423_1282_2025 245
543 3300046492 Ga0495585_0208285 Ga0495585_0208285_131_874 245
544 3300046501 Ga0495607_0018615 Ga0495607_0018615_1996_2739 245
545 3300046507 Ga0495606_0029044 Ga0495606_0029044_305_1081 245
546 3300046516 Ga0495628_0116921 Ga0495628_0116921_637_1380 245
547 3300046520 Ga0495637_0097923 Ga0495637_0097923_370_1128 245
548 3300046524 Ga0495648_0040093 Ga0495648_0040093_1119_1862 245
549 3300046528 Ga0495642_0002072 Ga0495642_0002072_3456_4199 245
550 3300046528 Ga0495642_0007140 Ga0495642_0007140_2964_3707 245
551 3300046531 Ga0495665_0011572 Ga0495665_0011572_3532_4275 245
552 3300046535 Ga0495586_0013837 Ga0495586_0013837_2471_3214 245
553 3300046542 Ga0495597_0052070 Ga0495597_0052070_267_1010 245
554 3300046543 Ga0495645_0001014 Ga0495645_0001014_3548_4291 245
555 3300046557 Ga0495622_0000126 Ga0495622_0000126_13258_14001 245
556 3300046559 Ga0495667_0072015 Ga0495667_0072015_1198_1941 245
557 3300046615 Ga0495656_0037535 Ga0495656_0037535_660_1403 245
558 3300046648 Ga0495611_0044664 Ga0495611_0044664_1162_1905 245
559 3300046674 Ga0495588_0014191 Ga0495588_0014191_1811_2554 245
560 3300046684 Ga0495669_0040677 Ga0495669_0040677_597_1340 245
561 3300046689 Ga0495613_0048684 Ga0495613_0048684_1551_2294 245
562 3300046690 Ga0495624_0089967 Ga0495624_0089967_666_1409 245
563 3300046691 Ga0495670_0037656 Ga0495670_0037656_155_898 245
564 3300046694 Ga0495649_0007521 Ga0495649_0007521_1146_1922 245
565 3300046794 Ga0495589_0001219 Ga0495589_0001219_3415_4158 245
566 3300046794 Ga0495589_0013071 Ga0495589_0013071_775_1518 245
567 3300047315 Ga0495581_0000534 Ga0495581_0000534_14857_15600 245
568 3300047320 Ga0495672_0075902 Ga0495672_0075902_638_1381 245
569 3300047323 Ga0495683_0002629 Ga0495683_0002629_526_1302 245
570 3300047323 Ga0495683_0197899 Ga0495683_0197899_17_760 245
571 3300047443 Ga0495687_039117 Ga0495687_039117_890_1633 245
572 3300047444 Ga0495675_0062087 Ga0495675_0062087_1316_2059 245
573 3300047445 Ga0495677_0140514 Ga0495677_0140514_107_850 245
574 3300047446 Ga0495679_005443 Ga0495679_005443_4540_5283 245
575 3300047446 Ga0495679_006754 Ga0495679_006754_2685_3428 245
576 3300047471 Ga0495684_0424912 Ga0495684_0424912_78_821 245
577 3300048091 Ga0495626_0037972 Ga0495626_0037972_612_1355 245
578 3300048903 Ga0496100_0187892 Ga0496100_0187892_77_835 245
579 3300048904 Ga0496101_0008396 Ga0496101_0008396_4395_5138 245
580 3300048905 Ga0496102_0012755 Ga0496102_0012755_3934_4677 245
581 3300048907 Ga0496104_0103788 Ga0496104_0103788_1740_2483 245
582 3300048908 Ga0496105_0017664 Ga0496105_0017664_1744_2502 245
583 3300048908 Ga0496105_0182466 Ga0496105_0182466_785_1528 245
584 3300048910 Ga0496107_0047588 Ga0496107_0047588_1000_1743 245
585 3300048910 Ga0496107_0157598 Ga0496107_0157598_179_922 245
586 3300048917 Ga0496114_0003425 Ga0496114_0003425_3513_4256 245
587 3300048918 Ga0496115_0004888 Ga0496115_0004888_4759_5517 245
588 3300048918 Ga0496115_0023113 Ga0496115_0023113_2335_3078 245
589 3300048920 Ga0496117_0010209 Ga0496117_0010209_2830_3600 245
590 3300048921 Ga0496118_0039064 Ga0496118_0039064_2222_2992 245
591 3300048922 Ga0496119_0040496 Ga0496119_0040496_1103_1873 245
592 3300049569 Ga0501032_0029712 Ga0501032_0029712_199_1008 245
593 3300049574 Ga0501038_0142624 Ga0501038_0142624_1052_1798 245
594 3300049578 Ga0501042_0170219 Ga0501042_0170219_255_1013 245
595 3300049580 Ga0501046_0068046 Ga0501046_0068046_975_1721 245
596 3300049590 Ga0501074_0338117 Ga0501074_0338117_196_954 245
597 3300049592 Ga0501076_0472752 Ga0501076_0472752_91_849 245
598 3300049741 Ga0501079_0519090 Ga0501079_0519090_30_788 245
599 3300049822 Ga0501035_0009229 Ga0501035_0009229_119_865 245
600 3300050507 nmdc:mga05p37_327008_c1 nmdc:mga05p37_327008_c1_676_1434 245
601 3300050512 nmdc:mga0n895_135888_c1 nmdc:mga0n895_135888_c1_1340_2098 245
602 3300050514 nmdc:mga08x19_316610_c1 nmdc:mga08x19_316610_c1_89_847 245
603 3300050515 nmdc:mga0a205_250823_c1 nmdc:mga0a205_250823_c1_749_1507 245
604 3300060353 Ga0501082_0509560 Ga0501082_0509560_209_970 245
605 3300061719 Ga0466962_0005043 Ga0466962_0005043_1679_2455 245
606 3300061719 Ga0466962_0012718 Ga0466962_0012718_391_1149 245
607 2162886007 SwRhRL2b_contig_1052005 SwRhRL2b_0838.00005150 246
608 3300002737 JGI25162J39368_1000067 JGI25162J39368_1000067111 246
609 3300002771 JGI25163J39215_1000114 JGI25163J39215_100011420 246
610 3300002772 JGI25164J39214_1000039 JGI25164J39214_100003928 246
611 3300003751 Ga0055538_1000052 Ga0055538_100005228 246
612 3300003752 Ga0055539_1000077 Ga0055539_100007728 246
613 3300003756 Ga0055533_1000083 Ga0055533_100008328 246
614 3300003759 Ga0055525_1000110 Ga0055525_100011028 246
615 3300003841 Ga0055541_1000054 Ga0055541_100005428 246
616 3300005289 Ga0065704_10000086 Ga0065704_1000008611 246
617 3300005327 Ga0070658_10323291 Ga0070658_103232912 246
618 3300005328 Ga0070676_10002823 Ga0070676_100028235 246
619 3300005331 Ga0070670_100733791 Ga0070670_1007337911 246
620 3300005334 Ga0068869_100001193 Ga0068869_1000011934 246
621 3300005334 Ga0068869_100014797 Ga0068869_1000147973 246
622 3300005334 Ga0068869_100149052 Ga0068869_1001490522 246
623 3300005335 Ga0070666_10001793 Ga0070666_100017934 246
624 3300005335 Ga0070666_10238456 Ga0070666_102384562 246
625 3300005336 Ga0070680_100004336 Ga0070680_1000043363 246
626 3300005338 Ga0068868_100000185 Ga0068868_1000001853 246
627 3300005338 Ga0068868_100012143 Ga0068868_1000121433 246
628 3300005339 Ga0070660_100005623 Ga0070660_1000056236 246
629 3300005339 Ga0070660_100084247 Ga0070660_1000842472 246
630 3300005340 Ga0070689_100010833 Ga0070689_1000108333 246
631 3300005341 Ga0070691_10105692 Ga0070691_101056922 246
632 3300005343 Ga0070687_100024370 Ga0070687_1000243703 246
633 3300005347 Ga0070668_100029171 Ga0070668_1000291711 246
634 3300005347 Ga0070668_100077972 Ga0070668_1000779722 246
635 3300005353 Ga0070669_100023411 Ga0070669_1000234112 246
636 3300005353 Ga0070669_100029773 Ga0070669_1000297733 246
637 3300005354 Ga0070675_100001427 Ga0070675_1000014273 246
638 3300005354 Ga0070675_100002466 Ga0070675_1000024663 246
639 3300005355 Ga0070671_100015468 Ga0070671_1000154683 246
640 3300005364 Ga0070673_100002536 Ga0070673_1000025364 246
641 3300005364 Ga0070673_100143386 Ga0070673_1001433862 246
642 3300005367 Ga0070667_100020821 Ga0070667_1000208212 246
643 3300005367 Ga0070667_100077412 Ga0070667_1000774123 246
644 3300005367 Ga0070667_100168469 Ga0070667_1001684692 246
645 3300005438 Ga0070701_10116317 Ga0070701_101163172 246
646 3300005455 Ga0070663_100020341 Ga0070663_1000203413 246
647 3300005457 Ga0070662_100007037 Ga0070662_1000070372 246
648 3300005457 Ga0070662_100155742 Ga0070662_1001557422 246
649 3300005458 Ga0070681_10101502 Ga0070681_101015023 246
650 3300005458 Ga0070681_10109271 Ga0070681_101092711 246
651 3300005459 Ga0068867_100030151 Ga0068867_1000301511 246
652 3300005468 Ga0070707_100176391 Ga0070707_1001763912 246
653 3300005471 Ga0070698_100180024 Ga0070698_1001800242 246
654 3300005518 Ga0070699_100089170 Ga0070699_1000891703 246
655 3300005530 Ga0070679_100081200 Ga0070679_1000812002 246
656 3300005535 Ga0070684_100018963 Ga0070684_1000189633 246
657 3300005536 Ga0070697_100081899 Ga0070697_1000818992 246
658 3300005539 Ga0068853_100029693 Ga0068853_1000296933 246
659 3300005539 Ga0068853_100189365 Ga0068853_1001893652 246
660 3300005539 Ga0068853_100333581 Ga0068853_1003335812 246
661 3300005543 Ga0070672_100015407 Ga0070672_1000154074 246
662 3300005543 Ga0070672_100117142 Ga0070672_1001171422 246
663 3300005543 Ga0070672_100221402 Ga0070672_1002214021 246
664 3300005547 Ga0070693_100145147 Ga0070693_1001451471 246
665 3300005547 Ga0070693_100193944 Ga0070693_1001939441 246
666 3300005563 Ga0068855_100025726 Ga0068855_1000257264 246
667 3300005564 Ga0070664_100111815 Ga0070664_1001118152 246
668 3300005564 Ga0070664_100160719 Ga0070664_1001607193 246
669 3300005577 Ga0068857_100144683 Ga0068857_1001446832 246
670 3300005578 Ga0068854_100066061 Ga0068854_1000660612 246
671 3300005614 Ga0068856_100033738 Ga0068856_1000337384 246
672 3300005614 Ga0068856_100065349 Ga0068856_1000653492 246
673 3300005614 Ga0068856_100441686 Ga0068856_1004416862 246
674 3300005615 Ga0070702_100013026 Ga0070702_1000130263 246
675 3300005616 Ga0068852_100023260 Ga0068852_1000232603 246
676 3300005617 Ga0068859_100001283 Ga0068859_1000012838 246
677 3300005617 Ga0068859_100474436 Ga0068859_1004744362 246
678 3300005618 Ga0068864_100001050 Ga0068864_1000010509 246
679 3300005618 Ga0068864_100014858 Ga0068864_1000148584 246
680 3300005719 Ga0068861_100000536 Ga0068861_10000053612 246
681 3300005719 Ga0068861_100106030 Ga0068861_1001060303 246
682 3300005834 Ga0068851_10078654 Ga0068851_100786542 246
683 3300005841 Ga0068863_100004913 Ga0068863_1000049133 246
684 3300005841 Ga0068863_100087518 Ga0068863_1000875182 246
685 3300005842 Ga0068858_100000885 Ga0068858_10000088519 246
686 3300005842 Ga0068858_100057021 Ga0068858_1000570212 246
687 3300005843 Ga0068860_100046824 Ga0068860_1000468244 246
688 3300005843 Ga0068860_100067502 Ga0068860_1000675023 246
689 3300005844 Ga0068862_100038274 Ga0068862_1000382743 246
690 3300005844 Ga0068862_100138508 Ga0068862_1001385082 246
691 3300006177 Ga0075362_10021179 Ga0075362_100211793 246
692 3300006195 Ga0075366_10013029 Ga0075366_100130292 246
693 3300006237 Ga0097621_100028263 Ga0097621_1000282632 246
694 3300006237 Ga0097621_100066237 Ga0097621_1000662372 246
695 3300006358 Ga0068871_100007888 Ga0068871_1000078884 246
696 3300006880 Ga0075429_100002684 Ga0075429_1000026843 246
697 3300006881 Ga0068865_100269152 Ga0068865_1002691522 246
698 3300006931 Ga0097620_100001283 Ga0097620_1000012838 246
699 3300006931 Ga0097620_100474396 Ga0097620_1004743962 246
700 3300007076 Ga0075435_100578635 Ga0075435_1005786351 246
701 3300009036 Ga0105244_10000008 Ga0105244_1000000827 246
702 3300009036 Ga0105244_10000945 Ga0105244_1000094522 246
703 3300009092 Ga0105250_10001925 Ga0105250_100019258 246
704 3300009148 Ga0105243_10017212 Ga0105243_100172125 246
705 3300009148 Ga0105243_10243103 Ga0105243_102431032 246
706 3300009174 Ga0105241_10707230 Ga0105241_107072301 246
707 3300009177 Ga0105248_10029339 Ga0105248_100293397 246
708 3300009177 Ga0105248_10114596 Ga0105248_101145962 246
709 3300009177 Ga0105248_10170182 Ga0105248_101701821 246
710 3300009545 Ga0105237_10158940 Ga0105237_101589402 246
711 3300009551 Ga0105238_10076954 Ga0105238_100769543 246
712 3300009551 Ga0105238_10158745 Ga0105238_101587451 246
713 3300009553 Ga0105249_10036077 Ga0105249_100360773 246
714 3300010375 Ga0105239_10444222 Ga0105239_104442222 246
715 3300013100 Ga0157373_10002177 Ga0157373_1000217713 246
716 3300013100 Ga0157373_10147087 Ga0157373_101470872 246
717 3300013102 Ga0157371_10000075 Ga0157371_1000007520 246
718 3300013102 Ga0157371_10009934 Ga0157371_100099343 246
719 3300013105 Ga0157369_10150479 Ga0157369_101504792 246
720 3300013105 Ga0157369_10180215 Ga0157369_101802152 246
721 3300013296 Ga0157374_10008777 Ga0157374_100087775 246
722 3300013296 Ga0157374_10021504 Ga0157374_100215047 246
723 3300013306 Ga0163162_10013948 Ga0163162_100139485 246
724 3300013306 Ga0163162_10213186 Ga0163162_102131861 246
725 3300013307 Ga0157372_10029443 Ga0157372_100294432 246
726 3300013307 Ga0157372_10302668 Ga0157372_103026682 246
727 3300013307 Ga0157372_10331267 Ga0157372_103312672 246
728 3300013308 Ga0157375_10016333 Ga0157375_100163334 246
729 3300013308 Ga0157375_10052050 Ga0157375_100520503 246
730 3300013308 Ga0157375_10157456 Ga0157375_101574562 246
731 3300014325 Ga0163163_10012602 Ga0163163_100126024 246
732 3300014326 Ga0157380_10143005 Ga0157380_101430052 246
733 3300014745 Ga0157377_10003314 Ga0157377_100033142 246
734 3300014968 Ga0157379_10002653 Ga0157379_100026532 246
735 3300014968 Ga0157379_10008236 Ga0157379_100082367 246
736 3300014968 Ga0157379_10305251 Ga0157379_103052512 246
737 3300014969 Ga0157376_10008707 Ga0157376_100087075 246
738 3300014969 Ga0157376_10104576 Ga0157376_101045762 246
739 3300015261 Ga0182006_1000004 Ga0182006_1000004346 246
740 3300015262 Ga0182007_10000018 Ga0182007_1000001825 246
741 3300015265 Ga0182005_1000011 Ga0182005_100001135 246
742 3300015265 Ga0182005_1070727 Ga0182005_10707271 246
743 3300017792 Ga0163161_10013883 Ga0163161_100138832 246
744 3300017792 Ga0163161_10076178 Ga0163161_100761783 246
745 3300017792 Ga0163161_10101262 Ga0163161_101012622 246
746 3300025207 Ga0209760_100070 Ga0209760_10007015 246
747 3300025224 Ga0209784_100012 Ga0209784_100012471 246
748 3300025225 Ga0209566_100010 Ga0209566_100010471 246
749 3300025226 Ga0209674_100023 Ga0209674_100023471 246
750 3300025230 Ga0209563_100027 Ga0209563_100027471 246
751 3300025231 Ga0207427_100017 Ga0207427_100017471 246
752 3300025233 Ga0209437_100029 Ga0209437_100029471 246
753 3300025253 Ga0209677_100014 Ga0209677_100014471 246
754 3300025261 Ga0209233_1000890 Ga0209233_10008907 246
755 3300025298 Ga0209050_1006975 Ga0209050_10069757 246
756 3300025321 Ga0207656_10054712 Ga0207656_100547122 246
757 3300025711 Ga0207696_1000658 Ga0207696_10006585 246
758 3300025728 Ga0207655_1000243 Ga0207655_100024356 246
759 3300025728 Ga0207655_1001135 Ga0207655_100113526 246
760 3300025893 Ga0207682_10023171 Ga0207682_100231712 246
761 3300025893 Ga0207682_10044908 Ga0207682_100449082 246
762 3300025899 Ga0207642_10144607 Ga0207642_101446072 246
763 3300025901 Ga0207688_10089558 Ga0207688_100895582 246
764 3300025903 Ga0207680_10000931 Ga0207680_1000093111 246
765 3300025903 Ga0207680_10204005 Ga0207680_102040052 246
766 3300025903 Ga0207680_10221954 Ga0207680_102219541 246
767 3300025907 Ga0207645_10001374 Ga0207645_100013743 246
768 3300025908 Ga0207643_10257413 Ga0207643_102574131 246
769 3300025912 Ga0207707_10059522 Ga0207707_100595222 246
770 3300025914 Ga0207671_10181187 Ga0207671_101811872 246
771 3300025917 Ga0207660_10002960 Ga0207660_100029605 246
772 3300025918 Ga0207662_10053058 Ga0207662_100530582 246
773 3300025919 Ga0207657_10024958 Ga0207657_100249583 246
774 3300025920 Ga0207649_10200860 Ga0207649_102008602 246
775 3300025921 Ga0207652_10068958 Ga0207652_100689583 246
776 3300025922 Ga0207646_10251807 Ga0207646_102518071 246
777 3300025923 Ga0207681_10071819 Ga0207681_100718192 246
778 3300025923 Ga0207681_10083286 Ga0207681_100832862 246
779 3300025923 Ga0207681_10378178 Ga0207681_103781782 246
780 3300025924 Ga0207694_10061975 Ga0207694_100619752 246
781 3300025925 Ga0207650_10337765 Ga0207650_103377652 246
782 3300025926 Ga0207659_10004208 Ga0207659_100042083 246
783 3300025926 Ga0207659_10007353 Ga0207659_100073538 246
784 3300025931 Ga0207644_10000635 Ga0207644_100006354 246
785 3300025932 Ga0207690_10015082 Ga0207690_100150823 246
786 3300025933 Ga0207706_10007598 Ga0207706_100075983 246
787 3300025933 Ga0207706_10172123 Ga0207706_101721232 246
788 3300025933 Ga0207706_10263616 Ga0207706_102636161 246
789 3300025935 Ga0207709_10036106 Ga0207709_100361062 246
790 3300025935 Ga0207709_10234604 Ga0207709_102346042 246
791 3300025936 Ga0207670_10009447 Ga0207670_100094472 246
792 3300025938 Ga0207704_10312482 Ga0207704_103124822 246
793 3300025940 Ga0207691_10046267 Ga0207691_100462673 246
794 3300025940 Ga0207691_10272737 Ga0207691_102727372 246
795 3300025941 Ga0207711_10007617 Ga0207711_100076172 246
796 3300025941 Ga0207711_10017006 Ga0207711_100170062 246
797 3300025941 Ga0207711_10112369 Ga0207711_101123692 246
798 3300025941 Ga0207711_10300554 Ga0207711_103005542 246
799 3300025942 Ga0207689_10000851 Ga0207689_1000085124 246
800 3300025942 Ga0207689_10083483 Ga0207689_100834833 246
801 3300025942 Ga0207689_10334793 Ga0207689_103347931 246
802 3300025944 Ga0207661_10186763 Ga0207661_101867631 246
803 3300025945 Ga0207679_10080361 Ga0207679_100803613 246
804 3300025960 Ga0207651_10005276 Ga0207651_100052764 246
805 3300025960 Ga0207651_10234740 Ga0207651_102347402 246
806 3300025972 Ga0207668_10017458 Ga0207668_100174582 246
807 3300025986 Ga0207658_10005671 Ga0207658_1000567110 246
808 3300025986 Ga0207658_10078687 Ga0207658_100786872 246
809 3300026023 Ga0207677_10002592 Ga0207677_100025923 246
810 3300026023 Ga0207677_10004596 Ga0207677_100045963 246
811 3300026035 Ga0207703_10001221 Ga0207703_100012216 246
812 3300026041 Ga0207639_10033688 Ga0207639_100336882 246
813 3300026041 Ga0207639_10370530 Ga0207639_103705302 246
814 3300026067 Ga0207678_10005562 Ga0207678_100055623 246
815 3300026078 Ga0207702_10025016 Ga0207702_100250162 246
816 3300026078 Ga0207702_10037987 Ga0207702_100379871 246
817 3300026088 Ga0207641_10015891 Ga0207641_100158913 246
818 3300026088 Ga0207641_10025598 Ga0207641_100255982 246
819 3300026088 Ga0207641_10059408 Ga0207641_100594084 246
820 3300026088 Ga0207641_10119471 Ga0207641_101194712 246
821 3300026089 Ga0207648_10055361 Ga0207648_100553613 246
822 3300026095 Ga0207676_10001143 Ga0207676_1000114315 246
823 3300026095 Ga0207676_10002759 Ga0207676_100027593 246
824 3300026116 Ga0207674_10244119 Ga0207674_102441192 246
825 3300026118 Ga0207675_100000246 Ga0207675_10000024633 246
826 3300026118 Ga0207675_100160268 Ga0207675_1001602682 246
827 3300026121 Ga0207683_10075611 Ga0207683_100756113 246
828 3300026142 Ga0207698_10002713 Ga0207698_1000271310 246
829 3300026142 Ga0207698_10036635 Ga0207698_100366353 246
830 3300027312 Ga0209371_1000087 Ga0209371_100008722 246
831 3300028380 Ga0268265_10179993 Ga0268265_101799932 246
832 3300028381 Ga0268264_10061418 Ga0268264_100614183 246
833 3300028381 Ga0268264_10067513 Ga0268264_100675132 246
834 3300028381 Ga0268264_10486547 Ga0268264_104865472 246
835 3300030500 Ga0268256_1000101 Ga0268256_100010122 246
836 3300030500 Ga0268256_1041207 Ga0268256_10412072 246
837 3300030731 Ga0316177_1054551 Ga0316177_10545513 246
838 3300030736 Ga0316180_1095940 Ga0316180_10959403 246
839 3300031241 Ga0265325_10005021 Ga0265325_100050214 246
840 3300031456 Ga0307513_10195563 Ga0307513_101955632 246
841 3300031456 Ga0307513_10318280 Ga0307513_103182802 246
842 3300031730 Ga0307516_10002914 Ga0307516_100029146 246
843 3300031901 Ga0307406_10689436 Ga0307406_106894361 246
844 3300031911 Ga0307412_10029815 Ga0307412_100298153 246
845 3300031911 Ga0307412_10071852 Ga0307412_100718523 246
846 3300034816 Ga0373930_0039127 Ga0373930_0039127_121_885 246
847 3300035121 Ga0373960_0058618 Ga0373960_0058618_32_796 246
848 3300035691 Ga0373931_0003648 Ga0373931_0003648_4585_5349 246
849 3300035725 Ga0373947_0238841 Ga0373947_0238841_187_951 246
850 3300037418 Ga0395900_0023039 Ga0395900_0023039_4275_5081 246
851 3300038443 Ga0395901_0130199 Ga0395901_0130199_728_1534 246
852 3300039438 Ga0436360_1229390 Ga0436360_1229390_244_999 246
853 3300039450 Ga0436363_0134441 Ga0436363_0134441_42_806 246
854 3300039450 Ga0436363_1058409 Ga0436363_1058409_347_1111 246
855 3300041405 Ga0439438_000018 Ga0439438_000018_24378_25118 246
856 3300041407 Ga0439447_002351 Ga0439447_002351_3716_4456 246
857 3300041512 Ga0451853_2911252 Ga0451853_2911252_609_1616 246
858 3300042006 Ga0439432_004844 Ga0439432_004844_1028_1768 246
859 3300044658 Ga0466972_0000383 Ga0466972_0000383_6000_6758 246
860 3300044684 Ga0466966_0032955 Ga0466966_0032955_38_808 246
861 3300044719 Ga0466971_0082607 Ga0466971_0082607_196_966 246
862 3300044765 Ga0466970_0054294 Ga0466970_0054294_916_1686 246
863 3300045051 Ga0451576_0216002 Ga0451576_0216002_393_1157 246
864 3300046455 Ga0495603_0306290 Ga0495603_0306290_142_882 246
865 3300046457 Ga0495590_0000016 Ga0495590_0000016_125859_126605 246
866 3300046460 Ga0495638_0000057 Ga0495638_0000057_68607_69353 246
867 3300046460 Ga0495638_0011962 Ga0495638_0011962_4624_5370 246
868 3300046463 Ga0495653_0001187 Ga0495653_0001187_17682_18422 246
869 3300046471 Ga0495650_0000008 Ga0495650_0000008_644831_645571 246
870 3300046471 Ga0495650_0000102 Ga0495650_0000102_58081_58821 246
871 3300046471 Ga0495650_0002031 Ga0495650_0002031_4989_5735 246
872 3300046475 Ga0495639_0009356 Ga0495639_0009356_2250_2996 246
873 3300046492 Ga0495585_0000162 Ga0495585_0000162_65579_66346 246
874 3300046492 Ga0495585_0036768 Ga0495585_0036768_1775_2521 246
875 3300046500 Ga0495596_0000901 Ga0495596_0000901_15861_16628 246
876 3300046500 Ga0495596_0009485 Ga0495596_0009485_2646_3392 246
877 3300046501 Ga0495607_0002244 Ga0495607_0002244_11762_12502 246
878 3300046506 Ga0495583_0000688 Ga0495583_0000688_18772_19518 246
879 3300046507 Ga0495606_0215386 Ga0495606_0215386_247_987 246
880 3300046518 Ga0495631_0130860 Ga0495631_0130860_108_848 246
881 3300046519 Ga0495632_0006806 Ga0495632_0006806_4555_5301 246
882 3300046522 Ga0495643_0000236 Ga0495643_0000236_42190_42936 246
883 3300046522 Ga0495643_0084456 Ga0495643_0084456_460_1206 246
884 3300046524 Ga0495648_0000002 Ga0495648_0000002_465796_466542 246
885 3300046528 Ga0495642_0025740 Ga0495642_0025740_78_824 246
886 3300046530 Ga0495654_0000218 Ga0495654_0000218_42623_43363 246
887 3300046537 Ga0495598_0033145 Ga0495598_0033145_466_1230 246
888 3300046538 Ga0495609_0004395 Ga0495609_0004395_6402_7148 246
889 3300046542 Ga0495597_0000080 Ga0495597_0000080_70900_71646 246
890 3300046557 Ga0495622_0000483 Ga0495622_0000483_18155_18901 246
891 3300046558 Ga0495633_0000399 Ga0495633_0000399_26052_26798 246
892 3300046558 Ga0495633_0004029 Ga0495633_0004029_220_987 246
893 3300046616 Ga0495668_0000132 Ga0495668_0000132_68621_69367 246
894 3300046616 Ga0495668_0353418 Ga0495668_0353418_38_784 246
895 3300046648 Ga0495611_0016943 Ga0495611_0016943_949_1695 246
896 3300046660 Ga0495625_0000177 Ga0495625_0000177_25938_26684 246
897 3300046660 Ga0495625_0026687 Ga0495625_0026687_762_1508 246
898 3300046683 Ga0495658_0063585 Ga0495658_0063585_22_786 246
899 3300046694 Ga0495649_0001590 Ga0495649_0001590_5979_6719 246
900 3300046694 Ga0495649_0107798 Ga0495649_0107798_428_1174 246
901 3300046794 Ga0495589_0117340 Ga0495589_0117340_326_1072 246
902 3300046810 Ga0495660_0000006 Ga0495660_0000006_457404_458144 246
903 3300047315 Ga0495581_0264524 Ga0495581_0264524_173_928 246
904 3300047320 Ga0495672_0000003 Ga0495672_0000003_42717_43457 246
905 3300047321 Ga0495676_0046612 Ga0495676_0046612_1195_1935 246
906 3300047323 Ga0495683_0000072 Ga0495683_0000072_34838_35605 246
907 3300047323 Ga0495683_0100117 Ga0495683_0100117_297_1043 246
908 3300048091 Ga0495626_0011297 Ga0495626_0011297_583_1329 246
909 3300048903 Ga0496100_0007795 Ga0496100_0007795_2404_3168 246
910 3300048904 Ga0496101_0214875 Ga0496101_0214875_337_1101 246
911 3300048905 Ga0496102_0095663 Ga0496102_0095663_554_1318 246
912 3300048907 Ga0496104_0001453 Ga0496104_0001453_13972_14712 246
913 3300048907 Ga0496104_0043071 Ga0496104_0043071_1402_2166 246
914 3300048909 Ga0496106_0005946 Ga0496106_0005946_6034_6798 246
915 3300048909 Ga0496106_0061377 Ga0496106_0061377_1400_2155 246
916 3300048910 Ga0496107_0138529 Ga0496107_0138529_609_1373 246
917 3300048911 Ga0496108_0052815 Ga0496108_0052815_329_1093 246
918 3300048912 Ga0496109_0026177 Ga0496109_0026177_1480_2244 246
919 3300048912 Ga0496109_0231886 Ga0496109_0231886_644_1408 246
920 3300048913 Ga0496110_0061421 Ga0496110_0061421_1716_2480 246
921 3300048915 Ga0496112_0069091 Ga0496112_0069091_575_1339 246
922 3300048916 Ga0496113_0009831 Ga0496113_0009831_879_1643 246
923 3300048916 Ga0496113_0369185 Ga0496113_0369185_27_797 246
924 3300048917 Ga0496114_0221129 Ga0496114_0221129_593_1357 246
925 3300048917 Ga0496114_0591727 Ga0496114_0591727_70_834 246
926 3300048918 Ga0496115_0009776 Ga0496115_0009776_4153_4917 246
927 3300048919 Ga0496116_0000020 Ga0496116_0000020_473367_474107 246
928 3300048919 Ga0496116_0048918 Ga0496116_0048918_28_774 246
929 3300048919 Ga0496116_0070363 Ga0496116_0070363_552_1307 246
930 3300048920 Ga0496117_0000011 Ga0496117_0000011_386987_387742 246
931 3300048920 Ga0496117_0043729 Ga0496117_0043729_527_1267 246
932 3300048921 Ga0496118_0000010 Ga0496118_0000010_223189_223944 246
933 3300048921 Ga0496118_0002115 Ga0496118_0002115_14237_14977 246
934 3300048921 Ga0496118_0003691 Ga0496118_0003691_3703_4443 246
935 3300048923 Ga0496120_0002102 Ga0496120_0002102_19386_20126 246
936 3300048924 Ga0496121_0002266 Ga0496121_0002266_14116_14871 246
937 3300048924 Ga0496121_0004661 Ga0496121_0004661_5718_6473 246
938 3300048924 Ga0496121_0118184 Ga0496121_0118184_1210_1965 246
939 3300048925 Ga0496122_0000010 Ga0496122_0000010_173848_174588 246
940 3300048926 Ga0496123_0000061 Ga0496123_0000061_42090_42830 246
941 3300048927 Ga0496124_0000084 Ga0496124_0000084_29775_30515 246
942 3300048927 Ga0496124_0218820 Ga0496124_0218820_387_1133 246
943 3300048928 Ga0496125_0000071 Ga0496125_0000071_42639_43379 246
944 3300048928 Ga0496125_0089187 Ga0496125_0089187_74_829 246
945 3300048929 Ga0496126_0002615 Ga0496126_0002615_16742_17482 246
946 3300049459 Ga0495678_007026 Ga0495678_007026_2289_3035 246
947 3300049460 Ga0495682_0000017 Ga0495682_0000017_189852_190592 246
948 3300049515 Ga0501292_003979 Ga0501292_003979_1156_1911 246
949 3300049569 Ga0501032_0238738 Ga0501032_0238738_94_840 246
950 3300049573 Ga0501037_0041992 Ga0501037_0041992_1726_2472 246
951 3300049579 Ga0501043_0204213 Ga0501043_0204213_162_908 246
952 3300049581 Ga0501047_0036949 Ga0501047_0036949_1760_2506 246
953 3300049822 Ga0501035_0076485 Ga0501035_0076485_1979_2725 246
954 3300050489 nmdc:mga03683_30766_c1 nmdc:mga03683_30766_c1_668_1423 246
955 3300050493 nmdc:mga0k408_66252_c1 nmdc:mga0k408_66252_c1_317_1072 246
956 3300050507 nmdc:mga05p37_358905_c1 nmdc:mga05p37_358905_c1_401_1189 246
957 3300050508 nmdc:mga09592_16638_c1 nmdc:mga09592_16638_c1_2849_3604 246
958 3300053086 Ga0500578_0199438 Ga0500578_0199438_221_976 246
959 3300053125 Ga0500618_001635 Ga0500618_001635_2946_3686 246
960 3300053730 Ga0500645_006464 Ga0500645_006464_1268_2023 246
961 3300061719 Ga0466962_0060604 Ga0466962_0060604_275_1045 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

61

250

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

66

306

0.9

PF08659

KR

KR domain

62

226

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yqz-assembly1.cif.gz_B crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9756 1 246
4yqz-assembly1.cif.gz_B crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9715 1 246
4yqz-assembly1.cif.gz_D crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9652 1 246
4yqz-assembly1.cif.gz_D crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9612 1 246
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9576 3 244
ID Description Score Start End Superfamily
4yqzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 2 244 3.40.50.720
4yqzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9659 2 244 3.40.50.720
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 1 246 3.40.50.720
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 1 246 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9504 79 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7L3BNC6-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9974 48 174 GO:0003858
GO:0005737
GO:0019290
AF-A0A0Q0X477-F1-model_v4 Oxidoreductase 0.9926 66 246 GO:0016491
AF-A0A7L2JCT2-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9904 3 170 GO:0003858
GO:0005737
GO:0019290
AF-A0A3B3DAU7-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9901 3 187 GO:0003858
GO:0005737
GO:0019290
GO:0042168
GO:0042541
GO:0043249
AF-S9XYG3-F1-model_v4 deleted 0.99 3 172

Feature Viewer

pLDDT pTM Quality
95.88 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map