F486865
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 961 | 279 | 1922 | 348 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10199158|Ga0163162_101991582 |
| Length | 378 |
| Sequence | MVADLKPNGGAGARQPAADGRAKPINPGNAIEVDHIVKKYGDFTAVDDVSFNVKEEEIFGLLGPNGAGKSTLIRMMTTLIPITAGSARIAGHDVSKEPDSVRRTIGVIPQALTSDLDLTIEENMNIYAKLYDVPAKKRKATIDELLELVDLTKWRSAQTKTLSGGMRRRLEIARGLVHSPRIFFLDEPTTGLDPVSRVAVWEMLTNIKSHRQLTILITTHYMDEADRLCDRIAIVDHGKLVALDTPPALKASVPGSNVIEAQFENAPADWEQRLHALNGVTSVQHEGAGMYRILTGDGSRTTTELVEAAVHAGVLVKSLLVQNTSLDDVFVHYTGRQLRDELVKAHIFVMPPRPGMQPLTGCWLLSNAKCGNSSALPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 103 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 104 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 105 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 163 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.58 |
| Rhizosphere | 94.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10199158 | 3300013306 | Bacteria | 2131 |
| 2 | LJNas_1000020 | 3300000546 | Bacteria | 21204 |
| 3 | Ga0065712_10014754 | 3300005290 | Bacteria | 1732 |
| 4 | Ga0065715_10121416 | 3300005293 | Bacteria | 2230 |
| 5 | Ga0065715_10129313 | 3300005293 | Bacteria | 2048 |
| 6 | Ga0070658_10000031 | 3300005327 | Bacteria | 153171 |
| 7 | Ga0070658_10011573 | 3300005327 | Bacteria | 7077 |
| 8 | Ga0070658_10116211 | 3300005327 | Bacteria | 2220 |
| 9 | Ga0070658_10221330 | 3300005327 | Bacteria | 1601 |
| 10 | Ga0070683_100017895 | 3300005329 | Bacteria | 6265 |
| 11 | Ga0070683_100032229 | 3300005329 | Bacteria | 4772 |
| 12 | Ga0070683_100044633 | 3300005329 | Bacteria | 4088 |
| 13 | Ga0070683_100077075 | 3300005329 | Bacteria | 3117 |
| 14 | Ga0070683_100096931 | 3300005329 | Bacteria | 2774 |
| 15 | Ga0070683_100097386 | 3300005329 | Bacteria | 2767 |
| 16 | Ga0070683_100210786 | 3300005329 | Bacteria | 1846 |
| 17 | Ga0070690_100015669 | 3300005330 | Bacteria | 4528 |
| 18 | Ga0070670_100000865 | 3300005331 | Bacteria | 23780 |
| 19 | Ga0070670_100019692 | 3300005331 | Bacteria | 5794 |
| 20 | Ga0070670_100141497 | 3300005331 | Bacteria | 2081 |
| 21 | Ga0068869_100002057 | 3300005334 | Bacteria | 12093 |
| 22 | Ga0068869_100033529 | 3300005334 | Bacteria | 3625 |
| 23 | Ga0068869_100112226 | 3300005334 | Bacteria | 2075 |
| 24 | Ga0070666_10016303 | 3300005335 | Bacteria | 4752 |
| 25 | Ga0070666_10094648 | 3300005335 | Bacteria | 2055 |
| 26 | Ga0070680_100008624 | 3300005336 | Bacteria | 7813 |
| 27 | Ga0070680_100034573 | 3300005336 | Bacteria | 4075 |
| 28 | Ga0070680_100076142 | 3300005336 | Bacteria | 2762 |
| 29 | Ga0070680_100206572 | 3300005336 | Bacteria | 1656 |
| 30 | Ga0070682_100013182 | 3300005337 | Bacteria | 4750 |
| 31 | Ga0068868_100001229 | 3300005338 | Bacteria | 17608 |
| 32 | Ga0068868_100002179 | 3300005338 | Bacteria | 13498 |
| 33 | Ga0068868_100008131 | 3300005338 | Bacteria | 7504 |
| 34 | Ga0068868_100047543 | 3300005338 | Unclassified | 3363 |
| 35 | Ga0068868_100071895 | 3300005338 | Bacteria | 2759 |
| 36 | Ga0068868_100172455 | 3300005338 | Bacteria | 1791 |
| 37 | Ga0068868_100181395 | 3300005338 | Bacteria | 1747 |
| 38 | Ga0070689_100078704 | 3300005340 | Bacteria | 2585 |
| 39 | Ga0070689_100306072 | 3300005340 | Bacteria | 1324 |
| 40 | Ga0070691_10116501 | 3300005341 | Bacteria | 1341 |
| 41 | Ga0070687_100014399 | 3300005343 | Bacteria | 3552 |
| 42 | Ga0070661_100019129 | 3300005344 | Bacteria | 4876 |
| 43 | Ga0070661_100021554 | 3300005344 | Bacteria | 4605 |
| 44 | Ga0070661_100034903 | 3300005344 | Bacteria | 3650 |
| 45 | Ga0070661_100063421 | 3300005344 | Bacteria | 2714 |
| 46 | Ga0070692_10109133 | 3300005345 | Bacteria | 1528 |
| 47 | Ga0070668_100006867 | 3300005347 | Bacteria | 8434 |
| 48 | Ga0070674_100192871 | 3300005356 | Bacteria | 1568 |
| 49 | Ga0070688_100192948 | 3300005365 | Bacteria | 1420 |
| 50 | Ga0070659_100001885 | 3300005366 | Bacteria | 15005 |
| 51 | Ga0070659_100019016 | 3300005366 | Bacteria | 5194 |
| 52 | Ga0070667_100008624 | 3300005367 | Bacteria | 8449 |
| 53 | Ga0070709_10006324 | 3300005434 | Bacteria | 6448 |
| 54 | Ga0070709_10031561 | 3300005434 | Bacteria | 3187 |
| 55 | Ga0070709_10032092 | 3300005434 | Bacteria | 3165 |
| 56 | Ga0070709_10179938 | 3300005434 | Bacteria | 1484 |
| 57 | Ga0070714_100000062 | 3300005435 | Bacteria | 100209 |
| 58 | Ga0070714_100002700 | 3300005435 | Bacteria | 13070 |
| 59 | Ga0070714_100003248 | 3300005435 | Bacteria | 12097 |
| 60 | Ga0070714_100030679 | 3300005435 | Unclassified | 4477 |
| 61 | Ga0070714_100041172 | 3300005435 | Bacteria | 3897 |
| 62 | Ga0070714_100111271 | 3300005435 | Bacteria | 2425 |
| 63 | Ga0070714_100227360 | 3300005435 | Bacteria | 1717 |
| 64 | Ga0070714_100297815 | 3300005435 | Bacteria | 1503 |
| 65 | Ga0070714_100377291 | 3300005435 | Bacteria | 1336 |
| 66 | Ga0070713_100000656 | 3300005436 | Bacteria | 22137 |
| 67 | Ga0070713_100008569 | 3300005436 | Bacteria | 7259 |
| 68 | Ga0070713_100027336 | 3300005436 | Bacteria | 4490 |
| 69 | Ga0070713_100028138 | 3300005436 | Bacteria | 4435 |
| 70 | Ga0070713_100047695 | 3300005436 | Bacteria | 3522 |
| 71 | Ga0070713_100071884 | 3300005436 | Bacteria | 2925 |
| 72 | Ga0070713_100094421 | 3300005436 | Bacteria | 2579 |
| 73 | Ga0070713_100095531 | 3300005436 | Bacteria | 2564 |
| 74 | Ga0070713_100103365 | 3300005436 | Bacteria | 2472 |
| 75 | Ga0070713_100200693 | 3300005436 | Bacteria | 1801 |
| 76 | Ga0070713_100243731 | 3300005436 | Bacteria | 1637 |
| 77 | Ga0070713_100458213 | 3300005436 | Bacteria | 1198 |
| 78 | Ga0070710_10010238 | 3300005437 | Bacteria | 4603 |
| 79 | Ga0070710_10012555 | 3300005437 | Bacteria | 4211 |
| 80 | Ga0070710_10156594 | 3300005437 | Bacteria | 1409 |
| 81 | Ga0070711_100000213 | 3300005439 | Bacteria | 30586 |
| 82 | Ga0070711_100000295 | 3300005439 | Bacteria | 25937 |
| 83 | Ga0070711_100004192 | 3300005439 | Bacteria | 8473 |
| 84 | Ga0070711_100007243 | 3300005439 | Bacteria | 6740 |
| 85 | Ga0070711_100013898 | 3300005439 | Bacteria | 5065 |
| 86 | Ga0070711_100060721 | 3300005439 | Bacteria | 2629 |
| 87 | Ga0070711_100097071 | 3300005439 | Unclassified | 2136 |
| 88 | Ga0070711_100112160 | 3300005439 | Unclassified | 2003 |
| 89 | Ga0070711_100201473 | 3300005439 | Bacteria | 1536 |
| 90 | Ga0070694_100167216 | 3300005444 | Bacteria | 1618 |
| 91 | Ga0070708_100000645 | 3300005445 | Bacteria | 26370 |
| 92 | Ga0070708_100001134 | 3300005445 | Bacteria | 20451 |
| 93 | Ga0070708_100006720 | 3300005445 | Bacteria | 9159 |
| 94 | Ga0070708_100007060 | 3300005445 | Bacteria | 8963 |
| 95 | Ga0070708_100011143 | 3300005445 | Bacteria | 7311 |
| 96 | Ga0070708_100011243 | 3300005445 | Bacteria | 7280 |
| 97 | Ga0070708_100020446 | 3300005445 | Bacteria | 5581 |
| 98 | Ga0070708_100091846 | 3300005445 | Bacteria | 2765 |
| 99 | Ga0070708_100190521 | 3300005445 | Bacteria | 1918 |
| 100 | Ga0070663_100032251 | 3300005455 | Bacteria | 3609 |
| 101 | Ga0070678_100137958 | 3300005456 | Bacteria | 1947 |
| 102 | Ga0070662_100198201 | 3300005457 | Bacteria | 1592 |
| 103 | Ga0070681_10000134 | 3300005458 | Bacteria | 56209 |
| 104 | Ga0070681_10006139 | 3300005458 | Bacteria | 11665 |
| 105 | Ga0070681_10006931 | 3300005458 | Bacteria | 11029 |
| 106 | Ga0070681_10013459 | 3300005458 | Bacteria | 8129 |
| 107 | Ga0070681_10073815 | 3300005458 | Unclassified | 3373 |
| 108 | Ga0070681_10074820 | 3300005458 | Bacteria | 3347 |
| 109 | Ga0068867_100015789 | 3300005459 | Bacteria | 5360 |
| 110 | Ga0070706_100000496 | 3300005467 | Bacteria | 46239 |
| 111 | Ga0070706_100000674 | 3300005467 | Bacteria | 38701 |
| 112 | Ga0070706_100010441 | 3300005467 | Bacteria | 8618 |
| 113 | Ga0070706_100024527 | 3300005467 | Bacteria | 5552 |
| 114 | Ga0070706_100037477 | 3300005467 | Bacteria | 4477 |
| 115 | Ga0070706_100098960 | 3300005467 | Bacteria | 2710 |
| 116 | Ga0070706_100132418 | 3300005467 | Bacteria | 2327 |
| 117 | Ga0070706_100261149 | 3300005467 | Bacteria | 1616 |
| 118 | Ga0070707_100000853 | 3300005468 | Bacteria | 30281 |
| 119 | Ga0070707_100001215 | 3300005468 | Bacteria | 25370 |
| 120 | Ga0070707_100011884 | 3300005468 | Bacteria | 8127 |
| 121 | Ga0070707_100082370 | 3300005468 | Bacteria | 3107 |
| 122 | Ga0070707_100156969 | 3300005468 | Bacteria | 2217 |
| 123 | Ga0070707_100198043 | 3300005468 | Bacteria | 1958 |
| 124 | Ga0070707_100261105 | 3300005468 | Bacteria | 1685 |
| 125 | Ga0070707_100355497 | 3300005468 | Bacteria | 1423 |
| 126 | Ga0070698_100000012 | 3300005471 | Bacteria | 116260 |
| 127 | Ga0070698_100004151 | 3300005471 | Bacteria | 15932 |
| 128 | Ga0070698_100343063 | 3300005471 | Bacteria | 1425 |
| 129 | Ga0070699_100000288 | 3300005518 | Bacteria | 48324 |
| 130 | Ga0070699_100060133 | 3300005518 | Bacteria | 3292 |
| 131 | Ga0070699_100099763 | 3300005518 | Bacteria | 2545 |
| 132 | Ga0070699_100404933 | 3300005518 | Bacteria | 1234 |
| 133 | Ga0070679_100003333 | 3300005530 | Bacteria | 14707 |
| 134 | Ga0070679_100006061 | 3300005530 | Bacteria | 11249 |
| 135 | Ga0070679_100026036 | 3300005530 | Bacteria | 5741 |
| 136 | Ga0070679_100111489 | 3300005530 | Bacteria | 2722 |
| 137 | Ga0070684_100001287 | 3300005535 | Bacteria | 17963 |
| 138 | Ga0070684_100009964 | 3300005535 | Bacteria | 7512 |
| 139 | Ga0070684_100034168 | 3300005535 | Bacteria | 4346 |
| 140 | Ga0070684_100077441 | 3300005535 | Bacteria | 2937 |
| 141 | Ga0070684_100082042 | 3300005535 | Bacteria | 2854 |
| 142 | Ga0070684_100115873 | 3300005535 | Bacteria | 2407 |
| 143 | Ga0070697_100000281 | 3300005536 | Bacteria | 41062 |
| 144 | Ga0070697_100000289 | 3300005536 | Bacteria | 40345 |
| 145 | Ga0070697_100000772 | 3300005536 | Bacteria | 23968 |
| 146 | Ga0070697_100002989 | 3300005536 | Bacteria | 12984 |
| 147 | Ga0070697_100003013 | 3300005536 | Bacteria | 12928 |
| 148 | Ga0070697_100006248 | 3300005536 | Bacteria | 9222 |
| 149 | Ga0070697_100074494 | 3300005536 | Bacteria | 2789 |
| 150 | Ga0070697_100140411 | 3300005536 | Bacteria | 2031 |
| 151 | Ga0068853_100000020 | 3300005539 | Bacteria | 157450 |
| 152 | Ga0068853_100000442 | 3300005539 | Bacteria | 28292 |
| 153 | Ga0068853_100011796 | 3300005539 | Bacteria | 7104 |
| 154 | Ga0068853_100034468 | 3300005539 | Bacteria | 4296 |
| 155 | Ga0068853_100034722 | 3300005539 | Bacteria | 4281 |
| 156 | Ga0068853_100038140 | 3300005539 | Bacteria | 4092 |
| 157 | Ga0068853_100066973 | 3300005539 | Bacteria | 3119 |
| 158 | Ga0068853_100228094 | 3300005539 | Bacteria | 1703 |
| 159 | Ga0070696_100081560 | 3300005546 | Unclassified | 2292 |
| 160 | Ga0070696_100094976 | 3300005546 | Bacteria | 2128 |
| 161 | Ga0070693_100081302 | 3300005547 | Bacteria | 1932 |
| 162 | Ga0070693_100097144 | 3300005547 | Bacteria | 1787 |
| 163 | Ga0070665_100002682 | 3300005548 | Bacteria | 19337 |
| 164 | Ga0070665_100023873 | 3300005548 | Bacteria | 6161 |
| 165 | Ga0070704_100166139 | 3300005549 | Bacteria | 1750 |
| 166 | Ga0068855_100001768 | 3300005563 | Bacteria | 26996 |
| 167 | Ga0068855_100004933 | 3300005563 | Bacteria | 16273 |
| 168 | Ga0068855_100010394 | 3300005563 | Bacteria | 11227 |
| 169 | Ga0068855_100022876 | 3300005563 | Bacteria | 7491 |
| 170 | Ga0068855_100025865 | 3300005563 | Bacteria | 7019 |
| 171 | Ga0068855_100029165 | 3300005563 | Bacteria | 6599 |
| 172 | Ga0068855_100031183 | 3300005563 | Bacteria | 6367 |
| 173 | Ga0068855_100044190 | 3300005563 | Bacteria | 5273 |
| 174 | Ga0068855_100087942 | 3300005563 | Bacteria | 3590 |
| 175 | Ga0068855_100270035 | 3300005563 | Bacteria | 1891 |
| 176 | Ga0070664_100000499 | 3300005564 | Bacteria | 29728 |
| 177 | Ga0070664_100033836 | 3300005564 | Bacteria | 4284 |
| 178 | Ga0070664_100056227 | 3300005564 | Bacteria | 3343 |
| 179 | Ga0070664_100063300 | 3300005564 | Bacteria | 3154 |
| 180 | Ga0068857_100006354 | 3300005577 | Bacteria | 10120 |
| 181 | Ga0068857_100017725 | 3300005577 | Bacteria | 6244 |
| 182 | Ga0068857_100020596 | 3300005577 | Bacteria | 5804 |
| 183 | Ga0068857_100148042 | 3300005577 | Bacteria | 2125 |
| 184 | Ga0068854_100000057 | 3300005578 | Bacteria | 82860 |
| 185 | Ga0068854_100014546 | 3300005578 | Bacteria | 5191 |
| 186 | Ga0068854_100044682 | 3300005578 | Bacteria | 3146 |
| 187 | Ga0068856_100001767 | 3300005614 | Bacteria | 22609 |
| 188 | Ga0068856_100002074 | 3300005614 | Bacteria | 20786 |
| 189 | Ga0068856_100009770 | 3300005614 | Bacteria | 9323 |
| 190 | Ga0068856_100018784 | 3300005614 | Bacteria | 6704 |
| 191 | Ga0068856_100021154 | 3300005614 | Bacteria | 6322 |
| 192 | Ga0068856_100023374 | 3300005614 | Bacteria | 6009 |
| 193 | Ga0068856_100044236 | 3300005614 | Bacteria | 4381 |
| 194 | Ga0068856_100061370 | 3300005614 | Bacteria | 3713 |
| 195 | Ga0068856_100122411 | 3300005614 | Bacteria | 2603 |
| 196 | Ga0068856_100128737 | 3300005614 | Bacteria | 2535 |
| 197 | Ga0068856_100152544 | 3300005614 | Bacteria | 2320 |
| 198 | Ga0068856_100181042 | 3300005614 | Bacteria | 2120 |
| 199 | Ga0068856_100272829 | 3300005614 | Bacteria | 1707 |
| 200 | Ga0068856_100366977 | 3300005614 | Bacteria | 1458 |
| 201 | Ga0070702_100091145 | 3300005615 | Bacteria | 1849 |
| 202 | Ga0068852_100000057 | 3300005616 | Bacteria | 75410 |
| 203 | Ga0068852_100002802 | 3300005616 | Bacteria | 12079 |
| 204 | Ga0068852_100007675 | 3300005616 | Bacteria | 7893 |
| 205 | Ga0068852_100044313 | 3300005616 | Bacteria | 3777 |
| 206 | Ga0068852_100142435 | 3300005616 | Bacteria | 2220 |
| 207 | Ga0068852_100428833 | 3300005616 | Bacteria | 1305 |
| 208 | Ga0068859_100000871 | 3300005617 | Bacteria | 30785 |
| 209 | Ga0068859_100011050 | 3300005617 | Bacteria | 9084 |
| 210 | Ga0068859_100027637 | 3300005617 | Bacteria | 5690 |
| 211 | Ga0068859_100037789 | 3300005617 | Bacteria | 4845 |
| 212 | Ga0068859_100185605 | 3300005617 | Bacteria | 2163 |
| 213 | Ga0068859_100259989 | 3300005617 | Bacteria | 1827 |
| 214 | Ga0068864_100000664 | 3300005618 | Bacteria | 28711 |
| 215 | Ga0068864_100061436 | 3300005618 | Bacteria | 3254 |
| 216 | Ga0068864_100063076 | 3300005618 | Bacteria | 3212 |
| 217 | Ga0068864_100151169 | 3300005618 | Bacteria | 2103 |
| 218 | Ga0068866_10014077 | 3300005718 | Bacteria | 3523 |
| 219 | Ga0068851_10000954 | 3300005834 | Bacteria | 12524 |
| 220 | Ga0068851_10018902 | 3300005834 | Bacteria | 3326 |
| 221 | Ga0068851_10026504 | 3300005834 | Bacteria | 2849 |
| 222 | Ga0068851_10133536 | 3300005834 | Bacteria | 1344 |
| 223 | Ga0068870_10163951 | 3300005840 | Bacteria | 1321 |
| 224 | Ga0068863_100020269 | 3300005841 | Bacteria | 6360 |
| 225 | Ga0068863_100053900 | 3300005841 | Bacteria | 3812 |
| 226 | Ga0068863_100081410 | 3300005841 | Bacteria | 3067 |
| 227 | Ga0068863_100154293 | 3300005841 | Bacteria | 2198 |
| 228 | Ga0068858_100002350 | 3300005842 | Bacteria | 19112 |
| 229 | Ga0068858_100038770 | 3300005842 | Bacteria | 4420 |
| 230 | Ga0068858_100093824 | 3300005842 | Bacteria | 2794 |
| 231 | Ga0068858_100329516 | 3300005842 | Bacteria | 1460 |
| 232 | Ga0068860_100004062 | 3300005843 | Bacteria | 15024 |
| 233 | Ga0068860_100026628 | 3300005843 | Bacteria | 5574 |
| 234 | Ga0068860_100051289 | 3300005843 | Bacteria | 3926 |
| 235 | Ga0068860_100054259 | 3300005843 | Bacteria | 3810 |
| 236 | Ga0068862_100148281 | 3300005844 | Bacteria | 2087 |
| 237 | Ga0070717_10000248 | 3300006028 | Bacteria | 37042 |
| 238 | Ga0070717_10001075 | 3300006028 | Bacteria | 18367 |
| 239 | Ga0070717_10003342 | 3300006028 | Bacteria | 11460 |
| 240 | Ga0070717_10006430 | 3300006028 | Bacteria | 8643 |
| 241 | Ga0070717_10009279 | 3300006028 | Bacteria | 7394 |
| 242 | Ga0070717_10021131 | 3300006028 | Bacteria | 5128 |
| 243 | Ga0070717_10036213 | 3300006028 | Unclassified | 4001 |
| 244 | Ga0070717_10082862 | 3300006028 | Bacteria | 2696 |
| 245 | Ga0070717_10105712 | 3300006028 | Bacteria | 2396 |
| 246 | Ga0070717_10194860 | 3300006028 | Bacteria | 1772 |
| 247 | Ga0070715_10003825 | 3300006163 | Bacteria | 4857 |
| 248 | Ga0070715_10053873 | 3300006163 | Bacteria | 1740 |
| 249 | Ga0070716_100000132 | 3300006173 | Bacteria | 29801 |
| 250 | Ga0070716_100034079 | 3300006173 | Bacteria | 2789 |
| 251 | Ga0070716_100053626 | 3300006173 | Bacteria | 2300 |
| 252 | Ga0070712_100000047 | 3300006175 | Bacteria | 65314 |
| 253 | Ga0070712_100000601 | 3300006175 | Bacteria | 21098 |
| 254 | Ga0070712_100001013 | 3300006175 | Bacteria | 16925 |
| 255 | Ga0070712_100001074 | 3300006175 | Bacteria | 16499 |
| 256 | Ga0070712_100002835 | 3300006175 | Bacteria | 10731 |
| 257 | Ga0070712_100017174 | 3300006175 | Bacteria | 4681 |
| 258 | Ga0070712_100308122 | 3300006175 | Bacteria | 1284 |
| 259 | Ga0097621_100000181 | 3300006237 | Bacteria | 40008 |
| 260 | Ga0097621_100001172 | 3300006237 | Bacteria | 18150 |
| 261 | Ga0097621_100007256 | 3300006237 | Bacteria | 7914 |
| 262 | Ga0097621_100008436 | 3300006237 | Bacteria | 7422 |
| 263 | Ga0097621_100009481 | 3300006237 | Bacteria | 7066 |
| 264 | Ga0097621_100020909 | 3300006237 | Bacteria | 5050 |
| 265 | Ga0097621_100026261 | 3300006237 | Bacteria | 4566 |
| 266 | Ga0097621_100053852 | 3300006237 | Bacteria | 3280 |
| 267 | Ga0097621_100061925 | 3300006237 | Bacteria | 3070 |
| 268 | Ga0097621_100178290 | 3300006237 | Unclassified | 1835 |
| 269 | Ga0068871_100001954 | 3300006358 | Bacteria | 13955 |
| 270 | Ga0068871_100006144 | 3300006358 | Bacteria | 8463 |
| 271 | Ga0068871_100010456 | 3300006358 | Bacteria | 6773 |
| 272 | Ga0068871_100014443 | 3300006358 | Bacteria | 5891 |
| 273 | Ga0068871_100022851 | 3300006358 | Bacteria | 4827 |
| 274 | Ga0068871_100045641 | 3300006358 | Bacteria | 3527 |
| 275 | Ga0068871_100090164 | 3300006358 | Bacteria | 2553 |
| 276 | Ga0075433_10040317 | 3300006852 | Bacteria | 4042 |
| 277 | Ga0075434_100000020 | 3300006871 | Bacteria | 72327 |
| 278 | Ga0068865_100021435 | 3300006881 | Bacteria | 4201 |
| 279 | Ga0068865_100031206 | 3300006881 | Bacteria | 3552 |
| 280 | Ga0075436_100005025 | 3300006914 | Bacteria | 9091 |
| 281 | Ga0075436_100014759 | 3300006914 | Bacteria | 5353 |
| 282 | Ga0097620_100000871 | 3300006931 | Bacteria | 30785 |
| 283 | Ga0097620_100011050 | 3300006931 | Bacteria | 9084 |
| 284 | Ga0097620_100027636 | 3300006931 | Bacteria | 5690 |
| 285 | Ga0097620_100037791 | 3300006931 | Bacteria | 4845 |
| 286 | Ga0097620_100185619 | 3300006931 | Bacteria | 2163 |
| 287 | Ga0097620_100259956 | 3300006931 | Bacteria | 1827 |
| 288 | Ga0075435_100029854 | 3300007076 | Bacteria | 4282 |
| 289 | Ga0075435_100037949 | 3300007076 | Bacteria | 3840 |
| 290 | Ga0075435_100040447 | 3300007076 | Bacteria | 3722 |
| 291 | Ga0099794_10032752 | 3300007265 | Bacteria | 2441 |
| 292 | Ga0105240_10000454 | 3300009093 | Bacteria | 75423 |
| 293 | Ga0105240_10003924 | 3300009093 | Bacteria | 22973 |
| 294 | Ga0105240_10016569 | 3300009093 | Bacteria | 9971 |
| 295 | Ga0105240_10025553 | 3300009093 | Bacteria | 7758 |
| 296 | Ga0105240_10027409 | 3300009093 | Bacteria | 7458 |
| 297 | Ga0105240_10057755 | 3300009093 | Bacteria | 4845 |
| 298 | Ga0105240_10063402 | 3300009093 | Bacteria | 4598 |
| 299 | Ga0105240_10064403 | 3300009093 | Bacteria | 4555 |
| 300 | Ga0105240_10069863 | 3300009093 | Bacteria | 4346 |
| 301 | Ga0105240_10106498 | 3300009093 | Bacteria | 3400 |
| 302 | Ga0105240_10167508 | 3300009093 | Bacteria | 2605 |
| 303 | Ga0105240_10202388 | 3300009093 | Bacteria | 2326 |
| 304 | Ga0105240_10211037 | 3300009093 | Bacteria | 2269 |
| 305 | Ga0105240_10223781 | 3300009093 | Bacteria | 2191 |
| 306 | Ga0105240_10413483 | 3300009093 | Bacteria | 1517 |
| 307 | Ga0105240_10448520 | 3300009093 | Bacteria | 1444 |
| 308 | Ga0105245_10057209 | 3300009098 | Bacteria | 3506 |
| 309 | Ga0105245_10079711 | 3300009098 | Bacteria | 2990 |
| 310 | Ga0105245_10137565 | 3300009098 | Bacteria | 2297 |
| 311 | Ga0105245_10322208 | 3300009098 | Bacteria | 1523 |
| 312 | Ga0105247_10058039 | 3300009101 | Bacteria | 2394 |
| 313 | Ga0114129_10017635 | 3300009147 | Bacteria | 10164 |
| 314 | Ga0105243_10046344 | 3300009148 | Bacteria | 3420 |
| 315 | Ga0105241_10000178 | 3300009174 | Bacteria | 47115 |
| 316 | Ga0105241_10001986 | 3300009174 | Bacteria | 15491 |
| 317 | Ga0105241_10005084 | 3300009174 | Bacteria | 9700 |
| 318 | Ga0105241_10033827 | 3300009174 | Bacteria | 3838 |
| 319 | Ga0105241_10045122 | 3300009174 | Bacteria | 3342 |
| 320 | Ga0105241_10050801 | 3300009174 | Bacteria | 3161 |
| 321 | Ga0105241_10074968 | 3300009174 | Bacteria | 2636 |
| 322 | Ga0105241_10098865 | 3300009174 | Bacteria | 2316 |
| 323 | Ga0105241_10116285 | 3300009174 | Bacteria | 2147 |
| 324 | Ga0105242_10039680 | 3300009176 | Bacteria | 3790 |
| 325 | Ga0105242_10088255 | 3300009176 | Bacteria | 2605 |
| 326 | Ga0105242_10102841 | 3300009176 | Bacteria | 2423 |
| 327 | Ga0105248_10002674 | 3300009177 | Bacteria | 19791 |
| 328 | Ga0105248_10017862 | 3300009177 | Bacteria | 7828 |
| 329 | Ga0105237_10009941 | 3300009545 | Bacteria | 10150 |
| 330 | Ga0105237_10045387 | 3300009545 | Bacteria | 4423 |
| 331 | Ga0105237_10055322 | 3300009545 | Bacteria | 3975 |
| 332 | Ga0105237_10066510 | 3300009545 | Bacteria | 3599 |
| 333 | Ga0105237_10164308 | 3300009545 | Bacteria | 2219 |
| 334 | Ga0105237_10199512 | 3300009545 | Bacteria | 2000 |
| 335 | Ga0105237_10268112 | 3300009545 | Bacteria | 1710 |
| 336 | Ga0105237_10275319 | 3300009545 | Bacteria | 1686 |
| 337 | Ga0105238_10000233 | 3300009551 | Bacteria | 62266 |
| 338 | Ga0105238_10003997 | 3300009551 | Bacteria | 14635 |
| 339 | Ga0105238_10010999 | 3300009551 | Bacteria | 9100 |
| 340 | Ga0105238_10012427 | 3300009551 | Bacteria | 8588 |
| 341 | Ga0105238_10021832 | 3300009551 | Bacteria | 6521 |
| 342 | Ga0105238_10027571 | 3300009551 | Bacteria | 5789 |
| 343 | Ga0105238_10043696 | 3300009551 | Bacteria | 4533 |
| 344 | Ga0105238_10071733 | 3300009551 | Bacteria | 3461 |
| 345 | Ga0105238_10096553 | 3300009551 | Bacteria | 2941 |
| 346 | Ga0105238_10097078 | 3300009551 | Bacteria | 2933 |
| 347 | Ga0105238_10120152 | 3300009551 | Bacteria | 2607 |
| 348 | Ga0105249_10009316 | 3300009553 | Bacteria | 8588 |
| 349 | Ga0105239_10000866 | 3300010375 | Bacteria | 42989 |
| 350 | Ga0105239_10008235 | 3300010375 | Bacteria | 11893 |
| 351 | Ga0105239_10028676 | 3300010375 | Bacteria | 6121 |
| 352 | Ga0105239_10057563 | 3300010375 | Bacteria | 4264 |
| 353 | Ga0105239_10107325 | 3300010375 | Bacteria | 3093 |
| 354 | Ga0105239_10172185 | 3300010375 | Bacteria | 2421 |
| 355 | Ga0105239_10436780 | 3300010375 | Bacteria | 1484 |
| 356 | Ga0157373_10002068 | 3300013100 | Bacteria | 15211 |
| 357 | Ga0157373_10127613 | 3300013100 | Bacteria | 1789 |
| 358 | Ga0157371_10013276 | 3300013102 | Bacteria | 6266 |
| 359 | Ga0157371_10090306 | 3300013102 | Bacteria | 2170 |
| 360 | Ga0157370_10000294 | 3300013104 | Bacteria | 63367 |
| 361 | Ga0157370_10015639 | 3300013104 | Bacteria | 7707 |
| 362 | Ga0157370_10075975 | 3300013104 | Bacteria | 3165 |
| 363 | Ga0157370_10091412 | 3300013104 | Bacteria | 2857 |
| 364 | Ga0157370_10268740 | 3300013104 | Bacteria | 1576 |
| 365 | Ga0157369_10000131 | 3300013105 | Bacteria | 107900 |
| 366 | Ga0157369_10000244 | 3300013105 | Bacteria | 75434 |
| 367 | Ga0157369_10000497 | 3300013105 | Bacteria | 52025 |
| 368 | Ga0157369_10002520 | 3300013105 | Bacteria | 21892 |
| 369 | Ga0157369_10014550 | 3300013105 | Bacteria | 8877 |
| 370 | Ga0157369_10026897 | 3300013105 | Bacteria | 6379 |
| 371 | Ga0157369_10042808 | 3300013105 | Bacteria | 4940 |
| 372 | Ga0157369_10056745 | 3300013105 | Bacteria | 4225 |
| 373 | Ga0157369_10199290 | 3300013105 | Bacteria | 2102 |
| 374 | Ga0157369_10326128 | 3300013105 | Bacteria | 1596 |
| 375 | Ga0157374_10000363 | 3300013296 | Bacteria | 42074 |
| 376 | Ga0157374_10000554 | 3300013296 | Bacteria | 33376 |
| 377 | Ga0157374_10002076 | 3300013296 | Bacteria | 16865 |
| 378 | Ga0157374_10016309 | 3300013296 | Bacteria | 6526 |
| 379 | Ga0157374_10017519 | 3300013296 | Bacteria | 6309 |
| 380 | Ga0157374_10024120 | 3300013296 | Bacteria | 5449 |
| 381 | Ga0157374_10025785 | 3300013296 | Bacteria | 5283 |
| 382 | Ga0157374_10094631 | 3300013296 | Bacteria | 2855 |
| 383 | Ga0157374_10179195 | 3300013296 | Bacteria | 2069 |
| 384 | Ga0157374_10191440 | 3300013296 | Bacteria | 2001 |
| 385 | Ga0157374_10266967 | 3300013296 | Bacteria | 1687 |
| 386 | Ga0157374_10298180 | 3300013296 | Bacteria | 1594 |
| 387 | Ga0157378_10000162 | 3300013297 | Bacteria | 63795 |
| 388 | Ga0157378_10000397 | 3300013297 | Bacteria | 42878 |
| 389 | Ga0157378_10007198 | 3300013297 | Bacteria | 9719 |
| 390 | Ga0157378_10010329 | 3300013297 | Bacteria | 8150 |
| 391 | Ga0157378_10011835 | 3300013297 | Bacteria | 7637 |
| 392 | Ga0157378_10056461 | 3300013297 | Bacteria | 3499 |
| 393 | Ga0157378_10112206 | 3300013297 | Bacteria | 2500 |
| 394 | Ga0157378_10141070 | 3300013297 | Bacteria | 2238 |
| 395 | Ga0157378_10162766 | 3300013297 | Bacteria | 2088 |
| 396 | Ga0157378_10229121 | 3300013297 | Bacteria | 1770 |
| 397 | Ga0163162_10000276 | 3300013306 | Bacteria | 46939 |
| 398 | Ga0163162_10003017 | 3300013306 | Bacteria | 16084 |
| 399 | Ga0163162_10030469 | 3300013306 | Bacteria | 5345 |
| 400 | Ga0163162_10416205 | 3300013306 | Bacteria | 1476 |
| 401 | Ga0157372_10000390 | 3300013307 | Bacteria | 48665 |
| 402 | Ga0157372_10001666 | 3300013307 | Bacteria | 24077 |
| 403 | Ga0157372_10001776 | 3300013307 | Bacteria | 23400 |
| 404 | Ga0157372_10001923 | 3300013307 | Bacteria | 22549 |
| 405 | Ga0157372_10002305 | 3300013307 | Bacteria | 20711 |
| 406 | Ga0157372_10006184 | 3300013307 | Bacteria | 12730 |
| 407 | Ga0157372_10009260 | 3300013307 | Bacteria | 10472 |
| 408 | Ga0157372_10012963 | 3300013307 | Bacteria | 8890 |
| 409 | Ga0157372_10016605 | 3300013307 | Bacteria | 7900 |
| 410 | Ga0157372_10020007 | 3300013307 | Bacteria | 7217 |
| 411 | Ga0157372_10023331 | 3300013307 | Bacteria | 6706 |
| 412 | Ga0157372_10023660 | 3300013307 | Bacteria | 6663 |
| 413 | Ga0157372_10027421 | 3300013307 | Bacteria | 6202 |
| 414 | Ga0157372_10028928 | 3300013307 | Bacteria | 6047 |
| 415 | Ga0157372_10054382 | 3300013307 | Bacteria | 4465 |
| 416 | Ga0157372_10055103 | 3300013307 | Bacteria | 4439 |
| 417 | Ga0157372_10057399 | 3300013307 | Bacteria | 4351 |
| 418 | Ga0157372_10139085 | 3300013307 | Bacteria | 2797 |
| 419 | Ga0157372_10146595 | 3300013307 | Bacteria | 2722 |
| 420 | Ga0157372_10413112 | 3300013307 | Bacteria | 1573 |
| 421 | Ga0157375_10010936 | 3300013308 | Bacteria | 8004 |
| 422 | Ga0157375_10016852 | 3300013308 | Bacteria | 6577 |
| 423 | Ga0157375_10037551 | 3300013308 | Bacteria | 4642 |
| 424 | Ga0163163_10005994 | 3300014325 | Bacteria | 10570 |
| 425 | Ga0163163_10036606 | 3300014325 | Bacteria | 4769 |
| 426 | Ga0163163_10045860 | 3300014325 | Unclassified | 4292 |
| 427 | Ga0163163_10062090 | 3300014325 | Bacteria | 3702 |
| 428 | Ga0163163_10086316 | 3300014325 | Bacteria | 3147 |
| 429 | Ga0157379_10004032 | 3300014968 | Bacteria | 12515 |
| 430 | Ga0157379_10041831 | 3300014968 | Bacteria | 4090 |
| 431 | Ga0157379_10063550 | 3300014968 | Bacteria | 3300 |
| 432 | Ga0157379_10167597 | 3300014968 | Bacteria | 1983 |
| 433 | Ga0157379_10184540 | 3300014968 | Bacteria | 1885 |
| 434 | Ga0157379_10298443 | 3300014968 | Bacteria | 1468 |
| 435 | Ga0157376_10002473 | 3300014969 | Bacteria | 12496 |
| 436 | Ga0157376_10016334 | 3300014969 | Bacteria | 5633 |
| 437 | Ga0157376_10088336 | 3300014969 | Bacteria | 2677 |
| 438 | Ga0157376_10142182 | 3300014969 | Bacteria | 2154 |
| 439 | Ga0157376_10287454 | 3300014969 | Bacteria | 1551 |
| 440 | Ga0157376_10412449 | 3300014969 | Bacteria | 1309 |
| 441 | Ga0213874_10009792 | 3300021377 | Bacteria | 2382 |
| 442 | Ga0213875_10047462 | 3300021388 | Bacteria | 2015 |
| 443 | Ga0224570_100377 | 3300022730 | Bacteria | 3480 |
| 444 | Ga0224569_100841 | 3300022732 | Bacteria | 2590 |
| 445 | Ga0224572_1000147 | 3300024225 | Bacteria | 6073 |
| 446 | Ga0224572_1015171 | 3300024225 | Bacteria | 1473 |
| 447 | Ga0228598_1006077 | 3300024227 | Bacteria | 2505 |
| 448 | Ga0207656_10008238 | 3300025321 | Bacteria | 3827 |
| 449 | Ga0207656_10063070 | 3300025321 | Bacteria | 1630 |
| 450 | Ga0207692_10022170 | 3300025898 | Bacteria | 2919 |
| 451 | Ga0207692_10105940 | 3300025898 | Bacteria | 1552 |
| 452 | Ga0207642_10041543 | 3300025899 | Bacteria | 2015 |
| 453 | Ga0207710_10025761 | 3300025900 | Bacteria | 2540 |
| 454 | Ga0207710_10033604 | 3300025900 | Bacteria | 2250 |
| 455 | Ga0207680_10073566 | 3300025903 | Bacteria | 2125 |
| 456 | Ga0207647_10002559 | 3300025904 | Bacteria | 13755 |
| 457 | Ga0207647_10023490 | 3300025904 | Bacteria | 4076 |
| 458 | Ga0207647_10035457 | 3300025904 | Bacteria | 3179 |
| 459 | Ga0207647_10045211 | 3300025904 | Bacteria | 2748 |
| 460 | Ga0207685_10006966 | 3300025905 | Bacteria | 3118 |
| 461 | Ga0207685_10017722 | 3300025905 | Bacteria | 2310 |
| 462 | Ga0207685_10054817 | 3300025905 | Bacteria | 1554 |
| 463 | Ga0207699_10000189 | 3300025906 | Bacteria | 37481 |
| 464 | Ga0207699_10032143 | 3300025906 | Bacteria | 2954 |
| 465 | Ga0207699_10035928 | 3300025906 | Bacteria | 2822 |
| 466 | Ga0207699_10037186 | 3300025906 | Bacteria | 2781 |
| 467 | Ga0207699_10112884 | 3300025906 | Bacteria | 1745 |
| 468 | Ga0207645_10004443 | 3300025907 | Bacteria | 10383 |
| 469 | Ga0207705_10000171 | 3300025909 | Bacteria | 69439 |
| 470 | Ga0207705_10005338 | 3300025909 | Bacteria | 9609 |
| 471 | Ga0207705_10019372 | 3300025909 | Bacteria | 4865 |
| 472 | Ga0207705_10163214 | 3300025909 | Bacteria | 1675 |
| 473 | Ga0207684_10000475 | 3300025910 | Bacteria | 51854 |
| 474 | Ga0207684_10001079 | 3300025910 | Bacteria | 30538 |
| 475 | Ga0207684_10004709 | 3300025910 | Bacteria | 12796 |
| 476 | Ga0207684_10060411 | 3300025910 | Bacteria | 3219 |
| 477 | Ga0207684_10155845 | 3300025910 | Bacteria | 1966 |
| 478 | Ga0207654_10000059 | 3300025911 | Bacteria | 75594 |
| 479 | Ga0207654_10005858 | 3300025911 | Bacteria | 6198 |
| 480 | Ga0207654_10018595 | 3300025911 | Bacteria | 3650 |
| 481 | Ga0207654_10042497 | 3300025911 | Bacteria | 2573 |
| 482 | Ga0207654_10055590 | 3300025911 | Bacteria | 2292 |
| 483 | Ga0207654_10085702 | 3300025911 | Bacteria | 1908 |
| 484 | Ga0207707_10004211 | 3300025912 | Bacteria | 12731 |
| 485 | Ga0207707_10010273 | 3300025912 | Bacteria | 8124 |
| 486 | Ga0207707_10013862 | 3300025912 | Bacteria | 7030 |
| 487 | Ga0207707_10029785 | 3300025912 | Bacteria | 4774 |
| 488 | Ga0207707_10113562 | 3300025912 | Bacteria | 2367 |
| 489 | Ga0207707_10319024 | 3300025912 | Bacteria | 1342 |
| 490 | Ga0207695_10000096 | 3300025913 | Bacteria | 265048 |
| 491 | Ga0207695_10000570 | 3300025913 | Bacteria | 75451 |
| 492 | Ga0207695_10003417 | 3300025913 | Bacteria | 22409 |
| 493 | Ga0207695_10028488 | 3300025913 | Bacteria | 6193 |
| 494 | Ga0207695_10032643 | 3300025913 | Bacteria | 5695 |
| 495 | Ga0207695_10055498 | 3300025913 | Bacteria | 4128 |
| 496 | Ga0207695_10062197 | 3300025913 | Bacteria | 3855 |
| 497 | Ga0207695_10076222 | 3300025913 | Bacteria | 3410 |
| 498 | Ga0207695_10099744 | 3300025913 | Bacteria | 2901 |
| 499 | Ga0207695_10138803 | 3300025913 | Bacteria | 2382 |
| 500 | Ga0207695_10142806 | 3300025913 | Bacteria | 2340 |
| 501 | Ga0207695_10173161 | 3300025913 | Bacteria | 2083 |
| 502 | Ga0207695_10440737 | 3300025913 | Bacteria | 1186 |
| 503 | Ga0207671_10002674 | 3300025914 | Bacteria | 18699 |
| 504 | Ga0207671_10015500 | 3300025914 | Bacteria | 5964 |
| 505 | Ga0207671_10033927 | 3300025914 | Bacteria | 3795 |
| 506 | Ga0207671_10050221 | 3300025914 | Bacteria | 3089 |
| 507 | Ga0207671_10189965 | 3300025914 | Bacteria | 1601 |
| 508 | Ga0207693_10000210 | 3300025915 | Bacteria | 53555 |
| 509 | Ga0207693_10000537 | 3300025915 | Bacteria | 34386 |
| 510 | Ga0207693_10002933 | 3300025915 | Bacteria | 14760 |
| 511 | Ga0207693_10009006 | 3300025915 | Bacteria | 8147 |
| 512 | Ga0207693_10017069 | 3300025915 | Bacteria | 5794 |
| 513 | Ga0207693_10025121 | 3300025915 | Bacteria | 4726 |
| 514 | Ga0207693_10025681 | 3300025915 | Bacteria | 4668 |
| 515 | Ga0207693_10138348 | 3300025915 | Bacteria | 1915 |
| 516 | Ga0207663_10000279 | 3300025916 | Bacteria | 22307 |
| 517 | Ga0207663_10020339 | 3300025916 | Bacteria | 3757 |
| 518 | Ga0207663_10058823 | 3300025916 | Bacteria | 2428 |
| 519 | Ga0207663_10062404 | 3300025916 | Bacteria | 2369 |
| 520 | Ga0207663_10107960 | 3300025916 | Bacteria | 1884 |
| 521 | Ga0207663_10258872 | 3300025916 | Bacteria | 1284 |
| 522 | Ga0207660_10036880 | 3300025917 | Bacteria | 3401 |
| 523 | Ga0207660_10041176 | 3300025917 | Bacteria | 3236 |
| 524 | Ga0207662_10041063 | 3300025918 | Bacteria | 2722 |
| 525 | Ga0207657_10004750 | 3300025919 | Bacteria | 14344 |
| 526 | Ga0207657_10010068 | 3300025919 | Bacteria | 9454 |
| 527 | Ga0207657_10018159 | 3300025919 | Bacteria | 6728 |
| 528 | Ga0207657_10090247 | 3300025919 | Bacteria | 2558 |
| 529 | Ga0207657_10183670 | 3300025919 | Bacteria | 1690 |
| 530 | Ga0207649_10039735 | 3300025920 | Bacteria | 2854 |
| 531 | Ga0207652_10006502 | 3300025921 | Bacteria | 9418 |
| 532 | Ga0207652_10018778 | 3300025921 | Bacteria | 5675 |
| 533 | Ga0207652_10042027 | 3300025921 | Bacteria | 3889 |
| 534 | Ga0207652_10078278 | 3300025921 | Bacteria | 2887 |
| 535 | Ga0207646_10000178 | 3300025922 | Bacteria | 86727 |
| 536 | Ga0207646_10000632 | 3300025922 | Bacteria | 45779 |
| 537 | Ga0207646_10001378 | 3300025922 | Bacteria | 30144 |
| 538 | Ga0207646_10052696 | 3300025922 | Bacteria | 3641 |
| 539 | Ga0207646_10239242 | 3300025922 | Bacteria | 1640 |
| 540 | Ga0207646_10290685 | 3300025922 | Bacteria | 1477 |
| 541 | Ga0207646_10294130 | 3300025922 | Bacteria | 1467 |
| 542 | Ga0207646_10322847 | 3300025922 | Bacteria | 1395 |
| 543 | Ga0207681_10158329 | 3300025923 | Bacteria | 1704 |
| 544 | Ga0207694_10001230 | 3300025924 | Bacteria | 22207 |
| 545 | Ga0207694_10009730 | 3300025924 | Bacteria | 7251 |
| 546 | Ga0207694_10013316 | 3300025924 | Bacteria | 6192 |
| 547 | Ga0207694_10014603 | 3300025924 | Bacteria | 5922 |
| 548 | Ga0207694_10024896 | 3300025924 | Bacteria | 4546 |
| 549 | Ga0207694_10026831 | 3300025924 | Bacteria | 4385 |
| 550 | Ga0207694_10058071 | 3300025924 | Bacteria | 3010 |
| 551 | Ga0207650_10015148 | 3300025925 | Bacteria | 5366 |
| 552 | Ga0207650_10133029 | 3300025925 | Bacteria | 1948 |
| 553 | Ga0207687_10078817 | 3300025927 | Bacteria | 2373 |
| 554 | Ga0207687_10086462 | 3300025927 | Bacteria | 2277 |
| 555 | Ga0207687_10100025 | 3300025927 | Bacteria | 2132 |
| 556 | Ga0207700_10000385 | 3300025928 | Bacteria | 25704 |
| 557 | Ga0207700_10000443 | 3300025928 | Bacteria | 24359 |
| 558 | Ga0207700_10011819 | 3300025928 | Bacteria | 5590 |
| 559 | Ga0207700_10022360 | 3300025928 | Bacteria | 4339 |
| 560 | Ga0207700_10029523 | 3300025928 | Bacteria | 3870 |
| 561 | Ga0207700_10043322 | 3300025928 | Bacteria | 3305 |
| 562 | Ga0207700_10046520 | 3300025928 | Bacteria | 3209 |
| 563 | Ga0207700_10051164 | 3300025928 | Bacteria | 3082 |
| 564 | Ga0207700_10091658 | 3300025928 | Bacteria | 2401 |
| 565 | Ga0207664_10000977 | 3300025929 | Bacteria | 19275 |
| 566 | Ga0207664_10002047 | 3300025929 | Bacteria | 13275 |
| 567 | Ga0207664_10022887 | 3300025929 | Bacteria | 4674 |
| 568 | Ga0207664_10063377 | 3300025929 | Bacteria | 2954 |
| 569 | Ga0207664_10118384 | 3300025929 | Bacteria | 2213 |
| 570 | Ga0207664_10173020 | 3300025929 | Bacteria | 1849 |
| 571 | Ga0207664_10176352 | 3300025929 | Bacteria | 1833 |
| 572 | Ga0207664_10211441 | 3300025929 | Bacteria | 1678 |
| 573 | Ga0207664_10259191 | 3300025929 | Bacteria | 1520 |
| 574 | Ga0207664_10273951 | 3300025929 | Bacteria | 1479 |
| 575 | Ga0207664_10323194 | 3300025929 | Bacteria | 1362 |
| 576 | Ga0207690_10003276 | 3300025932 | Bacteria | 9707 |
| 577 | Ga0207690_10078148 | 3300025932 | Bacteria | 2302 |
| 578 | Ga0207690_10104254 | 3300025932 | Bacteria | 2031 |
| 579 | Ga0207690_10289911 | 3300025932 | Bacteria | 1277 |
| 580 | Ga0207706_10001043 | 3300025933 | Bacteria | 28102 |
| 581 | Ga0207686_10044025 | 3300025934 | Bacteria | 2739 |
| 582 | Ga0207670_10057635 | 3300025936 | Bacteria | 2635 |
| 583 | Ga0207665_10010386 | 3300025939 | Bacteria | 6116 |
| 584 | Ga0207665_10010710 | 3300025939 | Bacteria | 6022 |
| 585 | Ga0207665_10042300 | 3300025939 | Bacteria | 3045 |
| 586 | Ga0207665_10053915 | 3300025939 | Bacteria | 2711 |
| 587 | Ga0207665_10065001 | 3300025939 | Bacteria | 2480 |
| 588 | Ga0207665_10073619 | 3300025939 | Bacteria | 2336 |
| 589 | Ga0207665_10098024 | 3300025939 | Bacteria | 2042 |
| 590 | Ga0207711_10028907 | 3300025941 | Bacteria | 4670 |
| 591 | Ga0207711_10094862 | 3300025941 | Bacteria | 2630 |
| 592 | Ga0207689_10086129 | 3300025942 | Bacteria | 2582 |
| 593 | Ga0207661_10057631 | 3300025944 | Bacteria | 3124 |
| 594 | Ga0207661_10064655 | 3300025944 | Bacteria | 2966 |
| 595 | Ga0207661_10339411 | 3300025944 | Bacteria | 1353 |
| 596 | Ga0207679_10007363 | 3300025945 | Bacteria | 6979 |
| 597 | Ga0207679_10034205 | 3300025945 | Bacteria | 3583 |
| 598 | Ga0207679_10035208 | 3300025945 | Bacteria | 3540 |
| 599 | Ga0207679_10048506 | 3300025945 | Bacteria | 3092 |
| 600 | Ga0207667_10000056 | 3300025949 | Bacteria | 206107 |
| 601 | Ga0207667_10001636 | 3300025949 | Bacteria | 28204 |
| 602 | Ga0207667_10002468 | 3300025949 | Bacteria | 23083 |
| 603 | Ga0207667_10006361 | 3300025949 | Bacteria | 14316 |
| 604 | Ga0207667_10008520 | 3300025949 | Bacteria | 12177 |
| 605 | Ga0207667_10016174 | 3300025949 | Bacteria | 8437 |
| 606 | Ga0207667_10035667 | 3300025949 | Bacteria | 5335 |
| 607 | Ga0207667_10062087 | 3300025949 | Bacteria | 3908 |
| 608 | Ga0207667_10064854 | 3300025949 | Bacteria | 3811 |
| 609 | Ga0207667_10070314 | 3300025949 | Bacteria | 3643 |
| 610 | Ga0207667_10075773 | 3300025949 | Bacteria | 3492 |
| 611 | Ga0207667_10085675 | 3300025949 | Bacteria | 3261 |
| 612 | Ga0207651_10161546 | 3300025960 | Bacteria | 1757 |
| 613 | Ga0207668_10004546 | 3300025972 | Bacteria | 8162 |
| 614 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 615 | Ga0207640_10007235 | 3300025981 | Bacteria | 6122 |
| 616 | Ga0207677_10005168 | 3300026023 | Bacteria | 7064 |
| 617 | Ga0207677_10029495 | 3300026023 | Bacteria | 3487 |
| 618 | Ga0207677_10038683 | 3300026023 | Bacteria | 3130 |
| 619 | Ga0207677_10045538 | 3300026023 | Bacteria | 2930 |
| 620 | Ga0207677_10143992 | 3300026023 | Bacteria | 1829 |
| 621 | Ga0207703_10002440 | 3300026035 | Bacteria | 16124 |
| 622 | Ga0207703_10077877 | 3300026035 | Bacteria | 2753 |
| 623 | Ga0207703_10126869 | 3300026035 | Bacteria | 2198 |
| 624 | Ga0207639_10000023 | 3300026041 | Bacteria | 215340 |
| 625 | Ga0207639_10000529 | 3300026041 | Bacteria | 26276 |
| 626 | Ga0207639_10148670 | 3300026041 | Bacteria | 1960 |
| 627 | Ga0207678_10004337 | 3300026067 | Bacteria | 12731 |
| 628 | Ga0207678_10018701 | 3300026067 | Bacteria | 6084 |
| 629 | Ga0207708_10069155 | 3300026075 | Bacteria | 2703 |
| 630 | Ga0207702_10000660 | 3300026078 | Bacteria | 37577 |
| 631 | Ga0207702_10006768 | 3300026078 | Bacteria | 9832 |
| 632 | Ga0207702_10011890 | 3300026078 | Bacteria | 7246 |
| 633 | Ga0207702_10012133 | 3300026078 | Bacteria | 7167 |
| 634 | Ga0207702_10034962 | 3300026078 | Bacteria | 4202 |
| 635 | Ga0207702_10062037 | 3300026078 | Bacteria | 3190 |
| 636 | Ga0207702_10171630 | 3300026078 | Bacteria | 1989 |
| 637 | Ga0207702_10234680 | 3300026078 | Bacteria | 1716 |
| 638 | Ga0207702_10378235 | 3300026078 | Bacteria | 1361 |
| 639 | Ga0207641_10034388 | 3300026088 | Bacteria | 4216 |
| 640 | Ga0207641_10045758 | 3300026088 | Bacteria | 3687 |
| 641 | Ga0207641_10072917 | 3300026088 | Bacteria | 2958 |
| 642 | Ga0207641_10133420 | 3300026088 | Bacteria | 2232 |
| 643 | Ga0207648_10006733 | 3300026089 | Bacteria | 11399 |
| 644 | Ga0207648_10112356 | 3300026089 | Bacteria | 2392 |
| 645 | Ga0207676_10048850 | 3300026095 | Bacteria | 3287 |
| 646 | Ga0207674_10005307 | 3300026116 | Bacteria | 15330 |
| 647 | Ga0207674_10018205 | 3300026116 | Bacteria | 7644 |
| 648 | Ga0207674_10018363 | 3300026116 | Bacteria | 7604 |
| 649 | Ga0207674_10049427 | 3300026116 | Bacteria | 4301 |
| 650 | Ga0207674_10087833 | 3300026116 | Bacteria | 3102 |
| 651 | Ga0207675_100118197 | 3300026118 | Bacteria | 2506 |
| 652 | Ga0207683_10060094 | 3300026121 | Bacteria | 3340 |
| 653 | Ga0207698_10000033 | 3300026142 | Bacteria | 110484 |
| 654 | Ga0207698_10000803 | 3300026142 | Bacteria | 18265 |
| 655 | Ga0207698_10014164 | 3300026142 | Bacteria | 5290 |
| 656 | Ga0207698_10118611 | 3300026142 | Bacteria | 2235 |
| 657 | Ga0207698_10145634 | 3300026142 | Bacteria | 2048 |
| 658 | Ga0209998_10008831 | 3300027717 | Bacteria | 2086 |
| 659 | Ga0265356_1000547 | 3300028017 | Bacteria | 6681 |
| 660 | Ga0265355_1000390 | 3300028036 | Bacteria | 2247 |
| 661 | Ga0268266_10171312 | 3300028379 | Bacteria | 1970 |
| 662 | Ga0268264_10034434 | 3300028381 | Bacteria | 4166 |
| 663 | Ga0268264_10036781 | 3300028381 | Bacteria | 4034 |
| 664 | Ga0268264_10060699 | 3300028381 | Bacteria | 3169 |
| 665 | Ga0268264_10076464 | 3300028381 | Bacteria | 2848 |
| 666 | Ga0268264_10076885 | 3300028381 | Bacteria | 2841 |
| 667 | Ga0268264_10240365 | 3300028381 | Bacteria | 1677 |
| 668 | Ga0265318_10005221 | 3300028577 | Bacteria | 6123 |
| 669 | Ga0265323_10025473 | 3300028653 | Bacteria | 2239 |
| 670 | Ga0265338_10000884 | 3300028800 | Bacteria | 50557 |
| 671 | Ga0265338_10005846 | 3300028800 | Bacteria | 15877 |
| 672 | Ga0265338_10010579 | 3300028800 | Bacteria | 10792 |
| 673 | Ga0265338_10015061 | 3300028800 | Bacteria | 8536 |
| 674 | Ga0265338_10016519 | 3300028800 | Bacteria | 8022 |
| 675 | Ga0265338_10023672 | 3300028800 | Bacteria | 6301 |
| 676 | Ga0265338_10025365 | 3300028800 | Bacteria | 6018 |
| 677 | Ga0265338_10028696 | 3300028800 | Bacteria | 5543 |
| 678 | Ga0265338_10029982 | 3300028800 | Bacteria | 5376 |
| 679 | Ga0265338_10030700 | 3300028800 | Bacteria | 5285 |
| 680 | Ga0265338_10052859 | 3300028800 | Bacteria | 3640 |
| 681 | Ga0265338_10059134 | 3300028800 | Bacteria | 3378 |
| 682 | Ga0265762_1000288 | 3300030760 | Bacteria | 8431 |
| 683 | Ga0265762_1005710 | 3300030760 | Bacteria | 2232 |
| 684 | Ga0265770_1002318 | 3300030878 | Bacteria | 2589 |
| 685 | Ga0265765_1004480 | 3300030879 | Bacteria | 1438 |
| 686 | Ga0265760_10000300 | 3300031090 | Bacteria | 13592 |
| 687 | Ga0265760_10002305 | 3300031090 | Bacteria | 5572 |
| 688 | Ga0265760_10042842 | 3300031090 | Bacteria | 1352 |
| 689 | Ga0265330_10000316 | 3300031235 | Bacteria | 34632 |
| 690 | Ga0265330_10016986 | 3300031235 | Bacteria | 3355 |
| 691 | Ga0265330_10017850 | 3300031235 | Bacteria | 3265 |
| 692 | Ga0265332_10097632 | 3300031238 | Bacteria | 1240 |
| 693 | Ga0265328_10034420 | 3300031239 | Bacteria | 1876 |
| 694 | Ga0265325_10000312 | 3300031241 | Bacteria | 34209 |
| 695 | Ga0265325_10003323 | 3300031241 | Bacteria | 10576 |
| 696 | Ga0265325_10012965 | 3300031241 | Bacteria | 4755 |
| 697 | Ga0265325_10014919 | 3300031241 | Bacteria | 4381 |
| 698 | Ga0265325_10059435 | 3300031241 | Bacteria | 1943 |
| 699 | Ga0265340_10011480 | 3300031247 | Bacteria | 4706 |
| 700 | Ga0265340_10031942 | 3300031247 | Bacteria | 2630 |
| 701 | Ga0265340_10075255 | 3300031247 | Bacteria | 1596 |
| 702 | Ga0265339_10000007 | 3300031249 | Bacteria | 241067 |
| 703 | Ga0265339_10000394 | 3300031249 | Bacteria | 34437 |
| 704 | Ga0265339_10004190 | 3300031249 | Bacteria | 9883 |
| 705 | Ga0265339_10020996 | 3300031249 | Bacteria | 3807 |
| 706 | Ga0265339_10040190 | 3300031249 | Bacteria | 2601 |
| 707 | Ga0265339_10073692 | 3300031249 | Bacteria | 1815 |
| 708 | Ga0265331_10020262 | 3300031250 | Bacteria | 3419 |
| 709 | Ga0265331_10022969 | 3300031250 | Bacteria | 3176 |
| 710 | Ga0265327_10033065 | 3300031251 | Bacteria | 2887 |
| 711 | Ga0265316_10000523 | 3300031344 | Bacteria | 43376 |
| 712 | Ga0265316_10000577 | 3300031344 | Bacteria | 40978 |
| 713 | Ga0265316_10001955 | 3300031344 | Bacteria | 21656 |
| 714 | Ga0265316_10015061 | 3300031344 | Bacteria | 6778 |
| 715 | Ga0265316_10036807 | 3300031344 | Bacteria | 3956 |
| 716 | Ga0265316_10040889 | 3300031344 | Bacteria | 3715 |
| 717 | Ga0265316_10058565 | 3300031344 | Bacteria | 3000 |
| 718 | Ga0265316_10061957 | 3300031344 | Bacteria | 2904 |
| 719 | Ga0265316_10116801 | 3300031344 | Bacteria | 2017 |
| 720 | Ga0265316_10148684 | 3300031344 | Bacteria | 1755 |
| 721 | Ga0265313_10007815 | 3300031595 | Bacteria | 7224 |
| 722 | Ga0265313_10010408 | 3300031595 | Bacteria | 5883 |
| 723 | Ga0265313_10015391 | 3300031595 | Bacteria | 4457 |
| 724 | Ga0265313_10016777 | 3300031595 | Bacteria | 4199 |
| 725 | Ga0265314_10000036 | 3300031711 | Bacteria | 234928 |
| 726 | Ga0265314_10014337 | 3300031711 | Bacteria | 6350 |
| 727 | Ga0265314_10019363 | 3300031711 | Bacteria | 5274 |
| 728 | Ga0265314_10035128 | 3300031711 | Bacteria | 3655 |
| 729 | Ga0265314_10094417 | 3300031711 | Bacteria | 1939 |
| 730 | Ga0265314_10159310 | 3300031711 | Archaea | 1375 |
| 731 | Ga0265342_10000927 | 3300031712 | Bacteria | 29139 |
| 732 | Ga0265342_10008880 | 3300031712 | Bacteria | 7154 |
| 733 | Ga0265342_10009400 | 3300031712 | Bacteria | 6898 |
| 734 | Ga0265342_10019662 | 3300031712 | Bacteria | 4348 |
| 735 | Ga0373944_0005067 | 3300035089 | Bacteria | 3458 |
| 736 | Ga0373944_0024314 | 3300035089 | Bacteria | 1774 |
| 737 | Ga0373923_0049533 | 3300035111 | Bacteria | 1757 |
| 738 | Ga0373936_0001156 | 3300035113 | Bacteria | 9481 |
| 739 | Ga0373936_0005969 | 3300035113 | Bacteria | 4586 |
| 740 | Ga0373953_0109767 | 3300035117 | Bacteria | 1166 |
| 741 | Ga0373954_0057446 | 3300035118 | Bacteria | 1833 |
| 742 | Ga0373956_0061172 | 3300035119 | Bacteria | 1706 |
| 743 | Ga0373943_0000004 | 3300035170 | Bacteria | 99386 |
| 744 | Ga0373943_0074006 | 3300035170 | Bacteria | 1731 |
| 745 | Ga0373943_0090030 | 3300035170 | Bacteria | 1588 |
| 746 | Ga0373943_0153203 | 3300035170 | Bacteria | 1250 |
| 747 | Ga0373946_0009075 | 3300035171 | Unclassified | 3659 |
| 748 | Ga0373946_0049612 | 3300035171 | Bacteria | 1751 |
| 749 | Ga0373955_0059453 | 3300035172 | Bacteria | 2105 |
| 750 | Ga0373955_0088270 | 3300035172 | Bacteria | 1763 |
| 751 | Ga0373955_0263409 | 3300035172 | Bacteria | 1035 |
| 752 | Ga0373924_0028898 | 3300035410 | Bacteria | 2212 |
| 753 | Ga0373924_0033401 | 3300035410 | Bacteria | 2077 |
| 754 | Ga0373931_0010296 | 3300035691 | Bacteria | 4494 |
| 755 | Ga0373931_0141339 | 3300035691 | Bacteria | 1394 |
| 756 | Ga0373935_0007828 | 3300035692 | Bacteria | 6406 |
| 757 | Ga0373935_0041922 | 3300035692 | Bacteria | 2877 |
| 758 | Ga0373935_0052155 | 3300035692 | Bacteria | 2600 |
| 759 | Ga0373935_0406774 | 3300035692 | Bacteria | 978 |
| 760 | Ga0373927_0002620 | 3300035695 | Bacteria | 13119 |
| 761 | Ga0373927_0018199 | 3300035695 | Bacteria | 4619 |
| 762 | Ga0373927_0020842 | 3300035695 | Bacteria | 4297 |
| 763 | Ga0373927_0118902 | 3300035695 | Bacteria | 1724 |
| 764 | Ga0373927_0186092 | 3300035695 | Bacteria | 1362 |
| 765 | Ga0373933_0008022 | 3300035724 | Bacteria | 5762 |
| 766 | Ga0373933_0128497 | 3300035724 | Bacteria | 1592 |
| 767 | Ga0373933_0139075 | 3300035724 | Bacteria | 1532 |
| 768 | Ga0373947_0000164 | 3300035725 | Bacteria | 35529 |
| 769 | Ga0373947_0006614 | 3300035725 | Bacteria | 6729 |
| 770 | Ga0373947_0010434 | 3300035725 | Bacteria | 5331 |
| 771 | Ga0373947_0024718 | 3300035725 | Bacteria | 3502 |
| 772 | Ga0373937_0025631 | 3300036401 | Bacteria | 5325 |
| 773 | Ga0373937_0043194 | 3300036401 | Bacteria | 4113 |
| 774 | Ga0373937_0063206 | 3300036401 | Bacteria | 3404 |
| 775 | Ga0373937_0253017 | 3300036401 | Bacteria | 1661 |
| 776 | Ga0373925_0000567 | 3300037068 | Bacteria | 36257 |
| 777 | Ga0373925_0017979 | 3300037068 | Bacteria | 5133 |
| 778 | Ga0373925_0019442 | 3300037068 | Bacteria | 4940 |
| 779 | Ga0373925_0084671 | 3300037068 | Bacteria | 2416 |
| 780 | Ga0373925_0127694 | 3300037068 | Bacteria | 1980 |
| 781 | Ga0373925_0133979 | 3300037068 | Bacteria | 1934 |
| 782 | Ga0373925_0189253 | 3300037068 | Bacteria | 1632 |
| 783 | Ga0373925_0478681 | 3300037068 | Bacteria | 1021 |
| 784 | Ga0436364_0518068 | 3300037853 | Bacteria | 9402 |
| 785 | Ga0436363_0063768 | 3300039450 | Bacteria | 5079 |
| 786 | Ga0436363_1320008 | 3300039450 | Bacteria | 1709 |
| 787 | Ga0436362_0531405 | 3300039453 | Bacteria | 9654 |
| 788 | Ga0436362_0878763 | 3300039453 | Bacteria | 1762 |
| 789 | Ga0451577_0001020 | 3300042876 | Bacteria | 40682 |
| 790 | Ga0451577_0025182 | 3300042876 | Bacteria | 5400 |
| 791 | Ga0453683_0003430 | 3300044673 | Bacteria | 11686 |
| 792 | Ga0453683_0004822 | 3300044673 | Bacteria | 9497 |
| 793 | Ga0453683_0004869 | 3300044673 | Bacteria | 9434 |
| 794 | Ga0453683_0014295 | 3300044673 | Bacteria | 5157 |
| 795 | Ga0466961_0031282 | 3300044693 | Bacteria | 3422 |
| 796 | Ga0466963_0000354 | 3300044694 | Bacteria | 20811 |
| 797 | Ga0453684_0002315 | 3300044712 | Bacteria | 46780 |
| 798 | Ga0453684_0043215 | 3300044712 | Bacteria | 6061 |
| 799 | Ga0453684_0065381 | 3300044712 | Bacteria | 4639 |
| 800 | Ga0466970_0126907 | 3300044765 | Bacteria | 1399 |
| 801 | Ga0466957_0136365 | 3300044842 | Bacteria | 1578 |
| 802 | Ga0466959_0276167 | 3300045049 | Bacteria | 1154 |
| 803 | Ga0451576_0009426 | 3300045051 | Bacteria | 11315 |
| 804 | Ga0451576_0154684 | 3300045051 | Bacteria | 2392 |
| 805 | Ga0451576_0576932 | 3300045051 | Bacteria | 1182 |
| 806 | Ga0466967_0064429 | 3300045976 | Bacteria | 3259 |
| 807 | Ga0466967_0112330 | 3300045976 | Bacteria | 2505 |
| 808 | Ga0466967_0275568 | 3300045976 | Bacteria | 1613 |
| 809 | Ga0466967_0381963 | 3300045976 | Bacteria | 1368 |
| 810 | Ga0495592_0028438 | 3300046454 | Bacteria | 4234 |
| 811 | Ga0495592_0119170 | 3300046454 | Bacteria | 1859 |
| 812 | Ga0495629_0030894 | 3300046459 | Bacteria | 3795 |
| 813 | Ga0495651_0001179 | 3300046462 | Bacteria | 20176 |
| 814 | Ga0495651_0004574 | 3300046462 | Bacteria | 10581 |
| 815 | Ga0495651_0006468 | 3300046462 | Bacteria | 8959 |
| 816 | Ga0495651_0101843 | 3300046462 | Bacteria | 2137 |
| 817 | Ga0495653_0001994 | 3300046463 | Bacteria | 16052 |
| 818 | Ga0495580_0000441 | 3300046472 | Bacteria | 34221 |
| 819 | Ga0495580_0000609 | 3300046472 | Bacteria | 30239 |
| 820 | Ga0495580_0001062 | 3300046472 | Bacteria | 24157 |
| 821 | Ga0495580_0001431 | 3300046472 | Bacteria | 20958 |
| 822 | Ga0495580_0001583 | 3300046472 | Bacteria | 19978 |
| 823 | Ga0495580_0008222 | 3300046472 | Bacteria | 8302 |
| 824 | Ga0495580_0014062 | 3300046472 | Bacteria | 6086 |
| 825 | Ga0495580_0024445 | 3300046472 | Bacteria | 4422 |
| 826 | Ga0495580_0024687 | 3300046472 | Bacteria | 4398 |
| 827 | Ga0495580_0038766 | 3300046472 | Bacteria | 3411 |
| 828 | Ga0495580_0045221 | 3300046472 | Bacteria | 3128 |
| 829 | Ga0495580_0064865 | 3300046472 | Bacteria | 2559 |
| 830 | Ga0495580_0072637 | 3300046472 | Bacteria | 2402 |
| 831 | Ga0495580_0080685 | 3300046472 | Bacteria | 2268 |
| 832 | Ga0495580_0087251 | 3300046472 | Bacteria | 2173 |
| 833 | Ga0495582_0001260 | 3300046473 | Bacteria | 14236 |
| 834 | Ga0495582_0006455 | 3300046473 | Bacteria | 6515 |
| 835 | Ga0495639_0035377 | 3300046475 | Bacteria | 2234 |
| 836 | Ga0495639_0044102 | 3300046475 | Bacteria | 2016 |
| 837 | Ga0495664_0035479 | 3300046477 | Bacteria | 2937 |
| 838 | Ga0495584_0028527 | 3300046491 | Bacteria | 2829 |
| 839 | Ga0495594_0036964 | 3300046499 | Bacteria | 2665 |
| 840 | Ga0495608_0030409 | 3300046511 | Bacteria | 3655 |
| 841 | Ga0495618_0005298 | 3300046514 | Bacteria | 7875 |
| 842 | Ga0495628_0000515 | 3300046516 | Bacteria | 35499 |
| 843 | Ga0495628_0020783 | 3300046516 | Bacteria | 5409 |
| 844 | Ga0495630_0025176 | 3300046517 | Bacteria | 4399 |
| 845 | Ga0495630_0038396 | 3300046517 | Bacteria | 3582 |
| 846 | Ga0495630_0043043 | 3300046517 | Bacteria | 3372 |
| 847 | Ga0495630_0221931 | 3300046517 | Bacteria | 1443 |
| 848 | Ga0495666_0031273 | 3300046526 | Bacteria | 2608 |
| 849 | Ga0495652_0002539 | 3300046529 | Bacteria | 18711 |
| 850 | Ga0495652_0003408 | 3300046529 | Bacteria | 15718 |
| 851 | Ga0495652_0045581 | 3300046529 | Bacteria | 3768 |
| 852 | Ga0495665_0005280 | 3300046531 | Bacteria | 6964 |
| 853 | Ga0495665_0028806 | 3300046531 | Bacteria | 2975 |
| 854 | Ga0495665_0113032 | 3300046531 | Bacteria | 1424 |
| 855 | Ga0495665_0155624 | 3300046531 | Bacteria | 1192 |
| 856 | Ga0495586_0020124 | 3300046535 | Bacteria | 3554 |
| 857 | Ga0495587_0005591 | 3300046536 | Bacteria | 8203 |
| 858 | Ga0495645_0017238 | 3300046543 | Bacteria | 5173 |
| 859 | Ga0495645_0018213 | 3300046543 | Bacteria | 5042 |
| 860 | Ga0495645_0029827 | 3300046543 | Bacteria | 3971 |
| 861 | Ga0495645_0038424 | 3300046543 | Bacteria | 3491 |
| 862 | Ga0495667_0000891 | 3300046559 | Bacteria | 19311 |
| 863 | Ga0495667_0064674 | 3300046559 | Bacteria | 2392 |
| 864 | Ga0495634_0117311 | 3300046642 | Bacteria | 1707 |
| 865 | Ga0495635_0040967 | 3300046663 | Bacteria | 3200 |
| 866 | Ga0495635_0061284 | 3300046663 | Bacteria | 2584 |
| 867 | Ga0495635_0094915 | 3300046663 | Bacteria | 2039 |
| 868 | Ga0495657_0098220 | 3300046675 | Bacteria | 1869 |
| 869 | Ga0495657_0147302 | 3300046675 | Bacteria | 1464 |
| 870 | Ga0495599_0120593 | 3300046678 | Bacteria | 1630 |
| 871 | Ga0495623_0000969 | 3300046679 | Bacteria | 19361 |
| 872 | Ga0495623_0134031 | 3300046679 | Bacteria | 1480 |
| 873 | Ga0495646_0042960 | 3300046680 | Bacteria | 2771 |
| 874 | Ga0495669_0053362 | 3300046684 | Bacteria | 1818 |
| 875 | Ga0495613_0036425 | 3300046689 | Bacteria | 3648 |
| 876 | Ga0495613_0042375 | 3300046689 | Bacteria | 3369 |
| 877 | Ga0495613_0045880 | 3300046689 | Bacteria | 3232 |
| 878 | Ga0495613_0191672 | 3300046689 | Bacteria | 1444 |
| 879 | Ga0495600_0011303 | 3300046809 | Bacteria | 5561 |
| 880 | Ga0495600_0215656 | 3300046809 | Bacteria | 1229 |
| 881 | Ga0495581_0016318 | 3300047315 | Bacteria | 4319 |
| 882 | Ga0495581_0074992 | 3300047315 | Bacteria | 1957 |
| 883 | Ga0495581_0091084 | 3300047315 | Bacteria | 1769 |
| 884 | Ga0495604_0004504 | 3300047317 | Bacteria | 11036 |
| 885 | Ga0495604_0006614 | 3300047317 | Bacteria | 9186 |
| 886 | Ga0495674_0027813 | 3300047319 | Bacteria | 5164 |
| 887 | Ga0495674_0053400 | 3300047319 | Bacteria | 3552 |
| 888 | Ga0495676_0190727 | 3300047321 | Bacteria | 1429 |
| 889 | Ga0495680_0000563 | 3300047322 | Bacteria | 41798 |
| 890 | Ga0495680_0012551 | 3300047322 | Bacteria | 7448 |
| 891 | Ga0495675_0000371 | 3300047444 | Bacteria | 31063 |
| 892 | Ga0495675_0028486 | 3300047444 | Bacteria | 3559 |
| 893 | Ga0495684_0011434 | 3300047471 | Bacteria | 6854 |
| 894 | Ga0495684_0040926 | 3300047471 | Bacteria | 3551 |
| 895 | Ga0495593_0036019 | 3300047673 | Bacteria | 2684 |
| 896 | Ga0495602_0029718 | 3300048088 | Bacteria | 5196 |
| 897 | Ga0495602_0033924 | 3300048088 | Bacteria | 4781 |
| 898 | Ga0495602_0054017 | 3300048088 | Bacteria | 3550 |
| 899 | Ga0495602_0105428 | 3300048088 | Bacteria | 2304 |
| 900 | Ga0495602_0173542 | 3300048088 | Bacteria | 1671 |
| 901 | Ga0495614_0008720 | 3300048089 | Bacteria | 4506 |
| 902 | Ga0496100_0014929 | 3300048903 | Bacteria | 4525 |
| 903 | Ga0496100_0060505 | 3300048903 | Bacteria | 2493 |
| 904 | Ga0496100_0216440 | 3300048903 | Bacteria | 1404 |
| 905 | Ga0496102_0032314 | 3300048905 | Bacteria | 4701 |
| 906 | Ga0496102_0326193 | 3300048905 | Bacteria | 1446 |
| 907 | Ga0496103_0219500 | 3300048906 | Bacteria | 1223 |
| 908 | Ga0496104_0011547 | 3300048907 | Bacteria | 7914 |
| 909 | Ga0496104_0047856 | 3300048907 | Bacteria | 4031 |
| 910 | Ga0496104_0083680 | 3300048907 | Bacteria | 3043 |
| 911 | Ga0496104_0099947 | 3300048907 | Bacteria | 2777 |
| 912 | Ga0496104_0215322 | 3300048907 | Bacteria | 1833 |
| 913 | Ga0496105_0058046 | 3300048908 | Bacteria | 3195 |
| 914 | Ga0496105_0153537 | 3300048908 | Bacteria | 1892 |
| 915 | Ga0496105_0185005 | 3300048908 | Bacteria | 1705 |
| 916 | Ga0496105_0196764 | 3300048908 | Bacteria | 1646 |
| 917 | Ga0496105_0233431 | 3300048908 | Archaea | 1494 |
| 918 | Ga0496107_0067267 | 3300048910 | Bacteria | 2599 |
| 919 | Ga0496107_0081266 | 3300048910 | Bacteria | 2363 |
| 920 | Ga0496107_0136651 | 3300048910 | Bacteria | 1811 |
| 921 | Ga0496108_0109525 | 3300048911 | Bacteria | 2360 |
| 922 | Ga0496109_0015872 | 3300048912 | Bacteria | 6576 |
| 923 | Ga0496109_0024173 | 3300048912 | Bacteria | 5399 |
| 924 | Ga0496109_0125974 | 3300048912 | Bacteria | 2388 |
| 925 | Ga0496109_0182735 | 3300048912 | Bacteria | 1970 |
| 926 | Ga0496110_0058648 | 3300048913 | Bacteria | 3390 |
| 927 | Ga0496110_0100844 | 3300048913 | Bacteria | 2588 |
| 928 | Ga0496110_0186081 | 3300048913 | Bacteria | 1886 |
| 929 | Ga0496110_0240248 | 3300048913 | Bacteria | 1648 |
| 930 | Ga0496111_0071702 | 3300048914 | Bacteria | 2521 |
| 931 | Ga0496112_0001261 | 3300048915 | Bacteria | 19187 |
| 932 | Ga0496112_0003216 | 3300048915 | Bacteria | 13450 |
| 933 | Ga0496112_0029415 | 3300048915 | Bacteria | 5313 |
| 934 | Ga0496112_0038573 | 3300048915 | Unclassified | 4665 |
| 935 | Ga0496112_0055318 | 3300048915 | Bacteria | 3901 |
| 936 | Ga0496112_0117680 | 3300048915 | Bacteria | 2628 |
| 937 | Ga0496112_0152867 | 3300048915 | Bacteria | 2275 |
| 938 | Ga0496112_0279384 | 3300048915 | Bacteria | 1617 |
| 939 | Ga0496113_0141057 | 3300048916 | Bacteria | 1896 |
| 940 | Ga0496113_0160576 | 3300048916 | Bacteria | 1777 |
| 941 | Ga0496114_0030933 | 3300048917 | Bacteria | 4404 |
| 942 | Ga0496114_0067765 | 3300048917 | Bacteria | 2994 |
| 943 | Ga0496115_0003572 | 3300048918 | Bacteria | 11180 |
| 944 | Ga0496115_0007295 | 3300048918 | Bacteria | 8130 |
| 945 | Ga0496115_0227090 | 3300048918 | Bacteria | 1540 |
| 946 | Ga0501031_0146485 | 3300049568 | Bacteria | 1543 |
| 947 | Ga0501048_0147006 | 3300049582 | Bacteria | 1667 |
| 948 | Ga0501067_0043118 | 3300049583 | Bacteria | 2506 |
| 949 | Ga0501075_0027342 | 3300049591 | Bacteria | 4204 |
| 950 | Ga0501083_0027986 | 3300049744 | Bacteria | 3886 |
| 951 | nmdc:mga0n895_47947_c1 | 3300050512 | Bacteria | 4180 |
| 952 | nmdc:mga0rr50_16792_c1 | 3300050513 | Bacteria | 4871 |
| 953 | nmdc:mga0rr50_46448_c1 | 3300050513 | Bacteria | 3197 |
| 954 | nmdc:mga0rr50_69457_c1 | 3300050513 | Bacteria | 2681 |
| 955 | nmdc:mga08x19_11108_c1 | 3300050514 | Bacteria | 5421 |
| 956 | nmdc:mga08x19_2239_c1 | 3300050514 | Bacteria | 11812 |
| 957 | nmdc:mga08x19_2667_c1 | 3300050514 | Bacteria | 10795 |
| 958 | nmdc:mga08x19_77344_c1 | 3300050514 | Bacteria | 2179 |
| 959 | nmdc:mga0a205_232_c1 | 3300050515 | Bacteria | 39253 |
| 960 | Ga0495619_0129677 | 3300053085 | Bacteria | 1732 |
| 961 | Ga0530510_0188495 | 3300061734 | Bacteria | 1531 |
| 962 | Ga0163162_10199158 | |||
| 963 | LJNas_1000020 | |||
| 964 | Ga0065712_10014754 | |||
| 965 | Ga0065715_10121416 | |||
| 966 | Ga0065715_10129313 | |||
| 967 | Ga0070658_10000031 | |||
| 968 | Ga0070658_10011573 | |||
| 969 | Ga0070658_10116211 | |||
| 970 | Ga0070658_10221330 | |||
| 971 | Ga0070683_100017895 | |||
| 972 | Ga0070683_100032229 | |||
| 973 | Ga0070683_100044633 | |||
| 974 | Ga0070683_100077075 | |||
| 975 | Ga0070683_100096931 | |||
| 976 | Ga0070683_100097386 | |||
| 977 | Ga0070683_100210786 | |||
| 978 | Ga0070690_100015669 | |||
| 979 | Ga0070670_100000865 | |||
| 980 | Ga0070670_100019692 | |||
| 981 | Ga0070670_100141497 | |||
| 982 | Ga0068869_100002057 | |||
| 983 | Ga0068869_100033529 | |||
| 984 | Ga0068869_100112226 | |||
| 985 | Ga0070666_10016303 | |||
| 986 | Ga0070666_10094648 | |||
| 987 | Ga0070680_100008624 | |||
| 988 | Ga0070680_100034573 | |||
| 989 | Ga0070680_100076142 | |||
| 990 | Ga0070680_100206572 | |||
| 991 | Ga0070682_100013182 | |||
| 992 | Ga0068868_100001229 | |||
| 993 | Ga0068868_100002179 | |||
| 994 | Ga0068868_100008131 | |||
| 995 | Ga0068868_100047543 | |||
| 996 | Ga0068868_100071895 | |||
| 997 | Ga0068868_100172455 | |||
| 998 | Ga0068868_100181395 | |||
| 999 | Ga0070689_100078704 | |||
| 1000 | Ga0070689_100306072 | |||
| 1001 | Ga0070691_10116501 | |||
| 1002 | Ga0070687_100014399 | |||
| 1003 | Ga0070661_100019129 | |||
| 1004 | Ga0070661_100021554 | |||
| 1005 | Ga0070661_100034903 | |||
| 1006 | Ga0070661_100063421 | |||
| 1007 | Ga0070692_10109133 | |||
| 1008 | Ga0070668_100006867 | |||
| 1009 | Ga0070674_100192871 | |||
| 1010 | Ga0070688_100192948 | |||
| 1011 | Ga0070659_100001885 | |||
| 1012 | Ga0070659_100019016 | |||
| 1013 | Ga0070667_100008624 | |||
| 1014 | Ga0070709_10006324 | |||
| 1015 | Ga0070709_10031561 | |||
| 1016 | Ga0070709_10032092 | |||
| 1017 | Ga0070709_10179938 | |||
| 1018 | Ga0070714_100000062 | |||
| 1019 | Ga0070714_100002700 | |||
| 1020 | Ga0070714_100003248 | |||
| 1021 | Ga0070714_100030679 | |||
| 1022 | Ga0070714_100041172 | |||
| 1023 | Ga0070714_100111271 | |||
| 1024 | Ga0070714_100227360 | |||
| 1025 | Ga0070714_100297815 | |||
| 1026 | Ga0070714_100377291 | |||
| 1027 | Ga0070713_100000656 | |||
| 1028 | Ga0070713_100008569 | |||
| 1029 | Ga0070713_100027336 | |||
| 1030 | Ga0070713_100028138 | |||
| 1031 | Ga0070713_100047695 | |||
| 1032 | Ga0070713_100071884 | |||
| 1033 | Ga0070713_100094421 | |||
| 1034 | Ga0070713_100095531 | |||
| 1035 | Ga0070713_100103365 | |||
| 1036 | Ga0070713_100200693 | |||
| 1037 | Ga0070713_100243731 | |||
| 1038 | Ga0070713_100458213 | |||
| 1039 | Ga0070710_10010238 | |||
| 1040 | Ga0070710_10012555 | |||
| 1041 | Ga0070710_10156594 | |||
| 1042 | Ga0070711_100000213 | |||
| 1043 | Ga0070711_100000295 | |||
| 1044 | Ga0070711_100004192 | |||
| 1045 | Ga0070711_100007243 | |||
| 1046 | Ga0070711_100013898 | |||
| 1047 | Ga0070711_100060721 | |||
| 1048 | Ga0070711_100097071 | |||
| 1049 | Ga0070711_100112160 | |||
| 1050 | Ga0070711_100201473 | |||
| 1051 | Ga0070694_100167216 | |||
| 1052 | Ga0070708_100000645 | |||
| 1053 | Ga0070708_100001134 | |||
| 1054 | Ga0070708_100006720 | |||
| 1055 | Ga0070708_100007060 | |||
| 1056 | Ga0070708_100011143 | |||
| 1057 | Ga0070708_100011243 | |||
| 1058 | Ga0070708_100020446 | |||
| 1059 | Ga0070708_100091846 | |||
| 1060 | Ga0070708_100190521 | |||
| 1061 | Ga0070663_100032251 | |||
| 1062 | Ga0070678_100137958 | |||
| 1063 | Ga0070662_100198201 | |||
| 1064 | Ga0070681_10000134 | |||
| 1065 | Ga0070681_10006139 | |||
| 1066 | Ga0070681_10006931 | |||
| 1067 | Ga0070681_10013459 | |||
| 1068 | Ga0070681_10073815 | |||
| 1069 | Ga0070681_10074820 | |||
| 1070 | Ga0068867_100015789 | |||
| 1071 | Ga0070706_100000496 | |||
| 1072 | Ga0070706_100000674 | |||
| 1073 | Ga0070706_100010441 | |||
| 1074 | Ga0070706_100024527 | |||
| 1075 | Ga0070706_100037477 | |||
| 1076 | Ga0070706_100098960 | |||
| 1077 | Ga0070706_100132418 | |||
| 1078 | Ga0070706_100261149 | |||
| 1079 | Ga0070707_100000853 | |||
| 1080 | Ga0070707_100001215 | |||
| 1081 | Ga0070707_100011884 | |||
| 1082 | Ga0070707_100082370 | |||
| 1083 | Ga0070707_100156969 | |||
| 1084 | Ga0070707_100198043 | |||
| 1085 | Ga0070707_100261105 | |||
| 1086 | Ga0070707_100355497 | |||
| 1087 | Ga0070698_100000012 | |||
| 1088 | Ga0070698_100004151 | |||
| 1089 | Ga0070698_100343063 | |||
| 1090 | Ga0070699_100000288 | |||
| 1091 | Ga0070699_100060133 | |||
| 1092 | Ga0070699_100099763 | |||
| 1093 | Ga0070699_100404933 | |||
| 1094 | Ga0070679_100003333 | |||
| 1095 | Ga0070679_100006061 | |||
| 1096 | Ga0070679_100026036 | |||
| 1097 | Ga0070679_100111489 | |||
| 1098 | Ga0070684_100001287 | |||
| 1099 | Ga0070684_100009964 | |||
| 1100 | Ga0070684_100034168 | |||
| 1101 | Ga0070684_100077441 | |||
| 1102 | Ga0070684_100082042 | |||
| 1103 | Ga0070684_100115873 | |||
| 1104 | Ga0070697_100000281 | |||
| 1105 | Ga0070697_100000289 | |||
| 1106 | Ga0070697_100000772 | |||
| 1107 | Ga0070697_100002989 | |||
| 1108 | Ga0070697_100003013 | |||
| 1109 | Ga0070697_100006248 | |||
| 1110 | Ga0070697_100074494 | |||
| 1111 | Ga0070697_100140411 | |||
| 1112 | Ga0068853_100000020 | |||
| 1113 | Ga0068853_100000442 | |||
| 1114 | Ga0068853_100011796 | |||
| 1115 | Ga0068853_100034468 | |||
| 1116 | Ga0068853_100034722 | |||
| 1117 | Ga0068853_100038140 | |||
| 1118 | Ga0068853_100066973 | |||
| 1119 | Ga0068853_100228094 | |||
| 1120 | Ga0070696_100081560 | |||
| 1121 | Ga0070696_100094976 | |||
| 1122 | Ga0070693_100081302 | |||
| 1123 | Ga0070693_100097144 | |||
| 1124 | Ga0070665_100002682 | |||
| 1125 | Ga0070665_100023873 | |||
| 1126 | Ga0070704_100166139 | |||
| 1127 | Ga0068855_100001768 | |||
| 1128 | Ga0068855_100004933 | |||
| 1129 | Ga0068855_100010394 | |||
| 1130 | Ga0068855_100022876 | |||
| 1131 | Ga0068855_100025865 | |||
| 1132 | Ga0068855_100029165 | |||
| 1133 | Ga0068855_100031183 | |||
| 1134 | Ga0068855_100044190 | |||
| 1135 | Ga0068855_100087942 | |||
| 1136 | Ga0068855_100270035 | |||
| 1137 | Ga0070664_100000499 | |||
| 1138 | Ga0070664_100033836 | |||
| 1139 | Ga0070664_100056227 | |||
| 1140 | Ga0070664_100063300 | |||
| 1141 | Ga0068857_100006354 | |||
| 1142 | Ga0068857_100017725 | |||
| 1143 | Ga0068857_100020596 | |||
| 1144 | Ga0068857_100148042 | |||
| 1145 | Ga0068854_100000057 | |||
| 1146 | Ga0068854_100014546 | |||
| 1147 | Ga0068854_100044682 | |||
| 1148 | Ga0068856_100001767 | |||
| 1149 | Ga0068856_100002074 | |||
| 1150 | Ga0068856_100009770 | |||
| 1151 | Ga0068856_100018784 | |||
| 1152 | Ga0068856_100021154 | |||
| 1153 | Ga0068856_100023374 | |||
| 1154 | Ga0068856_100044236 | |||
| 1155 | Ga0068856_100061370 | |||
| 1156 | Ga0068856_100122411 | |||
| 1157 | Ga0068856_100128737 | |||
| 1158 | Ga0068856_100152544 | |||
| 1159 | Ga0068856_100181042 | |||
| 1160 | Ga0068856_100272829 | |||
| 1161 | Ga0068856_100366977 | |||
| 1162 | Ga0070702_100091145 | |||
| 1163 | Ga0068852_100000057 | |||
| 1164 | Ga0068852_100002802 | |||
| 1165 | Ga0068852_100007675 | |||
| 1166 | Ga0068852_100044313 | |||
| 1167 | Ga0068852_100142435 | |||
| 1168 | Ga0068852_100428833 | |||
| 1169 | Ga0068859_100000871 | |||
| 1170 | Ga0068859_100011050 | |||
| 1171 | Ga0068859_100027637 | |||
| 1172 | Ga0068859_100037789 | |||
| 1173 | Ga0068859_100185605 | |||
| 1174 | Ga0068859_100259989 | |||
| 1175 | Ga0068864_100000664 | |||
| 1176 | Ga0068864_100061436 | |||
| 1177 | Ga0068864_100063076 | |||
| 1178 | Ga0068864_100151169 | |||
| 1179 | Ga0068866_10014077 | |||
| 1180 | Ga0068851_10000954 | |||
| 1181 | Ga0068851_10018902 | |||
| 1182 | Ga0068851_10026504 | |||
| 1183 | Ga0068851_10133536 | |||
| 1184 | Ga0068870_10163951 | |||
| 1185 | Ga0068863_100020269 | |||
| 1186 | Ga0068863_100053900 | |||
| 1187 | Ga0068863_100081410 | |||
| 1188 | Ga0068863_100154293 | |||
| 1189 | Ga0068858_100002350 | |||
| 1190 | Ga0068858_100038770 | |||
| 1191 | Ga0068858_100093824 | |||
| 1192 | Ga0068858_100329516 | |||
| 1193 | Ga0068860_100004062 | |||
| 1194 | Ga0068860_100026628 | |||
| 1195 | Ga0068860_100051289 | |||
| 1196 | Ga0068860_100054259 | |||
| 1197 | Ga0068862_100148281 | |||
| 1198 | Ga0070717_10000248 | |||
| 1199 | Ga0070717_10001075 | |||
| 1200 | Ga0070717_10003342 | |||
| 1201 | Ga0070717_10006430 | |||
| 1202 | Ga0070717_10009279 | |||
| 1203 | Ga0070717_10021131 | |||
| 1204 | Ga0070717_10036213 | |||
| 1205 | Ga0070717_10082862 | |||
| 1206 | Ga0070717_10105712 | |||
| 1207 | Ga0070717_10194860 | |||
| 1208 | Ga0070715_10003825 | |||
| 1209 | Ga0070715_10053873 | |||
| 1210 | Ga0070716_100000132 | |||
| 1211 | Ga0070716_100034079 | |||
| 1212 | Ga0070716_100053626 | |||
| 1213 | Ga0070712_100000047 | |||
| 1214 | Ga0070712_100000601 | |||
| 1215 | Ga0070712_100001013 | |||
| 1216 | Ga0070712_100001074 | |||
| 1217 | Ga0070712_100002835 | |||
| 1218 | Ga0070712_100017174 | |||
| 1219 | Ga0070712_100308122 | |||
| 1220 | Ga0097621_100000181 | |||
| 1221 | Ga0097621_100001172 | |||
| 1222 | Ga0097621_100007256 | |||
| 1223 | Ga0097621_100008436 | |||
| 1224 | Ga0097621_100009481 | |||
| 1225 | Ga0097621_100020909 | |||
| 1226 | Ga0097621_100026261 | |||
| 1227 | Ga0097621_100053852 | |||
| 1228 | Ga0097621_100061925 | |||
| 1229 | Ga0097621_100178290 | |||
| 1230 | Ga0068871_100001954 | |||
| 1231 | Ga0068871_100006144 | |||
| 1232 | Ga0068871_100010456 | |||
| 1233 | Ga0068871_100014443 | |||
| 1234 | Ga0068871_100022851 | |||
| 1235 | Ga0068871_100045641 | |||
| 1236 | Ga0068871_100090164 | |||
| 1237 | Ga0075433_10040317 | |||
| 1238 | Ga0075434_100000020 | |||
| 1239 | Ga0068865_100021435 | |||
| 1240 | Ga0068865_100031206 | |||
| 1241 | Ga0075436_100005025 | |||
| 1242 | Ga0075436_100014759 | |||
| 1243 | Ga0097620_100000871 | |||
| 1244 | Ga0097620_100011050 | |||
| 1245 | Ga0097620_100027636 | |||
| 1246 | Ga0097620_100037791 | |||
| 1247 | Ga0097620_100185619 | |||
| 1248 | Ga0097620_100259956 | |||
| 1249 | Ga0075435_100029854 | |||
| 1250 | Ga0075435_100037949 | |||
| 1251 | Ga0075435_100040447 | |||
| 1252 | Ga0099794_10032752 | |||
| 1253 | Ga0105240_10000454 | |||
| 1254 | Ga0105240_10003924 | |||
| 1255 | Ga0105240_10016569 | |||
| 1256 | Ga0105240_10025553 | |||
| 1257 | Ga0105240_10027409 | |||
| 1258 | Ga0105240_10057755 | |||
| 1259 | Ga0105240_10063402 | |||
| 1260 | Ga0105240_10064403 | |||
| 1261 | Ga0105240_10069863 | |||
| 1262 | Ga0105240_10106498 | |||
| 1263 | Ga0105240_10167508 | |||
| 1264 | Ga0105240_10202388 | |||
| 1265 | Ga0105240_10211037 | |||
| 1266 | Ga0105240_10223781 | |||
| 1267 | Ga0105240_10413483 | |||
| 1268 | Ga0105240_10448520 | |||
| 1269 | Ga0105245_10057209 | |||
| 1270 | Ga0105245_10079711 | |||
| 1271 | Ga0105245_10137565 | |||
| 1272 | Ga0105245_10322208 | |||
| 1273 | Ga0105247_10058039 | |||
| 1274 | Ga0114129_10017635 | |||
| 1275 | Ga0105243_10046344 | |||
| 1276 | Ga0105241_10000178 | |||
| 1277 | Ga0105241_10001986 | |||
| 1278 | Ga0105241_10005084 | |||
| 1279 | Ga0105241_10033827 | |||
| 1280 | Ga0105241_10045122 | |||
| 1281 | Ga0105241_10050801 | |||
| 1282 | Ga0105241_10074968 | |||
| 1283 | Ga0105241_10098865 | |||
| 1284 | Ga0105241_10116285 | |||
| 1285 | Ga0105242_10039680 | |||
| 1286 | Ga0105242_10088255 | |||
| 1287 | Ga0105242_10102841 | |||
| 1288 | Ga0105248_10002674 | |||
| 1289 | Ga0105248_10017862 | |||
| 1290 | Ga0105237_10009941 | |||
| 1291 | Ga0105237_10045387 | |||
| 1292 | Ga0105237_10055322 | |||
| 1293 | Ga0105237_10066510 | |||
| 1294 | Ga0105237_10164308 | |||
| 1295 | Ga0105237_10199512 | |||
| 1296 | Ga0105237_10268112 | |||
| 1297 | Ga0105237_10275319 | |||
| 1298 | Ga0105238_10000233 | |||
| 1299 | Ga0105238_10003997 | |||
| 1300 | Ga0105238_10010999 | |||
| 1301 | Ga0105238_10012427 | |||
| 1302 | Ga0105238_10021832 | |||
| 1303 | Ga0105238_10027571 | |||
| 1304 | Ga0105238_10043696 | |||
| 1305 | Ga0105238_10071733 | |||
| 1306 | Ga0105238_10096553 | |||
| 1307 | Ga0105238_10097078 | |||
| 1308 | Ga0105238_10120152 | |||
| 1309 | Ga0105249_10009316 | |||
| 1310 | Ga0105239_10000866 | |||
| 1311 | Ga0105239_10008235 | |||
| 1312 | Ga0105239_10028676 | |||
| 1313 | Ga0105239_10057563 | |||
| 1314 | Ga0105239_10107325 | |||
| 1315 | Ga0105239_10172185 | |||
| 1316 | Ga0105239_10436780 | |||
| 1317 | Ga0157373_10002068 | |||
| 1318 | Ga0157373_10127613 | |||
| 1319 | Ga0157371_10013276 | |||
| 1320 | Ga0157371_10090306 | |||
| 1321 | Ga0157370_10000294 | |||
| 1322 | Ga0157370_10015639 | |||
| 1323 | Ga0157370_10075975 | |||
| 1324 | Ga0157370_10091412 | |||
| 1325 | Ga0157370_10268740 | |||
| 1326 | Ga0157369_10000131 | |||
| 1327 | Ga0157369_10000244 | |||
| 1328 | Ga0157369_10000497 | |||
| 1329 | Ga0157369_10002520 | |||
| 1330 | Ga0157369_10014550 | |||
| 1331 | Ga0157369_10026897 | |||
| 1332 | Ga0157369_10042808 | |||
| 1333 | Ga0157369_10056745 | |||
| 1334 | Ga0157369_10199290 | |||
| 1335 | Ga0157369_10326128 | |||
| 1336 | Ga0157374_10000363 | |||
| 1337 | Ga0157374_10000554 | |||
| 1338 | Ga0157374_10002076 | |||
| 1339 | Ga0157374_10016309 | |||
| 1340 | Ga0157374_10017519 | |||
| 1341 | Ga0157374_10024120 | |||
| 1342 | Ga0157374_10025785 | |||
| 1343 | Ga0157374_10094631 | |||
| 1344 | Ga0157374_10179195 | |||
| 1345 | Ga0157374_10191440 | |||
| 1346 | Ga0157374_10266967 | |||
| 1347 | Ga0157374_10298180 | |||
| 1348 | Ga0157378_10000162 | |||
| 1349 | Ga0157378_10000397 | |||
| 1350 | Ga0157378_10007198 | |||
| 1351 | Ga0157378_10010329 | |||
| 1352 | Ga0157378_10011835 | |||
| 1353 | Ga0157378_10056461 | |||
| 1354 | Ga0157378_10112206 | |||
| 1355 | Ga0157378_10141070 | |||
| 1356 | Ga0157378_10162766 | |||
| 1357 | Ga0157378_10229121 | |||
| 1358 | Ga0163162_10000276 | |||
| 1359 | Ga0163162_10003017 | |||
| 1360 | Ga0163162_10030469 | |||
| 1361 | Ga0163162_10416205 | |||
| 1362 | Ga0157372_10000390 | |||
| 1363 | Ga0157372_10001666 | |||
| 1364 | Ga0157372_10001776 | |||
| 1365 | Ga0157372_10001923 | |||
| 1366 | Ga0157372_10002305 | |||
| 1367 | Ga0157372_10006184 | |||
| 1368 | Ga0157372_10009260 | |||
| 1369 | Ga0157372_10012963 | |||
| 1370 | Ga0157372_10016605 | |||
| 1371 | Ga0157372_10020007 | |||
| 1372 | Ga0157372_10023331 | |||
| 1373 | Ga0157372_10023660 | |||
| 1374 | Ga0157372_10027421 | |||
| 1375 | Ga0157372_10028928 | |||
| 1376 | Ga0157372_10054382 | |||
| 1377 | Ga0157372_10055103 | |||
| 1378 | Ga0157372_10057399 | |||
| 1379 | Ga0157372_10139085 | |||
| 1380 | Ga0157372_10146595 | |||
| 1381 | Ga0157372_10413112 | |||
| 1382 | Ga0157375_10010936 | |||
| 1383 | Ga0157375_10016852 | |||
| 1384 | Ga0157375_10037551 | |||
| 1385 | Ga0163163_10005994 | |||
| 1386 | Ga0163163_10036606 | |||
| 1387 | Ga0163163_10045860 | |||
| 1388 | Ga0163163_10062090 | |||
| 1389 | Ga0163163_10086316 | |||
| 1390 | Ga0157379_10004032 | |||
| 1391 | Ga0157379_10041831 | |||
| 1392 | Ga0157379_10063550 | |||
| 1393 | Ga0157379_10167597 | |||
| 1394 | Ga0157379_10184540 | |||
| 1395 | Ga0157379_10298443 | |||
| 1396 | Ga0157376_10002473 | |||
| 1397 | Ga0157376_10016334 | |||
| 1398 | Ga0157376_10088336 | |||
| 1399 | Ga0157376_10142182 | |||
| 1400 | Ga0157376_10287454 | |||
| 1401 | Ga0157376_10412449 | |||
| 1402 | Ga0213874_10009792 | |||
| 1403 | Ga0213875_10047462 | |||
| 1404 | Ga0224570_100377 | |||
| 1405 | Ga0224569_100841 | |||
| 1406 | Ga0224572_1000147 | |||
| 1407 | Ga0224572_1015171 | |||
| 1408 | Ga0228598_1006077 | |||
| 1409 | Ga0207656_10008238 | |||
| 1410 | Ga0207656_10063070 | |||
| 1411 | Ga0207692_10022170 | |||
| 1412 | Ga0207692_10105940 | |||
| 1413 | Ga0207642_10041543 | |||
| 1414 | Ga0207710_10025761 | |||
| 1415 | Ga0207710_10033604 | |||
| 1416 | Ga0207680_10073566 | |||
| 1417 | Ga0207647_10002559 | |||
| 1418 | Ga0207647_10023490 | |||
| 1419 | Ga0207647_10035457 | |||
| 1420 | Ga0207647_10045211 | |||
| 1421 | Ga0207685_10006966 | |||
| 1422 | Ga0207685_10017722 | |||
| 1423 | Ga0207685_10054817 | |||
| 1424 | Ga0207699_10000189 | |||
| 1425 | Ga0207699_10032143 | |||
| 1426 | Ga0207699_10035928 | |||
| 1427 | Ga0207699_10037186 | |||
| 1428 | Ga0207699_10112884 | |||
| 1429 | Ga0207645_10004443 | |||
| 1430 | Ga0207705_10000171 | |||
| 1431 | Ga0207705_10005338 | |||
| 1432 | Ga0207705_10019372 | |||
| 1433 | Ga0207705_10163214 | |||
| 1434 | Ga0207684_10000475 | |||
| 1435 | Ga0207684_10001079 | |||
| 1436 | Ga0207684_10004709 | |||
| 1437 | Ga0207684_10060411 | |||
| 1438 | Ga0207684_10155845 | |||
| 1439 | Ga0207654_10000059 | |||
| 1440 | Ga0207654_10005858 | |||
| 1441 | Ga0207654_10018595 | |||
| 1442 | Ga0207654_10042497 | |||
| 1443 | Ga0207654_10055590 | |||
| 1444 | Ga0207654_10085702 | |||
| 1445 | Ga0207707_10004211 | |||
| 1446 | Ga0207707_10010273 | |||
| 1447 | Ga0207707_10013862 | |||
| 1448 | Ga0207707_10029785 | |||
| 1449 | Ga0207707_10113562 | |||
| 1450 | Ga0207707_10319024 | |||
| 1451 | Ga0207695_10000096 | |||
| 1452 | Ga0207695_10000570 | |||
| 1453 | Ga0207695_10003417 | |||
| 1454 | Ga0207695_10028488 | |||
| 1455 | Ga0207695_10032643 | |||
| 1456 | Ga0207695_10055498 | |||
| 1457 | Ga0207695_10062197 | |||
| 1458 | Ga0207695_10076222 | |||
| 1459 | Ga0207695_10099744 | |||
| 1460 | Ga0207695_10138803 | |||
| 1461 | Ga0207695_10142806 | |||
| 1462 | Ga0207695_10173161 | |||
| 1463 | Ga0207695_10440737 | |||
| 1464 | Ga0207671_10002674 | |||
| 1465 | Ga0207671_10015500 | |||
| 1466 | Ga0207671_10033927 | |||
| 1467 | Ga0207671_10050221 | |||
| 1468 | Ga0207671_10189965 | |||
| 1469 | Ga0207693_10000210 | |||
| 1470 | Ga0207693_10000537 | |||
| 1471 | Ga0207693_10002933 | |||
| 1472 | Ga0207693_10009006 | |||
| 1473 | Ga0207693_10017069 | |||
| 1474 | Ga0207693_10025121 | |||
| 1475 | Ga0207693_10025681 | |||
| 1476 | Ga0207693_10138348 | |||
| 1477 | Ga0207663_10000279 | |||
| 1478 | Ga0207663_10020339 | |||
| 1479 | Ga0207663_10058823 | |||
| 1480 | Ga0207663_10062404 | |||
| 1481 | Ga0207663_10107960 | |||
| 1482 | Ga0207663_10258872 | |||
| 1483 | Ga0207660_10036880 | |||
| 1484 | Ga0207660_10041176 | |||
| 1485 | Ga0207662_10041063 | |||
| 1486 | Ga0207657_10004750 | |||
| 1487 | Ga0207657_10010068 | |||
| 1488 | Ga0207657_10018159 | |||
| 1489 | Ga0207657_10090247 | |||
| 1490 | Ga0207657_10183670 | |||
| 1491 | Ga0207649_10039735 | |||
| 1492 | Ga0207652_10006502 | |||
| 1493 | Ga0207652_10018778 | |||
| 1494 | Ga0207652_10042027 | |||
| 1495 | Ga0207652_10078278 | |||
| 1496 | Ga0207646_10000178 | |||
| 1497 | Ga0207646_10000632 | |||
| 1498 | Ga0207646_10001378 | |||
| 1499 | Ga0207646_10052696 | |||
| 1500 | Ga0207646_10239242 | |||
| 1501 | Ga0207646_10290685 | |||
| 1502 | Ga0207646_10294130 | |||
| 1503 | Ga0207646_10322847 | |||
| 1504 | Ga0207681_10158329 | |||
| 1505 | Ga0207694_10001230 | |||
| 1506 | Ga0207694_10009730 | |||
| 1507 | Ga0207694_10013316 | |||
| 1508 | Ga0207694_10014603 | |||
| 1509 | Ga0207694_10024896 | |||
| 1510 | Ga0207694_10026831 | |||
| 1511 | Ga0207694_10058071 | |||
| 1512 | Ga0207650_10015148 | |||
| 1513 | Ga0207650_10133029 | |||
| 1514 | Ga0207687_10078817 | |||
| 1515 | Ga0207687_10086462 | |||
| 1516 | Ga0207687_10100025 | |||
| 1517 | Ga0207700_10000385 | |||
| 1518 | Ga0207700_10000443 | |||
| 1519 | Ga0207700_10011819 | |||
| 1520 | Ga0207700_10022360 | |||
| 1521 | Ga0207700_10029523 | |||
| 1522 | Ga0207700_10043322 | |||
| 1523 | Ga0207700_10046520 | |||
| 1524 | Ga0207700_10051164 | |||
| 1525 | Ga0207700_10091658 | |||
| 1526 | Ga0207664_10000977 | |||
| 1527 | Ga0207664_10002047 | |||
| 1528 | Ga0207664_10022887 | |||
| 1529 | Ga0207664_10063377 | |||
| 1530 | Ga0207664_10118384 | |||
| 1531 | Ga0207664_10173020 | |||
| 1532 | Ga0207664_10176352 | |||
| 1533 | Ga0207664_10211441 | |||
| 1534 | Ga0207664_10259191 | |||
| 1535 | Ga0207664_10273951 | |||
| 1536 | Ga0207664_10323194 | |||
| 1537 | Ga0207690_10003276 | |||
| 1538 | Ga0207690_10078148 | |||
| 1539 | Ga0207690_10104254 | |||
| 1540 | Ga0207690_10289911 | |||
| 1541 | Ga0207706_10001043 | |||
| 1542 | Ga0207686_10044025 | |||
| 1543 | Ga0207670_10057635 | |||
| 1544 | Ga0207665_10010386 | |||
| 1545 | Ga0207665_10010710 | |||
| 1546 | Ga0207665_10042300 | |||
| 1547 | Ga0207665_10053915 | |||
| 1548 | Ga0207665_10065001 | |||
| 1549 | Ga0207665_10073619 | |||
| 1550 | Ga0207665_10098024 | |||
| 1551 | Ga0207711_10028907 | |||
| 1552 | Ga0207711_10094862 | |||
| 1553 | Ga0207689_10086129 | |||
| 1554 | Ga0207661_10057631 | |||
| 1555 | Ga0207661_10064655 | |||
| 1556 | Ga0207661_10339411 | |||
| 1557 | Ga0207679_10007363 | |||
| 1558 | Ga0207679_10034205 | |||
| 1559 | Ga0207679_10035208 | |||
| 1560 | Ga0207679_10048506 | |||
| 1561 | Ga0207667_10000056 | |||
| 1562 | Ga0207667_10001636 | |||
| 1563 | Ga0207667_10002468 | |||
| 1564 | Ga0207667_10006361 | |||
| 1565 | Ga0207667_10008520 | |||
| 1566 | Ga0207667_10016174 | |||
| 1567 | Ga0207667_10035667 | |||
| 1568 | Ga0207667_10062087 | |||
| 1569 | Ga0207667_10064854 | |||
| 1570 | Ga0207667_10070314 | |||
| 1571 | Ga0207667_10075773 | |||
| 1572 | Ga0207667_10085675 | |||
| 1573 | Ga0207651_10161546 | |||
| 1574 | Ga0207668_10004546 | |||
| 1575 | Ga0207640_10000001 | |||
| 1576 | Ga0207640_10007235 | |||
| 1577 | Ga0207677_10005168 | |||
| 1578 | Ga0207677_10029495 | |||
| 1579 | Ga0207677_10038683 | |||
| 1580 | Ga0207677_10045538 | |||
| 1581 | Ga0207677_10143992 | |||
| 1582 | Ga0207703_10002440 | |||
| 1583 | Ga0207703_10077877 | |||
| 1584 | Ga0207703_10126869 | |||
| 1585 | Ga0207639_10000023 | |||
| 1586 | Ga0207639_10000529 | |||
| 1587 | Ga0207639_10148670 | |||
| 1588 | Ga0207678_10004337 | |||
| 1589 | Ga0207678_10018701 | |||
| 1590 | Ga0207708_10069155 | |||
| 1591 | Ga0207702_10000660 | |||
| 1592 | Ga0207702_10006768 | |||
| 1593 | Ga0207702_10011890 | |||
| 1594 | Ga0207702_10012133 | |||
| 1595 | Ga0207702_10034962 | |||
| 1596 | Ga0207702_10062037 | |||
| 1597 | Ga0207702_10171630 | |||
| 1598 | Ga0207702_10234680 | |||
| 1599 | Ga0207702_10378235 | |||
| 1600 | Ga0207641_10034388 | |||
| 1601 | Ga0207641_10045758 | |||
| 1602 | Ga0207641_10072917 | |||
| 1603 | Ga0207641_10133420 | |||
| 1604 | Ga0207648_10006733 | |||
| 1605 | Ga0207648_10112356 | |||
| 1606 | Ga0207676_10048850 | |||
| 1607 | Ga0207674_10005307 | |||
| 1608 | Ga0207674_10018205 | |||
| 1609 | Ga0207674_10018363 | |||
| 1610 | Ga0207674_10049427 | |||
| 1611 | Ga0207674_10087833 | |||
| 1612 | Ga0207675_100118197 | |||
| 1613 | Ga0207683_10060094 | |||
| 1614 | Ga0207698_10000033 | |||
| 1615 | Ga0207698_10000803 | |||
| 1616 | Ga0207698_10014164 | |||
| 1617 | Ga0207698_10118611 | |||
| 1618 | Ga0207698_10145634 | |||
| 1619 | Ga0209998_10008831 | |||
| 1620 | Ga0265356_1000547 | |||
| 1621 | Ga0265355_1000390 | |||
| 1622 | Ga0268266_10171312 | |||
| 1623 | Ga0268264_10034434 | |||
| 1624 | Ga0268264_10036781 | |||
| 1625 | Ga0268264_10060699 | |||
| 1626 | Ga0268264_10076464 | |||
| 1627 | Ga0268264_10076885 | |||
| 1628 | Ga0268264_10240365 | |||
| 1629 | Ga0265318_10005221 | |||
| 1630 | Ga0265323_10025473 | |||
| 1631 | Ga0265338_10000884 | |||
| 1632 | Ga0265338_10005846 | |||
| 1633 | Ga0265338_10010579 | |||
| 1634 | Ga0265338_10015061 | |||
| 1635 | Ga0265338_10016519 | |||
| 1636 | Ga0265338_10023672 | |||
| 1637 | Ga0265338_10025365 | |||
| 1638 | Ga0265338_10028696 | |||
| 1639 | Ga0265338_10029982 | |||
| 1640 | Ga0265338_10030700 | |||
| 1641 | Ga0265338_10052859 | |||
| 1642 | Ga0265338_10059134 | |||
| 1643 | Ga0265762_1000288 | |||
| 1644 | Ga0265762_1005710 | |||
| 1645 | Ga0265770_1002318 | |||
| 1646 | Ga0265765_1004480 | |||
| 1647 | Ga0265760_10000300 | |||
| 1648 | Ga0265760_10002305 | |||
| 1649 | Ga0265760_10042842 | |||
| 1650 | Ga0265330_10000316 | |||
| 1651 | Ga0265330_10016986 | |||
| 1652 | Ga0265330_10017850 | |||
| 1653 | Ga0265332_10097632 | |||
| 1654 | Ga0265328_10034420 | |||
| 1655 | Ga0265325_10000312 | |||
| 1656 | Ga0265325_10003323 | |||
| 1657 | Ga0265325_10012965 | |||
| 1658 | Ga0265325_10014919 | |||
| 1659 | Ga0265325_10059435 | |||
| 1660 | Ga0265340_10011480 | |||
| 1661 | Ga0265340_10031942 | |||
| 1662 | Ga0265340_10075255 | |||
| 1663 | Ga0265339_10000007 | |||
| 1664 | Ga0265339_10000394 | |||
| 1665 | Ga0265339_10004190 | |||
| 1666 | Ga0265339_10020996 | |||
| 1667 | Ga0265339_10040190 | |||
| 1668 | Ga0265339_10073692 | |||
| 1669 | Ga0265331_10020262 | |||
| 1670 | Ga0265331_10022969 | |||
| 1671 | Ga0265327_10033065 | |||
| 1672 | Ga0265316_10000523 | |||
| 1673 | Ga0265316_10000577 | |||
| 1674 | Ga0265316_10001955 | |||
| 1675 | Ga0265316_10015061 | |||
| 1676 | Ga0265316_10036807 | |||
| 1677 | Ga0265316_10040889 | |||
| 1678 | Ga0265316_10058565 | |||
| 1679 | Ga0265316_10061957 | |||
| 1680 | Ga0265316_10116801 | |||
| 1681 | Ga0265316_10148684 | |||
| 1682 | Ga0265313_10007815 | |||
| 1683 | Ga0265313_10010408 | |||
| 1684 | Ga0265313_10015391 | |||
| 1685 | Ga0265313_10016777 | |||
| 1686 | Ga0265314_10000036 | |||
| 1687 | Ga0265314_10014337 | |||
| 1688 | Ga0265314_10019363 | |||
| 1689 | Ga0265314_10035128 | |||
| 1690 | Ga0265314_10094417 | |||
| 1691 | Ga0265314_10159310 | |||
| 1692 | Ga0265342_10000927 | |||
| 1693 | Ga0265342_10008880 | |||
| 1694 | Ga0265342_10009400 | |||
| 1695 | Ga0265342_10019662 | |||
| 1696 | Ga0373944_0005067 | |||
| 1697 | Ga0373944_0024314 | |||
| 1698 | Ga0373923_0049533 | |||
| 1699 | Ga0373936_0001156 | |||
| 1700 | Ga0373936_0005969 | |||
| 1701 | Ga0373953_0109767 | |||
| 1702 | Ga0373954_0057446 | |||
| 1703 | Ga0373956_0061172 | |||
| 1704 | Ga0373943_0000004 | |||
| 1705 | Ga0373943_0074006 | |||
| 1706 | Ga0373943_0090030 | |||
| 1707 | Ga0373943_0153203 | |||
| 1708 | Ga0373946_0009075 | |||
| 1709 | Ga0373946_0049612 | |||
| 1710 | Ga0373955_0059453 | |||
| 1711 | Ga0373955_0088270 | |||
| 1712 | Ga0373955_0263409 | |||
| 1713 | Ga0373924_0028898 | |||
| 1714 | Ga0373924_0033401 | |||
| 1715 | Ga0373931_0010296 | |||
| 1716 | Ga0373931_0141339 | |||
| 1717 | Ga0373935_0007828 | |||
| 1718 | Ga0373935_0041922 | |||
| 1719 | Ga0373935_0052155 | |||
| 1720 | Ga0373935_0406774 | |||
| 1721 | Ga0373927_0002620 | |||
| 1722 | Ga0373927_0018199 | |||
| 1723 | Ga0373927_0020842 | |||
| 1724 | Ga0373927_0118902 | |||
| 1725 | Ga0373927_0186092 | |||
| 1726 | Ga0373933_0008022 | |||
| 1727 | Ga0373933_0128497 | |||
| 1728 | Ga0373933_0139075 | |||
| 1729 | Ga0373947_0000164 | |||
| 1730 | Ga0373947_0006614 | |||
| 1731 | Ga0373947_0010434 | |||
| 1732 | Ga0373947_0024718 | |||
| 1733 | Ga0373937_0025631 | |||
| 1734 | Ga0373937_0043194 | |||
| 1735 | Ga0373937_0063206 | |||
| 1736 | Ga0373937_0253017 | |||
| 1737 | Ga0373925_0000567 | |||
| 1738 | Ga0373925_0017979 | |||
| 1739 | Ga0373925_0019442 | |||
| 1740 | Ga0373925_0084671 | |||
| 1741 | Ga0373925_0127694 | |||
| 1742 | Ga0373925_0133979 | |||
| 1743 | Ga0373925_0189253 | |||
| 1744 | Ga0373925_0478681 | |||
| 1745 | Ga0436364_0518068 | |||
| 1746 | Ga0436363_0063768 | |||
| 1747 | Ga0436363_1320008 | |||
| 1748 | Ga0436362_0531405 | |||
| 1749 | Ga0436362_0878763 | |||
| 1750 | Ga0451577_0001020 | |||
| 1751 | Ga0451577_0025182 | |||
| 1752 | Ga0453683_0003430 | |||
| 1753 | Ga0453683_0004822 | |||
| 1754 | Ga0453683_0004869 | |||
| 1755 | Ga0453683_0014295 | |||
| 1756 | Ga0466961_0031282 | |||
| 1757 | Ga0466963_0000354 | |||
| 1758 | Ga0453684_0002315 | |||
| 1759 | Ga0453684_0043215 | |||
| 1760 | Ga0453684_0065381 | |||
| 1761 | Ga0466970_0126907 | |||
| 1762 | Ga0466957_0136365 | |||
| 1763 | Ga0466959_0276167 | |||
| 1764 | Ga0451576_0009426 | |||
| 1765 | Ga0451576_0154684 | |||
| 1766 | Ga0451576_0576932 | |||
| 1767 | Ga0466967_0064429 | |||
| 1768 | Ga0466967_0112330 | |||
| 1769 | Ga0466967_0275568 | |||
| 1770 | Ga0466967_0381963 | |||
| 1771 | Ga0495592_0028438 | |||
| 1772 | Ga0495592_0119170 | |||
| 1773 | Ga0495629_0030894 | |||
| 1774 | Ga0495651_0001179 | |||
| 1775 | Ga0495651_0004574 | |||
| 1776 | Ga0495651_0006468 | |||
| 1777 | Ga0495651_0101843 | |||
| 1778 | Ga0495653_0001994 | |||
| 1779 | Ga0495580_0000441 | |||
| 1780 | Ga0495580_0000609 | |||
| 1781 | Ga0495580_0001062 | |||
| 1782 | Ga0495580_0001431 | |||
| 1783 | Ga0495580_0001583 | |||
| 1784 | Ga0495580_0008222 | |||
| 1785 | Ga0495580_0014062 | |||
| 1786 | Ga0495580_0024445 | |||
| 1787 | Ga0495580_0024687 | |||
| 1788 | Ga0495580_0038766 | |||
| 1789 | Ga0495580_0045221 | |||
| 1790 | Ga0495580_0064865 | |||
| 1791 | Ga0495580_0072637 | |||
| 1792 | Ga0495580_0080685 | |||
| 1793 | Ga0495580_0087251 | |||
| 1794 | Ga0495582_0001260 | |||
| 1795 | Ga0495582_0006455 | |||
| 1796 | Ga0495639_0035377 | |||
| 1797 | Ga0495639_0044102 | |||
| 1798 | Ga0495664_0035479 | |||
| 1799 | Ga0495584_0028527 | |||
| 1800 | Ga0495594_0036964 | |||
| 1801 | Ga0495608_0030409 | |||
| 1802 | Ga0495618_0005298 | |||
| 1803 | Ga0495628_0000515 | |||
| 1804 | Ga0495628_0020783 | |||
| 1805 | Ga0495630_0025176 | |||
| 1806 | Ga0495630_0038396 | |||
| 1807 | Ga0495630_0043043 | |||
| 1808 | Ga0495630_0221931 | |||
| 1809 | Ga0495666_0031273 | |||
| 1810 | Ga0495652_0002539 | |||
| 1811 | Ga0495652_0003408 | |||
| 1812 | Ga0495652_0045581 | |||
| 1813 | Ga0495665_0005280 | |||
| 1814 | Ga0495665_0028806 | |||
| 1815 | Ga0495665_0113032 | |||
| 1816 | Ga0495665_0155624 | |||
| 1817 | Ga0495586_0020124 | |||
| 1818 | Ga0495587_0005591 | |||
| 1819 | Ga0495645_0017238 | |||
| 1820 | Ga0495645_0018213 | |||
| 1821 | Ga0495645_0029827 | |||
| 1822 | Ga0495645_0038424 | |||
| 1823 | Ga0495667_0000891 | |||
| 1824 | Ga0495667_0064674 | |||
| 1825 | Ga0495634_0117311 | |||
| 1826 | Ga0495635_0040967 | |||
| 1827 | Ga0495635_0061284 | |||
| 1828 | Ga0495635_0094915 | |||
| 1829 | Ga0495657_0098220 | |||
| 1830 | Ga0495657_0147302 | |||
| 1831 | Ga0495599_0120593 | |||
| 1832 | Ga0495623_0000969 | |||
| 1833 | Ga0495623_0134031 | |||
| 1834 | Ga0495646_0042960 | |||
| 1835 | Ga0495669_0053362 | |||
| 1836 | Ga0495613_0036425 | |||
| 1837 | Ga0495613_0042375 | |||
| 1838 | Ga0495613_0045880 | |||
| 1839 | Ga0495613_0191672 | |||
| 1840 | Ga0495600_0011303 | |||
| 1841 | Ga0495600_0215656 | |||
| 1842 | Ga0495581_0016318 | |||
| 1843 | Ga0495581_0074992 | |||
| 1844 | Ga0495581_0091084 | |||
| 1845 | Ga0495604_0004504 | |||
| 1846 | Ga0495604_0006614 | |||
| 1847 | Ga0495674_0027813 | |||
| 1848 | Ga0495674_0053400 | |||
| 1849 | Ga0495676_0190727 | |||
| 1850 | Ga0495680_0000563 | |||
| 1851 | Ga0495680_0012551 | |||
| 1852 | Ga0495675_0000371 | |||
| 1853 | Ga0495675_0028486 | |||
| 1854 | Ga0495684_0011434 | |||
| 1855 | Ga0495684_0040926 | |||
| 1856 | Ga0495593_0036019 | |||
| 1857 | Ga0495602_0029718 | |||
| 1858 | Ga0495602_0033924 | |||
| 1859 | Ga0495602_0054017 | |||
| 1860 | Ga0495602_0105428 | |||
| 1861 | Ga0495602_0173542 | |||
| 1862 | Ga0495614_0008720 | |||
| 1863 | Ga0496100_0014929 | |||
| 1864 | Ga0496100_0060505 | |||
| 1865 | Ga0496100_0216440 | |||
| 1866 | Ga0496102_0032314 | |||
| 1867 | Ga0496102_0326193 | |||
| 1868 | Ga0496103_0219500 | |||
| 1869 | Ga0496104_0011547 | |||
| 1870 | Ga0496104_0047856 | |||
| 1871 | Ga0496104_0083680 | |||
| 1872 | Ga0496104_0099947 | |||
| 1873 | Ga0496104_0215322 | |||
| 1874 | Ga0496105_0058046 | |||
| 1875 | Ga0496105_0153537 | |||
| 1876 | Ga0496105_0185005 | |||
| 1877 | Ga0496105_0196764 | |||
| 1878 | Ga0496105_0233431 | |||
| 1879 | Ga0496107_0067267 | |||
| 1880 | Ga0496107_0081266 | |||
| 1881 | Ga0496107_0136651 | |||
| 1882 | Ga0496108_0109525 | |||
| 1883 | Ga0496109_0015872 | |||
| 1884 | Ga0496109_0024173 | |||
| 1885 | Ga0496109_0125974 | |||
| 1886 | Ga0496109_0182735 | |||
| 1887 | Ga0496110_0058648 | |||
| 1888 | Ga0496110_0100844 | |||
| 1889 | Ga0496110_0186081 | |||
| 1890 | Ga0496110_0240248 | |||
| 1891 | Ga0496111_0071702 | |||
| 1892 | Ga0496112_0001261 | |||
| 1893 | Ga0496112_0003216 | |||
| 1894 | Ga0496112_0029415 | |||
| 1895 | Ga0496112_0038573 | |||
| 1896 | Ga0496112_0055318 | |||
| 1897 | Ga0496112_0117680 | |||
| 1898 | Ga0496112_0152867 | |||
| 1899 | Ga0496112_0279384 | |||
| 1900 | Ga0496113_0141057 | |||
| 1901 | Ga0496113_0160576 | |||
| 1902 | Ga0496114_0030933 | |||
| 1903 | Ga0496114_0067765 | |||
| 1904 | Ga0496115_0003572 | |||
| 1905 | Ga0496115_0007295 | |||
| 1906 | Ga0496115_0227090 | |||
| 1907 | Ga0501031_0146485 | |||
| 1908 | Ga0501048_0147006 | |||
| 1909 | Ga0501067_0043118 | |||
| 1910 | Ga0501075_0027342 | |||
| 1911 | Ga0501083_0027986 | |||
| 1912 | nmdc:mga0n895_47947_c1 | |||
| 1913 | nmdc:mga0rr50_16792_c1 | |||
| 1914 | nmdc:mga0rr50_46448_c1 | |||
| 1915 | nmdc:mga0rr50_69457_c1 | |||
| 1916 | nmdc:mga08x19_11108_c1 | |||
| 1917 | nmdc:mga08x19_2239_c1 | |||
| 1918 | nmdc:mga08x19_2667_c1 | |||
| 1919 | nmdc:mga08x19_77344_c1 | |||
| 1920 | nmdc:mga0a205_232_c1 | |||
| 1921 | Ga0495619_0129677 | |||
| 1922 | Ga0530510_0188495 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9541 | 18 | 235 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9505 | 20 | 242 |
| 8bmp-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp | 0.945 | 18 | 240 |
| 7nnu-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs | 0.944 | 18 | 243 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9434 | 18 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9726 | 21 | 242 | 3.40.50.300 |
| af_Q8T6J0_514_774_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9704 | 19 | 241 | 3.40.50.300 |
| af_Q9VDR4_479_718_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9661 | 19 | 240 | 3.40.50.300 |
| af_A4I2P8_1496_1744_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9646 | 19 | 242 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9643 | 21 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R0D0B4-F1-model_v4 | ABC transporter domain-containing protein | 0.9809 | 21 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A7C6CAI4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9777 | 18 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A170S8R2-F1-model_v4 | ABC transporter ATP-binding protein (Daunorubicin resistance ATP-binding protein) | 0.9762 | 18 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A842TW32-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9741 | 18 | 242 |
GO:0005524
GO:0016887 |
| AF-A0A0D1P4L1-F1-model_v4 | deleted | 0.9704 | 18 | 242 |
|