F486865

General Info

Members Datasets Scaffolds Average Seq Length
961 279 1922 348

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10199158|Ga0163162_101991582
Length 378
Sequence MVADLKPNGGAGARQPAADGRAKPINPGNAIEVDHIVKKYGDFTAVDDVSFNVKEEEIFGLLGPNGAGKSTLIRMMTTLIPITAGSARIAGHDVSKEPDSVRRTIGVIPQALTSDLDLTIEENMNIYAKLYDVPAKKRKATIDELLELVDLTKWRSAQTKTLSGGMRRRLEIARGLVHSPRIFFLDEPTTGLDPVSRVAVWEMLTNIKSHRQLTILITTHYMDEADRLCDRIAIVDHGKLVALDTPPALKASVPGSNVIEAQFENAPADWEQRLHALNGVTSVQHEGAGMYRILTGDGSRTTTELVEAAVHAGVLVKSLLVQNTSLDDVFVHYTGRQLRDELVKAHIFVMPPRPGMQPLTGCWLLSNAKCGNSSALPR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
103 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.58
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10199158 3300013306 Bacteria 2131
2 LJNas_1000020 3300000546 Bacteria 21204
3 Ga0065712_10014754 3300005290 Bacteria 1732
4 Ga0065715_10121416 3300005293 Bacteria 2230
5 Ga0065715_10129313 3300005293 Bacteria 2048
6 Ga0070658_10000031 3300005327 Bacteria 153171
7 Ga0070658_10011573 3300005327 Bacteria 7077
8 Ga0070658_10116211 3300005327 Bacteria 2220
9 Ga0070658_10221330 3300005327 Bacteria 1601
10 Ga0070683_100017895 3300005329 Bacteria 6265
11 Ga0070683_100032229 3300005329 Bacteria 4772
12 Ga0070683_100044633 3300005329 Bacteria 4088
13 Ga0070683_100077075 3300005329 Bacteria 3117
14 Ga0070683_100096931 3300005329 Bacteria 2774
15 Ga0070683_100097386 3300005329 Bacteria 2767
16 Ga0070683_100210786 3300005329 Bacteria 1846
17 Ga0070690_100015669 3300005330 Bacteria 4528
18 Ga0070670_100000865 3300005331 Bacteria 23780
19 Ga0070670_100019692 3300005331 Bacteria 5794
20 Ga0070670_100141497 3300005331 Bacteria 2081
21 Ga0068869_100002057 3300005334 Bacteria 12093
22 Ga0068869_100033529 3300005334 Bacteria 3625
23 Ga0068869_100112226 3300005334 Bacteria 2075
24 Ga0070666_10016303 3300005335 Bacteria 4752
25 Ga0070666_10094648 3300005335 Bacteria 2055
26 Ga0070680_100008624 3300005336 Bacteria 7813
27 Ga0070680_100034573 3300005336 Bacteria 4075
28 Ga0070680_100076142 3300005336 Bacteria 2762
29 Ga0070680_100206572 3300005336 Bacteria 1656
30 Ga0070682_100013182 3300005337 Bacteria 4750
31 Ga0068868_100001229 3300005338 Bacteria 17608
32 Ga0068868_100002179 3300005338 Bacteria 13498
33 Ga0068868_100008131 3300005338 Bacteria 7504
34 Ga0068868_100047543 3300005338 Unclassified 3363
35 Ga0068868_100071895 3300005338 Bacteria 2759
36 Ga0068868_100172455 3300005338 Bacteria 1791
37 Ga0068868_100181395 3300005338 Bacteria 1747
38 Ga0070689_100078704 3300005340 Bacteria 2585
39 Ga0070689_100306072 3300005340 Bacteria 1324
40 Ga0070691_10116501 3300005341 Bacteria 1341
41 Ga0070687_100014399 3300005343 Bacteria 3552
42 Ga0070661_100019129 3300005344 Bacteria 4876
43 Ga0070661_100021554 3300005344 Bacteria 4605
44 Ga0070661_100034903 3300005344 Bacteria 3650
45 Ga0070661_100063421 3300005344 Bacteria 2714
46 Ga0070692_10109133 3300005345 Bacteria 1528
47 Ga0070668_100006867 3300005347 Bacteria 8434
48 Ga0070674_100192871 3300005356 Bacteria 1568
49 Ga0070688_100192948 3300005365 Bacteria 1420
50 Ga0070659_100001885 3300005366 Bacteria 15005
51 Ga0070659_100019016 3300005366 Bacteria 5194
52 Ga0070667_100008624 3300005367 Bacteria 8449
53 Ga0070709_10006324 3300005434 Bacteria 6448
54 Ga0070709_10031561 3300005434 Bacteria 3187
55 Ga0070709_10032092 3300005434 Bacteria 3165
56 Ga0070709_10179938 3300005434 Bacteria 1484
57 Ga0070714_100000062 3300005435 Bacteria 100209
58 Ga0070714_100002700 3300005435 Bacteria 13070
59 Ga0070714_100003248 3300005435 Bacteria 12097
60 Ga0070714_100030679 3300005435 Unclassified 4477
61 Ga0070714_100041172 3300005435 Bacteria 3897
62 Ga0070714_100111271 3300005435 Bacteria 2425
63 Ga0070714_100227360 3300005435 Bacteria 1717
64 Ga0070714_100297815 3300005435 Bacteria 1503
65 Ga0070714_100377291 3300005435 Bacteria 1336
66 Ga0070713_100000656 3300005436 Bacteria 22137
67 Ga0070713_100008569 3300005436 Bacteria 7259
68 Ga0070713_100027336 3300005436 Bacteria 4490
69 Ga0070713_100028138 3300005436 Bacteria 4435
70 Ga0070713_100047695 3300005436 Bacteria 3522
71 Ga0070713_100071884 3300005436 Bacteria 2925
72 Ga0070713_100094421 3300005436 Bacteria 2579
73 Ga0070713_100095531 3300005436 Bacteria 2564
74 Ga0070713_100103365 3300005436 Bacteria 2472
75 Ga0070713_100200693 3300005436 Bacteria 1801
76 Ga0070713_100243731 3300005436 Bacteria 1637
77 Ga0070713_100458213 3300005436 Bacteria 1198
78 Ga0070710_10010238 3300005437 Bacteria 4603
79 Ga0070710_10012555 3300005437 Bacteria 4211
80 Ga0070710_10156594 3300005437 Bacteria 1409
81 Ga0070711_100000213 3300005439 Bacteria 30586
82 Ga0070711_100000295 3300005439 Bacteria 25937
83 Ga0070711_100004192 3300005439 Bacteria 8473
84 Ga0070711_100007243 3300005439 Bacteria 6740
85 Ga0070711_100013898 3300005439 Bacteria 5065
86 Ga0070711_100060721 3300005439 Bacteria 2629
87 Ga0070711_100097071 3300005439 Unclassified 2136
88 Ga0070711_100112160 3300005439 Unclassified 2003
89 Ga0070711_100201473 3300005439 Bacteria 1536
90 Ga0070694_100167216 3300005444 Bacteria 1618
91 Ga0070708_100000645 3300005445 Bacteria 26370
92 Ga0070708_100001134 3300005445 Bacteria 20451
93 Ga0070708_100006720 3300005445 Bacteria 9159
94 Ga0070708_100007060 3300005445 Bacteria 8963
95 Ga0070708_100011143 3300005445 Bacteria 7311
96 Ga0070708_100011243 3300005445 Bacteria 7280
97 Ga0070708_100020446 3300005445 Bacteria 5581
98 Ga0070708_100091846 3300005445 Bacteria 2765
99 Ga0070708_100190521 3300005445 Bacteria 1918
100 Ga0070663_100032251 3300005455 Bacteria 3609
101 Ga0070678_100137958 3300005456 Bacteria 1947
102 Ga0070662_100198201 3300005457 Bacteria 1592
103 Ga0070681_10000134 3300005458 Bacteria 56209
104 Ga0070681_10006139 3300005458 Bacteria 11665
105 Ga0070681_10006931 3300005458 Bacteria 11029
106 Ga0070681_10013459 3300005458 Bacteria 8129
107 Ga0070681_10073815 3300005458 Unclassified 3373
108 Ga0070681_10074820 3300005458 Bacteria 3347
109 Ga0068867_100015789 3300005459 Bacteria 5360
110 Ga0070706_100000496 3300005467 Bacteria 46239
111 Ga0070706_100000674 3300005467 Bacteria 38701
112 Ga0070706_100010441 3300005467 Bacteria 8618
113 Ga0070706_100024527 3300005467 Bacteria 5552
114 Ga0070706_100037477 3300005467 Bacteria 4477
115 Ga0070706_100098960 3300005467 Bacteria 2710
116 Ga0070706_100132418 3300005467 Bacteria 2327
117 Ga0070706_100261149 3300005467 Bacteria 1616
118 Ga0070707_100000853 3300005468 Bacteria 30281
119 Ga0070707_100001215 3300005468 Bacteria 25370
120 Ga0070707_100011884 3300005468 Bacteria 8127
121 Ga0070707_100082370 3300005468 Bacteria 3107
122 Ga0070707_100156969 3300005468 Bacteria 2217
123 Ga0070707_100198043 3300005468 Bacteria 1958
124 Ga0070707_100261105 3300005468 Bacteria 1685
125 Ga0070707_100355497 3300005468 Bacteria 1423
126 Ga0070698_100000012 3300005471 Bacteria 116260
127 Ga0070698_100004151 3300005471 Bacteria 15932
128 Ga0070698_100343063 3300005471 Bacteria 1425
129 Ga0070699_100000288 3300005518 Bacteria 48324
130 Ga0070699_100060133 3300005518 Bacteria 3292
131 Ga0070699_100099763 3300005518 Bacteria 2545
132 Ga0070699_100404933 3300005518 Bacteria 1234
133 Ga0070679_100003333 3300005530 Bacteria 14707
134 Ga0070679_100006061 3300005530 Bacteria 11249
135 Ga0070679_100026036 3300005530 Bacteria 5741
136 Ga0070679_100111489 3300005530 Bacteria 2722
137 Ga0070684_100001287 3300005535 Bacteria 17963
138 Ga0070684_100009964 3300005535 Bacteria 7512
139 Ga0070684_100034168 3300005535 Bacteria 4346
140 Ga0070684_100077441 3300005535 Bacteria 2937
141 Ga0070684_100082042 3300005535 Bacteria 2854
142 Ga0070684_100115873 3300005535 Bacteria 2407
143 Ga0070697_100000281 3300005536 Bacteria 41062
144 Ga0070697_100000289 3300005536 Bacteria 40345
145 Ga0070697_100000772 3300005536 Bacteria 23968
146 Ga0070697_100002989 3300005536 Bacteria 12984
147 Ga0070697_100003013 3300005536 Bacteria 12928
148 Ga0070697_100006248 3300005536 Bacteria 9222
149 Ga0070697_100074494 3300005536 Bacteria 2789
150 Ga0070697_100140411 3300005536 Bacteria 2031
151 Ga0068853_100000020 3300005539 Bacteria 157450
152 Ga0068853_100000442 3300005539 Bacteria 28292
153 Ga0068853_100011796 3300005539 Bacteria 7104
154 Ga0068853_100034468 3300005539 Bacteria 4296
155 Ga0068853_100034722 3300005539 Bacteria 4281
156 Ga0068853_100038140 3300005539 Bacteria 4092
157 Ga0068853_100066973 3300005539 Bacteria 3119
158 Ga0068853_100228094 3300005539 Bacteria 1703
159 Ga0070696_100081560 3300005546 Unclassified 2292
160 Ga0070696_100094976 3300005546 Bacteria 2128
161 Ga0070693_100081302 3300005547 Bacteria 1932
162 Ga0070693_100097144 3300005547 Bacteria 1787
163 Ga0070665_100002682 3300005548 Bacteria 19337
164 Ga0070665_100023873 3300005548 Bacteria 6161
165 Ga0070704_100166139 3300005549 Bacteria 1750
166 Ga0068855_100001768 3300005563 Bacteria 26996
167 Ga0068855_100004933 3300005563 Bacteria 16273
168 Ga0068855_100010394 3300005563 Bacteria 11227
169 Ga0068855_100022876 3300005563 Bacteria 7491
170 Ga0068855_100025865 3300005563 Bacteria 7019
171 Ga0068855_100029165 3300005563 Bacteria 6599
172 Ga0068855_100031183 3300005563 Bacteria 6367
173 Ga0068855_100044190 3300005563 Bacteria 5273
174 Ga0068855_100087942 3300005563 Bacteria 3590
175 Ga0068855_100270035 3300005563 Bacteria 1891
176 Ga0070664_100000499 3300005564 Bacteria 29728
177 Ga0070664_100033836 3300005564 Bacteria 4284
178 Ga0070664_100056227 3300005564 Bacteria 3343
179 Ga0070664_100063300 3300005564 Bacteria 3154
180 Ga0068857_100006354 3300005577 Bacteria 10120
181 Ga0068857_100017725 3300005577 Bacteria 6244
182 Ga0068857_100020596 3300005577 Bacteria 5804
183 Ga0068857_100148042 3300005577 Bacteria 2125
184 Ga0068854_100000057 3300005578 Bacteria 82860
185 Ga0068854_100014546 3300005578 Bacteria 5191
186 Ga0068854_100044682 3300005578 Bacteria 3146
187 Ga0068856_100001767 3300005614 Bacteria 22609
188 Ga0068856_100002074 3300005614 Bacteria 20786
189 Ga0068856_100009770 3300005614 Bacteria 9323
190 Ga0068856_100018784 3300005614 Bacteria 6704
191 Ga0068856_100021154 3300005614 Bacteria 6322
192 Ga0068856_100023374 3300005614 Bacteria 6009
193 Ga0068856_100044236 3300005614 Bacteria 4381
194 Ga0068856_100061370 3300005614 Bacteria 3713
195 Ga0068856_100122411 3300005614 Bacteria 2603
196 Ga0068856_100128737 3300005614 Bacteria 2535
197 Ga0068856_100152544 3300005614 Bacteria 2320
198 Ga0068856_100181042 3300005614 Bacteria 2120
199 Ga0068856_100272829 3300005614 Bacteria 1707
200 Ga0068856_100366977 3300005614 Bacteria 1458
201 Ga0070702_100091145 3300005615 Bacteria 1849
202 Ga0068852_100000057 3300005616 Bacteria 75410
203 Ga0068852_100002802 3300005616 Bacteria 12079
204 Ga0068852_100007675 3300005616 Bacteria 7893
205 Ga0068852_100044313 3300005616 Bacteria 3777
206 Ga0068852_100142435 3300005616 Bacteria 2220
207 Ga0068852_100428833 3300005616 Bacteria 1305
208 Ga0068859_100000871 3300005617 Bacteria 30785
209 Ga0068859_100011050 3300005617 Bacteria 9084
210 Ga0068859_100027637 3300005617 Bacteria 5690
211 Ga0068859_100037789 3300005617 Bacteria 4845
212 Ga0068859_100185605 3300005617 Bacteria 2163
213 Ga0068859_100259989 3300005617 Bacteria 1827
214 Ga0068864_100000664 3300005618 Bacteria 28711
215 Ga0068864_100061436 3300005618 Bacteria 3254
216 Ga0068864_100063076 3300005618 Bacteria 3212
217 Ga0068864_100151169 3300005618 Bacteria 2103
218 Ga0068866_10014077 3300005718 Bacteria 3523
219 Ga0068851_10000954 3300005834 Bacteria 12524
220 Ga0068851_10018902 3300005834 Bacteria 3326
221 Ga0068851_10026504 3300005834 Bacteria 2849
222 Ga0068851_10133536 3300005834 Bacteria 1344
223 Ga0068870_10163951 3300005840 Bacteria 1321
224 Ga0068863_100020269 3300005841 Bacteria 6360
225 Ga0068863_100053900 3300005841 Bacteria 3812
226 Ga0068863_100081410 3300005841 Bacteria 3067
227 Ga0068863_100154293 3300005841 Bacteria 2198
228 Ga0068858_100002350 3300005842 Bacteria 19112
229 Ga0068858_100038770 3300005842 Bacteria 4420
230 Ga0068858_100093824 3300005842 Bacteria 2794
231 Ga0068858_100329516 3300005842 Bacteria 1460
232 Ga0068860_100004062 3300005843 Bacteria 15024
233 Ga0068860_100026628 3300005843 Bacteria 5574
234 Ga0068860_100051289 3300005843 Bacteria 3926
235 Ga0068860_100054259 3300005843 Bacteria 3810
236 Ga0068862_100148281 3300005844 Bacteria 2087
237 Ga0070717_10000248 3300006028 Bacteria 37042
238 Ga0070717_10001075 3300006028 Bacteria 18367
239 Ga0070717_10003342 3300006028 Bacteria 11460
240 Ga0070717_10006430 3300006028 Bacteria 8643
241 Ga0070717_10009279 3300006028 Bacteria 7394
242 Ga0070717_10021131 3300006028 Bacteria 5128
243 Ga0070717_10036213 3300006028 Unclassified 4001
244 Ga0070717_10082862 3300006028 Bacteria 2696
245 Ga0070717_10105712 3300006028 Bacteria 2396
246 Ga0070717_10194860 3300006028 Bacteria 1772
247 Ga0070715_10003825 3300006163 Bacteria 4857
248 Ga0070715_10053873 3300006163 Bacteria 1740
249 Ga0070716_100000132 3300006173 Bacteria 29801
250 Ga0070716_100034079 3300006173 Bacteria 2789
251 Ga0070716_100053626 3300006173 Bacteria 2300
252 Ga0070712_100000047 3300006175 Bacteria 65314
253 Ga0070712_100000601 3300006175 Bacteria 21098
254 Ga0070712_100001013 3300006175 Bacteria 16925
255 Ga0070712_100001074 3300006175 Bacteria 16499
256 Ga0070712_100002835 3300006175 Bacteria 10731
257 Ga0070712_100017174 3300006175 Bacteria 4681
258 Ga0070712_100308122 3300006175 Bacteria 1284
259 Ga0097621_100000181 3300006237 Bacteria 40008
260 Ga0097621_100001172 3300006237 Bacteria 18150
261 Ga0097621_100007256 3300006237 Bacteria 7914
262 Ga0097621_100008436 3300006237 Bacteria 7422
263 Ga0097621_100009481 3300006237 Bacteria 7066
264 Ga0097621_100020909 3300006237 Bacteria 5050
265 Ga0097621_100026261 3300006237 Bacteria 4566
266 Ga0097621_100053852 3300006237 Bacteria 3280
267 Ga0097621_100061925 3300006237 Bacteria 3070
268 Ga0097621_100178290 3300006237 Unclassified 1835
269 Ga0068871_100001954 3300006358 Bacteria 13955
270 Ga0068871_100006144 3300006358 Bacteria 8463
271 Ga0068871_100010456 3300006358 Bacteria 6773
272 Ga0068871_100014443 3300006358 Bacteria 5891
273 Ga0068871_100022851 3300006358 Bacteria 4827
274 Ga0068871_100045641 3300006358 Bacteria 3527
275 Ga0068871_100090164 3300006358 Bacteria 2553
276 Ga0075433_10040317 3300006852 Bacteria 4042
277 Ga0075434_100000020 3300006871 Bacteria 72327
278 Ga0068865_100021435 3300006881 Bacteria 4201
279 Ga0068865_100031206 3300006881 Bacteria 3552
280 Ga0075436_100005025 3300006914 Bacteria 9091
281 Ga0075436_100014759 3300006914 Bacteria 5353
282 Ga0097620_100000871 3300006931 Bacteria 30785
283 Ga0097620_100011050 3300006931 Bacteria 9084
284 Ga0097620_100027636 3300006931 Bacteria 5690
285 Ga0097620_100037791 3300006931 Bacteria 4845
286 Ga0097620_100185619 3300006931 Bacteria 2163
287 Ga0097620_100259956 3300006931 Bacteria 1827
288 Ga0075435_100029854 3300007076 Bacteria 4282
289 Ga0075435_100037949 3300007076 Bacteria 3840
290 Ga0075435_100040447 3300007076 Bacteria 3722
291 Ga0099794_10032752 3300007265 Bacteria 2441
292 Ga0105240_10000454 3300009093 Bacteria 75423
293 Ga0105240_10003924 3300009093 Bacteria 22973
294 Ga0105240_10016569 3300009093 Bacteria 9971
295 Ga0105240_10025553 3300009093 Bacteria 7758
296 Ga0105240_10027409 3300009093 Bacteria 7458
297 Ga0105240_10057755 3300009093 Bacteria 4845
298 Ga0105240_10063402 3300009093 Bacteria 4598
299 Ga0105240_10064403 3300009093 Bacteria 4555
300 Ga0105240_10069863 3300009093 Bacteria 4346
301 Ga0105240_10106498 3300009093 Bacteria 3400
302 Ga0105240_10167508 3300009093 Bacteria 2605
303 Ga0105240_10202388 3300009093 Bacteria 2326
304 Ga0105240_10211037 3300009093 Bacteria 2269
305 Ga0105240_10223781 3300009093 Bacteria 2191
306 Ga0105240_10413483 3300009093 Bacteria 1517
307 Ga0105240_10448520 3300009093 Bacteria 1444
308 Ga0105245_10057209 3300009098 Bacteria 3506
309 Ga0105245_10079711 3300009098 Bacteria 2990
310 Ga0105245_10137565 3300009098 Bacteria 2297
311 Ga0105245_10322208 3300009098 Bacteria 1523
312 Ga0105247_10058039 3300009101 Bacteria 2394
313 Ga0114129_10017635 3300009147 Bacteria 10164
314 Ga0105243_10046344 3300009148 Bacteria 3420
315 Ga0105241_10000178 3300009174 Bacteria 47115
316 Ga0105241_10001986 3300009174 Bacteria 15491
317 Ga0105241_10005084 3300009174 Bacteria 9700
318 Ga0105241_10033827 3300009174 Bacteria 3838
319 Ga0105241_10045122 3300009174 Bacteria 3342
320 Ga0105241_10050801 3300009174 Bacteria 3161
321 Ga0105241_10074968 3300009174 Bacteria 2636
322 Ga0105241_10098865 3300009174 Bacteria 2316
323 Ga0105241_10116285 3300009174 Bacteria 2147
324 Ga0105242_10039680 3300009176 Bacteria 3790
325 Ga0105242_10088255 3300009176 Bacteria 2605
326 Ga0105242_10102841 3300009176 Bacteria 2423
327 Ga0105248_10002674 3300009177 Bacteria 19791
328 Ga0105248_10017862 3300009177 Bacteria 7828
329 Ga0105237_10009941 3300009545 Bacteria 10150
330 Ga0105237_10045387 3300009545 Bacteria 4423
331 Ga0105237_10055322 3300009545 Bacteria 3975
332 Ga0105237_10066510 3300009545 Bacteria 3599
333 Ga0105237_10164308 3300009545 Bacteria 2219
334 Ga0105237_10199512 3300009545 Bacteria 2000
335 Ga0105237_10268112 3300009545 Bacteria 1710
336 Ga0105237_10275319 3300009545 Bacteria 1686
337 Ga0105238_10000233 3300009551 Bacteria 62266
338 Ga0105238_10003997 3300009551 Bacteria 14635
339 Ga0105238_10010999 3300009551 Bacteria 9100
340 Ga0105238_10012427 3300009551 Bacteria 8588
341 Ga0105238_10021832 3300009551 Bacteria 6521
342 Ga0105238_10027571 3300009551 Bacteria 5789
343 Ga0105238_10043696 3300009551 Bacteria 4533
344 Ga0105238_10071733 3300009551 Bacteria 3461
345 Ga0105238_10096553 3300009551 Bacteria 2941
346 Ga0105238_10097078 3300009551 Bacteria 2933
347 Ga0105238_10120152 3300009551 Bacteria 2607
348 Ga0105249_10009316 3300009553 Bacteria 8588
349 Ga0105239_10000866 3300010375 Bacteria 42989
350 Ga0105239_10008235 3300010375 Bacteria 11893
351 Ga0105239_10028676 3300010375 Bacteria 6121
352 Ga0105239_10057563 3300010375 Bacteria 4264
353 Ga0105239_10107325 3300010375 Bacteria 3093
354 Ga0105239_10172185 3300010375 Bacteria 2421
355 Ga0105239_10436780 3300010375 Bacteria 1484
356 Ga0157373_10002068 3300013100 Bacteria 15211
357 Ga0157373_10127613 3300013100 Bacteria 1789
358 Ga0157371_10013276 3300013102 Bacteria 6266
359 Ga0157371_10090306 3300013102 Bacteria 2170
360 Ga0157370_10000294 3300013104 Bacteria 63367
361 Ga0157370_10015639 3300013104 Bacteria 7707
362 Ga0157370_10075975 3300013104 Bacteria 3165
363 Ga0157370_10091412 3300013104 Bacteria 2857
364 Ga0157370_10268740 3300013104 Bacteria 1576
365 Ga0157369_10000131 3300013105 Bacteria 107900
366 Ga0157369_10000244 3300013105 Bacteria 75434
367 Ga0157369_10000497 3300013105 Bacteria 52025
368 Ga0157369_10002520 3300013105 Bacteria 21892
369 Ga0157369_10014550 3300013105 Bacteria 8877
370 Ga0157369_10026897 3300013105 Bacteria 6379
371 Ga0157369_10042808 3300013105 Bacteria 4940
372 Ga0157369_10056745 3300013105 Bacteria 4225
373 Ga0157369_10199290 3300013105 Bacteria 2102
374 Ga0157369_10326128 3300013105 Bacteria 1596
375 Ga0157374_10000363 3300013296 Bacteria 42074
376 Ga0157374_10000554 3300013296 Bacteria 33376
377 Ga0157374_10002076 3300013296 Bacteria 16865
378 Ga0157374_10016309 3300013296 Bacteria 6526
379 Ga0157374_10017519 3300013296 Bacteria 6309
380 Ga0157374_10024120 3300013296 Bacteria 5449
381 Ga0157374_10025785 3300013296 Bacteria 5283
382 Ga0157374_10094631 3300013296 Bacteria 2855
383 Ga0157374_10179195 3300013296 Bacteria 2069
384 Ga0157374_10191440 3300013296 Bacteria 2001
385 Ga0157374_10266967 3300013296 Bacteria 1687
386 Ga0157374_10298180 3300013296 Bacteria 1594
387 Ga0157378_10000162 3300013297 Bacteria 63795
388 Ga0157378_10000397 3300013297 Bacteria 42878
389 Ga0157378_10007198 3300013297 Bacteria 9719
390 Ga0157378_10010329 3300013297 Bacteria 8150
391 Ga0157378_10011835 3300013297 Bacteria 7637
392 Ga0157378_10056461 3300013297 Bacteria 3499
393 Ga0157378_10112206 3300013297 Bacteria 2500
394 Ga0157378_10141070 3300013297 Bacteria 2238
395 Ga0157378_10162766 3300013297 Bacteria 2088
396 Ga0157378_10229121 3300013297 Bacteria 1770
397 Ga0163162_10000276 3300013306 Bacteria 46939
398 Ga0163162_10003017 3300013306 Bacteria 16084
399 Ga0163162_10030469 3300013306 Bacteria 5345
400 Ga0163162_10416205 3300013306 Bacteria 1476
401 Ga0157372_10000390 3300013307 Bacteria 48665
402 Ga0157372_10001666 3300013307 Bacteria 24077
403 Ga0157372_10001776 3300013307 Bacteria 23400
404 Ga0157372_10001923 3300013307 Bacteria 22549
405 Ga0157372_10002305 3300013307 Bacteria 20711
406 Ga0157372_10006184 3300013307 Bacteria 12730
407 Ga0157372_10009260 3300013307 Bacteria 10472
408 Ga0157372_10012963 3300013307 Bacteria 8890
409 Ga0157372_10016605 3300013307 Bacteria 7900
410 Ga0157372_10020007 3300013307 Bacteria 7217
411 Ga0157372_10023331 3300013307 Bacteria 6706
412 Ga0157372_10023660 3300013307 Bacteria 6663
413 Ga0157372_10027421 3300013307 Bacteria 6202
414 Ga0157372_10028928 3300013307 Bacteria 6047
415 Ga0157372_10054382 3300013307 Bacteria 4465
416 Ga0157372_10055103 3300013307 Bacteria 4439
417 Ga0157372_10057399 3300013307 Bacteria 4351
418 Ga0157372_10139085 3300013307 Bacteria 2797
419 Ga0157372_10146595 3300013307 Bacteria 2722
420 Ga0157372_10413112 3300013307 Bacteria 1573
421 Ga0157375_10010936 3300013308 Bacteria 8004
422 Ga0157375_10016852 3300013308 Bacteria 6577
423 Ga0157375_10037551 3300013308 Bacteria 4642
424 Ga0163163_10005994 3300014325 Bacteria 10570
425 Ga0163163_10036606 3300014325 Bacteria 4769
426 Ga0163163_10045860 3300014325 Unclassified 4292
427 Ga0163163_10062090 3300014325 Bacteria 3702
428 Ga0163163_10086316 3300014325 Bacteria 3147
429 Ga0157379_10004032 3300014968 Bacteria 12515
430 Ga0157379_10041831 3300014968 Bacteria 4090
431 Ga0157379_10063550 3300014968 Bacteria 3300
432 Ga0157379_10167597 3300014968 Bacteria 1983
433 Ga0157379_10184540 3300014968 Bacteria 1885
434 Ga0157379_10298443 3300014968 Bacteria 1468
435 Ga0157376_10002473 3300014969 Bacteria 12496
436 Ga0157376_10016334 3300014969 Bacteria 5633
437 Ga0157376_10088336 3300014969 Bacteria 2677
438 Ga0157376_10142182 3300014969 Bacteria 2154
439 Ga0157376_10287454 3300014969 Bacteria 1551
440 Ga0157376_10412449 3300014969 Bacteria 1309
441 Ga0213874_10009792 3300021377 Bacteria 2382
442 Ga0213875_10047462 3300021388 Bacteria 2015
443 Ga0224570_100377 3300022730 Bacteria 3480
444 Ga0224569_100841 3300022732 Bacteria 2590
445 Ga0224572_1000147 3300024225 Bacteria 6073
446 Ga0224572_1015171 3300024225 Bacteria 1473
447 Ga0228598_1006077 3300024227 Bacteria 2505
448 Ga0207656_10008238 3300025321 Bacteria 3827
449 Ga0207656_10063070 3300025321 Bacteria 1630
450 Ga0207692_10022170 3300025898 Bacteria 2919
451 Ga0207692_10105940 3300025898 Bacteria 1552
452 Ga0207642_10041543 3300025899 Bacteria 2015
453 Ga0207710_10025761 3300025900 Bacteria 2540
454 Ga0207710_10033604 3300025900 Bacteria 2250
455 Ga0207680_10073566 3300025903 Bacteria 2125
456 Ga0207647_10002559 3300025904 Bacteria 13755
457 Ga0207647_10023490 3300025904 Bacteria 4076
458 Ga0207647_10035457 3300025904 Bacteria 3179
459 Ga0207647_10045211 3300025904 Bacteria 2748
460 Ga0207685_10006966 3300025905 Bacteria 3118
461 Ga0207685_10017722 3300025905 Bacteria 2310
462 Ga0207685_10054817 3300025905 Bacteria 1554
463 Ga0207699_10000189 3300025906 Bacteria 37481
464 Ga0207699_10032143 3300025906 Bacteria 2954
465 Ga0207699_10035928 3300025906 Bacteria 2822
466 Ga0207699_10037186 3300025906 Bacteria 2781
467 Ga0207699_10112884 3300025906 Bacteria 1745
468 Ga0207645_10004443 3300025907 Bacteria 10383
469 Ga0207705_10000171 3300025909 Bacteria 69439
470 Ga0207705_10005338 3300025909 Bacteria 9609
471 Ga0207705_10019372 3300025909 Bacteria 4865
472 Ga0207705_10163214 3300025909 Bacteria 1675
473 Ga0207684_10000475 3300025910 Bacteria 51854
474 Ga0207684_10001079 3300025910 Bacteria 30538
475 Ga0207684_10004709 3300025910 Bacteria 12796
476 Ga0207684_10060411 3300025910 Bacteria 3219
477 Ga0207684_10155845 3300025910 Bacteria 1966
478 Ga0207654_10000059 3300025911 Bacteria 75594
479 Ga0207654_10005858 3300025911 Bacteria 6198
480 Ga0207654_10018595 3300025911 Bacteria 3650
481 Ga0207654_10042497 3300025911 Bacteria 2573
482 Ga0207654_10055590 3300025911 Bacteria 2292
483 Ga0207654_10085702 3300025911 Bacteria 1908
484 Ga0207707_10004211 3300025912 Bacteria 12731
485 Ga0207707_10010273 3300025912 Bacteria 8124
486 Ga0207707_10013862 3300025912 Bacteria 7030
487 Ga0207707_10029785 3300025912 Bacteria 4774
488 Ga0207707_10113562 3300025912 Bacteria 2367
489 Ga0207707_10319024 3300025912 Bacteria 1342
490 Ga0207695_10000096 3300025913 Bacteria 265048
491 Ga0207695_10000570 3300025913 Bacteria 75451
492 Ga0207695_10003417 3300025913 Bacteria 22409
493 Ga0207695_10028488 3300025913 Bacteria 6193
494 Ga0207695_10032643 3300025913 Bacteria 5695
495 Ga0207695_10055498 3300025913 Bacteria 4128
496 Ga0207695_10062197 3300025913 Bacteria 3855
497 Ga0207695_10076222 3300025913 Bacteria 3410
498 Ga0207695_10099744 3300025913 Bacteria 2901
499 Ga0207695_10138803 3300025913 Bacteria 2382
500 Ga0207695_10142806 3300025913 Bacteria 2340
501 Ga0207695_10173161 3300025913 Bacteria 2083
502 Ga0207695_10440737 3300025913 Bacteria 1186
503 Ga0207671_10002674 3300025914 Bacteria 18699
504 Ga0207671_10015500 3300025914 Bacteria 5964
505 Ga0207671_10033927 3300025914 Bacteria 3795
506 Ga0207671_10050221 3300025914 Bacteria 3089
507 Ga0207671_10189965 3300025914 Bacteria 1601
508 Ga0207693_10000210 3300025915 Bacteria 53555
509 Ga0207693_10000537 3300025915 Bacteria 34386
510 Ga0207693_10002933 3300025915 Bacteria 14760
511 Ga0207693_10009006 3300025915 Bacteria 8147
512 Ga0207693_10017069 3300025915 Bacteria 5794
513 Ga0207693_10025121 3300025915 Bacteria 4726
514 Ga0207693_10025681 3300025915 Bacteria 4668
515 Ga0207693_10138348 3300025915 Bacteria 1915
516 Ga0207663_10000279 3300025916 Bacteria 22307
517 Ga0207663_10020339 3300025916 Bacteria 3757
518 Ga0207663_10058823 3300025916 Bacteria 2428
519 Ga0207663_10062404 3300025916 Bacteria 2369
520 Ga0207663_10107960 3300025916 Bacteria 1884
521 Ga0207663_10258872 3300025916 Bacteria 1284
522 Ga0207660_10036880 3300025917 Bacteria 3401
523 Ga0207660_10041176 3300025917 Bacteria 3236
524 Ga0207662_10041063 3300025918 Bacteria 2722
525 Ga0207657_10004750 3300025919 Bacteria 14344
526 Ga0207657_10010068 3300025919 Bacteria 9454
527 Ga0207657_10018159 3300025919 Bacteria 6728
528 Ga0207657_10090247 3300025919 Bacteria 2558
529 Ga0207657_10183670 3300025919 Bacteria 1690
530 Ga0207649_10039735 3300025920 Bacteria 2854
531 Ga0207652_10006502 3300025921 Bacteria 9418
532 Ga0207652_10018778 3300025921 Bacteria 5675
533 Ga0207652_10042027 3300025921 Bacteria 3889
534 Ga0207652_10078278 3300025921 Bacteria 2887
535 Ga0207646_10000178 3300025922 Bacteria 86727
536 Ga0207646_10000632 3300025922 Bacteria 45779
537 Ga0207646_10001378 3300025922 Bacteria 30144
538 Ga0207646_10052696 3300025922 Bacteria 3641
539 Ga0207646_10239242 3300025922 Bacteria 1640
540 Ga0207646_10290685 3300025922 Bacteria 1477
541 Ga0207646_10294130 3300025922 Bacteria 1467
542 Ga0207646_10322847 3300025922 Bacteria 1395
543 Ga0207681_10158329 3300025923 Bacteria 1704
544 Ga0207694_10001230 3300025924 Bacteria 22207
545 Ga0207694_10009730 3300025924 Bacteria 7251
546 Ga0207694_10013316 3300025924 Bacteria 6192
547 Ga0207694_10014603 3300025924 Bacteria 5922
548 Ga0207694_10024896 3300025924 Bacteria 4546
549 Ga0207694_10026831 3300025924 Bacteria 4385
550 Ga0207694_10058071 3300025924 Bacteria 3010
551 Ga0207650_10015148 3300025925 Bacteria 5366
552 Ga0207650_10133029 3300025925 Bacteria 1948
553 Ga0207687_10078817 3300025927 Bacteria 2373
554 Ga0207687_10086462 3300025927 Bacteria 2277
555 Ga0207687_10100025 3300025927 Bacteria 2132
556 Ga0207700_10000385 3300025928 Bacteria 25704
557 Ga0207700_10000443 3300025928 Bacteria 24359
558 Ga0207700_10011819 3300025928 Bacteria 5590
559 Ga0207700_10022360 3300025928 Bacteria 4339
560 Ga0207700_10029523 3300025928 Bacteria 3870
561 Ga0207700_10043322 3300025928 Bacteria 3305
562 Ga0207700_10046520 3300025928 Bacteria 3209
563 Ga0207700_10051164 3300025928 Bacteria 3082
564 Ga0207700_10091658 3300025928 Bacteria 2401
565 Ga0207664_10000977 3300025929 Bacteria 19275
566 Ga0207664_10002047 3300025929 Bacteria 13275
567 Ga0207664_10022887 3300025929 Bacteria 4674
568 Ga0207664_10063377 3300025929 Bacteria 2954
569 Ga0207664_10118384 3300025929 Bacteria 2213
570 Ga0207664_10173020 3300025929 Bacteria 1849
571 Ga0207664_10176352 3300025929 Bacteria 1833
572 Ga0207664_10211441 3300025929 Bacteria 1678
573 Ga0207664_10259191 3300025929 Bacteria 1520
574 Ga0207664_10273951 3300025929 Bacteria 1479
575 Ga0207664_10323194 3300025929 Bacteria 1362
576 Ga0207690_10003276 3300025932 Bacteria 9707
577 Ga0207690_10078148 3300025932 Bacteria 2302
578 Ga0207690_10104254 3300025932 Bacteria 2031
579 Ga0207690_10289911 3300025932 Bacteria 1277
580 Ga0207706_10001043 3300025933 Bacteria 28102
581 Ga0207686_10044025 3300025934 Bacteria 2739
582 Ga0207670_10057635 3300025936 Bacteria 2635
583 Ga0207665_10010386 3300025939 Bacteria 6116
584 Ga0207665_10010710 3300025939 Bacteria 6022
585 Ga0207665_10042300 3300025939 Bacteria 3045
586 Ga0207665_10053915 3300025939 Bacteria 2711
587 Ga0207665_10065001 3300025939 Bacteria 2480
588 Ga0207665_10073619 3300025939 Bacteria 2336
589 Ga0207665_10098024 3300025939 Bacteria 2042
590 Ga0207711_10028907 3300025941 Bacteria 4670
591 Ga0207711_10094862 3300025941 Bacteria 2630
592 Ga0207689_10086129 3300025942 Bacteria 2582
593 Ga0207661_10057631 3300025944 Bacteria 3124
594 Ga0207661_10064655 3300025944 Bacteria 2966
595 Ga0207661_10339411 3300025944 Bacteria 1353
596 Ga0207679_10007363 3300025945 Bacteria 6979
597 Ga0207679_10034205 3300025945 Bacteria 3583
598 Ga0207679_10035208 3300025945 Bacteria 3540
599 Ga0207679_10048506 3300025945 Bacteria 3092
600 Ga0207667_10000056 3300025949 Bacteria 206107
601 Ga0207667_10001636 3300025949 Bacteria 28204
602 Ga0207667_10002468 3300025949 Bacteria 23083
603 Ga0207667_10006361 3300025949 Bacteria 14316
604 Ga0207667_10008520 3300025949 Bacteria 12177
605 Ga0207667_10016174 3300025949 Bacteria 8437
606 Ga0207667_10035667 3300025949 Bacteria 5335
607 Ga0207667_10062087 3300025949 Bacteria 3908
608 Ga0207667_10064854 3300025949 Bacteria 3811
609 Ga0207667_10070314 3300025949 Bacteria 3643
610 Ga0207667_10075773 3300025949 Bacteria 3492
611 Ga0207667_10085675 3300025949 Bacteria 3261
612 Ga0207651_10161546 3300025960 Bacteria 1757
613 Ga0207668_10004546 3300025972 Bacteria 8162
614 Ga0207640_10000001 3300025981 Bacteria 628778
615 Ga0207640_10007235 3300025981 Bacteria 6122
616 Ga0207677_10005168 3300026023 Bacteria 7064
617 Ga0207677_10029495 3300026023 Bacteria 3487
618 Ga0207677_10038683 3300026023 Bacteria 3130
619 Ga0207677_10045538 3300026023 Bacteria 2930
620 Ga0207677_10143992 3300026023 Bacteria 1829
621 Ga0207703_10002440 3300026035 Bacteria 16124
622 Ga0207703_10077877 3300026035 Bacteria 2753
623 Ga0207703_10126869 3300026035 Bacteria 2198
624 Ga0207639_10000023 3300026041 Bacteria 215340
625 Ga0207639_10000529 3300026041 Bacteria 26276
626 Ga0207639_10148670 3300026041 Bacteria 1960
627 Ga0207678_10004337 3300026067 Bacteria 12731
628 Ga0207678_10018701 3300026067 Bacteria 6084
629 Ga0207708_10069155 3300026075 Bacteria 2703
630 Ga0207702_10000660 3300026078 Bacteria 37577
631 Ga0207702_10006768 3300026078 Bacteria 9832
632 Ga0207702_10011890 3300026078 Bacteria 7246
633 Ga0207702_10012133 3300026078 Bacteria 7167
634 Ga0207702_10034962 3300026078 Bacteria 4202
635 Ga0207702_10062037 3300026078 Bacteria 3190
636 Ga0207702_10171630 3300026078 Bacteria 1989
637 Ga0207702_10234680 3300026078 Bacteria 1716
638 Ga0207702_10378235 3300026078 Bacteria 1361
639 Ga0207641_10034388 3300026088 Bacteria 4216
640 Ga0207641_10045758 3300026088 Bacteria 3687
641 Ga0207641_10072917 3300026088 Bacteria 2958
642 Ga0207641_10133420 3300026088 Bacteria 2232
643 Ga0207648_10006733 3300026089 Bacteria 11399
644 Ga0207648_10112356 3300026089 Bacteria 2392
645 Ga0207676_10048850 3300026095 Bacteria 3287
646 Ga0207674_10005307 3300026116 Bacteria 15330
647 Ga0207674_10018205 3300026116 Bacteria 7644
648 Ga0207674_10018363 3300026116 Bacteria 7604
649 Ga0207674_10049427 3300026116 Bacteria 4301
650 Ga0207674_10087833 3300026116 Bacteria 3102
651 Ga0207675_100118197 3300026118 Bacteria 2506
652 Ga0207683_10060094 3300026121 Bacteria 3340
653 Ga0207698_10000033 3300026142 Bacteria 110484
654 Ga0207698_10000803 3300026142 Bacteria 18265
655 Ga0207698_10014164 3300026142 Bacteria 5290
656 Ga0207698_10118611 3300026142 Bacteria 2235
657 Ga0207698_10145634 3300026142 Bacteria 2048
658 Ga0209998_10008831 3300027717 Bacteria 2086
659 Ga0265356_1000547 3300028017 Bacteria 6681
660 Ga0265355_1000390 3300028036 Bacteria 2247
661 Ga0268266_10171312 3300028379 Bacteria 1970
662 Ga0268264_10034434 3300028381 Bacteria 4166
663 Ga0268264_10036781 3300028381 Bacteria 4034
664 Ga0268264_10060699 3300028381 Bacteria 3169
665 Ga0268264_10076464 3300028381 Bacteria 2848
666 Ga0268264_10076885 3300028381 Bacteria 2841
667 Ga0268264_10240365 3300028381 Bacteria 1677
668 Ga0265318_10005221 3300028577 Bacteria 6123
669 Ga0265323_10025473 3300028653 Bacteria 2239
670 Ga0265338_10000884 3300028800 Bacteria 50557
671 Ga0265338_10005846 3300028800 Bacteria 15877
672 Ga0265338_10010579 3300028800 Bacteria 10792
673 Ga0265338_10015061 3300028800 Bacteria 8536
674 Ga0265338_10016519 3300028800 Bacteria 8022
675 Ga0265338_10023672 3300028800 Bacteria 6301
676 Ga0265338_10025365 3300028800 Bacteria 6018
677 Ga0265338_10028696 3300028800 Bacteria 5543
678 Ga0265338_10029982 3300028800 Bacteria 5376
679 Ga0265338_10030700 3300028800 Bacteria 5285
680 Ga0265338_10052859 3300028800 Bacteria 3640
681 Ga0265338_10059134 3300028800 Bacteria 3378
682 Ga0265762_1000288 3300030760 Bacteria 8431
683 Ga0265762_1005710 3300030760 Bacteria 2232
684 Ga0265770_1002318 3300030878 Bacteria 2589
685 Ga0265765_1004480 3300030879 Bacteria 1438
686 Ga0265760_10000300 3300031090 Bacteria 13592
687 Ga0265760_10002305 3300031090 Bacteria 5572
688 Ga0265760_10042842 3300031090 Bacteria 1352
689 Ga0265330_10000316 3300031235 Bacteria 34632
690 Ga0265330_10016986 3300031235 Bacteria 3355
691 Ga0265330_10017850 3300031235 Bacteria 3265
692 Ga0265332_10097632 3300031238 Bacteria 1240
693 Ga0265328_10034420 3300031239 Bacteria 1876
694 Ga0265325_10000312 3300031241 Bacteria 34209
695 Ga0265325_10003323 3300031241 Bacteria 10576
696 Ga0265325_10012965 3300031241 Bacteria 4755
697 Ga0265325_10014919 3300031241 Bacteria 4381
698 Ga0265325_10059435 3300031241 Bacteria 1943
699 Ga0265340_10011480 3300031247 Bacteria 4706
700 Ga0265340_10031942 3300031247 Bacteria 2630
701 Ga0265340_10075255 3300031247 Bacteria 1596
702 Ga0265339_10000007 3300031249 Bacteria 241067
703 Ga0265339_10000394 3300031249 Bacteria 34437
704 Ga0265339_10004190 3300031249 Bacteria 9883
705 Ga0265339_10020996 3300031249 Bacteria 3807
706 Ga0265339_10040190 3300031249 Bacteria 2601
707 Ga0265339_10073692 3300031249 Bacteria 1815
708 Ga0265331_10020262 3300031250 Bacteria 3419
709 Ga0265331_10022969 3300031250 Bacteria 3176
710 Ga0265327_10033065 3300031251 Bacteria 2887
711 Ga0265316_10000523 3300031344 Bacteria 43376
712 Ga0265316_10000577 3300031344 Bacteria 40978
713 Ga0265316_10001955 3300031344 Bacteria 21656
714 Ga0265316_10015061 3300031344 Bacteria 6778
715 Ga0265316_10036807 3300031344 Bacteria 3956
716 Ga0265316_10040889 3300031344 Bacteria 3715
717 Ga0265316_10058565 3300031344 Bacteria 3000
718 Ga0265316_10061957 3300031344 Bacteria 2904
719 Ga0265316_10116801 3300031344 Bacteria 2017
720 Ga0265316_10148684 3300031344 Bacteria 1755
721 Ga0265313_10007815 3300031595 Bacteria 7224
722 Ga0265313_10010408 3300031595 Bacteria 5883
723 Ga0265313_10015391 3300031595 Bacteria 4457
724 Ga0265313_10016777 3300031595 Bacteria 4199
725 Ga0265314_10000036 3300031711 Bacteria 234928
726 Ga0265314_10014337 3300031711 Bacteria 6350
727 Ga0265314_10019363 3300031711 Bacteria 5274
728 Ga0265314_10035128 3300031711 Bacteria 3655
729 Ga0265314_10094417 3300031711 Bacteria 1939
730 Ga0265314_10159310 3300031711 Archaea 1375
731 Ga0265342_10000927 3300031712 Bacteria 29139
732 Ga0265342_10008880 3300031712 Bacteria 7154
733 Ga0265342_10009400 3300031712 Bacteria 6898
734 Ga0265342_10019662 3300031712 Bacteria 4348
735 Ga0373944_0005067 3300035089 Bacteria 3458
736 Ga0373944_0024314 3300035089 Bacteria 1774
737 Ga0373923_0049533 3300035111 Bacteria 1757
738 Ga0373936_0001156 3300035113 Bacteria 9481
739 Ga0373936_0005969 3300035113 Bacteria 4586
740 Ga0373953_0109767 3300035117 Bacteria 1166
741 Ga0373954_0057446 3300035118 Bacteria 1833
742 Ga0373956_0061172 3300035119 Bacteria 1706
743 Ga0373943_0000004 3300035170 Bacteria 99386
744 Ga0373943_0074006 3300035170 Bacteria 1731
745 Ga0373943_0090030 3300035170 Bacteria 1588
746 Ga0373943_0153203 3300035170 Bacteria 1250
747 Ga0373946_0009075 3300035171 Unclassified 3659
748 Ga0373946_0049612 3300035171 Bacteria 1751
749 Ga0373955_0059453 3300035172 Bacteria 2105
750 Ga0373955_0088270 3300035172 Bacteria 1763
751 Ga0373955_0263409 3300035172 Bacteria 1035
752 Ga0373924_0028898 3300035410 Bacteria 2212
753 Ga0373924_0033401 3300035410 Bacteria 2077
754 Ga0373931_0010296 3300035691 Bacteria 4494
755 Ga0373931_0141339 3300035691 Bacteria 1394
756 Ga0373935_0007828 3300035692 Bacteria 6406
757 Ga0373935_0041922 3300035692 Bacteria 2877
758 Ga0373935_0052155 3300035692 Bacteria 2600
759 Ga0373935_0406774 3300035692 Bacteria 978
760 Ga0373927_0002620 3300035695 Bacteria 13119
761 Ga0373927_0018199 3300035695 Bacteria 4619
762 Ga0373927_0020842 3300035695 Bacteria 4297
763 Ga0373927_0118902 3300035695 Bacteria 1724
764 Ga0373927_0186092 3300035695 Bacteria 1362
765 Ga0373933_0008022 3300035724 Bacteria 5762
766 Ga0373933_0128497 3300035724 Bacteria 1592
767 Ga0373933_0139075 3300035724 Bacteria 1532
768 Ga0373947_0000164 3300035725 Bacteria 35529
769 Ga0373947_0006614 3300035725 Bacteria 6729
770 Ga0373947_0010434 3300035725 Bacteria 5331
771 Ga0373947_0024718 3300035725 Bacteria 3502
772 Ga0373937_0025631 3300036401 Bacteria 5325
773 Ga0373937_0043194 3300036401 Bacteria 4113
774 Ga0373937_0063206 3300036401 Bacteria 3404
775 Ga0373937_0253017 3300036401 Bacteria 1661
776 Ga0373925_0000567 3300037068 Bacteria 36257
777 Ga0373925_0017979 3300037068 Bacteria 5133
778 Ga0373925_0019442 3300037068 Bacteria 4940
779 Ga0373925_0084671 3300037068 Bacteria 2416
780 Ga0373925_0127694 3300037068 Bacteria 1980
781 Ga0373925_0133979 3300037068 Bacteria 1934
782 Ga0373925_0189253 3300037068 Bacteria 1632
783 Ga0373925_0478681 3300037068 Bacteria 1021
784 Ga0436364_0518068 3300037853 Bacteria 9402
785 Ga0436363_0063768 3300039450 Bacteria 5079
786 Ga0436363_1320008 3300039450 Bacteria 1709
787 Ga0436362_0531405 3300039453 Bacteria 9654
788 Ga0436362_0878763 3300039453 Bacteria 1762
789 Ga0451577_0001020 3300042876 Bacteria 40682
790 Ga0451577_0025182 3300042876 Bacteria 5400
791 Ga0453683_0003430 3300044673 Bacteria 11686
792 Ga0453683_0004822 3300044673 Bacteria 9497
793 Ga0453683_0004869 3300044673 Bacteria 9434
794 Ga0453683_0014295 3300044673 Bacteria 5157
795 Ga0466961_0031282 3300044693 Bacteria 3422
796 Ga0466963_0000354 3300044694 Bacteria 20811
797 Ga0453684_0002315 3300044712 Bacteria 46780
798 Ga0453684_0043215 3300044712 Bacteria 6061
799 Ga0453684_0065381 3300044712 Bacteria 4639
800 Ga0466970_0126907 3300044765 Bacteria 1399
801 Ga0466957_0136365 3300044842 Bacteria 1578
802 Ga0466959_0276167 3300045049 Bacteria 1154
803 Ga0451576_0009426 3300045051 Bacteria 11315
804 Ga0451576_0154684 3300045051 Bacteria 2392
805 Ga0451576_0576932 3300045051 Bacteria 1182
806 Ga0466967_0064429 3300045976 Bacteria 3259
807 Ga0466967_0112330 3300045976 Bacteria 2505
808 Ga0466967_0275568 3300045976 Bacteria 1613
809 Ga0466967_0381963 3300045976 Bacteria 1368
810 Ga0495592_0028438 3300046454 Bacteria 4234
811 Ga0495592_0119170 3300046454 Bacteria 1859
812 Ga0495629_0030894 3300046459 Bacteria 3795
813 Ga0495651_0001179 3300046462 Bacteria 20176
814 Ga0495651_0004574 3300046462 Bacteria 10581
815 Ga0495651_0006468 3300046462 Bacteria 8959
816 Ga0495651_0101843 3300046462 Bacteria 2137
817 Ga0495653_0001994 3300046463 Bacteria 16052
818 Ga0495580_0000441 3300046472 Bacteria 34221
819 Ga0495580_0000609 3300046472 Bacteria 30239
820 Ga0495580_0001062 3300046472 Bacteria 24157
821 Ga0495580_0001431 3300046472 Bacteria 20958
822 Ga0495580_0001583 3300046472 Bacteria 19978
823 Ga0495580_0008222 3300046472 Bacteria 8302
824 Ga0495580_0014062 3300046472 Bacteria 6086
825 Ga0495580_0024445 3300046472 Bacteria 4422
826 Ga0495580_0024687 3300046472 Bacteria 4398
827 Ga0495580_0038766 3300046472 Bacteria 3411
828 Ga0495580_0045221 3300046472 Bacteria 3128
829 Ga0495580_0064865 3300046472 Bacteria 2559
830 Ga0495580_0072637 3300046472 Bacteria 2402
831 Ga0495580_0080685 3300046472 Bacteria 2268
832 Ga0495580_0087251 3300046472 Bacteria 2173
833 Ga0495582_0001260 3300046473 Bacteria 14236
834 Ga0495582_0006455 3300046473 Bacteria 6515
835 Ga0495639_0035377 3300046475 Bacteria 2234
836 Ga0495639_0044102 3300046475 Bacteria 2016
837 Ga0495664_0035479 3300046477 Bacteria 2937
838 Ga0495584_0028527 3300046491 Bacteria 2829
839 Ga0495594_0036964 3300046499 Bacteria 2665
840 Ga0495608_0030409 3300046511 Bacteria 3655
841 Ga0495618_0005298 3300046514 Bacteria 7875
842 Ga0495628_0000515 3300046516 Bacteria 35499
843 Ga0495628_0020783 3300046516 Bacteria 5409
844 Ga0495630_0025176 3300046517 Bacteria 4399
845 Ga0495630_0038396 3300046517 Bacteria 3582
846 Ga0495630_0043043 3300046517 Bacteria 3372
847 Ga0495630_0221931 3300046517 Bacteria 1443
848 Ga0495666_0031273 3300046526 Bacteria 2608
849 Ga0495652_0002539 3300046529 Bacteria 18711
850 Ga0495652_0003408 3300046529 Bacteria 15718
851 Ga0495652_0045581 3300046529 Bacteria 3768
852 Ga0495665_0005280 3300046531 Bacteria 6964
853 Ga0495665_0028806 3300046531 Bacteria 2975
854 Ga0495665_0113032 3300046531 Bacteria 1424
855 Ga0495665_0155624 3300046531 Bacteria 1192
856 Ga0495586_0020124 3300046535 Bacteria 3554
857 Ga0495587_0005591 3300046536 Bacteria 8203
858 Ga0495645_0017238 3300046543 Bacteria 5173
859 Ga0495645_0018213 3300046543 Bacteria 5042
860 Ga0495645_0029827 3300046543 Bacteria 3971
861 Ga0495645_0038424 3300046543 Bacteria 3491
862 Ga0495667_0000891 3300046559 Bacteria 19311
863 Ga0495667_0064674 3300046559 Bacteria 2392
864 Ga0495634_0117311 3300046642 Bacteria 1707
865 Ga0495635_0040967 3300046663 Bacteria 3200
866 Ga0495635_0061284 3300046663 Bacteria 2584
867 Ga0495635_0094915 3300046663 Bacteria 2039
868 Ga0495657_0098220 3300046675 Bacteria 1869
869 Ga0495657_0147302 3300046675 Bacteria 1464
870 Ga0495599_0120593 3300046678 Bacteria 1630
871 Ga0495623_0000969 3300046679 Bacteria 19361
872 Ga0495623_0134031 3300046679 Bacteria 1480
873 Ga0495646_0042960 3300046680 Bacteria 2771
874 Ga0495669_0053362 3300046684 Bacteria 1818
875 Ga0495613_0036425 3300046689 Bacteria 3648
876 Ga0495613_0042375 3300046689 Bacteria 3369
877 Ga0495613_0045880 3300046689 Bacteria 3232
878 Ga0495613_0191672 3300046689 Bacteria 1444
879 Ga0495600_0011303 3300046809 Bacteria 5561
880 Ga0495600_0215656 3300046809 Bacteria 1229
881 Ga0495581_0016318 3300047315 Bacteria 4319
882 Ga0495581_0074992 3300047315 Bacteria 1957
883 Ga0495581_0091084 3300047315 Bacteria 1769
884 Ga0495604_0004504 3300047317 Bacteria 11036
885 Ga0495604_0006614 3300047317 Bacteria 9186
886 Ga0495674_0027813 3300047319 Bacteria 5164
887 Ga0495674_0053400 3300047319 Bacteria 3552
888 Ga0495676_0190727 3300047321 Bacteria 1429
889 Ga0495680_0000563 3300047322 Bacteria 41798
890 Ga0495680_0012551 3300047322 Bacteria 7448
891 Ga0495675_0000371 3300047444 Bacteria 31063
892 Ga0495675_0028486 3300047444 Bacteria 3559
893 Ga0495684_0011434 3300047471 Bacteria 6854
894 Ga0495684_0040926 3300047471 Bacteria 3551
895 Ga0495593_0036019 3300047673 Bacteria 2684
896 Ga0495602_0029718 3300048088 Bacteria 5196
897 Ga0495602_0033924 3300048088 Bacteria 4781
898 Ga0495602_0054017 3300048088 Bacteria 3550
899 Ga0495602_0105428 3300048088 Bacteria 2304
900 Ga0495602_0173542 3300048088 Bacteria 1671
901 Ga0495614_0008720 3300048089 Bacteria 4506
902 Ga0496100_0014929 3300048903 Bacteria 4525
903 Ga0496100_0060505 3300048903 Bacteria 2493
904 Ga0496100_0216440 3300048903 Bacteria 1404
905 Ga0496102_0032314 3300048905 Bacteria 4701
906 Ga0496102_0326193 3300048905 Bacteria 1446
907 Ga0496103_0219500 3300048906 Bacteria 1223
908 Ga0496104_0011547 3300048907 Bacteria 7914
909 Ga0496104_0047856 3300048907 Bacteria 4031
910 Ga0496104_0083680 3300048907 Bacteria 3043
911 Ga0496104_0099947 3300048907 Bacteria 2777
912 Ga0496104_0215322 3300048907 Bacteria 1833
913 Ga0496105_0058046 3300048908 Bacteria 3195
914 Ga0496105_0153537 3300048908 Bacteria 1892
915 Ga0496105_0185005 3300048908 Bacteria 1705
916 Ga0496105_0196764 3300048908 Bacteria 1646
917 Ga0496105_0233431 3300048908 Archaea 1494
918 Ga0496107_0067267 3300048910 Bacteria 2599
919 Ga0496107_0081266 3300048910 Bacteria 2363
920 Ga0496107_0136651 3300048910 Bacteria 1811
921 Ga0496108_0109525 3300048911 Bacteria 2360
922 Ga0496109_0015872 3300048912 Bacteria 6576
923 Ga0496109_0024173 3300048912 Bacteria 5399
924 Ga0496109_0125974 3300048912 Bacteria 2388
925 Ga0496109_0182735 3300048912 Bacteria 1970
926 Ga0496110_0058648 3300048913 Bacteria 3390
927 Ga0496110_0100844 3300048913 Bacteria 2588
928 Ga0496110_0186081 3300048913 Bacteria 1886
929 Ga0496110_0240248 3300048913 Bacteria 1648
930 Ga0496111_0071702 3300048914 Bacteria 2521
931 Ga0496112_0001261 3300048915 Bacteria 19187
932 Ga0496112_0003216 3300048915 Bacteria 13450
933 Ga0496112_0029415 3300048915 Bacteria 5313
934 Ga0496112_0038573 3300048915 Unclassified 4665
935 Ga0496112_0055318 3300048915 Bacteria 3901
936 Ga0496112_0117680 3300048915 Bacteria 2628
937 Ga0496112_0152867 3300048915 Bacteria 2275
938 Ga0496112_0279384 3300048915 Bacteria 1617
939 Ga0496113_0141057 3300048916 Bacteria 1896
940 Ga0496113_0160576 3300048916 Bacteria 1777
941 Ga0496114_0030933 3300048917 Bacteria 4404
942 Ga0496114_0067765 3300048917 Bacteria 2994
943 Ga0496115_0003572 3300048918 Bacteria 11180
944 Ga0496115_0007295 3300048918 Bacteria 8130
945 Ga0496115_0227090 3300048918 Bacteria 1540
946 Ga0501031_0146485 3300049568 Bacteria 1543
947 Ga0501048_0147006 3300049582 Bacteria 1667
948 Ga0501067_0043118 3300049583 Bacteria 2506
949 Ga0501075_0027342 3300049591 Bacteria 4204
950 Ga0501083_0027986 3300049744 Bacteria 3886
951 nmdc:mga0n895_47947_c1 3300050512 Bacteria 4180
952 nmdc:mga0rr50_16792_c1 3300050513 Bacteria 4871
953 nmdc:mga0rr50_46448_c1 3300050513 Bacteria 3197
954 nmdc:mga0rr50_69457_c1 3300050513 Bacteria 2681
955 nmdc:mga08x19_11108_c1 3300050514 Bacteria 5421
956 nmdc:mga08x19_2239_c1 3300050514 Bacteria 11812
957 nmdc:mga08x19_2667_c1 3300050514 Bacteria 10795
958 nmdc:mga08x19_77344_c1 3300050514 Bacteria 2179
959 nmdc:mga0a205_232_c1 3300050515 Bacteria 39253
960 Ga0495619_0129677 3300053085 Bacteria 1732
961 Ga0530510_0188495 3300061734 Bacteria 1531
962 Ga0163162_10199158
963 LJNas_1000020
964 Ga0065712_10014754
965 Ga0065715_10121416
966 Ga0065715_10129313
967 Ga0070658_10000031
968 Ga0070658_10011573
969 Ga0070658_10116211
970 Ga0070658_10221330
971 Ga0070683_100017895
972 Ga0070683_100032229
973 Ga0070683_100044633
974 Ga0070683_100077075
975 Ga0070683_100096931
976 Ga0070683_100097386
977 Ga0070683_100210786
978 Ga0070690_100015669
979 Ga0070670_100000865
980 Ga0070670_100019692
981 Ga0070670_100141497
982 Ga0068869_100002057
983 Ga0068869_100033529
984 Ga0068869_100112226
985 Ga0070666_10016303
986 Ga0070666_10094648
987 Ga0070680_100008624
988 Ga0070680_100034573
989 Ga0070680_100076142
990 Ga0070680_100206572
991 Ga0070682_100013182
992 Ga0068868_100001229
993 Ga0068868_100002179
994 Ga0068868_100008131
995 Ga0068868_100047543
996 Ga0068868_100071895
997 Ga0068868_100172455
998 Ga0068868_100181395
999 Ga0070689_100078704
1000 Ga0070689_100306072
1001 Ga0070691_10116501
1002 Ga0070687_100014399
1003 Ga0070661_100019129
1004 Ga0070661_100021554
1005 Ga0070661_100034903
1006 Ga0070661_100063421
1007 Ga0070692_10109133
1008 Ga0070668_100006867
1009 Ga0070674_100192871
1010 Ga0070688_100192948
1011 Ga0070659_100001885
1012 Ga0070659_100019016
1013 Ga0070667_100008624
1014 Ga0070709_10006324
1015 Ga0070709_10031561
1016 Ga0070709_10032092
1017 Ga0070709_10179938
1018 Ga0070714_100000062
1019 Ga0070714_100002700
1020 Ga0070714_100003248
1021 Ga0070714_100030679
1022 Ga0070714_100041172
1023 Ga0070714_100111271
1024 Ga0070714_100227360
1025 Ga0070714_100297815
1026 Ga0070714_100377291
1027 Ga0070713_100000656
1028 Ga0070713_100008569
1029 Ga0070713_100027336
1030 Ga0070713_100028138
1031 Ga0070713_100047695
1032 Ga0070713_100071884
1033 Ga0070713_100094421
1034 Ga0070713_100095531
1035 Ga0070713_100103365
1036 Ga0070713_100200693
1037 Ga0070713_100243731
1038 Ga0070713_100458213
1039 Ga0070710_10010238
1040 Ga0070710_10012555
1041 Ga0070710_10156594
1042 Ga0070711_100000213
1043 Ga0070711_100000295
1044 Ga0070711_100004192
1045 Ga0070711_100007243
1046 Ga0070711_100013898
1047 Ga0070711_100060721
1048 Ga0070711_100097071
1049 Ga0070711_100112160
1050 Ga0070711_100201473
1051 Ga0070694_100167216
1052 Ga0070708_100000645
1053 Ga0070708_100001134
1054 Ga0070708_100006720
1055 Ga0070708_100007060
1056 Ga0070708_100011143
1057 Ga0070708_100011243
1058 Ga0070708_100020446
1059 Ga0070708_100091846
1060 Ga0070708_100190521
1061 Ga0070663_100032251
1062 Ga0070678_100137958
1063 Ga0070662_100198201
1064 Ga0070681_10000134
1065 Ga0070681_10006139
1066 Ga0070681_10006931
1067 Ga0070681_10013459
1068 Ga0070681_10073815
1069 Ga0070681_10074820
1070 Ga0068867_100015789
1071 Ga0070706_100000496
1072 Ga0070706_100000674
1073 Ga0070706_100010441
1074 Ga0070706_100024527
1075 Ga0070706_100037477
1076 Ga0070706_100098960
1077 Ga0070706_100132418
1078 Ga0070706_100261149
1079 Ga0070707_100000853
1080 Ga0070707_100001215
1081 Ga0070707_100011884
1082 Ga0070707_100082370
1083 Ga0070707_100156969
1084 Ga0070707_100198043
1085 Ga0070707_100261105
1086 Ga0070707_100355497
1087 Ga0070698_100000012
1088 Ga0070698_100004151
1089 Ga0070698_100343063
1090 Ga0070699_100000288
1091 Ga0070699_100060133
1092 Ga0070699_100099763
1093 Ga0070699_100404933
1094 Ga0070679_100003333
1095 Ga0070679_100006061
1096 Ga0070679_100026036
1097 Ga0070679_100111489
1098 Ga0070684_100001287
1099 Ga0070684_100009964
1100 Ga0070684_100034168
1101 Ga0070684_100077441
1102 Ga0070684_100082042
1103 Ga0070684_100115873
1104 Ga0070697_100000281
1105 Ga0070697_100000289
1106 Ga0070697_100000772
1107 Ga0070697_100002989
1108 Ga0070697_100003013
1109 Ga0070697_100006248
1110 Ga0070697_100074494
1111 Ga0070697_100140411
1112 Ga0068853_100000020
1113 Ga0068853_100000442
1114 Ga0068853_100011796
1115 Ga0068853_100034468
1116 Ga0068853_100034722
1117 Ga0068853_100038140
1118 Ga0068853_100066973
1119 Ga0068853_100228094
1120 Ga0070696_100081560
1121 Ga0070696_100094976
1122 Ga0070693_100081302
1123 Ga0070693_100097144
1124 Ga0070665_100002682
1125 Ga0070665_100023873
1126 Ga0070704_100166139
1127 Ga0068855_100001768
1128 Ga0068855_100004933
1129 Ga0068855_100010394
1130 Ga0068855_100022876
1131 Ga0068855_100025865
1132 Ga0068855_100029165
1133 Ga0068855_100031183
1134 Ga0068855_100044190
1135 Ga0068855_100087942
1136 Ga0068855_100270035
1137 Ga0070664_100000499
1138 Ga0070664_100033836
1139 Ga0070664_100056227
1140 Ga0070664_100063300
1141 Ga0068857_100006354
1142 Ga0068857_100017725
1143 Ga0068857_100020596
1144 Ga0068857_100148042
1145 Ga0068854_100000057
1146 Ga0068854_100014546
1147 Ga0068854_100044682
1148 Ga0068856_100001767
1149 Ga0068856_100002074
1150 Ga0068856_100009770
1151 Ga0068856_100018784
1152 Ga0068856_100021154
1153 Ga0068856_100023374
1154 Ga0068856_100044236
1155 Ga0068856_100061370
1156 Ga0068856_100122411
1157 Ga0068856_100128737
1158 Ga0068856_100152544
1159 Ga0068856_100181042
1160 Ga0068856_100272829
1161 Ga0068856_100366977
1162 Ga0070702_100091145
1163 Ga0068852_100000057
1164 Ga0068852_100002802
1165 Ga0068852_100007675
1166 Ga0068852_100044313
1167 Ga0068852_100142435
1168 Ga0068852_100428833
1169 Ga0068859_100000871
1170 Ga0068859_100011050
1171 Ga0068859_100027637
1172 Ga0068859_100037789
1173 Ga0068859_100185605
1174 Ga0068859_100259989
1175 Ga0068864_100000664
1176 Ga0068864_100061436
1177 Ga0068864_100063076
1178 Ga0068864_100151169
1179 Ga0068866_10014077
1180 Ga0068851_10000954
1181 Ga0068851_10018902
1182 Ga0068851_10026504
1183 Ga0068851_10133536
1184 Ga0068870_10163951
1185 Ga0068863_100020269
1186 Ga0068863_100053900
1187 Ga0068863_100081410
1188 Ga0068863_100154293
1189 Ga0068858_100002350
1190 Ga0068858_100038770
1191 Ga0068858_100093824
1192 Ga0068858_100329516
1193 Ga0068860_100004062
1194 Ga0068860_100026628
1195 Ga0068860_100051289
1196 Ga0068860_100054259
1197 Ga0068862_100148281
1198 Ga0070717_10000248
1199 Ga0070717_10001075
1200 Ga0070717_10003342
1201 Ga0070717_10006430
1202 Ga0070717_10009279
1203 Ga0070717_10021131
1204 Ga0070717_10036213
1205 Ga0070717_10082862
1206 Ga0070717_10105712
1207 Ga0070717_10194860
1208 Ga0070715_10003825
1209 Ga0070715_10053873
1210 Ga0070716_100000132
1211 Ga0070716_100034079
1212 Ga0070716_100053626
1213 Ga0070712_100000047
1214 Ga0070712_100000601
1215 Ga0070712_100001013
1216 Ga0070712_100001074
1217 Ga0070712_100002835
1218 Ga0070712_100017174
1219 Ga0070712_100308122
1220 Ga0097621_100000181
1221 Ga0097621_100001172
1222 Ga0097621_100007256
1223 Ga0097621_100008436
1224 Ga0097621_100009481
1225 Ga0097621_100020909
1226 Ga0097621_100026261
1227 Ga0097621_100053852
1228 Ga0097621_100061925
1229 Ga0097621_100178290
1230 Ga0068871_100001954
1231 Ga0068871_100006144
1232 Ga0068871_100010456
1233 Ga0068871_100014443
1234 Ga0068871_100022851
1235 Ga0068871_100045641
1236 Ga0068871_100090164
1237 Ga0075433_10040317
1238 Ga0075434_100000020
1239 Ga0068865_100021435
1240 Ga0068865_100031206
1241 Ga0075436_100005025
1242 Ga0075436_100014759
1243 Ga0097620_100000871
1244 Ga0097620_100011050
1245 Ga0097620_100027636
1246 Ga0097620_100037791
1247 Ga0097620_100185619
1248 Ga0097620_100259956
1249 Ga0075435_100029854
1250 Ga0075435_100037949
1251 Ga0075435_100040447
1252 Ga0099794_10032752
1253 Ga0105240_10000454
1254 Ga0105240_10003924
1255 Ga0105240_10016569
1256 Ga0105240_10025553
1257 Ga0105240_10027409
1258 Ga0105240_10057755
1259 Ga0105240_10063402
1260 Ga0105240_10064403
1261 Ga0105240_10069863
1262 Ga0105240_10106498
1263 Ga0105240_10167508
1264 Ga0105240_10202388
1265 Ga0105240_10211037
1266 Ga0105240_10223781
1267 Ga0105240_10413483
1268 Ga0105240_10448520
1269 Ga0105245_10057209
1270 Ga0105245_10079711
1271 Ga0105245_10137565
1272 Ga0105245_10322208
1273 Ga0105247_10058039
1274 Ga0114129_10017635
1275 Ga0105243_10046344
1276 Ga0105241_10000178
1277 Ga0105241_10001986
1278 Ga0105241_10005084
1279 Ga0105241_10033827
1280 Ga0105241_10045122
1281 Ga0105241_10050801
1282 Ga0105241_10074968
1283 Ga0105241_10098865
1284 Ga0105241_10116285
1285 Ga0105242_10039680
1286 Ga0105242_10088255
1287 Ga0105242_10102841
1288 Ga0105248_10002674
1289 Ga0105248_10017862
1290 Ga0105237_10009941
1291 Ga0105237_10045387
1292 Ga0105237_10055322
1293 Ga0105237_10066510
1294 Ga0105237_10164308
1295 Ga0105237_10199512
1296 Ga0105237_10268112
1297 Ga0105237_10275319
1298 Ga0105238_10000233
1299 Ga0105238_10003997
1300 Ga0105238_10010999
1301 Ga0105238_10012427
1302 Ga0105238_10021832
1303 Ga0105238_10027571
1304 Ga0105238_10043696
1305 Ga0105238_10071733
1306 Ga0105238_10096553
1307 Ga0105238_10097078
1308 Ga0105238_10120152
1309 Ga0105249_10009316
1310 Ga0105239_10000866
1311 Ga0105239_10008235
1312 Ga0105239_10028676
1313 Ga0105239_10057563
1314 Ga0105239_10107325
1315 Ga0105239_10172185
1316 Ga0105239_10436780
1317 Ga0157373_10002068
1318 Ga0157373_10127613
1319 Ga0157371_10013276
1320 Ga0157371_10090306
1321 Ga0157370_10000294
1322 Ga0157370_10015639
1323 Ga0157370_10075975
1324 Ga0157370_10091412
1325 Ga0157370_10268740
1326 Ga0157369_10000131
1327 Ga0157369_10000244
1328 Ga0157369_10000497
1329 Ga0157369_10002520
1330 Ga0157369_10014550
1331 Ga0157369_10026897
1332 Ga0157369_10042808
1333 Ga0157369_10056745
1334 Ga0157369_10199290
1335 Ga0157369_10326128
1336 Ga0157374_10000363
1337 Ga0157374_10000554
1338 Ga0157374_10002076
1339 Ga0157374_10016309
1340 Ga0157374_10017519
1341 Ga0157374_10024120
1342 Ga0157374_10025785
1343 Ga0157374_10094631
1344 Ga0157374_10179195
1345 Ga0157374_10191440
1346 Ga0157374_10266967
1347 Ga0157374_10298180
1348 Ga0157378_10000162
1349 Ga0157378_10000397
1350 Ga0157378_10007198
1351 Ga0157378_10010329
1352 Ga0157378_10011835
1353 Ga0157378_10056461
1354 Ga0157378_10112206
1355 Ga0157378_10141070
1356 Ga0157378_10162766
1357 Ga0157378_10229121
1358 Ga0163162_10000276
1359 Ga0163162_10003017
1360 Ga0163162_10030469
1361 Ga0163162_10416205
1362 Ga0157372_10000390
1363 Ga0157372_10001666
1364 Ga0157372_10001776
1365 Ga0157372_10001923
1366 Ga0157372_10002305
1367 Ga0157372_10006184
1368 Ga0157372_10009260
1369 Ga0157372_10012963
1370 Ga0157372_10016605
1371 Ga0157372_10020007
1372 Ga0157372_10023331
1373 Ga0157372_10023660
1374 Ga0157372_10027421
1375 Ga0157372_10028928
1376 Ga0157372_10054382
1377 Ga0157372_10055103
1378 Ga0157372_10057399
1379 Ga0157372_10139085
1380 Ga0157372_10146595
1381 Ga0157372_10413112
1382 Ga0157375_10010936
1383 Ga0157375_10016852
1384 Ga0157375_10037551
1385 Ga0163163_10005994
1386 Ga0163163_10036606
1387 Ga0163163_10045860
1388 Ga0163163_10062090
1389 Ga0163163_10086316
1390 Ga0157379_10004032
1391 Ga0157379_10041831
1392 Ga0157379_10063550
1393 Ga0157379_10167597
1394 Ga0157379_10184540
1395 Ga0157379_10298443
1396 Ga0157376_10002473
1397 Ga0157376_10016334
1398 Ga0157376_10088336
1399 Ga0157376_10142182
1400 Ga0157376_10287454
1401 Ga0157376_10412449
1402 Ga0213874_10009792
1403 Ga0213875_10047462
1404 Ga0224570_100377
1405 Ga0224569_100841
1406 Ga0224572_1000147
1407 Ga0224572_1015171
1408 Ga0228598_1006077
1409 Ga0207656_10008238
1410 Ga0207656_10063070
1411 Ga0207692_10022170
1412 Ga0207692_10105940
1413 Ga0207642_10041543
1414 Ga0207710_10025761
1415 Ga0207710_10033604
1416 Ga0207680_10073566
1417 Ga0207647_10002559
1418 Ga0207647_10023490
1419 Ga0207647_10035457
1420 Ga0207647_10045211
1421 Ga0207685_10006966
1422 Ga0207685_10017722
1423 Ga0207685_10054817
1424 Ga0207699_10000189
1425 Ga0207699_10032143
1426 Ga0207699_10035928
1427 Ga0207699_10037186
1428 Ga0207699_10112884
1429 Ga0207645_10004443
1430 Ga0207705_10000171
1431 Ga0207705_10005338
1432 Ga0207705_10019372
1433 Ga0207705_10163214
1434 Ga0207684_10000475
1435 Ga0207684_10001079
1436 Ga0207684_10004709
1437 Ga0207684_10060411
1438 Ga0207684_10155845
1439 Ga0207654_10000059
1440 Ga0207654_10005858
1441 Ga0207654_10018595
1442 Ga0207654_10042497
1443 Ga0207654_10055590
1444 Ga0207654_10085702
1445 Ga0207707_10004211
1446 Ga0207707_10010273
1447 Ga0207707_10013862
1448 Ga0207707_10029785
1449 Ga0207707_10113562
1450 Ga0207707_10319024
1451 Ga0207695_10000096
1452 Ga0207695_10000570
1453 Ga0207695_10003417
1454 Ga0207695_10028488
1455 Ga0207695_10032643
1456 Ga0207695_10055498
1457 Ga0207695_10062197
1458 Ga0207695_10076222
1459 Ga0207695_10099744
1460 Ga0207695_10138803
1461 Ga0207695_10142806
1462 Ga0207695_10173161
1463 Ga0207695_10440737
1464 Ga0207671_10002674
1465 Ga0207671_10015500
1466 Ga0207671_10033927
1467 Ga0207671_10050221
1468 Ga0207671_10189965
1469 Ga0207693_10000210
1470 Ga0207693_10000537
1471 Ga0207693_10002933
1472 Ga0207693_10009006
1473 Ga0207693_10017069
1474 Ga0207693_10025121
1475 Ga0207693_10025681
1476 Ga0207693_10138348
1477 Ga0207663_10000279
1478 Ga0207663_10020339
1479 Ga0207663_10058823
1480 Ga0207663_10062404
1481 Ga0207663_10107960
1482 Ga0207663_10258872
1483 Ga0207660_10036880
1484 Ga0207660_10041176
1485 Ga0207662_10041063
1486 Ga0207657_10004750
1487 Ga0207657_10010068
1488 Ga0207657_10018159
1489 Ga0207657_10090247
1490 Ga0207657_10183670
1491 Ga0207649_10039735
1492 Ga0207652_10006502
1493 Ga0207652_10018778
1494 Ga0207652_10042027
1495 Ga0207652_10078278
1496 Ga0207646_10000178
1497 Ga0207646_10000632
1498 Ga0207646_10001378
1499 Ga0207646_10052696
1500 Ga0207646_10239242
1501 Ga0207646_10290685
1502 Ga0207646_10294130
1503 Ga0207646_10322847
1504 Ga0207681_10158329
1505 Ga0207694_10001230
1506 Ga0207694_10009730
1507 Ga0207694_10013316
1508 Ga0207694_10014603
1509 Ga0207694_10024896
1510 Ga0207694_10026831
1511 Ga0207694_10058071
1512 Ga0207650_10015148
1513 Ga0207650_10133029
1514 Ga0207687_10078817
1515 Ga0207687_10086462
1516 Ga0207687_10100025
1517 Ga0207700_10000385
1518 Ga0207700_10000443
1519 Ga0207700_10011819
1520 Ga0207700_10022360
1521 Ga0207700_10029523
1522 Ga0207700_10043322
1523 Ga0207700_10046520
1524 Ga0207700_10051164
1525 Ga0207700_10091658
1526 Ga0207664_10000977
1527 Ga0207664_10002047
1528 Ga0207664_10022887
1529 Ga0207664_10063377
1530 Ga0207664_10118384
1531 Ga0207664_10173020
1532 Ga0207664_10176352
1533 Ga0207664_10211441
1534 Ga0207664_10259191
1535 Ga0207664_10273951
1536 Ga0207664_10323194
1537 Ga0207690_10003276
1538 Ga0207690_10078148
1539 Ga0207690_10104254
1540 Ga0207690_10289911
1541 Ga0207706_10001043
1542 Ga0207686_10044025
1543 Ga0207670_10057635
1544 Ga0207665_10010386
1545 Ga0207665_10010710
1546 Ga0207665_10042300
1547 Ga0207665_10053915
1548 Ga0207665_10065001
1549 Ga0207665_10073619
1550 Ga0207665_10098024
1551 Ga0207711_10028907
1552 Ga0207711_10094862
1553 Ga0207689_10086129
1554 Ga0207661_10057631
1555 Ga0207661_10064655
1556 Ga0207661_10339411
1557 Ga0207679_10007363
1558 Ga0207679_10034205
1559 Ga0207679_10035208
1560 Ga0207679_10048506
1561 Ga0207667_10000056
1562 Ga0207667_10001636
1563 Ga0207667_10002468
1564 Ga0207667_10006361
1565 Ga0207667_10008520
1566 Ga0207667_10016174
1567 Ga0207667_10035667
1568 Ga0207667_10062087
1569 Ga0207667_10064854
1570 Ga0207667_10070314
1571 Ga0207667_10075773
1572 Ga0207667_10085675
1573 Ga0207651_10161546
1574 Ga0207668_10004546
1575 Ga0207640_10000001
1576 Ga0207640_10007235
1577 Ga0207677_10005168
1578 Ga0207677_10029495
1579 Ga0207677_10038683
1580 Ga0207677_10045538
1581 Ga0207677_10143992
1582 Ga0207703_10002440
1583 Ga0207703_10077877
1584 Ga0207703_10126869
1585 Ga0207639_10000023
1586 Ga0207639_10000529
1587 Ga0207639_10148670
1588 Ga0207678_10004337
1589 Ga0207678_10018701
1590 Ga0207708_10069155
1591 Ga0207702_10000660
1592 Ga0207702_10006768
1593 Ga0207702_10011890
1594 Ga0207702_10012133
1595 Ga0207702_10034962
1596 Ga0207702_10062037
1597 Ga0207702_10171630
1598 Ga0207702_10234680
1599 Ga0207702_10378235
1600 Ga0207641_10034388
1601 Ga0207641_10045758
1602 Ga0207641_10072917
1603 Ga0207641_10133420
1604 Ga0207648_10006733
1605 Ga0207648_10112356
1606 Ga0207676_10048850
1607 Ga0207674_10005307
1608 Ga0207674_10018205
1609 Ga0207674_10018363
1610 Ga0207674_10049427
1611 Ga0207674_10087833
1612 Ga0207675_100118197
1613 Ga0207683_10060094
1614 Ga0207698_10000033
1615 Ga0207698_10000803
1616 Ga0207698_10014164
1617 Ga0207698_10118611
1618 Ga0207698_10145634
1619 Ga0209998_10008831
1620 Ga0265356_1000547
1621 Ga0265355_1000390
1622 Ga0268266_10171312
1623 Ga0268264_10034434
1624 Ga0268264_10036781
1625 Ga0268264_10060699
1626 Ga0268264_10076464
1627 Ga0268264_10076885
1628 Ga0268264_10240365
1629 Ga0265318_10005221
1630 Ga0265323_10025473
1631 Ga0265338_10000884
1632 Ga0265338_10005846
1633 Ga0265338_10010579
1634 Ga0265338_10015061
1635 Ga0265338_10016519
1636 Ga0265338_10023672
1637 Ga0265338_10025365
1638 Ga0265338_10028696
1639 Ga0265338_10029982
1640 Ga0265338_10030700
1641 Ga0265338_10052859
1642 Ga0265338_10059134
1643 Ga0265762_1000288
1644 Ga0265762_1005710
1645 Ga0265770_1002318
1646 Ga0265765_1004480
1647 Ga0265760_10000300
1648 Ga0265760_10002305
1649 Ga0265760_10042842
1650 Ga0265330_10000316
1651 Ga0265330_10016986
1652 Ga0265330_10017850
1653 Ga0265332_10097632
1654 Ga0265328_10034420
1655 Ga0265325_10000312
1656 Ga0265325_10003323
1657 Ga0265325_10012965
1658 Ga0265325_10014919
1659 Ga0265325_10059435
1660 Ga0265340_10011480
1661 Ga0265340_10031942
1662 Ga0265340_10075255
1663 Ga0265339_10000007
1664 Ga0265339_10000394
1665 Ga0265339_10004190
1666 Ga0265339_10020996
1667 Ga0265339_10040190
1668 Ga0265339_10073692
1669 Ga0265331_10020262
1670 Ga0265331_10022969
1671 Ga0265327_10033065
1672 Ga0265316_10000523
1673 Ga0265316_10000577
1674 Ga0265316_10001955
1675 Ga0265316_10015061
1676 Ga0265316_10036807
1677 Ga0265316_10040889
1678 Ga0265316_10058565
1679 Ga0265316_10061957
1680 Ga0265316_10116801
1681 Ga0265316_10148684
1682 Ga0265313_10007815
1683 Ga0265313_10010408
1684 Ga0265313_10015391
1685 Ga0265313_10016777
1686 Ga0265314_10000036
1687 Ga0265314_10014337
1688 Ga0265314_10019363
1689 Ga0265314_10035128
1690 Ga0265314_10094417
1691 Ga0265314_10159310
1692 Ga0265342_10000927
1693 Ga0265342_10008880
1694 Ga0265342_10009400
1695 Ga0265342_10019662
1696 Ga0373944_0005067
1697 Ga0373944_0024314
1698 Ga0373923_0049533
1699 Ga0373936_0001156
1700 Ga0373936_0005969
1701 Ga0373953_0109767
1702 Ga0373954_0057446
1703 Ga0373956_0061172
1704 Ga0373943_0000004
1705 Ga0373943_0074006
1706 Ga0373943_0090030
1707 Ga0373943_0153203
1708 Ga0373946_0009075
1709 Ga0373946_0049612
1710 Ga0373955_0059453
1711 Ga0373955_0088270
1712 Ga0373955_0263409
1713 Ga0373924_0028898
1714 Ga0373924_0033401
1715 Ga0373931_0010296
1716 Ga0373931_0141339
1717 Ga0373935_0007828
1718 Ga0373935_0041922
1719 Ga0373935_0052155
1720 Ga0373935_0406774
1721 Ga0373927_0002620
1722 Ga0373927_0018199
1723 Ga0373927_0020842
1724 Ga0373927_0118902
1725 Ga0373927_0186092
1726 Ga0373933_0008022
1727 Ga0373933_0128497
1728 Ga0373933_0139075
1729 Ga0373947_0000164
1730 Ga0373947_0006614
1731 Ga0373947_0010434
1732 Ga0373947_0024718
1733 Ga0373937_0025631
1734 Ga0373937_0043194
1735 Ga0373937_0063206
1736 Ga0373937_0253017
1737 Ga0373925_0000567
1738 Ga0373925_0017979
1739 Ga0373925_0019442
1740 Ga0373925_0084671
1741 Ga0373925_0127694
1742 Ga0373925_0133979
1743 Ga0373925_0189253
1744 Ga0373925_0478681
1745 Ga0436364_0518068
1746 Ga0436363_0063768
1747 Ga0436363_1320008
1748 Ga0436362_0531405
1749 Ga0436362_0878763
1750 Ga0451577_0001020
1751 Ga0451577_0025182
1752 Ga0453683_0003430
1753 Ga0453683_0004822
1754 Ga0453683_0004869
1755 Ga0453683_0014295
1756 Ga0466961_0031282
1757 Ga0466963_0000354
1758 Ga0453684_0002315
1759 Ga0453684_0043215
1760 Ga0453684_0065381
1761 Ga0466970_0126907
1762 Ga0466957_0136365
1763 Ga0466959_0276167
1764 Ga0451576_0009426
1765 Ga0451576_0154684
1766 Ga0451576_0576932
1767 Ga0466967_0064429
1768 Ga0466967_0112330
1769 Ga0466967_0275568
1770 Ga0466967_0381963
1771 Ga0495592_0028438
1772 Ga0495592_0119170
1773 Ga0495629_0030894
1774 Ga0495651_0001179
1775 Ga0495651_0004574
1776 Ga0495651_0006468
1777 Ga0495651_0101843
1778 Ga0495653_0001994
1779 Ga0495580_0000441
1780 Ga0495580_0000609
1781 Ga0495580_0001062
1782 Ga0495580_0001431
1783 Ga0495580_0001583
1784 Ga0495580_0008222
1785 Ga0495580_0014062
1786 Ga0495580_0024445
1787 Ga0495580_0024687
1788 Ga0495580_0038766
1789 Ga0495580_0045221
1790 Ga0495580_0064865
1791 Ga0495580_0072637
1792 Ga0495580_0080685
1793 Ga0495580_0087251
1794 Ga0495582_0001260
1795 Ga0495582_0006455
1796 Ga0495639_0035377
1797 Ga0495639_0044102
1798 Ga0495664_0035479
1799 Ga0495584_0028527
1800 Ga0495594_0036964
1801 Ga0495608_0030409
1802 Ga0495618_0005298
1803 Ga0495628_0000515
1804 Ga0495628_0020783
1805 Ga0495630_0025176
1806 Ga0495630_0038396
1807 Ga0495630_0043043
1808 Ga0495630_0221931
1809 Ga0495666_0031273
1810 Ga0495652_0002539
1811 Ga0495652_0003408
1812 Ga0495652_0045581
1813 Ga0495665_0005280
1814 Ga0495665_0028806
1815 Ga0495665_0113032
1816 Ga0495665_0155624
1817 Ga0495586_0020124
1818 Ga0495587_0005591
1819 Ga0495645_0017238
1820 Ga0495645_0018213
1821 Ga0495645_0029827
1822 Ga0495645_0038424
1823 Ga0495667_0000891
1824 Ga0495667_0064674
1825 Ga0495634_0117311
1826 Ga0495635_0040967
1827 Ga0495635_0061284
1828 Ga0495635_0094915
1829 Ga0495657_0098220
1830 Ga0495657_0147302
1831 Ga0495599_0120593
1832 Ga0495623_0000969
1833 Ga0495623_0134031
1834 Ga0495646_0042960
1835 Ga0495669_0053362
1836 Ga0495613_0036425
1837 Ga0495613_0042375
1838 Ga0495613_0045880
1839 Ga0495613_0191672
1840 Ga0495600_0011303
1841 Ga0495600_0215656
1842 Ga0495581_0016318
1843 Ga0495581_0074992
1844 Ga0495581_0091084
1845 Ga0495604_0004504
1846 Ga0495604_0006614
1847 Ga0495674_0027813
1848 Ga0495674_0053400
1849 Ga0495676_0190727
1850 Ga0495680_0000563
1851 Ga0495680_0012551
1852 Ga0495675_0000371
1853 Ga0495675_0028486
1854 Ga0495684_0011434
1855 Ga0495684_0040926
1856 Ga0495593_0036019
1857 Ga0495602_0029718
1858 Ga0495602_0033924
1859 Ga0495602_0054017
1860 Ga0495602_0105428
1861 Ga0495602_0173542
1862 Ga0495614_0008720
1863 Ga0496100_0014929
1864 Ga0496100_0060505
1865 Ga0496100_0216440
1866 Ga0496102_0032314
1867 Ga0496102_0326193
1868 Ga0496103_0219500
1869 Ga0496104_0011547
1870 Ga0496104_0047856
1871 Ga0496104_0083680
1872 Ga0496104_0099947
1873 Ga0496104_0215322
1874 Ga0496105_0058046
1875 Ga0496105_0153537
1876 Ga0496105_0185005
1877 Ga0496105_0196764
1878 Ga0496105_0233431
1879 Ga0496107_0067267
1880 Ga0496107_0081266
1881 Ga0496107_0136651
1882 Ga0496108_0109525
1883 Ga0496109_0015872
1884 Ga0496109_0024173
1885 Ga0496109_0125974
1886 Ga0496109_0182735
1887 Ga0496110_0058648
1888 Ga0496110_0100844
1889 Ga0496110_0186081
1890 Ga0496110_0240248
1891 Ga0496111_0071702
1892 Ga0496112_0001261
1893 Ga0496112_0003216
1894 Ga0496112_0029415
1895 Ga0496112_0038573
1896 Ga0496112_0055318
1897 Ga0496112_0117680
1898 Ga0496112_0152867
1899 Ga0496112_0279384
1900 Ga0496113_0141057
1901 Ga0496113_0160576
1902 Ga0496114_0030933
1903 Ga0496114_0067765
1904 Ga0496115_0003572
1905 Ga0496115_0007295
1906 Ga0496115_0227090
1907 Ga0501031_0146485
1908 Ga0501048_0147006
1909 Ga0501067_0043118
1910 Ga0501075_0027342
1911 Ga0501083_0027986
1912 nmdc:mga0n895_47947_c1
1913 nmdc:mga0rr50_16792_c1
1914 nmdc:mga0rr50_46448_c1
1915 nmdc:mga0rr50_69457_c1
1916 nmdc:mga08x19_11108_c1
1917 nmdc:mga08x19_2239_c1
1918 nmdc:mga08x19_2667_c1
1919 nmdc:mga08x19_77344_c1
1920 nmdc:mga0a205_232_c1
1921 Ga0495619_0129677
1922 Ga0530510_0188495

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

190

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9541 18 235
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9505 20 242
8bmp-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp 0.945 18 240
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.944 18 243
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9434 18 242
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9726 21 242 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 19 241 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 19 240 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9646 19 242 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9643 21 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9809 21 242 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9777 18 242 GO:0005524
GO:0016887
AF-A0A170S8R2-F1-model_v4 ABC transporter ATP-binding protein (Daunorubicin resistance ATP-binding protein) 0.9762 18 242 GO:0005524
GO:0016887
AF-A0A842TW32-F1-model_v4 ATP-binding cassette domain-containing protein 0.9741 18 242 GO:0005524
GO:0016887
AF-A0A0D1P4L1-F1-model_v4 deleted 0.9704 18 242

Map