F486870

General Info

Members Datasets Scaffolds Average Seq Length
961 349 961 274

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0123418|Ga0395898_0123418_266_1282
Length 317
Sequence VLIRVGSRGSRLALTQAELAAARLRAPGMEIALMPITTAGDRDRTKPFGQIGSRGVFVKELEEALLEGRIDVAVHSAKDMTSSDPAGLAVGAYVERDDPRDALCGAEAIRPGMRIGTASARRKAQLLALEPTLSIEPLRGNIDTRLRKRGERGLDAVVLAACGLDRLGLAHEIGLRLDPETMLPEAAQGALALQVRAGEESLVADVDHAETRRRVEAERTVVAAVEGGCLAPVAAHHDGTTLTGLIAAEDGSWIDLGPRAGAVLERVAGDRKPFPPGRIGAAFEPSDPTGWLIVAGLSIALALGVAYARHRPGGATG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 10.82
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001067 3300003373 Bacteria 6025
2 Ga0070658_10037764 3300005327 Bacteria 3893
3 Ga0070683_100037562 3300005329 Bacteria 4433
4 Ga0070683_100254295 3300005329 Bacteria 1671
5 Ga0070690_100080852 3300005330 Bacteria 2126
6 Ga0068869_100088418 3300005334 Bacteria 2325
7 Ga0070680_100020568 3300005336 Bacteria 5239
8 Ga0070680_100023083 3300005336 Bacteria 4958
9 Ga0070680_100049179 3300005336 Bacteria 3436
10 Ga0070680_100077430 3300005336 Bacteria 2739
11 Ga0070680_100296143 3300005336 Bacteria 1372
12 Ga0070682_100137262 3300005337 Bacteria 1663
13 Ga0070660_100008257 3300005339 Bacteria 7278
14 Ga0070660_100020167 3300005339 Bacteria 4895
15 Ga0070660_100045357 3300005339 Bacteria 3365
16 Ga0070660_100054065 3300005339 Bacteria 3099
17 Ga0070660_100078063 3300005339 Unclassified 2596
18 Ga0070660_100296139 3300005339 Bacteria 1326
19 Ga0070691_10031993 3300005341 Bacteria 2470
20 Ga0070691_10086887 3300005341 Unclassified 1537
21 Ga0070661_100056424 3300005344 Bacteria 2878
22 Ga0070692_10014373 3300005345 Bacteria 3718
23 Ga0070692_10018151 3300005345 Bacteria 3377
24 Ga0070668_100053143 3300005347 Bacteria 3124
25 Ga0070669_100340478 3300005353 Bacteria 1215
26 Ga0070671_100136151 3300005355 Bacteria 2071
27 Ga0070671_100164199 3300005355 Bacteria 1877
28 Ga0070671_100435585 3300005355 Bacteria 1124
29 Ga0070674_100005755 3300005356 Bacteria 7192
30 Ga0070674_100055508 3300005356 Bacteria 2743
31 Ga0070673_100109765 3300005364 Bacteria 2286
32 Ga0070688_100182657 3300005365 Bacteria 1456
33 Ga0070659_100004574 3300005366 Bacteria 9892
34 Ga0070659_100024028 3300005366 Bacteria 4669
35 Ga0070659_100037243 3300005366 Bacteria 3791
36 Ga0070659_100282099 3300005366 Bacteria 1382
37 Ga0070703_10029379 3300005406 Bacteria 1650
38 Ga0070709_10006188 3300005434 Bacteria 6515
39 Ga0070709_10038468 3300005434 Bacteria 2929
40 Ga0070709_10068543 3300005434 Unclassified 2282
41 Ga0070709_10132751 3300005434 Bacteria 1701
42 Ga0070709_10327033 3300005434 Bacteria 1127
43 Ga0070709_10351815 3300005434 Unclassified 1089
44 Ga0070714_100004838 3300005435 Bacteria 10221
45 Ga0070714_100008551 3300005435 Bacteria 8003
46 Ga0070714_100026860 3300005435 Bacteria 4761
47 Ga0070714_100052155 3300005435 Bacteria 3488
48 Ga0070714_100061379 3300005435 Bacteria 3229
49 Ga0070714_100070139 3300005435 Bacteria 3029
50 Ga0070714_100083695 3300005435 Bacteria 2783
51 Ga0070714_100231522 3300005435 Bacteria 1702
52 Ga0070713_100001060 3300005436 Bacteria 17565
53 Ga0070713_100008471 3300005436 Bacteria 7293
54 Ga0070710_10003601 3300005437 Bacteria 7338
55 Ga0070710_10008982 3300005437 Bacteria 4882
56 Ga0070710_10105674 3300005437 Bacteria 1683
57 Ga0070701_10065807 3300005438 Bacteria 1925
58 Ga0070711_100009812 3300005439 Bacteria 5905
59 Ga0070711_100016495 3300005439 Bacteria 4693
60 Ga0070700_100156245 3300005441 Bacteria 1565
61 Ga0070700_100189187 3300005441 Unclassified 1438
62 Ga0070694_100047908 3300005444 Bacteria 2873
63 Ga0070694_100086507 3300005444 Bacteria 2191
64 Ga0070694_100408916 3300005444 Bacteria 1064
65 Ga0070678_100129016 3300005456 Bacteria 2006
66 Ga0070662_100032975 3300005457 Bacteria 3644
67 Ga0070681_10039443 3300005458 Bacteria 4734
68 Ga0070681_10071482 3300005458 Bacteria 3434
69 Ga0070681_10245233 3300005458 Bacteria 1705
70 Ga0068867_100022590 3300005459 Bacteria 4497
71 Ga0068867_100084604 3300005459 Bacteria 2397
72 Ga0070706_100058985 3300005467 Bacteria 3542
73 Ga0070706_100122634 3300005467 Bacteria 2423
74 Ga0070707_100051967 3300005468 Bacteria 3928
75 Ga0070707_100064103 3300005468 Bacteria 3527
76 Ga0070707_100421842 3300005468 Bacteria 1294
77 Ga0070698_100015246 3300005471 Bacteria 8127
78 Ga0070698_100016183 3300005471 Bacteria 7875
79 Ga0070698_100022054 3300005471 Bacteria 6668
80 Ga0070699_100082858 3300005518 Bacteria 2797
81 Ga0070679_100022080 3300005530 Bacteria 6217
82 Ga0070679_100033495 3300005530 Bacteria 5087
83 Ga0070679_100036271 3300005530 Bacteria 4894
84 Ga0070679_100052882 3300005530 Bacteria 4043
85 Ga0070679_100082777 3300005530 Unclassified 3198
86 Ga0070684_100020666 3300005535 Bacteria 5461
87 Ga0070684_100071138 3300005535 Bacteria 3062
88 Ga0070684_100126064 3300005535 Bacteria 2306
89 Ga0070684_100542332 3300005535 Bacteria 1079
90 Ga0070697_100158263 3300005536 Bacteria 1913
91 Ga0070697_100188955 3300005536 Bacteria 1748
92 Ga0068853_100325429 3300005539 Bacteria 1426
93 Ga0070695_100029461 3300005545 Bacteria 3411
94 Ga0070695_100140979 3300005545 Bacteria 1671
95 Ga0070696_100015889 3300005546 Bacteria 5060
96 Ga0070696_100061459 3300005546 Bacteria 2628
97 Ga0070693_100023061 3300005547 Bacteria 3320
98 Ga0070693_100248803 3300005547 Bacteria 1177
99 Ga0070704_100015256 3300005549 Bacteria 4822
100 Ga0070704_100017012 3300005549 Bacteria 4612
101 Ga0070704_100158114 3300005549 Bacteria 1789
102 Ga0070704_100162942 3300005549 Bacteria 1765
103 Ga0068855_100052856 3300005563 Bacteria 4781
104 Ga0068855_100061944 3300005563 Bacteria 4369
105 Ga0068855_100152857 3300005563 Bacteria 2624
106 Ga0068855_100208157 3300005563 Bacteria 2199
107 Ga0070664_100091185 3300005564 Unclassified 2638
108 Ga0068857_100038685 3300005577 Bacteria 4224
109 Ga0068857_100604640 3300005577 Bacteria 1037
110 Ga0068856_100083532 3300005614 Bacteria 3172
111 Ga0068852_100076060 3300005616 Bacteria 2964
112 Ga0068859_100488406 3300005617 Bacteria 1327
113 Ga0068864_100070632 3300005618 Bacteria 3039
114 Ga0068866_10125952 3300005718 Bacteria 1450
115 Ga0068861_100007739 3300005719 Bacteria 7381
116 Ga0068861_100094875 3300005719 Bacteria 2362
117 Ga0068861_100097859 3300005719 Bacteria 2328
118 Ga0068861_100184110 3300005719 Bacteria 1741
119 Ga0068851_10008024 3300005834 Bacteria 4870
120 Ga0068870_10097759 3300005840 Bacteria 1653
121 Ga0068863_100172157 3300005841 Unclassified 2077
122 Ga0068858_100432309 3300005842 Bacteria 1267
123 Ga0068862_100278360 3300005844 Bacteria 1533
124 Ga0081455_10004421 3300005937 Bacteria 15777
125 Ga0081455_10018767 3300005937 Bacteria 6563
126 Ga0081538_10000053 3300005981 Bacteria 109213
127 Ga0081538_10000094 3300005981 Bacteria 86715
128 Ga0081538_10000100 3300005981 Bacteria 83917
129 Ga0081538_10024011 3300005981 Bacteria 4359
130 Ga0081538_10034170 3300005981 Bacteria 3367
131 Ga0081538_10082099 3300005981 Bacteria 1711
132 Ga0081540_1017275 3300005983 Bacteria 4473
133 Ga0070717_10005467 3300006028 Bacteria 9275
134 Ga0070717_10007849 3300006028 Bacteria 7943
135 Ga0070717_10034859 3300006028 Bacteria 4070
136 Ga0070717_10205975 3300006028 Bacteria 1725
137 Ga0070717_10363118 3300006028 Bacteria 1296
138 Ga0075365_10210969 3300006038 Bacteria 1361
139 Ga0075364_10254025 3300006051 Bacteria 1195
140 Ga0075432_10008519 3300006058 Bacteria 3497
141 Ga0070715_10011394 3300006163 Bacteria 3201
142 Ga0070715_10038124 3300006163 Bacteria 1993
143 Ga0070716_100001457 3300006173 Bacteria 10535
144 Ga0070716_100008190 3300006173 Bacteria 5181
145 Ga0070716_100143012 3300006173 Bacteria 1528
146 Ga0070712_100211865 3300006175 Bacteria 1528
147 Ga0075367_10225184 3300006178 Bacteria 1174
148 Ga0097621_100281031 3300006237 Bacteria 1465
149 Ga0075428_100002460 3300006844 Bacteria 20102
150 Ga0075428_100005053 3300006844 Bacteria 14668
151 Ga0075428_100012212 3300006844 Bacteria 9550
152 Ga0075428_100379218 3300006844 Bacteria 1516
153 Ga0075431_100002910 3300006847 Bacteria 16568
154 Ga0075431_100033329 3300006847 Bacteria 5309
155 Ga0075431_100070213 3300006847 Bacteria 3614
156 Ga0075431_100134492 3300006847 Unclassified 2549
157 Ga0075431_100363473 3300006847 Bacteria 1453
158 Ga0075433_10002265 3300006852 Bacteria 14625
159 Ga0075433_10024118 3300006852 Bacteria 5129
160 Ga0075433_10071464 3300006852 Bacteria 3050
161 Ga0075433_10086955 3300006852 Bacteria 2761
162 Ga0075433_10113133 3300006852 Bacteria 2408
163 Ga0075434_100001294 3300006871 Bacteria 20866
164 Ga0075434_100003374 3300006871 Bacteria 14296
165 Ga0075434_100009463 3300006871 Bacteria 9085
166 Ga0075434_100033764 3300006871 Bacteria 5051
167 Ga0075434_100145869 3300006871 Bacteria 2387
168 Ga0075429_100008378 3300006880 Bacteria 9000
169 Ga0068865_100018192 3300006881 Bacteria 4532
170 Ga0075436_100000915 3300006914 Bacteria 19663
171 Ga0075436_100006395 3300006914 Bacteria 8074
172 Ga0075436_100008390 3300006914 Bacteria 7065
173 Ga0075436_100020398 3300006914 Bacteria 4549
174 Ga0075436_100272928 3300006914 Bacteria 1208
175 Ga0097620_100488357 3300006931 Bacteria 1327
176 Ga0075435_100001243 3300007076 Bacteria 16320
177 Ga0075435_100028080 3300007076 Bacteria 4410
178 Ga0075435_100103033 3300007076 Bacteria 2366
179 Ga0075435_100120794 3300007076 Bacteria 2186
180 Ga0075435_100331419 3300007076 Archaea 1303
181 Ga0105240_10040117 3300009093 Bacteria 5992
182 Ga0105240_10073540 3300009093 Bacteria 4220
183 Ga0105240_10119265 3300009093 Bacteria 3178
184 Ga0105240_10251425 3300009093 Bacteria 2044
185 Ga0111539_10003095 3300009094 Bacteria 22053
186 Ga0111539_10035714 3300009094 Bacteria 6017
187 Ga0105245_10006126 3300009098 Bacteria 10579
188 Ga0105245_10047671 3300009098 Bacteria 3830
189 Ga0105245_10186618 3300009098 Bacteria 1984
190 Ga0105245_10684038 3300009098 Bacteria 1058
191 Ga0114129_10000141 3300009147 Bacteria 75420
192 Ga0114129_10003813 3300009147 Bacteria 21253
193 Ga0114129_10142466 3300009147 Bacteria 3285
194 Ga0114129_10788334 3300009147 Bacteria 1213
195 Ga0105243_10100630 3300009148 Bacteria 2398
196 Ga0105243_10129849 3300009148 Bacteria 2136
197 Ga0105243_10136046 3300009148 Bacteria 2091
198 Ga0105243_10143766 3300009148 Bacteria 2039
199 Ga0105242_10024082 3300009176 Bacteria 4805
200 Ga0105242_10066229 3300009176 Bacteria 2982
201 Ga0105242_10121783 3300009176 Bacteria 2240
202 Ga0105242_10258774 3300009176 Unclassified 1571
203 Ga0105248_10212958 3300009177 Bacteria 2177
204 Ga0105248_10593259 3300009177 Bacteria 1250
205 Ga0105238_10053645 3300009551 Bacteria 4051
206 Ga0105249_10009086 3300009553 Bacteria 8690
207 Ga0105249_10026677 3300009553 Bacteria 5209
208 Ga0105239_10095749 3300010375 Bacteria 3279
209 Ga0105246_10338207 3300011119 Unclassified 1229
210 Ga0157371_10116002 3300013102 Bacteria 1902
211 Ga0157370_10033132 3300013104 Bacteria 5037
212 Ga0157370_10068805 3300013104 Bacteria 3345
213 Ga0157369_10089572 3300013105 Bacteria 3285
214 Ga0157374_10008652 3300013296 Bacteria 8712
215 Ga0157378_10396830 3300013297 Unclassified 1358
216 Ga0163162_10316400 3300013306 Bacteria 1693
217 Ga0157372_10100565 3300013307 Bacteria 3299
218 Ga0157372_10284795 3300013307 Bacteria 1922
219 Ga0157375_10578672 3300013308 Unclassified 1283
220 Ga0157375_10785346 3300013308 Bacteria 1102
221 Ga0163163_10128882 3300014325 Bacteria 2569
222 Ga0157380_10005200 3300014326 Bacteria 9095
223 Ga0157380_10060201 3300014326 Bacteria 3033
224 Ga0182008_10009436 3300014497 Bacteria 5264
225 Ga0157377_10018073 3300014745 Bacteria 3660
226 Ga0157379_10107811 3300014968 Unclassified 2501
227 Ga0157376_10159817 3300014969 Bacteria 2041
228 Ga0157376_10320910 3300014969 Bacteria 1472
229 Ga0182007_10012200 3300015262 Bacteria 3315
230 Ga0163161_10008822 3300017792 Bacteria 6969
231 Ga0163161_10229610 3300017792 Bacteria 1440
232 Ga0197907_10972893 3300020069 Bacteria 1525
233 Ga0206356_10739625 3300020070 Bacteria 3248
234 Ga0206354_10143858 3300020081 Unclassified 1371
235 Ga0206354_10579909 3300020081 Bacteria 2543
236 Ga0206353_10543908 3300020082 Bacteria 1596
237 Ga0206353_11152913 3300020082 Bacteria 3899
238 Ga0206353_11689011 3300020082 Bacteria 14322
239 Ga0213875_10139329 3300021388 Bacteria 1135
240 Ga0213871_10002981 3300021441 Bacteria 3200
241 Ga0207656_10004008 3300025321 Bacteria 5107
242 Ga0207653_10004251 3300025885 Bacteria 4499
243 Ga0207692_10012508 3300025898 Bacteria 3647
244 Ga0207692_10017163 3300025898 Bacteria 3223
245 Ga0207688_10005694 3300025901 Bacteria 6773
246 Ga0207685_10008146 3300025905 Bacteria 2966
247 Ga0207685_10057699 3300025905 Bacteria 1524
248 Ga0207699_10002004 3300025906 Bacteria 9617
249 Ga0207699_10039861 3300025906 Bacteria 2702
250 Ga0207699_10179391 3300025906 Unclassified 1422
251 Ga0207643_10206819 3300025908 Bacteria 1197
252 Ga0207705_10044675 3300025909 Bacteria 3184
253 Ga0207705_10144245 3300025909 Bacteria 1780
254 Ga0207705_10219367 3300025909 Bacteria 1444
255 Ga0207684_10118109 3300025910 Bacteria 2272
256 Ga0207707_10008396 3300025912 Bacteria 8961
257 Ga0207707_10040872 3300025912 Bacteria 4049
258 Ga0207695_10085325 3300025913 Bacteria 3187
259 Ga0207695_10230599 3300025913 Bacteria 1756
260 Ga0207693_10000282 3300025915 Bacteria 47278
261 Ga0207693_10007638 3300025915 Bacteria 8877
262 Ga0207693_10035896 3300025915 Bacteria 3907
263 Ga0207663_10044668 3300025916 Bacteria 2721
264 Ga0207663_10118368 3300025916 Bacteria 1809
265 Ga0207660_10178611 3300025917 Bacteria 1647
266 Ga0207660_10263106 3300025917 Bacteria 1365
267 Ga0207660_10268093 3300025917 Bacteria 1352
268 Ga0207657_10000988 3300025919 Bacteria 30190
269 Ga0207657_10033885 3300025919 Bacteria 4598
270 Ga0207657_10077510 3300025919 Unclassified 2800
271 Ga0207657_10080178 3300025919 Bacteria 2744
272 Ga0207657_10201020 3300025919 Bacteria 1603
273 Ga0207657_10350582 3300025919 Bacteria 1164
274 Ga0207652_10087226 3300025921 Bacteria 2737
275 Ga0207646_10001768 3300025922 Bacteria 26172
276 Ga0207646_10120866 3300025922 Bacteria 2353
277 Ga0207646_10148490 3300025922 Bacteria 2113
278 Ga0207646_10355995 3300025922 Bacteria 1322
279 Ga0207646_10491985 3300025922 Bacteria 1105
280 Ga0207681_10278020 3300025923 Bacteria 1317
281 Ga0207687_10015169 3300025927 Bacteria 5049
282 Ga0207700_10000039 3300025928 Bacteria 102496
283 Ga0207700_10015530 3300025928 Bacteria 5027
284 Ga0207700_10069117 3300025928 Bacteria 2710
285 Ga0207664_10012931 3300025929 Bacteria 5980
286 Ga0207664_10032025 3300025929 Bacteria 4027
287 Ga0207664_10047082 3300025929 Bacteria 3387
288 Ga0207664_10063827 3300025929 Bacteria 2944
289 Ga0207664_10100754 3300025929 Bacteria 2385
290 Ga0207664_10111667 3300025929 Bacteria 2274
291 Ga0207664_10132587 3300025929 Bacteria 2099
292 Ga0207644_10123627 3300025931 Bacteria 1973
293 Ga0207690_10012589 3300025932 Bacteria 5064
294 Ga0207690_10039559 3300025932 Unclassified 3077
295 Ga0207690_10177336 3300025932 Bacteria 1602
296 Ga0207706_10010201 3300025933 Bacteria 8593
297 Ga0207706_10041071 3300025933 Bacteria 4101
298 Ga0207686_10010201 3300025934 Bacteria 5108
299 Ga0207686_10230059 3300025934 Bacteria 1343
300 Ga0207709_10094126 3300025935 Unclassified 1966
301 Ga0207709_10242955 3300025935 Bacteria 1311
302 Ga0207669_10231393 3300025937 Bacteria 1364
303 Ga0207704_10218237 3300025938 Bacteria 1409
304 Ga0207704_10313786 3300025938 Bacteria 1207
305 Ga0207665_10004972 3300025939 Bacteria 8869
306 Ga0207665_10027771 3300025939 Bacteria 3738
307 Ga0207711_10143958 3300025941 Bacteria 2146
308 Ga0207689_10082630 3300025942 Bacteria 2641
309 Ga0207661_10062637 3300025944 Bacteria 3010
310 Ga0207661_10090489 3300025944 Bacteria 2548
311 Ga0207661_10116265 3300025944 Bacteria 2270
312 Ga0207661_10318684 3300025944 Bacteria 1397
313 Ga0207679_10069445 3300025945 Unclassified 2651
314 Ga0207679_10220337 3300025945 Bacteria 1596
315 Ga0207667_10101806 3300025949 Bacteria 2963
316 Ga0207667_10138760 3300025949 Bacteria 2503
317 Ga0207667_10159659 3300025949 Bacteria 2319
318 Ga0207651_10528870 3300025960 Bacteria 1023
319 Ga0207668_10062865 3300025972 Bacteria 2616
320 Ga0207658_10002326 3300025986 Bacteria 13958
321 Ga0207677_10183427 3300026023 Bacteria 1648
322 Ga0207678_10296639 3300026067 Unclassified 1389
323 Ga0207708_10000684 3300026075 Bacteria 25753
324 Ga0207708_10040507 3300026075 Bacteria 3551
325 Ga0207702_10100980 3300026078 Bacteria 2546
326 Ga0207702_10381501 3300026078 Bacteria 1355
327 Ga0207702_10602393 3300026078 Bacteria 1078
328 Ga0207641_10153622 3300026088 Unclassified 2087
329 Ga0207641_10532558 3300026088 Bacteria 1144
330 Ga0207648_10011247 3300026089 Bacteria 8438
331 Ga0207648_10352013 3300026089 Bacteria 1328
332 Ga0207648_10443595 3300026089 Bacteria 1181
333 Ga0207676_10240663 3300026095 Bacteria 1623
334 Ga0207675_100000929 3300026118 Bacteria 29254
335 Ga0207675_100336280 3300026118 Bacteria 1477
336 Ga0207683_10034207 3300026121 Bacteria 4416
337 Ga0207683_10037498 3300026121 Bacteria 4221
338 Ga0207683_10063512 3300026121 Bacteria 3253
339 Ga0207683_10219356 3300026121 Bacteria 1733
340 Ga0207698_10767550 3300026142 Bacteria 964
341 Ga0207428_10000108 3300027907 Bacteria 115378
342 Ga0207428_10099829 3300027907 Bacteria 2244
343 Ga0207428_10321501 3300027907 Bacteria 1143
344 Ga0265319_1000635 3300028563 Bacteria 23180
345 Ga0265334_10002590 3300028573 Bacteria 8429
346 Ga0265318_10003761 3300028577 Bacteria 7549
347 Ga0265322_10001612 3300028654 Bacteria 7210
348 Ga0265322_10032636 3300028654 Bacteria 1485
349 Ga0265338_10005641 3300028800 Bacteria 16249
350 Ga0265338_10007196 3300028800 Bacteria 13912
351 Ga0265338_10075508 3300028800 Bacteria 2859
352 Ga0265338_10144941 3300028800 Bacteria 1854
353 Ga0265324_10022996 3300029957 Bacteria 2223
354 Ga0265324_10033318 3300029957 Bacteria 1798
355 Ga0265330_10000327 3300031235 Bacteria 34205
356 Ga0265330_10046743 3300031235 Bacteria 1906
357 Ga0265332_10003969 3300031238 Bacteria 7049
358 Ga0265332_10116072 3300031238 Bacteria 1126
359 Ga0265320_10092767 3300031240 Bacteria 1397
360 Ga0265329_10025187 3300031242 Bacteria 1971
361 Ga0265340_10002177 3300031247 Bacteria 11216
362 Ga0265331_10004733 3300031250 Bacteria 8414
363 Ga0265327_10017812 3300031251 Bacteria 4432
364 Ga0265316_10020939 3300031344 Bacteria 5552
365 Ga0265316_10159049 3300031344 Bacteria 1689
366 Ga0307408_100118146 3300031548 Bacteria 2050
367 Ga0265313_10005397 3300031595 Bacteria 9426
368 Ga0265314_10002591 3300031711 Bacteria 18287
369 Ga0265342_10011070 3300031712 Bacteria 6191
370 Ga0265342_10130077 3300031712 Bacteria 1411
371 Ga0307406_10009746 3300031901 Bacteria 5401
372 Ga0307409_100187828 3300031995 Bacteria 1836
373 Ga0307416_100019684 3300032002 Bacteria 4793
374 Ga0307416_100212948 3300032002 Unclassified 1845
375 Ga0307411_10410369 3300032005 Bacteria 1122
376 Ga0307415_100021919 3300032126 Bacteria 3935
377 Ga0307415_100050027 3300032126 Bacteria 2829
378 Ga0316583_10021232 3300032133 Bacteria 2328
379 Ga0373948_0012084 3300034817 Bacteria 1538
380 Ga0373928_0015661 3300035084 Bacteria 1545
381 Ga0373940_0004842 3300035088 Bacteria 2873
382 Ga0373940_0019686 3300035088 Bacteria 1708
383 Ga0373949_0005830 3300035090 Bacteria 2738
384 Ga0373952_0002137 3300035092 Bacteria 3553
385 Ga0373932_0075588 3300035112 Bacteria 1054
386 Ga0373960_0029407 3300035121 Unclassified 1523
387 Ga0373943_0000198 3300035170 Bacteria 24537
388 Ga0373943_0072902 3300035170 Unclassified 1743
389 Ga0373961_0008795 3300035241 Bacteria 2460
390 Ga0373962_0005248 3300035242 Bacteria 3133
391 Ga0373931_0097985 3300035691 Bacteria 1645
392 Ga0373935_0109936 3300035692 Bacteria 1828
393 Ga0373935_0494438 3300035692 Bacteria 887
394 Ga0373933_0172015 3300035724 Bacteria 1379
395 Ga0373933_0186160 3300035724 Bacteria 1325
396 Ga0373947_0000463 3300035725 Bacteria 23167
397 Ga0373937_0109487 3300036401 Bacteria 2569
398 Ga0373925_0024512 3300037068 Bacteria 4405
399 Ga0395899_0000862 3300037312 Bacteria 28881
400 Ga0395899_0002568 3300037312 Bacteria 14676
401 Ga0395899_0005918 3300037312 Bacteria 9496
402 Ga0395899_0008133 3300037312 Bacteria 8079
403 Ga0395899_0009554 3300037312 Bacteria 7445
404 Ga0395899_0037927 3300037312 Bacteria 3612
405 Ga0395899_0082410 3300037312 Bacteria 2340
406 Ga0395899_0085266 3300037312 Unclassified 2295
407 Ga0395899_0182321 3300037312 Bacteria 1473
408 Ga0395900_0001219 3300037418 Bacteria 31689
409 Ga0395900_0001266 3300037418 Bacteria 30887
410 Ga0395900_0001485 3300037418 Bacteria 27947
411 Ga0395900_0004452 3300037418 Bacteria 14842
412 Ga0395900_0005059 3300037418 Bacteria 13833
413 Ga0395900_0009112 3300037418 Bacteria 10167
414 Ga0395900_0019826 3300037418 Bacteria 6853
415 Ga0395900_0024066 3300037418 Bacteria 6233
416 Ga0395900_0046723 3300037418 Bacteria 4458
417 Ga0395900_0068678 3300037418 Bacteria 3642
418 Ga0395900_0068882 3300037418 Bacteria 3636
419 Ga0395900_0166180 3300037418 Bacteria 2248
420 Ga0395900_0171588 3300037418 Bacteria 2207
421 Ga0395900_0188797 3300037418 Bacteria 2091
422 Ga0395900_0351242 3300037418 Bacteria 1448
423 Ga0395900_0497844 3300037418 Bacteria 1169
424 Ga0395898_0012615 3300037466 Bacteria 8736
425 Ga0395898_0015047 3300037466 Bacteria 7942
426 Ga0395898_0016535 3300037466 Bacteria 7545
427 Ga0395898_0020108 3300037466 Bacteria 6783
428 Ga0395898_0022431 3300037466 Bacteria 6394
429 Ga0395898_0027937 3300037466 Bacteria 5658
430 Ga0395898_0036950 3300037466 Bacteria 4847
431 Ga0395898_0040672 3300037466 Bacteria 4595
432 Ga0395898_0041721 3300037466 Bacteria 4531
433 Ga0395898_0054574 3300037466 Bacteria 3899
434 Ga0395898_0068165 3300037466 Bacteria 3443
435 Ga0395898_0071572 3300037466 Bacteria 3350
436 Ga0395898_0085312 3300037466 Bacteria 3043
437 Ga0395898_0123418 3300037466 Bacteria 2482
438 Ga0395898_0180539 3300037466 Unclassified 2017
439 Ga0395898_0220145 3300037466 Bacteria 1811
440 Ga0395898_0270203 3300037466 Bacteria 1622
441 Ga0395898_0489806 3300037466 Bacteria 1170
442 Ga0395905_0000640 3300037471 Bacteria 46768
443 Ga0395905_0001564 3300037471 Bacteria 27335
444 Ga0395905_0007797 3300037471 Bacteria 10619
445 Ga0395905_0008242 3300037471 Bacteria 10291
446 Ga0395905_0020747 3300037471 Bacteria 6221
447 Ga0395905_0063663 3300037471 Bacteria 3450
448 Ga0395905_0066894 3300037471 Bacteria 3365
449 Ga0395905_0093548 3300037471 Bacteria 2819
450 Ga0395905_0093695 3300037471 Bacteria 2817
451 Ga0395905_0160799 3300037471 Bacteria 2111
452 Ga0395905_0299866 3300037471 Bacteria 1494
453 Ga0395905_0500768 3300037471 Bacteria 1115
454 Ga0436364_0533197 3300037853 Bacteria 1358
455 Ga0395901_0000978 3300038443 Bacteria 30977
456 Ga0395901_0001883 3300038443 Bacteria 21647
457 Ga0395901_0002270 3300038443 Bacteria 19615
458 Ga0395901_0002692 3300038443 Bacteria 17910
459 Ga0395901_0011802 3300038443 Bacteria 8859
460 Ga0395901_0015905 3300038443 Bacteria 7667
461 Ga0395901_0016559 3300038443 Bacteria 7511
462 Ga0395901_0032992 3300038443 Bacteria 5342
463 Ga0395901_0035193 3300038443 Bacteria 5174
464 Ga0395901_0057609 3300038443 Bacteria 4041
465 Ga0395901_0114956 3300038443 Bacteria 2826
466 Ga0395901_0138285 3300038443 Bacteria 2560
467 Ga0395901_0143583 3300038443 Bacteria 2509
468 Ga0395901_0257143 3300038443 Bacteria 1818
469 Ga0395901_0341483 3300038443 Bacteria 1547
470 Ga0395901_0449267 3300038443 Bacteria 1318
471 Ga0436360_1292831 3300039438 Bacteria 2303
472 Ga0436363_1287539 3300039450 Bacteria 3055
473 Ga0439439_0044680 3300041406 Bacteria 1154
474 Ga0439461_0012809 3300041410 Bacteria 1575
475 Ga0451793_0979246 3300041452 Bacteria 1709
476 Ga0451853_3576152 3300041512 Bacteria 1629
477 Ga0451853_3629479 3300041512 Bacteria 1413
478 Ga0439448_0012082 3300042005 Bacteria 2579
479 Ga0439455_0016834 3300042012 Bacteria 1695
480 Ga0439456_031407 3300042013 Bacteria 1138
481 Ga0439446_0005591 3300042156 Bacteria 3238
482 Ga0466969_0003306 3300044656 Bacteria 8575
483 Ga0466969_0013131 3300044656 Bacteria 4364
484 Ga0466969_0085238 3300044656 Bacteria 1502
485 Ga0466972_0029041 3300044658 Bacteria 2724
486 Ga0466972_0070793 3300044658 Bacteria 1664
487 Ga0466965_0013693 3300044683 Unclassified 3830
488 Ga0466965_0049114 3300044683 Bacteria 2091
489 Ga0466965_0230224 3300044683 Unclassified 990
490 Ga0466966_0004938 3300044684 Bacteria 8765
491 Ga0466966_0008431 3300044684 Bacteria 6821
492 Ga0466966_0063700 3300044684 Bacteria 2323
493 Ga0466966_0202162 3300044684 Bacteria 1202
494 Ga0466961_0011545 3300044693 Bacteria 5649
495 Ga0466961_0026593 3300044693 Bacteria 3719
496 Ga0466961_0033324 3300044693 Bacteria 3310
497 Ga0466961_0049106 3300044693 Bacteria 2697
498 Ga0466961_0148650 3300044693 Bacteria 1464
499 Ga0466963_0000095 3300044694 Bacteria 31064
500 Ga0466963_0004541 3300044694 Bacteria 8082
501 Ga0466963_0004612 3300044694 Bacteria 8029
502 Ga0466963_0005966 3300044694 Bacteria 7176
503 Ga0466963_0015015 3300044694 Bacteria 4786
504 Ga0466963_0017054 3300044694 Bacteria 4523
505 Ga0466963_0017204 3300044694 Bacteria 4504
506 Ga0466963_0019732 3300044694 Bacteria 4233
507 Ga0466963_0021258 3300044694 Bacteria 4091
508 Ga0466963_0029166 3300044694 Bacteria 3549
509 Ga0466963_0030131 3300044694 Bacteria 3498
510 Ga0466963_0052948 3300044694 Bacteria 2694
511 Ga0466963_0116124 3300044694 Bacteria 1839
512 Ga0466963_0202221 3300044694 Bacteria 1389
513 Ga0466963_0246167 3300044694 Bacteria 1254
514 Ga0466963_0255268 3300044694 Bacteria 1230
515 Ga0466963_0346179 3300044694 Bacteria 1046
516 Ga0466964_0000465 3300044706 Bacteria 12455
517 Ga0466964_0007441 3300044706 Bacteria 4097
518 Ga0466964_0008767 3300044706 Bacteria 3802
519 Ga0466964_0024459 3300044706 Bacteria 2354
520 Ga0466964_0167302 3300044706 Bacteria 1032
521 Ga0466971_0001664 3300044719 Bacteria 9395
522 Ga0466971_0016536 3300044719 Unclassified 3257
523 Ga0466971_0053198 3300044719 Bacteria 1824
524 Ga0466971_0066685 3300044719 Bacteria 1631
525 Ga0466971_0091631 3300044719 Bacteria 1392
526 Ga0466968_0002238 3300044735 Bacteria 7071
527 Ga0466968_0006803 3300044735 Bacteria 4326
528 Ga0466968_0025288 3300044735 Bacteria 2431
529 Ga0466968_0031074 3300044735 Bacteria 2214
530 Ga0466968_0039968 3300044735 Bacteria 1976
531 Ga0466968_0080358 3300044735 Bacteria 1432
532 Ga0466968_0083542 3300044735 Bacteria 1407
533 Ga0466970_0004679 3300044765 Bacteria 6757
534 Ga0466970_0177079 3300044765 Bacteria 1183
535 Ga0466957_0001672 3300044842 Bacteria 11652
536 Ga0466957_0004210 3300044842 Bacteria 7978
537 Ga0466957_0015443 3300044842 Bacteria 4460
538 Ga0466957_0020943 3300044842 Bacteria 3848
539 Ga0466957_0025135 3300044842 Bacteria 3528
540 Ga0466957_0066648 3300044842 Bacteria 2220
541 Ga0466957_0070018 3300044842 Bacteria 2167
542 Ga0466957_0072128 3300044842 Bacteria 2137
543 Ga0466957_0073883 3300044842 Bacteria 2114
544 Ga0466957_0151095 3300044842 Bacteria 1502
545 Ga0466960_0001521 3300044901 Bacteria 8449
546 Ga0466960_0124262 3300044901 Bacteria 1355
547 Ga0466959_0002457 3300045049 Bacteria 11851
548 Ga0466959_0005583 3300045049 Bacteria 8642
549 Ga0466959_0011442 3300045049 Bacteria 6376
550 Ga0466959_0026369 3300045049 Bacteria 4307
551 Ga0466959_0109105 3300045049 Bacteria 1976
552 Ga0466959_0254129 3300045049 Bacteria 1212
553 Ga0466959_0417316 3300045049 Bacteria 911
554 Ga0451576_0408613 3300045051 Bacteria 1424
555 Ga0466958_0001908 3300045836 Bacteria 10200
556 Ga0466958_0002667 3300045836 Bacteria 9029
557 Ga0466958_0009659 3300045836 Bacteria 5382
558 Ga0466958_0011393 3300045836 Bacteria 5008
559 Ga0466958_0029313 3300045836 Bacteria 3266
560 Ga0466958_0089370 3300045836 Bacteria 1904
561 Ga0466958_0090580 3300045836 Bacteria 1892
562 Ga0466958_0117544 3300045836 Bacteria 1662
563 Ga0466958_0229725 3300045836 Bacteria 1185
564 Ga0466958_0258213 3300045836 Unclassified 1115
565 Ga0466958_0263946 3300045836 Bacteria 1102
566 Ga0466967_0000676 3300045976 Bacteria 17274
567 Ga0466967_0003281 3300045976 Bacteria 10494
568 Ga0466967_0004469 3300045976 Bacteria 9438
569 Ga0466967_0010011 3300045976 Bacteria 7082
570 Ga0466967_0011240 3300045976 Bacteria 6766
571 Ga0466967_0012377 3300045976 Bacteria 6521
572 Ga0466967_0019227 3300045976 Bacteria 5487
573 Ga0466967_0030709 3300045976 Bacteria 4511
574 Ga0466967_0040726 3300045976 Bacteria 4001
575 Ga0466967_0051313 3300045976 Bacteria 3614
576 Ga0466967_0058374 3300045976 Bacteria 3411
577 Ga0466967_0065864 3300045976 Bacteria 3226
578 Ga0466967_0068035 3300045976 Bacteria 3178
579 Ga0466967_0097862 3300045976 Bacteria 2678
580 Ga0466967_0112673 3300045976 Bacteria 2501
581 Ga0466967_0169802 3300045976 Bacteria 2051
582 Ga0466967_0177756 3300045976 Bacteria 2005
583 Ga0466967_0195313 3300045976 Bacteria 1914
584 Ga0466967_0204631 3300045976 Bacteria 1870
585 Ga0466967_0547148 3300045976 Unclassified 1139
586 Ga0466967_0607901 3300045976 Bacteria 1079
587 Ga0495627_076578 3300046453 Unclassified 973
588 Ga0495592_0042691 3300046454 Bacteria 3395
589 Ga0495592_0090270 3300046454 Bacteria 2198
590 Ga0495592_0175584 3300046454 Unclassified 1463
591 Ga0495603_0000081 3300046455 Bacteria 42501
592 Ga0495603_0165798 3300046455 Bacteria 1280
593 Ga0495629_0079661 3300046459 Bacteria 2287
594 Ga0495629_0141270 3300046459 Bacteria 1675
595 Ga0495629_0353297 3300046459 Bacteria 1002
596 Ga0495641_0002133 3300046461 Bacteria 15953
597 Ga0495641_0010605 3300046461 Bacteria 5322
598 Ga0495651_0209544 3300046462 Bacteria 1358
599 Ga0495651_0235532 3300046462 Bacteria 1258
600 Ga0495653_0051290 3300046463 Bacteria 3168
601 Ga0495653_0139181 3300046463 Bacteria 1709
602 Ga0495582_0027562 3300046473 Bacteria 3115
603 Ga0495582_0252168 3300046473 Bacteria 1012
604 Ga0495662_0052778 3300046476 Bacteria 1963
605 Ga0495662_0141439 3300046476 Bacteria 1184
606 Ga0495584_0014513 3300046491 Bacteria 4013
607 Ga0495584_0092599 3300046491 Bacteria 1525
608 Ga0495584_0224471 3300046491 Bacteria 955
609 Ga0495585_0077077 3300046492 Unclassified 1810
610 Ga0495594_0000536 3300046499 Bacteria 19443
611 Ga0495596_0061758 3300046500 Bacteria 1459
612 Ga0495596_0061914 3300046500 Unclassified 1457
613 Ga0495607_0070757 3300046501 Unclassified 1948
614 Ga0495608_0006235 3300046511 Bacteria 8464
615 Ga0495608_0106447 3300046511 Bacteria 1805
616 Ga0495608_0426257 3300046511 Unclassified 809
617 Ga0495630_0017298 3300046517 Bacteria 5281
618 Ga0495630_0130037 3300046517 Bacteria 1912
619 Ga0495631_0114062 3300046518 Unclassified 1162
620 Ga0495637_0128200 3300046520 Bacteria 971
621 Ga0495644_0008464 3300046523 Bacteria 3962
622 Ga0495663_0015710 3300046525 Unclassified 2135
623 Ga0495666_0019555 3300046526 Bacteria 3359
624 Ga0495666_0134563 3300046526 Bacteria 1154
625 Ga0495652_0120759 3300046529 Unclassified 2090
626 Ga0495586_0120846 3300046535 Bacteria 1463
627 Ga0495587_0011260 3300046536 Bacteria 5669
628 Ga0495609_0034225 3300046538 Unclassified 2304
629 Ga0495667_0025384 3300046559 Bacteria 3994
630 Ga0495667_0058443 3300046559 Bacteria 2534
631 Ga0495667_0059886 3300046559 Bacteria 2498
632 Ga0495667_0143913 3300046559 Bacteria 1536
633 Ga0495656_0069126 3300046615 Unclassified 1563
634 Ga0495656_0120245 3300046615 Bacteria 1239
635 Ga0495656_0206021 3300046615 Bacteria 978
636 Ga0495634_0064947 3300046642 Bacteria 2419
637 Ga0495634_0202561 3300046642 Bacteria 1232
638 Ga0495635_0131522 3300046663 Bacteria 1706
639 Ga0495659_0065526 3300046664 Bacteria 1351
640 Ga0495659_0137573 3300046664 Bacteria 973
641 Ga0495588_0002678 3300046674 Bacteria 7625
642 Ga0495588_0128966 3300046674 Bacteria 1334
643 Ga0495657_0073386 3300046675 Bacteria 2229
644 Ga0495657_0083062 3300046675 Unclassified 2068
645 Ga0495599_0050417 3300046678 Bacteria 2608
646 Ga0495599_0071124 3300046678 Bacteria 2171
647 Ga0495646_0034028 3300046680 Bacteria 3166
648 Ga0495646_0073986 3300046680 Bacteria 2001
649 Ga0495646_0125367 3300046680 Bacteria 1450
650 Ga0495647_0023856 3300046681 Bacteria 2222
651 Ga0495613_0025650 3300046689 Bacteria 4392
652 Ga0495613_0047146 3300046689 Unclassified 3183
653 Ga0495624_0210753 3300046690 Bacteria 1179
654 Ga0495670_0065767 3300046691 Bacteria 1828
655 Ga0495600_0014203 3300046809 Bacteria 5017
656 Ga0495581_0034383 3300047315 Bacteria 2933
657 Ga0495581_0071126 3300047315 Bacteria 2013
658 Ga0495604_0058379 3300047317 Bacteria 2963
659 Ga0495604_0219087 3300047317 Bacteria 1311
660 Ga0495674_0039772 3300047319 Bacteria 4212
661 Ga0495674_0082453 3300047319 Bacteria 2757
662 Ga0495676_0002817 3300047321 Bacteria 15665
663 Ga0495676_0204108 3300047321 Bacteria 1372
664 Ga0495680_0071197 3300047322 Bacteria 2648
665 Ga0495680_0120624 3300047322 Bacteria 1936
666 Ga0495680_0124632 3300047322 Bacteria 1899
667 Ga0495680_0143697 3300047322 Bacteria 1744
668 Ga0495675_0093888 3300047444 Bacteria 1882
669 Ga0495684_0029449 3300047471 Bacteria 4214
670 Ga0495684_0035091 3300047471 Bacteria 3848
671 Ga0495684_0350490 3300047471 Bacteria 1048
672 Ga0495602_0244232 3300048088 Bacteria 1341
673 Ga0496100_0012806 3300048903 Bacteria 4820
674 Ga0496100_0013565 3300048903 Bacteria 4705
675 Ga0496100_0128670 3300048903 Bacteria 1780
676 Ga0496101_0014642 3300048904 Bacteria 5274
677 Ga0496101_0048493 3300048904 Bacteria 3053
678 Ga0496101_0163765 3300048904 Bacteria 1707
679 Ga0496101_0212930 3300048904 Bacteria 1497
680 Ga0496101_0213762 3300048904 Bacteria 1495
681 Ga0496101_0340692 3300048904 Bacteria 1177
682 Ga0496101_0348559 3300048904 Unclassified 1163
683 Ga0496102_0016639 3300048905 Bacteria 6430
684 Ga0496102_0017600 3300048905 Bacteria 6262
685 Ga0496102_0048059 3300048905 Bacteria 3879
686 Ga0496102_0095778 3300048905 Bacteria 2751
687 Ga0496102_0422367 3300048905 Unclassified 1252
688 Ga0496103_0010103 3300048906 Bacteria 5580
689 Ga0496103_0015355 3300048906 Bacteria 4555
690 Ga0496103_0015863 3300048906 Bacteria 4492
691 Ga0496104_0000865 3300048907 Bacteria 26083
692 Ga0496104_0010631 3300048907 Bacteria 8224
693 Ga0496104_0016341 3300048907 Bacteria 6740
694 Ga0496104_0068058 3300048907 Bacteria 3383
695 Ga0496104_0235398 3300048907 Bacteria 1743
696 Ga0496104_0789962 3300048907 Bacteria 855
697 Ga0496105_0000775 3300048908 Bacteria 21608
698 Ga0496105_0004904 3300048908 Bacteria 10116
699 Ga0496105_0045676 3300048908 Bacteria 3614
700 Ga0496105_0063287 3300048908 Bacteria 3052
701 Ga0496105_0092357 3300048908 Bacteria 2499
702 Ga0496105_0191008 3300048908 Unclassified 1674
703 Ga0496105_0216472 3300048908 Bacteria 1560
704 Ga0496105_0296402 3300048908 Bacteria 1301
705 Ga0496106_0014470 3300048909 Bacteria 5829
706 Ga0496106_0058137 3300048909 Bacteria 2926
707 Ga0496106_0083654 3300048909 Bacteria 2454
708 Ga0496106_0141628 3300048909 Unclassified 1892
709 Ga0496106_0204146 3300048909 Bacteria 1573
710 Ga0496106_0362770 3300048909 Bacteria 1164
711 Ga0496107_0000242 3300048910 Bacteria 28631
712 Ga0496107_0006234 3300048910 Bacteria 8198
713 Ga0496107_0021016 3300048910 Bacteria 4612
714 Ga0496107_0041282 3300048910 Bacteria 3312
715 Ga0496107_0056304 3300048910 Bacteria 2841
716 Ga0496107_0307858 3300048910 Unclassified 1179
717 Ga0496107_0367837 3300048910 Bacteria 1069
718 Ga0496107_0369887 3300048910 Bacteria 1066
719 Ga0496108_0003137 3300048911 Bacteria 13288
720 Ga0496108_0005018 3300048911 Bacteria 10693
721 Ga0496108_0010715 3300048911 Bacteria 7439
722 Ga0496108_0022146 3300048911 Bacteria 5225
723 Ga0496108_0023428 3300048911 Bacteria 5081
724 Ga0496108_0033698 3300048911 Bacteria 4254
725 Ga0496108_0043433 3300048911 Bacteria 3754
726 Ga0496108_0196792 3300048911 Unclassified 1748
727 Ga0496109_0001239 3300048912 Bacteria 21163
728 Ga0496109_0008195 3300048912 Bacteria 8865
729 Ga0496109_0018833 3300048912 Bacteria 6073
730 Ga0496109_0041159 3300048912 Bacteria 4187
731 Ga0496109_0041213 3300048912 Bacteria 4183
732 Ga0496109_0062927 3300048912 Bacteria 3393
733 Ga0496109_0081032 3300048912 Bacteria 2991
734 Ga0496109_0233179 3300048912 Bacteria 1732
735 Ga0496109_0247179 3300048912 Bacteria 1679
736 Ga0496109_0304410 3300048912 Unclassified 1503
737 Ga0496109_0601108 3300048912 Bacteria 1036
738 Ga0496109_0618613 3300048912 Bacteria 1019
739 Ga0496110_0011919 3300048913 Bacteria 7142
740 Ga0496110_0029730 3300048913 Bacteria 4706
741 Ga0496110_0046702 3300048913 Unclassified 3789
742 Ga0496110_0048083 3300048913 Bacteria 3738
743 Ga0496110_0065457 3300048913 Bacteria 3213
744 Ga0496110_0149564 3300048913 Unclassified 2114
745 Ga0496111_0003372 3300048914 Bacteria 9877
746 Ga0496111_0024846 3300048914 Bacteria 4225
747 Ga0496111_0116049 3300048914 Bacteria 1974
748 Ga0496111_0116295 3300048914 Bacteria 1972
749 Ga0496111_0329855 3300048914 Bacteria 1130
750 Ga0496112_0003845 3300048915 Bacteria 12539
751 Ga0496112_0019694 3300048915 Bacteria 6376
752 Ga0496112_0093391 3300048915 Bacteria 2979
753 Ga0496112_0099657 3300048915 Bacteria 2875
754 Ga0496112_0116912 3300048915 Unclassified 2637
755 Ga0496112_0314375 3300048915 Bacteria 1511
756 Ga0496112_0578012 3300048915 Bacteria 1056
757 Ga0496113_0001165 3300048916 Bacteria 14346
758 Ga0496113_0001530 3300048916 Bacteria 12949
759 Ga0496113_0026871 3300048916 Bacteria 4119
760 Ga0496113_0069827 3300048916 Bacteria 2668
761 Ga0496113_0085219 3300048916 Unclassified 2427
762 Ga0496113_0299372 3300048916 Bacteria 1288
763 Ga0496114_0003362 3300048917 Bacteria 12289
764 Ga0496114_0015427 3300048917 Bacteria 6145
765 Ga0496114_0024732 3300048917 Bacteria 4902
766 Ga0496114_0026950 3300048917 Bacteria 4708
767 Ga0496114_0044143 3300048917 Bacteria 3698
768 Ga0496114_0178809 3300048917 Bacteria 1852
769 Ga0496114_0256222 3300048917 Unclassified 1540
770 Ga0496114_0279677 3300048917 Unclassified 1471
771 Ga0496115_0005818 3300048918 Bacteria 8984
772 Ga0496115_0034066 3300048918 Bacteria 4024
773 Ga0496115_0054854 3300048918 Bacteria 3200
774 Ga0496115_0226685 3300048918 Unclassified 1541
775 Ga0496115_0530921 3300048918 Bacteria 942
776 Ga0501031_0003333 3300049568 Bacteria 10307
777 Ga0501031_0021919 3300049568 Bacteria 4162
778 Ga0501032_0001554 3300049569 Bacteria 18314
779 Ga0501033_0000899 3300049570 Bacteria 27196
780 Ga0501033_0112125 3300049570 Unclassified 1984
781 Ga0501033_0160533 3300049570 Bacteria 1618
782 Ga0501034_0072921 3300049571 Bacteria 3442
783 Ga0501036_0005487 3300049572 Bacteria 10285
784 Ga0501036_0044330 3300049572 Bacteria 3767
785 Ga0501036_0053302 3300049572 Bacteria 3425
786 Ga0501037_0007386 3300049573 Bacteria 8039
787 Ga0501037_0122124 3300049573 Bacteria 1872
788 Ga0501038_0003802 3300049574 Bacteria 14046
789 Ga0501038_0040949 3300049574 Bacteria 4042
790 Ga0501039_0003976 3300049575 Bacteria 11110
791 Ga0501039_0009033 3300049575 Bacteria 7594
792 Ga0501040_0001387 3300049576 Bacteria 15298
793 Ga0501040_0002266 3300049576 Bacteria 12360
794 Ga0501040_0005466 3300049576 Bacteria 8221
795 Ga0501040_0141222 3300049576 Bacteria 1697
796 Ga0501041_0000474 3300049577 Bacteria 20418
797 Ga0501041_0000895 3300049577 Bacteria 16124
798 Ga0501042_0000930 3300049578 Bacteria 16501
799 Ga0501042_0068233 3300049578 Bacteria 2542
800 Ga0501043_0000693 3300049579 Bacteria 29791
801 Ga0501043_0086178 3300049579 Bacteria 2468
802 Ga0501043_0240756 3300049579 Bacteria 1395
803 Ga0501046_0001855 3300049580 Bacteria 20125
804 Ga0501046_0040284 3300049580 Bacteria 3734
805 Ga0501046_0328908 3300049580 Bacteria 1112
806 Ga0501047_0037685 3300049581 Bacteria 4676
807 Ga0501047_0061174 3300049581 Bacteria 3634
808 Ga0501047_0150034 3300049581 Bacteria 2208
809 Ga0501047_0231175 3300049581 Bacteria 1703
810 Ga0501048_0000867 3300049582 Bacteria 22328
811 Ga0501048_0008074 3300049582 Bacteria 7967
812 Ga0501048_0031868 3300049582 Bacteria 3812
813 Ga0501067_0020755 3300049583 Bacteria 3634
814 Ga0501067_0023040 3300049583 Bacteria 3449
815 Ga0501067_0031144 3300049583 Bacteria 2960
816 Ga0501067_0046875 3300049583 Bacteria 2399
817 Ga0501067_0121005 3300049583 Unclassified 1456
818 Ga0501067_0137929 3300049583 Bacteria 1358
819 Ga0501067_0139502 3300049583 Bacteria 1350
820 Ga0501067_0202908 3300049583 Bacteria 1104
821 Ga0501068_0001514 3300049584 Bacteria 12364
822 Ga0501068_0003100 3300049584 Bacteria 8878
823 Ga0501068_0015027 3300049584 Bacteria 4439
824 Ga0501068_0145475 3300049584 Unclassified 1487
825 Ga0501069_0000605 3300049585 Bacteria 16589
826 Ga0501069_0012648 3300049585 Bacteria 4490
827 Ga0501069_0030644 3300049585 Bacteria 2955
828 Ga0501069_0069892 3300049585 Bacteria 1966
829 Ga0501070_0001149 3300049586 Bacteria 23709
830 Ga0501070_0024878 3300049586 Bacteria 5021
831 Ga0501070_0042253 3300049586 Bacteria 3797
832 Ga0501070_0075545 3300049586 Bacteria 2790
833 Ga0501070_0333152 3300049586 Bacteria 1233
834 Ga0501070_0333798 3300049586 Bacteria 1232
835 Ga0501071_0000330 3300049587 Bacteria 22815
836 Ga0501071_0000677 3300049587 Bacteria 17791
837 Ga0501071_0030359 3300049587 Bacteria 3822
838 Ga0501072_0001627 3300049588 Bacteria 16809
839 Ga0501072_0003411 3300049588 Bacteria 11969
840 Ga0501072_0006557 3300049588 Bacteria 8862
841 Ga0501072_0007942 3300049588 Bacteria 8055
842 Ga0501072_0016896 3300049588 Bacteria 5606
843 Ga0501072_0023091 3300049588 Bacteria 4829
844 Ga0501072_0131910 3300049588 Bacteria 1991
845 Ga0501073_0003204 3300049589 Bacteria 12288
846 Ga0501073_0029285 3300049589 Bacteria 3935
847 Ga0501073_0031588 3300049589 Bacteria 3778
848 Ga0501073_0063173 3300049589 Bacteria 2583
849 Ga0501073_0269778 3300049589 Unclassified 1174
850 Ga0501074_0022586 3300049590 Bacteria 4572
851 Ga0501074_0030757 3300049590 Bacteria 3890
852 Ga0501074_0045687 3300049590 Bacteria 3167
853 Ga0501074_0153769 3300049590 Bacteria 1644
854 Ga0501075_0001209 3300049591 Bacteria 16714
855 Ga0501075_0017103 3300049591 Bacteria 5234
856 Ga0501075_0044640 3300049591 Unclassified 3325
857 Ga0501075_0108908 3300049591 Bacteria 2106
858 Ga0501075_0267954 3300049591 Bacteria 1301
859 Ga0501075_0332283 3300049591 Bacteria 1158
860 Ga0501076_0004029 3300049592 Bacteria 10380
861 Ga0501076_0006243 3300049592 Bacteria 8630
862 Ga0501076_0011459 3300049592 Bacteria 6606
863 Ga0501076_0035541 3300049592 Bacteria 3897
864 Ga0501076_0185501 3300049592 Bacteria 1696
865 Ga0501076_0219026 3300049592 Unclassified 1556
866 Ga0501077_0000576 3300049593 Bacteria 22271
867 Ga0501077_0008185 3300049593 Bacteria 6465
868 Ga0501077_0098818 3300049593 Bacteria 1850
869 Ga0501077_0103972 3300049593 Unclassified 1800
870 Ga0501079_0001513 3300049741 Bacteria 16457
871 Ga0501079_0009336 3300049741 Bacteria 7433
872 Ga0501079_0206946 3300049741 Bacteria 1533
873 Ga0501080_0001056 3300049742 Bacteria 22640
874 Ga0501080_0013393 3300049742 Bacteria 7543
875 Ga0501080_0043951 3300049742 Bacteria 4159
876 Ga0501080_0059685 3300049742 Bacteria 3549
877 Ga0501080_0074751 3300049742 Bacteria 3152
878 Ga0501080_0194526 3300049742 Bacteria 1863
879 Ga0501081_0000753 3300049743 Bacteria 18947
880 Ga0501081_0002176 3300049743 Bacteria 12311
881 Ga0501081_0005108 3300049743 Bacteria 8450
882 Ga0501083_0002444 3300049744 Bacteria 12712
883 Ga0501035_0001594 3300049822 Bacteria 22969
884 Ga0501035_0014199 3300049822 Bacteria 7351
885 Ga0501035_0108614 3300049822 Bacteria 2432
886 Ga0501044_0457884 3300049823 Unclassified 1181
887 Ga0501045_0001276 3300049824 Bacteria 16726
888 Ga0501045_0005255 3300049824 Bacteria 8957
889 Ga0501045_0038043 3300049824 Bacteria 3499
890 Ga0501045_0054993 3300049824 Bacteria 2911
891 Ga0501045_0095770 3300049824 Bacteria 2196
892 nmdc:mga03683_171769_c1 3300050489 Bacteria 985
893 nmdc:mga00v17_368682_c1 3300050491 Bacteria 934
894 nmdc:mga0yw44_181621_c1 3300050492 Bacteria 1385
895 nmdc:mga0yw44_51448_c1 3300050492 Bacteria 2494
896 nmdc:mga06z11_195294_c1 3300050494 Bacteria 1173
897 nmdc:mga05p37_1712_c1 3300050507 Bacteria 25565
898 nmdc:mga05p37_19624_c1 3300050507 Bacteria 8175
899 nmdc:mga05p37_301655_c1 3300050507 Unclassified 1903
900 nmdc:mga05p37_52672_c1 3300050507 Bacteria 5004
901 nmdc:mga05p37_606736_c1 3300050507 Bacteria 1234
902 nmdc:mga05p37_813115_c1 3300050507 Bacteria 1021
903 nmdc:mga05p37_8903_c1 3300050507 Bacteria 11860
904 nmdc:mga09592_118389_c1 3300050508 Unclassified 2273
905 nmdc:mga09592_5828_c1 3300050508 Bacteria 10047
906 nmdc:mga0qj67_291079_c1 3300050509 Bacteria 1323
907 nmdc:mga06r32_28868_c1 3300050510 Bacteria 5193
908 nmdc:mga06r32_49576_c1 3300050510 Bacteria 4015
909 nmdc:mga06r32_560576_c1 3300050510 Bacteria 1116
910 nmdc:mga06r32_66422_c1 3300050510 Bacteria 3480
911 nmdc:mga08y16_19493_c1 3300050511 Bacteria 7151
912 nmdc:mga08y16_580143_c1 3300050511 Bacteria 1132
913 nmdc:mga08y16_60613_c1 3300050511 Bacteria 3952
914 nmdc:mga08y16_786024_c1 3300050511 Bacteria 946
915 nmdc:mga0n895_12180_c1 3300050512 Bacteria 7702
916 nmdc:mga0n895_230390_c1 3300050512 Unclassified 1880
917 nmdc:mga0n895_234673_c1 3300050512 Bacteria 1862
918 nmdc:mga0n895_71764_c1 3300050512 Bacteria 3434
919 nmdc:mga0n895_88875_c1 3300050512 Bacteria 3090
920 nmdc:mga0rr50_157685_c1 3300050513 Bacteria 1840
921 nmdc:mga0rr50_201488_c1 3300050513 Bacteria 1635
922 nmdc:mga0rr50_33890_c1 3300050513 Bacteria 3652
923 nmdc:mga0rr50_372_c1 3300050513 Bacteria 24510
924 nmdc:mga0rr50_95152_c1 3300050513 Bacteria 2328
925 nmdc:mga08x19_177286_c1 3300050514 Bacteria 1454
926 nmdc:mga08x19_34795_c1 3300050514 Bacteria 3186
927 nmdc:mga08x19_45511_c1 3300050514 Bacteria 2805
928 nmdc:mga08x19_4620_c1 3300050514 Bacteria 8173
929 nmdc:mga08x19_5986_c1 3300050514 Bacteria 7191
930 nmdc:mga0a205_109138_c1 3300050515 Bacteria 2666
931 nmdc:mga0a205_15513_c1 3300050515 Bacteria 7120
932 nmdc:mga0a205_202628_c1 3300050515 Unclassified 1874
933 nmdc:mga0a205_28071_c1 3300050515 Bacteria 5378
934 nmdc:mga0a205_41740_c1 3300050515 Bacteria 4419
935 nmdc:mga0a205_503541_c1 3300050515 Unclassified 1068
936 Ga0495601_0006980 3300053077 Bacteria 6614
937 Ga0495612_0014817 3300053078 Bacteria 3128
938 Ga0495655_0107850 3300053083 Bacteria 833
939 Ga0495595_0010344 3300053084 Bacteria 3876
940 Ga0495595_0021019 3300053084 Bacteria 2847
941 Ga0495595_0030604 3300053084 Bacteria 2415
942 Ga0495619_0035292 3300053085 Bacteria 3252
943 Ga0495619_0052545 3300053085 Bacteria 2694
944 Ga0495619_0274774 3300053085 Bacteria 1167
945 Ga0501084_0000985 3300054114 Bacteria 22070
946 Ga0501084_0002974 3300054114 Bacteria 13727
947 Ga0501084_0038205 3300054114 Bacteria 4013
948 Ga0501084_0040964 3300054114 Bacteria 3875
949 Ga0501084_0076185 3300054114 Bacteria 2811
950 Ga0501082_0012784 3300060353 Bacteria 7215
951 Ga0501082_0016180 3300060353 Bacteria 6419
952 Ga0501082_0090400 3300060353 Bacteria 2643
953 Ga0501082_0121059 3300060353 Bacteria 2268
954 Ga0466962_0000096 3300061719 Bacteria 35253
955 Ga0466962_0003609 3300061719 Bacteria 7374
956 Ga0466962_0016261 3300061719 Bacteria 3588
957 Ga0530510_0002722 3300061734 Bacteria 12171
958 Ga0530510_0006950 3300061734 Bacteria 7888
959 Ga0530510_0011066 3300061734 Bacteria 6328
960 Ga0530510_0047359 3300061734 Bacteria 3106
961 Ga0530510_0172463 3300061734 Bacteria 1602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10034170 Ga0081538_100341704 240
2 3300035084 Ga0373928_0015661 Ga0373928_0015661_34_822 241
3 3300044684 Ga0466966_0004938 Ga0466966_0004938_7405_8229 241
4 3300045049 Ga0466959_0109105 Ga0466959_0109105_966_1790 241
5 3300046511 Ga0495608_0426257 Ga0495608_0426257_11_775 241
6 3300048917 Ga0496114_0256222 Ga0496114_0256222_726_1490 241
7 3300053083 Ga0495655_0107850 Ga0495655_0107850_14_778 241
8 3300005434 Ga0070709_10351815 Ga0070709_103518151 242
9 3300025906 Ga0207699_10179391 Ga0207699_101793912 242
10 3300026078 Ga0207702_10602393 Ga0207702_106023932 242
11 3300046559 Ga0495667_0058443 Ga0495667_0058443_899_1666 242
12 3300046520 Ga0495637_0128200 Ga0495637_0128200_73_897 244
13 3300009177 Ga0105248_10212958 Ga0105248_102129582 245
14 3300048917 Ga0496114_0024732 Ga0496114_0024732_1033_1866 245
15 3300025922 Ga0207646_10001768 Ga0207646_1000176820 246
16 3300005353 Ga0070669_100340478 Ga0070669_1003404781 247
17 3300005355 Ga0070671_100435585 Ga0070671_1004355851 247
18 3300005365 Ga0070688_100182657 Ga0070688_1001826571 247
19 3300005719 Ga0068861_100097859 Ga0068861_1000978592 247
20 3300005840 Ga0068870_10097759 Ga0068870_100977592 247
21 3300006237 Ga0097621_100281031 Ga0097621_1002810312 247
22 3300009148 Ga0105243_10143766 Ga0105243_101437662 247
23 3300013297 Ga0157378_10396830 Ga0157378_103968302 247
24 3300014325 Ga0163163_10128882 Ga0163163_101288822 247
25 3300014326 Ga0157380_10005200 Ga0157380_100052003 247
26 3300014968 Ga0157379_10107811 Ga0157379_101078111 247
27 3300014969 Ga0157376_10159817 Ga0157376_101598172 247
28 3300025908 Ga0207643_10206819 Ga0207643_102068191 247
29 3300025923 Ga0207681_10278020 Ga0207681_102780201 247
30 3300025935 Ga0207709_10094126 Ga0207709_100941262 247
31 3300026121 Ga0207683_10037498 Ga0207683_100374986 247
32 3300048912 Ga0496109_0618613 Ga0496109_0618613_122_946 247
33 3300048914 Ga0496111_0329855 Ga0496111_0329855_95_919 247
34 3300044683 Ga0466965_0013693 Ga0466965_0013693_1489_2322 248
35 3300044694 Ga0466963_0017054 Ga0466963_0017054_948_1781 248
36 3300044706 Ga0466964_0008767 Ga0466964_0008767_2179_3012 248
37 3300044719 Ga0466971_0016536 Ga0466971_0016536_1027_1860 248
38 3300044735 Ga0466968_0039968 Ga0466968_0039968_648_1481 248
39 3300044842 Ga0466957_0004210 Ga0466957_0004210_6899_7732 248
40 3300045836 Ga0466958_0011393 Ga0466958_0011393_3752_4585 248
41 3300045976 Ga0466967_0040726 Ga0466967_0040726_289_1122 248
42 3300046453 Ga0495627_076578 Ga0495627_076578_39_872 248
43 3300046491 Ga0495584_0014513 Ga0495584_0014513_1145_1978 248
44 3300046492 Ga0495585_0077077 Ga0495585_0077077_299_1132 248
45 3300046500 Ga0495596_0061914 Ga0495596_0061914_523_1356 248
46 3300046501 Ga0495607_0070757 Ga0495607_0070757_515_1348 248
47 3300046518 Ga0495631_0114062 Ga0495631_0114062_186_1019 248
48 3300046523 Ga0495644_0008464 Ga0495644_0008464_469_1302 248
49 3300046538 Ga0495609_0034225 Ga0495609_0034225_888_1721 248
50 3300046615 Ga0495656_0069126 Ga0495656_0069126_389_1222 248
51 3300046691 Ga0495670_0065767 Ga0495670_0065767_54_887 248
52 3300061719 Ga0466962_0016261 Ga0466962_0016261_2407_3240 248
53 3300046536 Ga0495587_0011260 Ga0495587_0011260_4792_5625 249
54 3300005577 Ga0068857_100604640 Ga0068857_1006046402 250
55 3300005618 Ga0068864_100070632 Ga0068864_1000706324 250
56 3300021441 Ga0213871_10002981 Ga0213871_100029813 250
57 3300026095 Ga0207676_10240663 Ga0207676_102406631 250
58 3300037418 Ga0395900_0046723 Ga0395900_0046723_2570_3394 250
59 3300038443 Ga0395901_0001883 Ga0395901_0001883_14857_15681 250
60 3300042013 Ga0439456_031407 Ga0439456_031407_57_890 250
61 3300048904 Ga0496101_0048493 Ga0496101_0048493_1482_2309 250
62 3300048907 Ga0496104_0000865 Ga0496104_0000865_301_1128 250
63 3300048908 Ga0496105_0000775 Ga0496105_0000775_16018_16845 250
64 3300048910 Ga0496107_0056304 Ga0496107_0056304_279_1106 250
65 3300048911 Ga0496108_0005018 Ga0496108_0005018_4596_5423 250
66 3300048912 Ga0496109_0001239 Ga0496109_0001239_5457_6284 250
67 3300048913 Ga0496110_0048083 Ga0496110_0048083_1764_2591 250
68 3300048915 Ga0496112_0003845 Ga0496112_0003845_476_1303 250
69 3300048916 Ga0496113_0001165 Ga0496113_0001165_251_1078 250
70 3300048918 Ga0496115_0005818 Ga0496115_0005818_1798_2625 250
71 3300013296 Ga0157374_10008652 Ga0157374_100086528 251
72 3300044842 Ga0466957_0151095 Ga0466957_0151095_71_910 251
73 3300044842 Ga0466957_0015443 Ga0466957_0015443_1381_2214 252
74 3300005334 Ga0068869_100088418 Ga0068869_1000884182 253
75 3300005336 Ga0070680_100023083 Ga0070680_1000230836 253
76 3300005339 Ga0070660_100078063 Ga0070660_1000780633 253
77 3300005341 Ga0070691_10086887 Ga0070691_100868871 253
78 3300005345 Ga0070692_10014373 Ga0070692_100143733 253
79 3300005366 Ga0070659_100024028 Ga0070659_1000240282 253
80 3300005434 Ga0070709_10068543 Ga0070709_100685432 253
81 3300005435 Ga0070714_100008551 Ga0070714_1000085512 253
82 3300005441 Ga0070700_100189187 Ga0070700_1001891871 253
83 3300005530 Ga0070679_100082777 Ga0070679_1000827772 253
84 3300005535 Ga0070684_100020666 Ga0070684_1000206664 253
85 3300005564 Ga0070664_100091185 Ga0070664_1000911853 253
86 3300005577 Ga0068857_100038685 Ga0068857_1000386852 253
87 3300006058 Ga0075432_10008519 Ga0075432_100085195 253
88 3300006844 Ga0075428_100002460 Ga0075428_10000246016 253
89 3300006852 Ga0075433_10086955 Ga0075433_100869553 253
90 3300006880 Ga0075429_100008378 Ga0075429_1000083786 253
91 3300009094 Ga0111539_10003095 Ga0111539_1000309512 253
92 3300009098 Ga0105245_10006126 Ga0105245_100061264 253
93 3300009147 Ga0114129_10003813 Ga0114129_1000381316 253
94 3300014745 Ga0157377_10018073 Ga0157377_100180732 253
95 3300025901 Ga0207688_10005694 Ga0207688_100056949 253
96 3300025919 Ga0207657_10077510 Ga0207657_100775102 253
97 3300025927 Ga0207687_10015169 Ga0207687_100151694 253
98 3300025932 Ga0207690_10039559 Ga0207690_100395594 253
99 3300025933 Ga0207706_10041071 Ga0207706_100410713 253
100 3300025942 Ga0207689_10082630 Ga0207689_100826302 253
101 3300025945 Ga0207679_10069445 Ga0207679_100694453 253
102 3300026067 Ga0207678_10296639 Ga0207678_102966391 253
103 3300026075 Ga0207708_10040507 Ga0207708_100405072 253
104 3300027907 Ga0207428_10000108 Ga0207428_10000108103 253
105 3300035121 Ga0373960_0029407 Ga0373960_0029407_207_1031 253
106 3300037312 Ga0395899_0037927 Ga0395899_0037927_1555_2379 253
107 3300037418 Ga0395900_0068882 Ga0395900_0068882_2273_3097 253
108 3300037466 Ga0395898_0068165 Ga0395898_0068165_694_1518 253
109 3300049586 Ga0501070_0075545 Ga0501070_0075545_1746_2573 253
110 3300049587 Ga0501071_0000330 Ga0501071_0000330_15211_16035 253
111 3300049588 Ga0501072_0001627 Ga0501072_0001627_9314_10138 253
112 3300049590 Ga0501074_0030757 Ga0501074_0030757_1373_2197 253
113 3300049592 Ga0501076_0004029 Ga0501076_0004029_6743_7567 253
114 3300049593 Ga0501077_0000576 Ga0501077_0000576_18153_18977 253
115 3300049741 Ga0501079_0001513 Ga0501079_0001513_8973_9797 253
116 3300049742 Ga0501080_0059685 Ga0501080_0059685_935_1759 253
117 3300049743 Ga0501081_0005108 Ga0501081_0005108_3392_4216 253
118 3300050507 nmdc:mga05p37_19624_c1 nmdc:mga05p37_19624_c1_2876_3700 253
119 3300050508 nmdc:mga09592_5828_c1 nmdc:mga09592_5828_c1_6506_7330 253
120 3300050511 nmdc:mga08y16_60613_c1 nmdc:mga08y16_60613_c1_1425_2249 253
121 3300050512 nmdc:mga0n895_230390_c1 nmdc:mga0n895_230390_c1_536_1360 253
122 3300050515 nmdc:mga0a205_41740_c1 nmdc:mga0a205_41740_c1_392_1216 253
123 3300054114 Ga0501084_0000985 Ga0501084_0000985_6664_7488 253
124 3300060353 Ga0501082_0090400 Ga0501082_0090400_1032_1856 253
125 3300061734 Ga0530510_0006950 Ga0530510_0006950_2080_2904 253
126 3300005434 Ga0070709_10006188 Ga0070709_100061885 254
127 3300005435 Ga0070714_100231522 Ga0070714_1002315221 254
128 3300005436 Ga0070713_100001060 Ga0070713_10000106014 254
129 3300005437 Ga0070710_10003601 Ga0070710_100036019 254
130 3300005468 Ga0070707_100064103 Ga0070707_1000641035 254
131 3300005535 Ga0070684_100542332 Ga0070684_1005423321 254
132 3300005549 Ga0070704_100017012 Ga0070704_1000170123 254
133 3300006028 Ga0070717_10007849 Ga0070717_100078495 254
134 3300006163 Ga0070715_10011394 Ga0070715_100113943 254
135 3300006173 Ga0070716_100001457 Ga0070716_1000014578 254
136 3300025898 Ga0207692_10017163 Ga0207692_100171635 254
137 3300025906 Ga0207699_10002004 Ga0207699_1000200412 254
138 3300025928 Ga0207700_10015530 Ga0207700_100155307 254
139 3300025929 Ga0207664_10012931 Ga0207664_100129312 254
140 3300025931 Ga0207644_10123627 Ga0207644_101236273 254
141 3300025939 Ga0207665_10027771 Ga0207665_100277712 254
142 3300026121 Ga0207683_10219356 Ga0207683_102193562 254
143 3300034817 Ga0373948_0012084 Ga0373948_0012084_173_1000 254
144 3300035088 Ga0373940_0019686 Ga0373940_0019686_569_1396 254
145 3300048903 Ga0496100_0128670 Ga0496100_0128670_608_1435 254
146 3300048904 Ga0496101_0340692 Ga0496101_0340692_298_1125 254
147 3300048905 Ga0496102_0016639 Ga0496102_0016639_494_1321 254
148 3300048906 Ga0496103_0015355 Ga0496103_0015355_3192_4019 254
149 3300048907 Ga0496104_0789962 Ga0496104_0789962_11_838 254
150 3300048908 Ga0496105_0063287 Ga0496105_0063287_587_1414 254
151 3300048909 Ga0496106_0204146 Ga0496106_0204146_138_965 254
152 3300048910 Ga0496107_0367837 Ga0496107_0367837_11_838 254
153 3300048910 Ga0496107_0369887 Ga0496107_0369887_163_990 254
154 3300048911 Ga0496108_0043433 Ga0496108_0043433_2917_3744 254
155 3300048912 Ga0496109_0041213 Ga0496109_0041213_805_1632 254
156 3300048914 Ga0496111_0024846 Ga0496111_0024846_1511_2338 254
157 3300048916 Ga0496113_0026871 Ga0496113_0026871_2947_3774 254
158 3300048917 Ga0496114_0003362 Ga0496114_0003362_4819_5646 254
159 3300048918 Ga0496115_0034066 Ga0496115_0034066_2838_3665 254
160 3300044706 Ga0466964_0167302 Ga0466964_0167302_100_924 255
161 3300045976 Ga0466967_0011240 Ga0466967_0011240_1485_2309 255
162 3300048905 Ga0496102_0422367 Ga0496102_0422367_253_1077 255
163 3300048910 Ga0496107_0000242 Ga0496107_0000242_19937_20761 255
164 3300044735 Ga0466968_0025288 Ga0466968_0025288_1123_1956 257
165 3300045049 Ga0466959_0254129 Ga0466959_0254129_280_1113 257
166 3300017792 Ga0163161_10229610 Ga0163161_102296102 258
167 3300046491 Ga0495584_0224471 Ga0495584_0224471_50_874 258
168 3300046689 Ga0495613_0047146 Ga0495613_0047146_2289_3125 258
169 3300049583 Ga0501067_0031144 Ga0501067_0031144_666_1499 259
170 3300049584 Ga0501068_0003100 Ga0501068_0003100_4130_4963 259
171 3300050515 nmdc:mga0a205_202628_c1 nmdc:mga0a205_202628_c1_193_1011 259
172 3300006844 Ga0075428_100012212 Ga0075428_10001221210 260
173 3300006844 Ga0075428_100379218 Ga0075428_1003792182 260
174 3300006847 Ga0075431_100002910 Ga0075431_10000291016 260
175 3300006852 Ga0075433_10024118 Ga0075433_100241185 260
176 3300006914 Ga0075436_100020398 Ga0075436_1000203984 260
177 3300007076 Ga0075435_100028080 Ga0075435_1000280806 260
178 3300009094 Ga0111539_10035714 Ga0111539_100357144 260
179 3300009147 Ga0114129_10788334 Ga0114129_107883342 260
180 3300025922 Ga0207646_10355995 Ga0207646_103559952 260
181 3300048912 Ga0496109_0601108 Ga0496109_0601108_177_998 260
182 3300049742 Ga0501080_0074751 Ga0501080_0074751_516_1340 260
183 3300050507 nmdc:mga05p37_52672_c1 nmdc:mga05p37_52672_c1_1233_2054 260
184 3300050507 nmdc:mga05p37_606736_c1 nmdc:mga05p37_606736_c1_128_949 260
185 3300050511 nmdc:mga08y16_19493_c1 nmdc:mga08y16_19493_c1_3336_4157 260
186 3300050514 nmdc:mga08x19_34795_c1 nmdc:mga08x19_34795_c1_1578_2399 260
187 3300050515 nmdc:mga0a205_28071_c1 nmdc:mga0a205_28071_c1_4417_5238 260
188 3300005339 Ga0070660_100054065 Ga0070660_1000540652 261
189 3300005356 Ga0070674_100005755 Ga0070674_1000057556 261
190 3300005439 Ga0070711_100009812 Ga0070711_1000098125 261
191 3300005459 Ga0068867_100084604 Ga0068867_1000846042 261
192 3300005471 Ga0070698_100015246 Ga0070698_1000152468 261
193 3300005536 Ga0070697_100158263 Ga0070697_1001582631 261
194 3300005549 Ga0070704_100162942 Ga0070704_1001629422 261
195 3300005834 Ga0068851_10008024 Ga0068851_100080243 261
196 3300005937 Ga0081455_10018767 Ga0081455_100187672 261
197 3300005981 Ga0081538_10000100 Ga0081538_1000010069 261
198 3300006038 Ga0075365_10210969 Ga0075365_102109691 261
199 3300006051 Ga0075364_10254025 Ga0075364_102540252 261
200 3300006178 Ga0075367_10225184 Ga0075367_102251841 261
201 3300006844 Ga0075428_100005053 Ga0075428_10000505311 261
202 3300006847 Ga0075431_100033329 Ga0075431_1000333295 261
203 3300006847 Ga0075431_100070213 Ga0075431_1000702134 261
204 3300006847 Ga0075431_100134492 Ga0075431_1001344923 261
205 3300006847 Ga0075431_100363473 Ga0075431_1003634732 261
206 3300006852 Ga0075433_10002265 Ga0075433_100022655 261
207 3300006871 Ga0075434_100009463 Ga0075434_1000094639 261
208 3300006914 Ga0075436_100000915 Ga0075436_10000091514 261
209 3300007076 Ga0075435_100001243 Ga0075435_10000124318 261
210 3300009147 Ga0114129_10000141 Ga0114129_1000014162 261
211 3300013102 Ga0157371_10116002 Ga0157371_101160022 261
212 3300013308 Ga0157375_10578672 Ga0157375_105786722 261
213 3300021388 Ga0213875_10139329 Ga0213875_101393292 261
214 3300025321 Ga0207656_10004008 Ga0207656_100040085 261
215 3300025915 Ga0207693_10007638 Ga0207693_100076388 261
216 3300025916 Ga0207663_10118368 Ga0207663_101183682 261
217 3300025921 Ga0207652_10087226 Ga0207652_100872262 261
218 3300025944 Ga0207661_10318684 Ga0207661_103186842 261
219 3300026089 Ga0207648_10352013 Ga0207648_103520132 261
220 3300026089 Ga0207648_10443595 Ga0207648_104435952 261
221 3300027907 Ga0207428_10321501 Ga0207428_103215011 261
222 3300031548 Ga0307408_100118146 Ga0307408_1001181462 261
223 3300031901 Ga0307406_10009746 Ga0307406_100097464 261
224 3300032002 Ga0307416_100212948 Ga0307416_1002129483 261
225 3300032005 Ga0307411_10410369 Ga0307411_104103693 261
226 3300032126 Ga0307415_100050027 Ga0307415_1000500273 261
227 3300037312 Ga0395899_0002568 Ga0395899_0002568_5800_6624 261
228 3300037312 Ga0395899_0009554 Ga0395899_0009554_6590_7414 261
229 3300037312 Ga0395899_0082410 Ga0395899_0082410_1148_1972 261
230 3300037418 Ga0395900_0001219 Ga0395900_0001219_26073_26897 261
231 3300037418 Ga0395900_0004452 Ga0395900_0004452_3230_4054 261
232 3300037418 Ga0395900_0019826 Ga0395900_0019826_5548_6429 261
233 3300037466 Ga0395898_0012615 Ga0395898_0012615_6861_7685 261
234 3300037466 Ga0395898_0027937 Ga0395898_0027937_4373_5197 261
235 3300037466 Ga0395898_0085312 Ga0395898_0085312_20_844 261
236 3300037466 Ga0395898_0180539 Ga0395898_0180539_848_1729 261
237 3300037466 Ga0395898_0489806 Ga0395898_0489806_269_1093 261
238 3300037471 Ga0395905_0000640 Ga0395905_0000640_45469_46293 261
239 3300037471 Ga0395905_0007797 Ga0395905_0007797_6265_7089 261
240 3300037471 Ga0395905_0063663 Ga0395905_0063663_299_1123 261
241 3300037471 Ga0395905_0066894 Ga0395905_0066894_164_994 261
242 3300037853 Ga0436364_0533197 Ga0436364_0533197_42_866 261
243 3300038443 Ga0395901_0000978 Ga0395901_0000978_26035_26859 261
244 3300038443 Ga0395901_0002692 Ga0395901_0002692_5735_6559 261
245 3300038443 Ga0395901_0015905 Ga0395901_0015905_5249_6079 261
246 3300038443 Ga0395901_0032992 Ga0395901_0032992_4019_4843 261
247 3300038443 Ga0395901_0035193 Ga0395901_0035193_2098_2979 261
248 3300038443 Ga0395901_0138285 Ga0395901_0138285_919_1749 261
249 3300039450 Ga0436363_1287539 Ga0436363_1287539_515_1339 261
250 3300041406 Ga0439439_0044680 Ga0439439_0044680_210_1049 261
251 3300041410 Ga0439461_0012809 Ga0439461_0012809_180_1004 261
252 3300041512 Ga0451853_3576152 Ga0451853_3576152_491_1315 261
253 3300041512 Ga0451853_3629479 Ga0451853_3629479_22_846 261
254 3300042156 Ga0439446_0005591 Ga0439446_0005591_1063_1902 261
255 3300044658 Ga0466972_0070793 Ga0466972_0070793_343_1167 261
256 3300044706 Ga0466964_0024459 Ga0466964_0024459_1474_2298 261
257 3300044719 Ga0466971_0091631 Ga0466971_0091631_536_1360 261
258 3300044735 Ga0466968_0080358 Ga0466968_0080358_78_902 261
259 3300044842 Ga0466957_0073883 Ga0466957_0073883_1008_1832 261
260 3300044901 Ga0466960_0124262 Ga0466960_0124262_244_1068 261
261 3300045976 Ga0466967_0003281 Ga0466967_0003281_4324_5148 261
262 3300045976 Ga0466967_0051313 Ga0466967_0051313_1217_2041 261
263 3300046459 Ga0495629_0141270 Ga0495629_0141270_545_1369 261
264 3300046463 Ga0495653_0139181 Ga0495653_0139181_858_1682 261
265 3300046500 Ga0495596_0061758 Ga0495596_0061758_584_1408 261
266 3300046517 Ga0495630_0130037 Ga0495630_0130037_71_895 261
267 3300046525 Ga0495663_0015710 Ga0495663_0015710_795_1619 261
268 3300046526 Ga0495666_0134563 Ga0495666_0134563_44_868 261
269 3300046615 Ga0495656_0120245 Ga0495656_0120245_388_1212 261
270 3300046615 Ga0495656_0206021 Ga0495656_0206021_11_835 261
271 3300046664 Ga0495659_0065526 Ga0495659_0065526_404_1228 261
272 3300046674 Ga0495588_0128966 Ga0495588_0128966_66_890 261
273 3300046675 Ga0495657_0073386 Ga0495657_0073386_1319_2143 261
274 3300047317 Ga0495604_0219087 Ga0495604_0219087_67_894 261
275 3300047322 Ga0495680_0120624 Ga0495680_0120624_1046_1870 261
276 3300048904 Ga0496101_0163765 Ga0496101_0163765_35_859 261
277 3300048907 Ga0496104_0235398 Ga0496104_0235398_200_1024 261
278 3300048908 Ga0496105_0296402 Ga0496105_0296402_119_943 261
279 3300048911 Ga0496108_0196792 Ga0496108_0196792_742_1566 261
280 3300048912 Ga0496109_0304410 Ga0496109_0304410_395_1219 261
281 3300048913 Ga0496110_0029730 Ga0496110_0029730_803_1627 261
282 3300048913 Ga0496110_0149564 Ga0496110_0149564_395_1219 261
283 3300048915 Ga0496112_0093391 Ga0496112_0093391_112_936 261
284 3300048916 Ga0496113_0085219 Ga0496113_0085219_1480_2304 261
285 3300048917 Ga0496114_0279677 Ga0496114_0279677_537_1361 261
286 3300049568 Ga0501031_0003333 Ga0501031_0003333_4613_5437 261
287 3300049569 Ga0501032_0001554 Ga0501032_0001554_12532_13356 261
288 3300049570 Ga0501033_0000899 Ga0501033_0000899_6076_6900 261
289 3300049570 Ga0501033_0112125 Ga0501033_0112125_917_1741 261
290 3300049571 Ga0501034_0072921 Ga0501034_0072921_621_1445 261
291 3300049572 Ga0501036_0044330 Ga0501036_0044330_1797_2621 261
292 3300049572 Ga0501036_0053302 Ga0501036_0053302_262_1086 261
293 3300049573 Ga0501037_0007386 Ga0501037_0007386_5062_5886 261
294 3300049573 Ga0501037_0122124 Ga0501037_0122124_812_1636 261
295 3300049574 Ga0501038_0003802 Ga0501038_0003802_8505_9329 261
296 3300049574 Ga0501038_0040949 Ga0501038_0040949_2341_3165 261
297 3300049575 Ga0501039_0009033 Ga0501039_0009033_5348_6172 261
298 3300049576 Ga0501040_0002266 Ga0501040_0002266_6021_6845 261
299 3300049576 Ga0501040_0005466 Ga0501040_0005466_7137_7961 261
300 3300049576 Ga0501040_0141222 Ga0501040_0141222_228_1052 261
301 3300049577 Ga0501041_0000474 Ga0501041_0000474_7027_7851 261
302 3300049578 Ga0501042_0000930 Ga0501042_0000930_4590_5414 261
303 3300049579 Ga0501043_0000693 Ga0501043_0000693_24413_25237 261
304 3300049579 Ga0501043_0086178 Ga0501043_0086178_368_1192 261
305 3300049580 Ga0501046_0001855 Ga0501046_0001855_2154_2978 261
306 3300049580 Ga0501046_0040284 Ga0501046_0040284_1990_2814 261
307 3300049581 Ga0501047_0231175 Ga0501047_0231175_800_1624 261
308 3300049582 Ga0501048_0000867 Ga0501048_0000867_3673_4497 261
309 3300049582 Ga0501048_0008074 Ga0501048_0008074_4497_5321 261
310 3300049582 Ga0501048_0031868 Ga0501048_0031868_1560_2384 261
311 3300049583 Ga0501067_0023040 Ga0501067_0023040_1273_2097 261
312 3300049583 Ga0501067_0137929 Ga0501067_0137929_120_944 261
313 3300049584 Ga0501068_0001514 Ga0501068_0001514_11088_11912 261
314 3300049584 Ga0501068_0145475 Ga0501068_0145475_425_1249 261
315 3300049585 Ga0501069_0000605 Ga0501069_0000605_3707_4531 261
316 3300049585 Ga0501069_0030644 Ga0501069_0030644_1538_2362 261
317 3300049585 Ga0501069_0069892 Ga0501069_0069892_729_1553 261
318 3300049586 Ga0501070_0001149 Ga0501070_0001149_1526_2350 261
319 3300049587 Ga0501071_0000677 Ga0501071_0000677_291_1115 261
320 3300049587 Ga0501071_0030359 Ga0501071_0030359_1705_2529 261
321 3300049588 Ga0501072_0016896 Ga0501072_0016896_331_1155 261
322 3300049588 Ga0501072_0023091 Ga0501072_0023091_3801_4625 261
323 3300049588 Ga0501072_0131910 Ga0501072_0131910_136_960 261
324 3300049589 Ga0501073_0003204 Ga0501073_0003204_8057_8881 261
325 3300049589 Ga0501073_0029285 Ga0501073_0029285_2924_3748 261
326 3300049589 Ga0501073_0269778 Ga0501073_0269778_145_969 261
327 3300049590 Ga0501074_0045687 Ga0501074_0045687_1925_2749 261
328 3300049591 Ga0501075_0017103 Ga0501075_0017103_101_925 261
329 3300049591 Ga0501075_0044640 Ga0501075_0044640_2459_3283 261
330 3300049591 Ga0501075_0108908 Ga0501075_0108908_218_1042 261
331 3300049591 Ga0501075_0267954 Ga0501075_0267954_59_883 261
332 3300049592 Ga0501076_0011459 Ga0501076_0011459_1698_2522 261
333 3300049592 Ga0501076_0035541 Ga0501076_0035541_878_1702 261
334 3300049592 Ga0501076_0185501 Ga0501076_0185501_419_1243 261
335 3300049592 Ga0501076_0219026 Ga0501076_0219026_520_1344 261
336 3300049593 Ga0501077_0008185 Ga0501077_0008185_4031_4855 261
337 3300049593 Ga0501077_0103972 Ga0501077_0103972_164_988 261
338 3300049741 Ga0501079_0206946 Ga0501079_0206946_482_1306 261
339 3300049742 Ga0501080_0001056 Ga0501080_0001056_19911_20735 261
340 3300049742 Ga0501080_0043951 Ga0501080_0043951_3131_3955 261
341 3300049742 Ga0501080_0194526 Ga0501080_0194526_677_1501 261
342 3300049743 Ga0501081_0002176 Ga0501081_0002176_4461_5285 261
343 3300049744 Ga0501083_0002444 Ga0501083_0002444_2123_2947 261
344 3300049822 Ga0501035_0001594 Ga0501035_0001594_4637_5461 261
345 3300049822 Ga0501035_0014199 Ga0501035_0014199_938_1762 261
346 3300049823 Ga0501044_0457884 Ga0501044_0457884_329_1153 261
347 3300049824 Ga0501045_0005255 Ga0501045_0005255_3673_4497 261
348 3300049824 Ga0501045_0038043 Ga0501045_0038043_77_901 261
349 3300049824 Ga0501045_0054993 Ga0501045_0054993_100_924 261
350 3300049824 Ga0501045_0095770 Ga0501045_0095770_993_1793 261
351 3300050489 nmdc:mga03683_171769_c1 nmdc:mga03683_171769_c1_122_946 261
352 3300050491 nmdc:mga00v17_368682_c1 nmdc:mga00v17_368682_c1_93_917 261
353 3300050492 nmdc:mga0yw44_181621_c1 nmdc:mga0yw44_181621_c1_111_935 261
354 3300050492 nmdc:mga0yw44_51448_c1 nmdc:mga0yw44_51448_c1_518_1342 261
355 3300050494 nmdc:mga06z11_195294_c1 nmdc:mga06z11_195294_c1_14_838 261
356 3300050507 nmdc:mga05p37_1712_c1 nmdc:mga05p37_1712_c1_18649_19473 261
357 3300050507 nmdc:mga05p37_813115_c1 nmdc:mga05p37_813115_c1_139_963 261
358 3300050507 nmdc:mga05p37_8903_c1 nmdc:mga05p37_8903_c1_61_885 261
359 3300050508 nmdc:mga09592_118389_c1 nmdc:mga09592_118389_c1_1330_2157 261
360 3300050509 nmdc:mga0qj67_291079_c1 nmdc:mga0qj67_291079_c1_35_859 261
361 3300050510 nmdc:mga06r32_28868_c1 nmdc:mga06r32_28868_c1_2886_3710 261
362 3300050510 nmdc:mga06r32_49576_c1 nmdc:mga06r32_49576_c1_231_1055 261
363 3300050510 nmdc:mga06r32_560576_c1 nmdc:mga06r32_560576_c1_93_917 261
364 3300050510 nmdc:mga06r32_66422_c1 nmdc:mga06r32_66422_c1_822_1646 261
365 3300050511 nmdc:mga08y16_580143_c1 nmdc:mga08y16_580143_c1_279_1103 261
366 3300050511 nmdc:mga08y16_786024_c1 nmdc:mga08y16_786024_c1_64_888 261
367 3300050512 nmdc:mga0n895_12180_c1 nmdc:mga0n895_12180_c1_844_1668 261
368 3300050513 nmdc:mga0rr50_372_c1 nmdc:mga0rr50_372_c1_3737_4561 261
369 3300050514 nmdc:mga08x19_4620_c1 nmdc:mga08x19_4620_c1_959_1783 261
370 3300053085 Ga0495619_0274774 Ga0495619_0274774_81_905 261
371 3300054114 Ga0501084_0038205 Ga0501084_0038205_59_883 261
372 3300054114 Ga0501084_0076185 Ga0501084_0076185_120_944 261
373 3300060353 Ga0501082_0121059 Ga0501082_0121059_1335_2159 261
374 3300061734 Ga0530510_0011066 Ga0530510_0011066_291_1115 261
375 3300061734 Ga0530510_0047359 Ga0530510_0047359_48_872 261
376 3300061734 Ga0530510_0172463 Ga0530510_0172463_165_989 261
377 3300005329 Ga0070683_100254295 Ga0070683_1002542951 262
378 3300005330 Ga0070690_100080852 Ga0070690_1000808523 262
379 3300005336 Ga0070680_100077430 Ga0070680_1000774304 262
380 3300005339 Ga0070660_100045357 Ga0070660_1000453573 262
381 3300005341 Ga0070691_10031993 Ga0070691_100319934 262
382 3300005345 Ga0070692_10018151 Ga0070692_100181513 262
383 3300005347 Ga0070668_100053143 Ga0070668_1000531434 262
384 3300005355 Ga0070671_100136151 Ga0070671_1001361512 262
385 3300005356 Ga0070674_100055508 Ga0070674_1000555082 262
386 3300005364 Ga0070673_100109765 Ga0070673_1001097653 262
387 3300005366 Ga0070659_100037243 Ga0070659_1000372433 262
388 3300005406 Ga0070703_10029379 Ga0070703_100293791 262
389 3300005434 Ga0070709_10038468 Ga0070709_100384683 262
390 3300005434 Ga0070709_10132751 Ga0070709_101327511 262
391 3300005435 Ga0070714_100070139 Ga0070714_1000701392 262
392 3300005435 Ga0070714_100083695 Ga0070714_1000836952 262
393 3300005437 Ga0070710_10105674 Ga0070710_101056742 262
394 3300005438 Ga0070701_10065807 Ga0070701_100658073 262
395 3300005441 Ga0070700_100156245 Ga0070700_1001562452 262
396 3300005444 Ga0070694_100047908 Ga0070694_1000479082 262
397 3300005444 Ga0070694_100086507 Ga0070694_1000865072 262
398 3300005444 Ga0070694_100408916 Ga0070694_1004089162 262
399 3300005456 Ga0070678_100129016 Ga0070678_1001290162 262
400 3300005457 Ga0070662_100032975 Ga0070662_1000329753 262
401 3300005459 Ga0068867_100022590 Ga0068867_1000225907 262
402 3300005467 Ga0070706_100058985 Ga0070706_1000589851 262
403 3300005468 Ga0070707_100051967 Ga0070707_1000519674 262
404 3300005471 Ga0070698_100016183 Ga0070698_1000161836 262
405 3300005471 Ga0070698_100022054 Ga0070698_1000220549 262
406 3300005518 Ga0070699_100082858 Ga0070699_1000828582 262
407 3300005536 Ga0070697_100188955 Ga0070697_1001889551 262
408 3300005539 Ga0068853_100325429 Ga0068853_1003254292 262
409 3300005545 Ga0070695_100029461 Ga0070695_1000294614 262
410 3300005545 Ga0070695_100140979 Ga0070695_1001409792 262
411 3300005546 Ga0070696_100015889 Ga0070696_1000158893 262
412 3300005546 Ga0070696_100061459 Ga0070696_1000614593 262
413 3300005547 Ga0070693_100023061 Ga0070693_1000230612 262
414 3300005547 Ga0070693_100248803 Ga0070693_1002488032 262
415 3300005549 Ga0070704_100015256 Ga0070704_1000152564 262
416 3300005549 Ga0070704_100158114 Ga0070704_1001581142 262
417 3300005563 Ga0068855_100152857 Ga0068855_1001528574 262
418 3300005563 Ga0068855_100208157 Ga0068855_1002081574 262
419 3300005614 Ga0068856_100083532 Ga0068856_1000835323 262
420 3300005718 Ga0068866_10125952 Ga0068866_101259521 262
421 3300005719 Ga0068861_100007739 Ga0068861_1000077394 262
422 3300005719 Ga0068861_100094875 Ga0068861_1000948752 262
423 3300005842 Ga0068858_100432309 Ga0068858_1004323093 262
424 3300005844 Ga0068862_100278360 Ga0068862_1002783603 262
425 3300005981 Ga0081538_10082099 Ga0081538_100820992 262
426 3300006163 Ga0070715_10038124 Ga0070715_100381242 262
427 3300006173 Ga0070716_100143012 Ga0070716_1001430122 262
428 3300006852 Ga0075433_10071464 Ga0075433_100714644 262
429 3300006852 Ga0075433_10113133 Ga0075433_101131333 262
430 3300006871 Ga0075434_100001294 Ga0075434_10000129418 262
431 3300006871 Ga0075434_100145869 Ga0075434_1001458692 262
432 3300006881 Ga0068865_100018192 Ga0068865_1000181923 262
433 3300006914 Ga0075436_100006395 Ga0075436_10000639510 262
434 3300006914 Ga0075436_100008390 Ga0075436_1000083905 262
435 3300007076 Ga0075435_100331419 Ga0075435_1003314191 262
436 3300009098 Ga0105245_10186618 Ga0105245_101866183 262
437 3300009147 Ga0114129_10142466 Ga0114129_101424662 262
438 3300009148 Ga0105243_10100630 Ga0105243_101006304 262
439 3300009148 Ga0105243_10129849 Ga0105243_101298493 262
440 3300009148 Ga0105243_10136046 Ga0105243_101360462 262
441 3300009176 Ga0105242_10066229 Ga0105242_100662294 262
442 3300009176 Ga0105242_10121783 Ga0105242_101217832 262
443 3300009177 Ga0105248_10593259 Ga0105248_105932592 262
444 3300009553 Ga0105249_10009086 Ga0105249_100090864 262
445 3300009553 Ga0105249_10026677 Ga0105249_100266772 262
446 3300010375 Ga0105239_10095749 Ga0105239_100957493 262
447 3300013308 Ga0157375_10785346 Ga0157375_107853461 262
448 3300014326 Ga0157380_10060201 Ga0157380_100602014 262
449 3300014969 Ga0157376_10320910 Ga0157376_103209101 262
450 3300017792 Ga0163161_10008822 Ga0163161_100088227 262
451 3300025885 Ga0207653_10004251 Ga0207653_100042512 262
452 3300025898 Ga0207692_10012508 Ga0207692_100125085 262
453 3300025905 Ga0207685_10008146 Ga0207685_100081462 262
454 3300025905 Ga0207685_10057699 Ga0207685_100576991 262
455 3300025910 Ga0207684_10118109 Ga0207684_101181093 262
456 3300025915 Ga0207693_10035896 Ga0207693_100358963 262
457 3300025919 Ga0207657_10080178 Ga0207657_100801784 262
458 3300025922 Ga0207646_10491985 Ga0207646_104919851 262
459 3300025928 Ga0207700_10069117 Ga0207700_100691174 262
460 3300025929 Ga0207664_10132587 Ga0207664_101325872 262
461 3300025933 Ga0207706_10010201 Ga0207706_100102013 262
462 3300025934 Ga0207686_10230059 Ga0207686_102300591 262
463 3300025935 Ga0207709_10242955 Ga0207709_102429553 262
464 3300025938 Ga0207704_10218237 Ga0207704_102182373 262
465 3300025938 Ga0207704_10313786 Ga0207704_103137861 262
466 3300025941 Ga0207711_10143958 Ga0207711_101439583 262
467 3300025944 Ga0207661_10090489 Ga0207661_100904892 262
468 3300025949 Ga0207667_10138760 Ga0207667_101387603 262
469 3300025949 Ga0207667_10159659 Ga0207667_101596593 262
470 3300025960 Ga0207651_10528870 Ga0207651_105288702 262
471 3300025972 Ga0207668_10062865 Ga0207668_100628652 262
472 3300026023 Ga0207677_10183427 Ga0207677_101834273 262
473 3300026075 Ga0207708_10000684 Ga0207708_1000068412 262
474 3300026078 Ga0207702_10381501 Ga0207702_103815012 262
475 3300026088 Ga0207641_10532558 Ga0207641_105325581 262
476 3300026089 Ga0207648_10011247 Ga0207648_100112474 262
477 3300026118 Ga0207675_100000929 Ga0207675_10000092911 262
478 3300026121 Ga0207683_10034207 Ga0207683_100342074 262
479 3300026121 Ga0207683_10063512 Ga0207683_100635123 262
480 3300028563 Ga0265319_1000635 Ga0265319_100063517 262
481 3300028654 Ga0265322_10032636 Ga0265322_100326361 262
482 3300028800 Ga0265338_10075508 Ga0265338_100755083 262
483 3300031235 Ga0265330_10046743 Ga0265330_100467432 262
484 3300031238 Ga0265332_10116072 Ga0265332_101160721 262
485 3300031240 Ga0265320_10092767 Ga0265320_100927672 262
486 3300031242 Ga0265329_10025187 Ga0265329_100251872 262
487 3300031344 Ga0265316_10159049 Ga0265316_101590492 262
488 3300031712 Ga0265342_10130077 Ga0265342_101300772 262
489 3300031995 Ga0307409_100187828 Ga0307409_1001878282 262
490 3300032002 Ga0307416_100019684 Ga0307416_1000196846 262
491 3300032126 Ga0307415_100021919 Ga0307415_1000219193 262
492 3300035088 Ga0373940_0004842 Ga0373940_0004842_76_906 262
493 3300035090 Ga0373949_0005830 Ga0373949_0005830_827_1657 262
494 3300035092 Ga0373952_0002137 Ga0373952_0002137_108_938 262
495 3300035170 Ga0373943_0000198 Ga0373943_0000198_6010_6837 262
496 3300035241 Ga0373961_0008795 Ga0373961_0008795_312_1142 262
497 3300035242 Ga0373962_0005248 Ga0373962_0005248_805_1635 262
498 3300035692 Ga0373935_0109936 Ga0373935_0109936_288_1115 262
499 3300035725 Ga0373947_0000463 Ga0373947_0000463_12344_13171 262
500 3300037068 Ga0373925_0024512 Ga0373925_0024512_1841_2668 262
501 3300037312 Ga0395899_0000862 Ga0395899_0000862_20031_20858 262
502 3300037312 Ga0395899_0005918 Ga0395899_0005918_1860_2687 262
503 3300037312 Ga0395899_0008133 Ga0395899_0008133_1187_2014 262
504 3300037312 Ga0395899_0182321 Ga0395899_0182321_455_1282 262
505 3300037418 Ga0395900_0001266 Ga0395900_0001266_3248_4075 262
506 3300037418 Ga0395900_0001485 Ga0395900_0001485_26290_27117 262
507 3300037418 Ga0395900_0005059 Ga0395900_0005059_453_1280 262
508 3300037418 Ga0395900_0068678 Ga0395900_0068678_482_1309 262
509 3300037418 Ga0395900_0171588 Ga0395900_0171588_637_1464 262
510 3300037418 Ga0395900_0351242 Ga0395900_0351242_550_1377 262
511 3300037418 Ga0395900_0497844 Ga0395900_0497844_148_975 262
512 3300037466 Ga0395898_0015047 Ga0395898_0015047_6644_7471 262
513 3300037466 Ga0395898_0020108 Ga0395898_0020108_5139_5966 262
514 3300037466 Ga0395898_0022431 Ga0395898_0022431_1789_2616 262
515 3300037466 Ga0395898_0036950 Ga0395898_0036950_27_854 262
516 3300037466 Ga0395898_0040672 Ga0395898_0040672_59_913 262
517 3300037466 Ga0395898_0054574 Ga0395898_0054574_1702_2529 262
518 3300037466 Ga0395898_0220145 Ga0395898_0220145_632_1459 262
519 3300037471 Ga0395905_0001564 Ga0395905_0001564_9795_10622 262
520 3300037471 Ga0395905_0008242 Ga0395905_0008242_5877_6704 262
521 3300037471 Ga0395905_0020747 Ga0395905_0020747_750_1577 262
522 3300037471 Ga0395905_0093548 Ga0395905_0093548_1661_2488 262
523 3300037471 Ga0395905_0299866 Ga0395905_0299866_645_1472 262
524 3300037471 Ga0395905_0500768 Ga0395905_0500768_202_1029 262
525 3300038443 Ga0395901_0002270 Ga0395901_0002270_203_1030 262
526 3300038443 Ga0395901_0011802 Ga0395901_0011802_7553_8380 262
527 3300038443 Ga0395901_0016559 Ga0395901_0016559_3049_3876 262
528 3300038443 Ga0395901_0143583 Ga0395901_0143583_697_1524 262
529 3300038443 Ga0395901_0257143 Ga0395901_0257143_214_1041 262
530 3300038443 Ga0395901_0449267 Ga0395901_0449267_65_892 262
531 3300041452 Ga0451793_0979246 Ga0451793_0979246_527_1354 262
532 3300044706 Ga0466964_0000465 Ga0466964_0000465_9141_9968 262
533 3300045051 Ga0451576_0408613 Ga0451576_0408613_577_1404 262
534 3300045976 Ga0466967_0065864 Ga0466967_0065864_2272_3099 262
535 3300046455 Ga0495603_0000081 Ga0495603_0000081_17914_18741 262
536 3300046461 Ga0495641_0002133 Ga0495641_0002133_12476_13303 262
537 3300046473 Ga0495582_0027562 Ga0495582_0027562_1191_2018 262
538 3300046491 Ga0495584_0092599 Ga0495584_0092599_678_1505 262
539 3300046499 Ga0495594_0000536 Ga0495594_0000536_4926_5753 262
540 3300046526 Ga0495666_0019555 Ga0495666_0019555_1572_2399 262
541 3300046664 Ga0495659_0137573 Ga0495659_0137573_66_893 262
542 3300046674 Ga0495588_0002678 Ga0495588_0002678_3503_4330 262
543 3300046690 Ga0495624_0210753 Ga0495624_0210753_20_847 262
544 3300047315 Ga0495581_0034383 Ga0495581_0034383_1237_2064 262
545 3300047321 Ga0495676_0002817 Ga0495676_0002817_4217_5044 262
546 3300047321 Ga0495676_0204108 Ga0495676_0204108_530_1357 262
547 3300048903 Ga0496100_0012806 Ga0496100_0012806_2503_3333 262
548 3300048904 Ga0496101_0014642 Ga0496101_0014642_1606_2436 262
549 3300048905 Ga0496102_0017600 Ga0496102_0017600_3854_4681 262
550 3300048905 Ga0496102_0048059 Ga0496102_0048059_2719_3546 262
551 3300048905 Ga0496102_0095778 Ga0496102_0095778_611_1441 262
552 3300048906 Ga0496103_0010103 Ga0496103_0010103_597_1427 262
553 3300048907 Ga0496104_0010631 Ga0496104_0010631_6539_7369 262
554 3300048907 Ga0496104_0068058 Ga0496104_0068058_24_851 262
555 3300048908 Ga0496105_0004904 Ga0496105_0004904_2048_2875 262
556 3300048908 Ga0496105_0092357 Ga0496105_0092357_1311_2141 262
557 3300048909 Ga0496106_0058137 Ga0496106_0058137_870_1700 262
558 3300048909 Ga0496106_0083654 Ga0496106_0083654_1214_2041 262
559 3300048909 Ga0496106_0362770 Ga0496106_0362770_279_1106 262
560 3300048910 Ga0496107_0006234 Ga0496107_0006234_5649_6476 262
561 3300048910 Ga0496107_0041282 Ga0496107_0041282_1172_2002 262
562 3300048911 Ga0496108_0003137 Ga0496108_0003137_5548_6378 262
563 3300048911 Ga0496108_0010715 Ga0496108_0010715_3952_4779 262
564 3300048911 Ga0496108_0022146 Ga0496108_0022146_2172_3002 262
565 3300048912 Ga0496109_0018833 Ga0496109_0018833_2889_3716 262
566 3300048912 Ga0496109_0062927 Ga0496109_0062927_307_1137 262
567 3300048912 Ga0496109_0247179 Ga0496109_0247179_515_1345 262
568 3300048913 Ga0496110_0011919 Ga0496110_0011919_2533_3360 262
569 3300048913 Ga0496110_0046702 Ga0496110_0046702_630_1460 262
570 3300048913 Ga0496110_0065457 Ga0496110_0065457_120_947 262
571 3300048914 Ga0496111_0003372 Ga0496111_0003372_3798_4625 262
572 3300048914 Ga0496111_0116049 Ga0496111_0116049_723_1550 262
573 3300048915 Ga0496112_0019694 Ga0496112_0019694_2889_3716 262
574 3300048915 Ga0496112_0099657 Ga0496112_0099657_1172_2002 262
575 3300048915 Ga0496112_0578012 Ga0496112_0578012_74_904 262
576 3300048916 Ga0496113_0001530 Ga0496113_0001530_4279_5106 262
577 3300048916 Ga0496113_0069827 Ga0496113_0069827_1218_2048 262
578 3300048916 Ga0496113_0299372 Ga0496113_0299372_316_1143 262
579 3300048917 Ga0496114_0026950 Ga0496114_0026950_2561_3388 262
580 3300048917 Ga0496114_0044143 Ga0496114_0044143_1500_2330 262
581 3300048917 Ga0496114_0178809 Ga0496114_0178809_248_1075 262
582 3300048918 Ga0496115_0054854 Ga0496115_0054854_633_1463 262
583 3300048918 Ga0496115_0530921 Ga0496115_0530921_32_859 262
584 3300049581 Ga0501047_0037685 Ga0501047_0037685_2923_3750 262
585 3300049581 Ga0501047_0061174 Ga0501047_0061174_909_1736 262
586 3300050507 nmdc:mga05p37_301655_c1 nmdc:mga05p37_301655_c1_880_1710 262
587 3300050512 nmdc:mga0n895_88875_c1 nmdc:mga0n895_88875_c1_1643_2473 262
588 3300050513 nmdc:mga0rr50_33890_c1 nmdc:mga0rr50_33890_c1_381_1211 262
589 3300050513 nmdc:mga0rr50_95152_c1 nmdc:mga0rr50_95152_c1_1262_2092 262
590 3300050514 nmdc:mga08x19_45511_c1 nmdc:mga08x19_45511_c1_1374_2204 262
591 3300050514 nmdc:mga08x19_5986_c1 nmdc:mga08x19_5986_c1_4263_5093 262
592 3300050515 nmdc:mga0a205_15513_c1 nmdc:mga0a205_15513_c1_1645_2475 262
593 3300050515 nmdc:mga0a205_503541_c1 nmdc:mga0a205_503541_c1_217_1047 262
594 3300005336 Ga0070680_100049179 Ga0070680_1000491794 263
595 3300005458 Ga0070681_10245233 Ga0070681_102452332 263
596 3300005530 Ga0070679_100036271 Ga0070679_1000362715 263
597 3300005719 Ga0068861_100184110 Ga0068861_1001841103 263
598 3300005937 Ga0081455_10004421 Ga0081455_100044217 263
599 3300005981 Ga0081538_10024011 Ga0081538_100240112 263
600 3300005983 Ga0081540_1017275 Ga0081540_10172754 263
601 3300006028 Ga0070717_10205975 Ga0070717_102059752 263
602 3300006173 Ga0070716_100008190 Ga0070716_1000081906 263
603 3300006871 Ga0075434_100033764 Ga0075434_1000337646 263
604 3300006914 Ga0075436_100272928 Ga0075436_1002729281 263
605 3300007076 Ga0075435_100103033 Ga0075435_1001030332 263
606 3300007076 Ga0075435_100120794 Ga0075435_1001207943 263
607 3300009093 Ga0105240_10119265 Ga0105240_101192652 263
608 3300009098 Ga0105245_10684038 Ga0105245_106840381 263
609 3300009176 Ga0105242_10024082 Ga0105242_100240826 263
610 3300013306 Ga0163162_10316400 Ga0163162_103164002 263
611 3300020081 Ga0206354_10143858 Ga0206354_101438582 263
612 3300025922 Ga0207646_10120866 Ga0207646_101208662 263
613 3300025922 Ga0207646_10148490 Ga0207646_101484901 263
614 3300025928 Ga0207700_10000039 Ga0207700_1000003963 263
615 3300025934 Ga0207686_10010201 Ga0207686_100102016 263
616 3300025937 Ga0207669_10231393 Ga0207669_102313932 263
617 3300025939 Ga0207665_10004972 Ga0207665_100049727 263
618 3300026118 Ga0207675_100336280 Ga0207675_1003362801 263
619 3300027907 Ga0207428_10099829 Ga0207428_100998293 263
620 3300028573 Ga0265334_10002590 Ga0265334_100025908 263
621 3300028654 Ga0265322_10001612 Ga0265322_100016128 263
622 3300028800 Ga0265338_10144941 Ga0265338_101449411 263
623 3300029957 Ga0265324_10033318 Ga0265324_100333182 263
624 3300031235 Ga0265330_10000327 Ga0265330_100003279 263
625 3300031238 Ga0265332_10003969 Ga0265332_100039696 263
626 3300031247 Ga0265340_10002177 Ga0265340_100021775 263
627 3300031250 Ga0265331_10004733 Ga0265331_100047332 263
628 3300031251 Ga0265327_10017812 Ga0265327_100178126 263
629 3300031344 Ga0265316_10020939 Ga0265316_100209395 263
630 3300031595 Ga0265313_10005397 Ga0265313_100053975 263
631 3300031711 Ga0265314_10002591 Ga0265314_1000259116 263
632 3300031712 Ga0265342_10011070 Ga0265342_100110702 263
633 3300035112 Ga0373932_0075588 Ga0373932_0075588_129_959 263
634 3300035691 Ga0373931_0097985 Ga0373931_0097985_116_946 263
635 3300037418 Ga0395900_0024066 Ga0395900_0024066_594_1424 263
636 3300037466 Ga0395898_0041721 Ga0395898_0041721_264_1094 263
637 3300037471 Ga0395905_0093695 Ga0395905_0093695_1813_2643 263
638 3300037471 Ga0395905_0160799 Ga0395905_0160799_445_1275 263
639 3300038443 Ga0395901_0057609 Ga0395901_0057609_25_855 263
640 3300042005 Ga0439448_0012082 Ga0439448_0012082_270_1100 263
641 3300042012 Ga0439455_0016834 Ga0439455_0016834_540_1370 263
642 3300045976 Ga0466967_0000676 Ga0466967_0000676_9767_10597 263
643 3300048903 Ga0496100_0013565 Ga0496100_0013565_720_1550 263
644 3300048904 Ga0496101_0212930 Ga0496101_0212930_104_934 263
645 3300048906 Ga0496103_0015863 Ga0496103_0015863_1992_2822 263
646 3300048909 Ga0496106_0014470 Ga0496106_0014470_1819_2649 263
647 3300048910 Ga0496107_0021016 Ga0496107_0021016_792_1622 263
648 3300048912 Ga0496109_0233179 Ga0496109_0233179_386_1216 263
649 3300048915 Ga0496112_0314375 Ga0496112_0314375_239_1069 263
650 3300048917 Ga0496114_0015427 Ga0496114_0015427_3635_4465 263
651 3300050512 nmdc:mga0n895_234673_c1 nmdc:mga0n895_234673_c1_513_1343 263
652 3300050513 nmdc:mga0rr50_157685_c1 nmdc:mga0rr50_157685_c1_202_1032 263
653 3300050514 nmdc:mga08x19_177286_c1 nmdc:mga08x19_177286_c1_167_997 263
654 3300050515 nmdc:mga0a205_109138_c1 nmdc:mga0a205_109138_c1_488_1318 263
655 3300005327 Ga0070658_10037764 Ga0070658_100377642 264
656 3300005329 Ga0070683_100037562 Ga0070683_1000375621 264
657 3300005336 Ga0070680_100020568 Ga0070680_1000205687 264
658 3300005336 Ga0070680_100296143 Ga0070680_1002961431 264
659 3300005337 Ga0070682_100137262 Ga0070682_1001372622 264
660 3300005339 Ga0070660_100008257 Ga0070660_1000082574 264
661 3300005339 Ga0070660_100020167 Ga0070660_1000201672 264
662 3300005339 Ga0070660_100296139 Ga0070660_1002961391 264
663 3300005344 Ga0070661_100056424 Ga0070661_1000564242 264
664 3300005355 Ga0070671_100164199 Ga0070671_1001641992 264
665 3300005366 Ga0070659_100004574 Ga0070659_1000045748 264
666 3300005366 Ga0070659_100282099 Ga0070659_1002820992 264
667 3300005434 Ga0070709_10327033 Ga0070709_103270332 264
668 3300005435 Ga0070714_100004838 Ga0070714_1000048382 264
669 3300005435 Ga0070714_100026860 Ga0070714_1000268602 264
670 3300005435 Ga0070714_100052155 Ga0070714_1000521552 264
671 3300005435 Ga0070714_100061379 Ga0070714_1000613793 264
672 3300005436 Ga0070713_100008471 Ga0070713_1000084715 264
673 3300005437 Ga0070710_10008982 Ga0070710_100089825 264
674 3300005439 Ga0070711_100016495 Ga0070711_1000164953 264
675 3300005458 Ga0070681_10039443 Ga0070681_100394434 264
676 3300005458 Ga0070681_10071482 Ga0070681_100714822 264
677 3300005468 Ga0070707_100421842 Ga0070707_1004218422 264
678 3300005530 Ga0070679_100022080 Ga0070679_1000220806 264
679 3300005530 Ga0070679_100033495 Ga0070679_1000334956 264
680 3300005530 Ga0070679_100052882 Ga0070679_1000528826 264
681 3300005535 Ga0070684_100071138 Ga0070684_1000711381 264
682 3300005535 Ga0070684_100126064 Ga0070684_1001260642 264
683 3300005563 Ga0068855_100052856 Ga0068855_1000528566 264
684 3300005563 Ga0068855_100061944 Ga0068855_1000619445 264
685 3300005616 Ga0068852_100076060 Ga0068852_1000760602 264
686 3300005841 Ga0068863_100172157 Ga0068863_1001721573 264
687 3300006028 Ga0070717_10005467 Ga0070717_100054673 264
688 3300006028 Ga0070717_10034859 Ga0070717_100348593 264
689 3300006028 Ga0070717_10363118 Ga0070717_103631181 264
690 3300006175 Ga0070712_100211865 Ga0070712_1002118652 264
691 3300006871 Ga0075434_100003374 Ga0075434_1000033747 264
692 3300009093 Ga0105240_10040117 Ga0105240_100401175 264
693 3300009093 Ga0105240_10073540 Ga0105240_100735404 264
694 3300009093 Ga0105240_10251425 Ga0105240_102514252 264
695 3300009098 Ga0105245_10047671 Ga0105245_100476711 264
696 3300009176 Ga0105242_10258774 Ga0105242_102587742 264
697 3300009551 Ga0105238_10053645 Ga0105238_100536452 264
698 3300011119 Ga0105246_10338207 Ga0105246_103382072 264
699 3300013104 Ga0157370_10033132 Ga0157370_100331323 264
700 3300013104 Ga0157370_10068805 Ga0157370_100688053 264
701 3300013105 Ga0157369_10089572 Ga0157369_100895722 264
702 3300013307 Ga0157372_10100565 Ga0157372_101005652 264
703 3300013307 Ga0157372_10284795 Ga0157372_102847952 264
704 3300014497 Ga0182008_10009436 Ga0182008_100094366 264
705 3300015262 Ga0182007_10012200 Ga0182007_100122002 264
706 3300020069 Ga0197907_10972893 Ga0197907_109728932 264
707 3300020070 Ga0206356_10739625 Ga0206356_107396254 264
708 3300020081 Ga0206354_10579909 Ga0206354_105799094 264
709 3300020082 Ga0206353_10543908 Ga0206353_105439082 264
710 3300020082 Ga0206353_11152913 Ga0206353_111529132 264
711 3300025906 Ga0207699_10039861 Ga0207699_100398612 264
712 3300025909 Ga0207705_10044675 Ga0207705_100446753 264
713 3300025909 Ga0207705_10144245 Ga0207705_101442452 264
714 3300025909 Ga0207705_10219367 Ga0207705_102193672 264
715 3300025912 Ga0207707_10008396 Ga0207707_1000839611 264
716 3300025912 Ga0207707_10040872 Ga0207707_100408725 264
717 3300025913 Ga0207695_10085325 Ga0207695_100853252 264
718 3300025913 Ga0207695_10230599 Ga0207695_102305992 264
719 3300025915 Ga0207693_10000282 Ga0207693_100002829 264
720 3300025916 Ga0207663_10044668 Ga0207663_100446682 264
721 3300025917 Ga0207660_10178611 Ga0207660_101786111 264
722 3300025917 Ga0207660_10263106 Ga0207660_102631062 264
723 3300025917 Ga0207660_10268093 Ga0207660_102680932 264
724 3300025919 Ga0207657_10000988 Ga0207657_1000098824 264
725 3300025919 Ga0207657_10033885 Ga0207657_100338852 264
726 3300025919 Ga0207657_10201020 Ga0207657_102010202 264
727 3300025919 Ga0207657_10350582 Ga0207657_103505822 264
728 3300025929 Ga0207664_10032025 Ga0207664_100320255 264
729 3300025929 Ga0207664_10047082 Ga0207664_100470822 264
730 3300025929 Ga0207664_10063827 Ga0207664_100638273 264
731 3300025929 Ga0207664_10100754 Ga0207664_101007541 264
732 3300025929 Ga0207664_10111667 Ga0207664_101116672 264
733 3300025932 Ga0207690_10012589 Ga0207690_100125892 264
734 3300025932 Ga0207690_10177336 Ga0207690_101773362 264
735 3300025944 Ga0207661_10062637 Ga0207661_100626372 264
736 3300025944 Ga0207661_10116265 Ga0207661_101162652 264
737 3300025945 Ga0207679_10220337 Ga0207679_102203372 264
738 3300025949 Ga0207667_10101806 Ga0207667_101018062 264
739 3300026078 Ga0207702_10100980 Ga0207702_101009802 264
740 3300026088 Ga0207641_10153622 Ga0207641_101536223 264
741 3300026142 Ga0207698_10767550 Ga0207698_107675502 264
742 3300032133 Ga0316583_10021232 Ga0316583_100212322 264
743 3300035170 Ga0373943_0072902 Ga0373943_0072902_465_1298 264
744 3300035692 Ga0373935_0494438 Ga0373935_0494438_24_857 264
745 3300035724 Ga0373933_0172015 Ga0373933_0172015_200_1033 264
746 3300036401 Ga0373937_0109487 Ga0373937_0109487_1259_2092 264
747 3300037312 Ga0395899_0085266 Ga0395899_0085266_1245_2078 264
748 3300037418 Ga0395900_0166180 Ga0395900_0166180_1357_2190 264
749 3300037418 Ga0395900_0188797 Ga0395900_0188797_245_1078 264
750 3300037466 Ga0395898_0016535 Ga0395898_0016535_3248_4081 264
751 3300037466 Ga0395898_0071572 Ga0395898_0071572_59_892 264
752 3300037466 Ga0395898_0270203 Ga0395898_0270203_690_1523 264
753 3300038443 Ga0395901_0114956 Ga0395901_0114956_264_1097 264
754 3300038443 Ga0395901_0341483 Ga0395901_0341483_224_1057 264
755 3300039438 Ga0436360_1292831 Ga0436360_1292831_671_1504 264
756 3300044656 Ga0466969_0003306 Ga0466969_0003306_6978_7811 264
757 3300044656 Ga0466969_0013131 Ga0466969_0013131_2448_3281 264
758 3300044656 Ga0466969_0085238 Ga0466969_0085238_636_1469 264
759 3300044658 Ga0466972_0029041 Ga0466972_0029041_216_1049 264
760 3300044683 Ga0466965_0049114 Ga0466965_0049114_1186_2019 264
761 3300044683 Ga0466965_0230224 Ga0466965_0230224_104_937 264
762 3300044684 Ga0466966_0008431 Ga0466966_0008431_4149_4982 264
763 3300044684 Ga0466966_0063700 Ga0466966_0063700_1233_2066 264
764 3300044684 Ga0466966_0202162 Ga0466966_0202162_273_1106 264
765 3300044693 Ga0466961_0011545 Ga0466961_0011545_227_1060 264
766 3300044693 Ga0466961_0026593 Ga0466961_0026593_1025_1858 264
767 3300044693 Ga0466961_0033324 Ga0466961_0033324_474_1307 264
768 3300044693 Ga0466961_0049106 Ga0466961_0049106_1132_1965 264
769 3300044693 Ga0466961_0148650 Ga0466961_0148650_456_1289 264
770 3300044694 Ga0466963_0000095 Ga0466963_0000095_97_930 264
771 3300044694 Ga0466963_0004541 Ga0466963_0004541_5608_6441 264
772 3300044694 Ga0466963_0004612 Ga0466963_0004612_7160_7993 264
773 3300044694 Ga0466963_0005966 Ga0466963_0005966_4482_5315 264
774 3300044694 Ga0466963_0015015 Ga0466963_0015015_354_1187 264
775 3300044694 Ga0466963_0017204 Ga0466963_0017204_2959_3792 264
776 3300044694 Ga0466963_0019732 Ga0466963_0019732_1640_2473 264
777 3300044694 Ga0466963_0021258 Ga0466963_0021258_2240_3073 264
778 3300044694 Ga0466963_0029166 Ga0466963_0029166_1184_2017 264
779 3300044694 Ga0466963_0030131 Ga0466963_0030131_710_1543 264
780 3300044694 Ga0466963_0052948 Ga0466963_0052948_29_862 264
781 3300044694 Ga0466963_0116124 Ga0466963_0116124_843_1676 264
782 3300044694 Ga0466963_0202221 Ga0466963_0202221_519_1352 264
783 3300044694 Ga0466963_0246167 Ga0466963_0246167_393_1226 264
784 3300044694 Ga0466963_0255268 Ga0466963_0255268_386_1219 264
785 3300044694 Ga0466963_0346179 Ga0466963_0346179_140_973 264
786 3300044706 Ga0466964_0007441 Ga0466964_0007441_333_1166 264
787 3300044719 Ga0466971_0001664 Ga0466971_0001664_5252_6085 264
788 3300044719 Ga0466971_0053198 Ga0466971_0053198_19_852 264
789 3300044719 Ga0466971_0066685 Ga0466971_0066685_452_1285 264
790 3300044735 Ga0466968_0002238 Ga0466968_0002238_214_1047 264
791 3300044735 Ga0466968_0006803 Ga0466968_0006803_853_1686 264
792 3300044735 Ga0466968_0031074 Ga0466968_0031074_230_1063 264
793 3300044735 Ga0466968_0083542 Ga0466968_0083542_551_1384 264
794 3300044765 Ga0466970_0004679 Ga0466970_0004679_3496_4329 264
795 3300044765 Ga0466970_0177079 Ga0466970_0177079_248_1081 264
796 3300044842 Ga0466957_0001672 Ga0466957_0001672_3182_4015 264
797 3300044842 Ga0466957_0020943 Ga0466957_0020943_2967_3800 264
798 3300044842 Ga0466957_0025135 Ga0466957_0025135_2479_3312 264
799 3300044842 Ga0466957_0066648 Ga0466957_0066648_666_1499 264
800 3300044842 Ga0466957_0070018 Ga0466957_0070018_811_1644 264
801 3300044842 Ga0466957_0072128 Ga0466957_0072128_618_1451 264
802 3300044901 Ga0466960_0001521 Ga0466960_0001521_3294_4127 264
803 3300045049 Ga0466959_0002457 Ga0466959_0002457_2924_3757 264
804 3300045049 Ga0466959_0005583 Ga0466959_0005583_6260_7093 264
805 3300045049 Ga0466959_0011442 Ga0466959_0011442_5029_5862 264
806 3300045049 Ga0466959_0026369 Ga0466959_0026369_2737_3570 264
807 3300045049 Ga0466959_0417316 Ga0466959_0417316_49_882 264
808 3300045836 Ga0466958_0001908 Ga0466958_0001908_4529_5362 264
809 3300045836 Ga0466958_0002667 Ga0466958_0002667_8124_8957 264
810 3300045836 Ga0466958_0009659 Ga0466958_0009659_2805_3638 264
811 3300045836 Ga0466958_0029313 Ga0466958_0029313_1682_2515 264
812 3300045836 Ga0466958_0089370 Ga0466958_0089370_797_1630 264
813 3300045836 Ga0466958_0090580 Ga0466958_0090580_849_1682 264
814 3300045836 Ga0466958_0117544 Ga0466958_0117544_739_1572 264
815 3300045836 Ga0466958_0229725 Ga0466958_0229725_198_1031 264
816 3300045836 Ga0466958_0258213 Ga0466958_0258213_29_862 264
817 3300045836 Ga0466958_0263946 Ga0466958_0263946_235_1068 264
818 3300045976 Ga0466967_0004469 Ga0466967_0004469_5786_6619 264
819 3300045976 Ga0466967_0010011 Ga0466967_0010011_2488_3321 264
820 3300045976 Ga0466967_0012377 Ga0466967_0012377_5457_6290 264
821 3300045976 Ga0466967_0019227 Ga0466967_0019227_4380_5213 264
822 3300045976 Ga0466967_0030709 Ga0466967_0030709_195_1028 264
823 3300045976 Ga0466967_0058374 Ga0466967_0058374_623_1456 264
824 3300045976 Ga0466967_0068035 Ga0466967_0068035_1640_2473 264
825 3300045976 Ga0466967_0097862 Ga0466967_0097862_456_1289 264
826 3300045976 Ga0466967_0112673 Ga0466967_0112673_468_1301 264
827 3300045976 Ga0466967_0169802 Ga0466967_0169802_544_1377 264
828 3300045976 Ga0466967_0177756 Ga0466967_0177756_473_1306 264
829 3300045976 Ga0466967_0195313 Ga0466967_0195313_267_1100 264
830 3300045976 Ga0466967_0204631 Ga0466967_0204631_133_966 264
831 3300045976 Ga0466967_0547148 Ga0466967_0547148_192_1025 264
832 3300045976 Ga0466967_0607901 Ga0466967_0607901_129_962 264
833 3300046454 Ga0495592_0042691 Ga0495592_0042691_139_972 264
834 3300046454 Ga0495592_0090270 Ga0495592_0090270_831_1664 264
835 3300046454 Ga0495592_0175584 Ga0495592_0175584_30_863 264
836 3300046455 Ga0495603_0165798 Ga0495603_0165798_292_1125 264
837 3300046459 Ga0495629_0079661 Ga0495629_0079661_35_868 264
838 3300046459 Ga0495629_0353297 Ga0495629_0353297_98_931 264
839 3300046461 Ga0495641_0010605 Ga0495641_0010605_3621_4454 264
840 3300046462 Ga0495651_0235532 Ga0495651_0235532_229_1062 264
841 3300046463 Ga0495653_0051290 Ga0495653_0051290_1213_2046 264
842 3300046473 Ga0495582_0252168 Ga0495582_0252168_167_1000 264
843 3300046476 Ga0495662_0052778 Ga0495662_0052778_985_1818 264
844 3300046476 Ga0495662_0141439 Ga0495662_0141439_96_929 264
845 3300046511 Ga0495608_0006235 Ga0495608_0006235_6266_7099 264
846 3300046517 Ga0495630_0017298 Ga0495630_0017298_1236_2069 264
847 3300046529 Ga0495652_0120759 Ga0495652_0120759_847_1680 264
848 3300046535 Ga0495586_0120846 Ga0495586_0120846_611_1444 264
849 3300046559 Ga0495667_0025384 Ga0495667_0025384_849_1682 264
850 3300046559 Ga0495667_0059886 Ga0495667_0059886_64_897 264
851 3300046559 Ga0495667_0143913 Ga0495667_0143913_605_1438 264
852 3300046642 Ga0495634_0064947 Ga0495634_0064947_328_1161 264
853 3300046642 Ga0495634_0202561 Ga0495634_0202561_266_1099 264
854 3300046663 Ga0495635_0131522 Ga0495635_0131522_818_1651 264
855 3300046675 Ga0495657_0083062 Ga0495657_0083062_1000_1833 264
856 3300046678 Ga0495599_0050417 Ga0495599_0050417_1557_2390 264
857 3300046678 Ga0495599_0071124 Ga0495599_0071124_202_1035 264
858 3300046680 Ga0495646_0034028 Ga0495646_0034028_1337_2170 264
859 3300046680 Ga0495646_0073986 Ga0495646_0073986_1047_1880 264
860 3300046680 Ga0495646_0125367 Ga0495646_0125367_506_1339 264
861 3300046681 Ga0495647_0023856 Ga0495647_0023856_1183_2016 264
862 3300046689 Ga0495613_0025650 Ga0495613_0025650_755_1588 264
863 3300046809 Ga0495600_0014203 Ga0495600_0014203_1870_2703 264
864 3300047315 Ga0495581_0071126 Ga0495581_0071126_156_989 264
865 3300047317 Ga0495604_0058379 Ga0495604_0058379_1098_1931 264
866 3300047319 Ga0495674_0039772 Ga0495674_0039772_1869_2702 264
867 3300047319 Ga0495674_0082453 Ga0495674_0082453_1815_2648 264
868 3300047322 Ga0495680_0124632 Ga0495680_0124632_708_1541 264
869 3300047322 Ga0495680_0143697 Ga0495680_0143697_623_1456 264
870 3300047444 Ga0495675_0093888 Ga0495675_0093888_445_1278 264
871 3300047471 Ga0495684_0029449 Ga0495684_0029449_3306_4139 264
872 3300047471 Ga0495684_0350490 Ga0495684_0350490_136_969 264
873 3300048088 Ga0495602_0244232 Ga0495602_0244232_356_1189 264
874 3300048904 Ga0496101_0213762 Ga0496101_0213762_80_913 264
875 3300048904 Ga0496101_0348559 Ga0496101_0348559_164_997 264
876 3300048907 Ga0496104_0016341 Ga0496104_0016341_4326_5159 264
877 3300048908 Ga0496105_0045676 Ga0496105_0045676_1582_2415 264
878 3300048908 Ga0496105_0191008 Ga0496105_0191008_775_1608 264
879 3300048908 Ga0496105_0216472 Ga0496105_0216472_235_1068 264
880 3300048909 Ga0496106_0141628 Ga0496106_0141628_1047_1880 264
881 3300048910 Ga0496107_0307858 Ga0496107_0307858_189_1022 264
882 3300048911 Ga0496108_0023428 Ga0496108_0023428_1944_2777 264
883 3300048911 Ga0496108_0033698 Ga0496108_0033698_2543_3376 264
884 3300048912 Ga0496109_0008195 Ga0496109_0008195_3481_4314 264
885 3300048912 Ga0496109_0041159 Ga0496109_0041159_2556_3389 264
886 3300048912 Ga0496109_0081032 Ga0496109_0081032_1949_2782 264
887 3300048914 Ga0496111_0116295 Ga0496111_0116295_849_1682 264
888 3300048915 Ga0496112_0116912 Ga0496112_0116912_1529_2362 264
889 3300048918 Ga0496115_0226685 Ga0496115_0226685_331_1164 264
890 3300049568 Ga0501031_0021919 Ga0501031_0021919_497_1336 264
891 3300049570 Ga0501033_0160533 Ga0501033_0160533_292_1131 264
892 3300049572 Ga0501036_0005487 Ga0501036_0005487_9143_9982 264
893 3300049575 Ga0501039_0003976 Ga0501039_0003976_1659_2498 264
894 3300049576 Ga0501040_0001387 Ga0501040_0001387_9472_10311 264
895 3300049577 Ga0501041_0000895 Ga0501041_0000895_9491_10330 264
896 3300049578 Ga0501042_0068233 Ga0501042_0068233_805_1644 264
897 3300049579 Ga0501043_0240756 Ga0501043_0240756_147_986 264
898 3300049580 Ga0501046_0328908 Ga0501046_0328908_237_1076 264
899 3300049581 Ga0501047_0150034 Ga0501047_0150034_1090_1923 264
900 3300049583 Ga0501067_0020755 Ga0501067_0020755_1019_1852 264
901 3300049583 Ga0501067_0046875 Ga0501067_0046875_645_1478 264
902 3300049583 Ga0501067_0121005 Ga0501067_0121005_556_1389 264
903 3300049583 Ga0501067_0139502 Ga0501067_0139502_46_879 264
904 3300049583 Ga0501067_0202908 Ga0501067_0202908_107_940 264
905 3300049584 Ga0501068_0015027 Ga0501068_0015027_2639_3478 264
906 3300049585 Ga0501069_0012648 Ga0501069_0012648_2667_3500 264
907 3300049586 Ga0501070_0024878 Ga0501070_0024878_3210_4043 264
908 3300049586 Ga0501070_0042253 Ga0501070_0042253_1295_2128 264
909 3300049586 Ga0501070_0333152 Ga0501070_0333152_270_1103 264
910 3300049588 Ga0501072_0003411 Ga0501072_0003411_9574_10407 264
911 3300049588 Ga0501072_0007942 Ga0501072_0007942_1668_2507 264
912 3300049589 Ga0501073_0031588 Ga0501073_0031588_49_882 264
913 3300049589 Ga0501073_0063173 Ga0501073_0063173_429_1262 264
914 3300049590 Ga0501074_0022586 Ga0501074_0022586_3363_4196 264
915 3300049591 Ga0501075_0001209 Ga0501075_0001209_14214_15053 264
916 3300049741 Ga0501079_0009336 Ga0501079_0009336_6351_7184 264
917 3300049742 Ga0501080_0013393 Ga0501080_0013393_6249_7082 264
918 3300049743 Ga0501081_0000753 Ga0501081_0000753_9470_10309 264
919 3300049822 Ga0501035_0108614 Ga0501035_0108614_1096_1935 264
920 3300049824 Ga0501045_0001276 Ga0501045_0001276_8856_9695 264
921 3300050512 nmdc:mga0n895_71764_c1 nmdc:mga0n895_71764_c1_1547_2380 264
922 3300050513 nmdc:mga0rr50_201488_c1 nmdc:mga0rr50_201488_c1_578_1411 264
923 3300053077 Ga0495601_0006980 Ga0495601_0006980_5728_6561 264
924 3300053078 Ga0495612_0014817 Ga0495612_0014817_1735_2568 264
925 3300053084 Ga0495595_0010344 Ga0495595_0010344_997_1830 264
926 3300053084 Ga0495595_0021019 Ga0495595_0021019_900_1733 264
927 3300053084 Ga0495595_0030604 Ga0495595_0030604_585_1418 264
928 3300053085 Ga0495619_0035292 Ga0495619_0035292_1466_2299 264
929 3300053085 Ga0495619_0052545 Ga0495619_0052545_272_1105 264
930 3300054114 Ga0501084_0002974 Ga0501084_0002974_1659_2498 264
931 3300060353 Ga0501082_0016180 Ga0501082_0016180_3755_4594 264
932 3300061719 Ga0466962_0000096 Ga0466962_0000096_14949_15782 264
933 3300061719 Ga0466962_0003609 Ga0466962_0003609_6468_7301 264
934 3300061734 Ga0530510_0002722 Ga0530510_0002722_92_931 264
935 3300005467 Ga0070706_100122634 Ga0070706_1001226341 265
936 3300005617 Ga0068859_100488406 Ga0068859_1004884063 265
937 3300005981 Ga0081538_10000053 Ga0081538_1000005398 265
938 3300006931 Ga0097620_100488357 Ga0097620_1004883571 265
939 3300028800 Ga0265338_10005641 Ga0265338_100056419 265
940 3300028800 Ga0265338_10007196 Ga0265338_1000719612 265
941 3300029957 Ga0265324_10022996 Ga0265324_100229963 265
942 3300035724 Ga0373933_0186160 Ga0373933_0186160_323_1159 265
943 3300046511 Ga0495608_0106447 Ga0495608_0106447_606_1442 265
944 3300047322 Ga0495680_0071197 Ga0495680_0071197_417_1253 265
945 3300047471 Ga0495684_0035091 Ga0495684_0035091_2723_3559 265
946 3300025986 Ga0207658_10002326 Ga0207658_1000232611 267
947 3300003373 JGI25407J50210_10001067 JGI25407J50210_100010672 268
948 3300005981 Ga0081538_10000094 Ga0081538_1000009436 268
949 3300020082 Ga0206353_11689011 Ga0206353_1168901112 268
950 3300028577 Ga0265318_10003761 Ga0265318_100037612 268
951 3300037418 Ga0395900_0009112 Ga0395900_0009112_6308_7156 268
952 3300037466 Ga0395898_0123418 Ga0395898_0123418_266_1282 268
953 3300046462 Ga0495651_0209544 Ga0495651_0209544_446_1291 268
954 3300049586 Ga0501070_0333798 Ga0501070_0333798_68_916 268
955 3300049588 Ga0501072_0006557 Ga0501072_0006557_1018_1866 268
956 3300049590 Ga0501074_0153769 Ga0501074_0153769_320_1168 268
957 3300049591 Ga0501075_0332283 Ga0501075_0332283_119_967 268
958 3300049592 Ga0501076_0006243 Ga0501076_0006243_618_1466 268
959 3300049593 Ga0501077_0098818 Ga0501077_0098818_221_1069 268
960 3300054114 Ga0501084_0040964 Ga0501084_0040964_921_1769 268
961 3300060353 Ga0501082_0012784 Ga0501082_0012784_1747_2595 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

3

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m6r-assembly1.cif.gz_A human porphobilinogen deaminase in complex with reaction intermediate 0.8229 1 241
8pnd-assembly1.cif.gz_A the es3 intermediate of hydroxymethylbilane synthase r167q variant 0.7882 2 241
5m7f-assembly2.cif.gz_B human porphobilinogen deaminase in complex with dpm cofactor 0.7819 1 241
7ccx-assembly2.cif.gz_C crystal structure of the holo form of human hydroxymethylbilane synthase 0.7784 1 241
5m7f-assembly1.cif.gz_A human porphobilinogen deaminase in complex with dpm cofactor 0.7779 1 241
ID Description Score Start End Superfamily
4htgA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9077 94 183 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9021 94 187 3.40.190.10
5ov6A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8576 1 91 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8434 94 187 3.40.190.10
1ah5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8092 2 91 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A538MB32-F1-model_v4 hydroxymethylbilane synthase (EC 2.5.1.61) 0.8796 82 256 GO:0004418
GO:0005737
GO:0006783
AF-A0A377TL07-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.8658 91 203 GO:0004418
GO:0005737
GO:0006782
AF-A0A447SA06-F1-model_v4 deleted 0.8608 57 186
AF-A0A498ESC5-F1-model_v4 deleted 0.8594 57 197
AF-A0A353PDS2-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.8592 75 203 GO:0004418
GO:0005737
GO:0006782

Feature Viewer

pLDDT pTM Quality
78.33 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map